BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8067

Length=936
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769700.1|  PREDICTED: lipid phosphate phosphatase delta       317   3e-102   Nicotiana sylvestris
emb|CDP14282.1|  unnamed protein product                                311   8e-100   Coffea canephora [robusta coffee]
ref|XP_009590582.1|  PREDICTED: lipid phosphate phosphatase delta       307   3e-98    Nicotiana tomentosiformis
ref|XP_004234755.1|  PREDICTED: lipid phosphate phosphatase delta       305   3e-97    Solanum lycopersicum
ref|XP_002323347.1|  phosphatidic acid phosphatase family protein       304   4e-97    
ref|XP_002281162.1|  PREDICTED: lipid phosphate phosphatase delta       304   8e-97    Vitis vinifera
ref|XP_006360606.1|  PREDICTED: dihydrosphingosine 1-phosphate ph...    303   1e-96    Solanum tuberosum [potatoes]
ref|XP_012090848.1|  PREDICTED: lipid phosphate phosphatase delta       302   3e-96    
ref|XP_011039508.1|  PREDICTED: lipid phosphate phosphatase delta...    302   4e-96    Populus euphratica
emb|CBI29969.3|  unnamed protein product                                303   5e-96    Vitis vinifera
ref|XP_002531164.1|  sphingosine-1-phosphate phosphohydrolase, pu...    301   1e-95    Ricinus communis
gb|EYU39977.1|  hypothetical protein MIMGU_mgv1a007447mg                299   4e-95    Erythranthe guttata [common monkey flower]
ref|XP_011047097.1|  PREDICTED: lipid phosphate phosphatase delta...    297   1e-94    Populus euphratica
ref|XP_011047096.1|  PREDICTED: lipid phosphate phosphatase delta...    296   4e-94    Populus euphratica
ref|XP_002308348.1|  phosphatidic acid phosphatase family protein       296   5e-94    Populus trichocarpa [western balsam poplar]
ref|XP_008241159.1|  PREDICTED: lipid phosphate phosphatase delta       293   9e-93    Prunus mume [ume]
gb|EPS61952.1|  phosphatidic acid phosphatase family protein            293   1e-92    Genlisea aurea
ref|XP_007202172.1|  hypothetical protein PRUPE_ppa006528mg             292   2e-92    Prunus persica
gb|KJB36159.1|  hypothetical protein B456_006G144600                    287   2e-92    Gossypium raimondii
gb|KDO70817.1|  hypothetical protein CISIN_1g015391mg                   285   2e-91    Citrus sinensis [apfelsine]
ref|XP_010257589.1|  PREDICTED: lipid phosphate phosphatase delta       289   5e-91    Nelumbo nucifera [Indian lotus]
gb|KJB36156.1|  hypothetical protein B456_006G144600                    288   1e-90    Gossypium raimondii
ref|XP_010101090.1|  Dihydrosphingosine 1-phosphate phosphatase         288   1e-90    Morus notabilis
ref|XP_004303367.1|  PREDICTED: lipid phosphate phosphatase delta       287   2e-90    Fragaria vesca subsp. vesca
ref|XP_006429943.1|  hypothetical protein CICLE_v10011869mg             287   2e-90    Citrus clementina [clementine]
gb|KHG30564.1|  hypothetical protein F383_14690                         285   7e-90    Gossypium arboreum [tree cotton]
gb|KDO70814.1|  hypothetical protein CISIN_1g015391mg                   285   2e-89    Citrus sinensis [apfelsine]
ref|XP_006481548.1|  PREDICTED: dihydrosphingosine 1-phosphate ph...    285   2e-89    Citrus sinensis [apfelsine]
ref|XP_007029091.1|  Phosphatidic acid phosphatase (PAP2) family ...    283   5e-89    
emb|CDX67745.1|  BnaA07g17850D                                          282   2e-88    
ref|XP_006402782.1|  hypothetical protein EUTSA_v10006516mg             280   1e-87    Eutrema salsugineum [saltwater cress]
ref|XP_010036523.1|  PREDICTED: lipid phosphate phosphatase delta...    278   1e-86    Eucalyptus grandis [rose gum]
ref|XP_009104145.1|  PREDICTED: lipid phosphate phosphatase delta       278   1e-86    Brassica rapa
emb|CDX98299.1|  BnaC06g16600D                                          276   3e-86    
ref|XP_010516498.1|  PREDICTED: lipid phosphate phosphatase delta...    276   4e-86    Camelina sativa [gold-of-pleasure]
ref|XP_008350252.1|  PREDICTED: LOW QUALITY PROTEIN: lipid phosph...    276   5e-86    
ref|XP_008387206.1|  PREDICTED: lipid phosphate phosphatase delta...    276   6e-86    Malus domestica [apple tree]
ref|XP_010427754.1|  PREDICTED: lipid phosphate phosphatase delta...    275   1e-85    Camelina sativa [gold-of-pleasure]
gb|KFK35109.1|  hypothetical protein AALP_AA5G237200                    275   1e-85    Arabis alpina [alpine rockcress]
gb|KEH24326.1|  phosphatidic acid phosphatase (PAP2) family protein     270   2e-85    Medicago truncatula
ref|XP_010504804.1|  PREDICTED: lipid phosphate phosphatase delta...    275   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_006604689.1|  PREDICTED: dihydrosphingosine 1-phosphate ph...    273   4e-85    Glycine max [soybeans]
ref|NP_191408.1|  sphingoid phosphate phosphatase 1                     273   5e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693832.1|  PREDICTED: lipid phosphate phosphatase delta       273   5e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008359537.1|  PREDICTED: lipid phosphate phosphatase delta...    273   6e-85    
ref|XP_002876465.1|  phosphatidic acid phosphatase family protein       273   6e-85    
gb|KHN43572.1|  Dihydrosphingosine 1-phosphate phosphatase              273   9e-85    Glycine soja [wild soybean]
ref|XP_010524833.1|  PREDICTED: lipid phosphate phosphatase delta       272   1e-84    Tarenaya hassleriana [spider flower]
ref|XP_003638097.1|  Sphingosine-1-phosphate phosphatase                271   3e-84    
ref|XP_009389049.1|  PREDICTED: lipid phosphate phosphatase delta...    271   4e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008442198.1|  PREDICTED: lipid phosphate phosphatase delta       270   8e-84    Cucumis melo [Oriental melon]
ref|XP_011075072.1|  PREDICTED: lipid phosphate phosphatase delta...    270   1e-83    Sesamum indicum [beniseed]
ref|XP_007163033.1|  hypothetical protein PHAVU_001G200400g             269   2e-83    Phaseolus vulgaris [French bean]
ref|XP_006291211.1|  hypothetical protein CARUB_v10017341mg             268   5e-83    Capsella rubella
ref|XP_004144672.1|  PREDICTED: lipid phosphate phosphatase delta       266   2e-82    Cucumis sativus [cucumbers]
ref|XP_010923351.1|  PREDICTED: lipid phosphate phosphatase delta...    266   3e-82    Elaeis guineensis
ref|XP_008370944.1|  PREDICTED: lipid phosphate phosphatase delta...    266   4e-82    Malus domestica [apple tree]
gb|KDO70815.1|  hypothetical protein CISIN_1g015391mg                   263   3e-81    Citrus sinensis [apfelsine]
ref|XP_006577115.1|  PREDICTED: dihydrosphingosine 1-phosphate ph...    263   3e-81    Glycine max [soybeans]
ref|XP_010934504.1|  PREDICTED: lipid phosphate phosphatase delta...    263   3e-81    Elaeis guineensis
ref|XP_009335872.1|  PREDICTED: lipid phosphate phosphatase delta       263   4e-81    
gb|KHN22563.1|  Dihydrosphingosine 1-phosphate phosphatase              263   4e-81    Glycine soja [wild soybean]
gb|KJB36157.1|  hypothetical protein B456_006G144600                    262   5e-81    Gossypium raimondii
ref|XP_010923350.1|  PREDICTED: lipid phosphate phosphatase delta...    261   2e-80    Elaeis guineensis
ref|XP_008789078.1|  PREDICTED: lipid phosphate phosphatase delta       261   3e-80    Phoenix dactylifera
ref|XP_011078801.1|  PREDICTED: lipid phosphate phosphatase delta       259   1e-79    Sesamum indicum [beniseed]
ref|XP_008796692.1|  PREDICTED: lipid phosphate phosphatase delta...    259   2e-79    Phoenix dactylifera
ref|XP_009397684.1|  PREDICTED: lipid phosphate phosphatase delta...    258   4e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001051628.1|  Os03g0805400                                       258   6e-79    
gb|EEC76370.1|  hypothetical protein OsI_13971                          256   2e-78    Oryza sativa Indica Group [Indian rice]
gb|KDO70816.1|  hypothetical protein CISIN_1g015391mg                   254   4e-78    Citrus sinensis [apfelsine]
ref|NP_001146142.1|  hypothetical protein                               253   3e-77    Zea mays [maize]
ref|XP_004981368.1|  PREDICTED: dihydrosphingosine 1-phosphate ph...    253   6e-77    Setaria italica
ref|XP_004494305.1|  PREDICTED: dihydrosphingosine 1-phosphate ph...    251   1e-76    Cicer arietinum [garbanzo]
dbj|BAJ98189.1|  predicted protein                                      246   2e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010036524.1|  PREDICTED: lipid phosphate phosphatase delta...    249   3e-76    Eucalyptus grandis [rose gum]
ref|XP_003564191.1|  PREDICTED: lipid phosphate phosphatase delta       251   4e-76    Brachypodium distachyon [annual false brome]
gb|EMS59474.1|  Sphingosine-1-phosphate phosphatase 1                   250   7e-76    Triticum urartu
ref|NP_001151171.1|  phosphoric ester hydrolase                         249   1e-75    
ref|NP_001137127.1|  uncharacterized protein LOC100217309               249   1e-75    
ref|NP_001146363.1|  phosphoric ester hydrolase                         245   5e-74    Zea mays [maize]
ref|XP_009402139.1|  PREDICTED: LOW QUALITY PROTEIN: lipid phosph...    242   4e-73    
ref|XP_011653921.1|  PREDICTED: lipid phosphate phosphatase delta...    233   6e-72    Cucumis sativus [cucumbers]
gb|KGN54852.1|  hypothetical protein Csa_4G551640                       230   2e-70    Cucumis sativus [cucumbers]
gb|ABR18474.1|  unknown                                                 233   3e-69    Picea sitchensis
ref|XP_006842772.1|  PREDICTED: lipid phosphate phosphatase delta       232   4e-69    Amborella trichopoda
ref|XP_011470743.1|  PREDICTED: lipid phosphate phosphatase delta...    219   1e-67    Fragaria vesca subsp. vesca
gb|AFW75795.1|  hypothetical protein ZEAMMB73_354014                    223   4e-67    
gb|AFW75794.1|  hypothetical protein ZEAMMB73_354014                    224   2e-66    
ref|XP_008648866.1|  PREDICTED: uncharacterized protein LOC103629566    223   3e-66    
ref|XP_006651931.1|  PREDICTED: dihydrosphingosine 1-phosphate ph...    214   1e-62    
ref|XP_002964339.1|  hypothetical protein SELMODRAFT_405511             185   3e-51    Selaginella moellendorffii
ref|XP_002967695.1|  hypothetical protein SELMODRAFT_88434              185   3e-51    Selaginella moellendorffii
dbj|BAE99276.1|  hypothetical protein                                   168   2e-45    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078308.1|  sphingoid phosphate phosphatase 1                  168   2e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516500.1|  PREDICTED: lipid phosphate phosphatase delta...    168   3e-45    Camelina sativa [gold-of-pleasure]
ref|XP_010504805.1|  PREDICTED: lipid phosphate phosphatase delta...    167   4e-45    Camelina sativa [gold-of-pleasure]
ref|XP_010427756.1|  PREDICTED: lipid phosphate phosphatase delta...    167   7e-45    Camelina sativa [gold-of-pleasure]
gb|EMT19170.1|  Sphingosine-1-phosphate phosphatase 1                   166   2e-44    
ref|XP_001756514.1|  predicted protein                                  162   2e-42    
gb|AFW67294.1|  hypothetical protein ZEAMMB73_714627                    155   9e-41    
ref|XP_008669419.1|  PREDICTED: lipid phosphate phosphatase delta...    144   1e-38    
ref|XP_001753925.1|  predicted protein                                  146   1e-36    
ref|XP_005844914.1|  hypothetical protein CHLNCDRAFT_138478             114   3e-25    Chlorella variabilis
gb|KFH62932.1|  hypothetical protein MVEG_11456                       87.0    1e-15    Mortierella verticillata NRRL 6337
gb|KDD74787.1|  hypothetical protein H632_c1074p0                     82.0    3e-15    Helicosporidium sp. ATCC 50920
ref|XP_504221.1|  YALI0E21197p                                        83.2    3e-14    Yarrowia lipolytica CLIB122
dbj|GAA96100.1|  hypothetical protein E5Q_02761                       82.8    4e-14    Mixia osmundae IAM 14324
gb|KEI39240.1|  hypothetical protein L969DRAFT_103179                 82.8    4e-14    Mixia osmundae IAM 14324
ref|XP_003675262.1|  hypothetical protein NCAS_0B08070                81.3    7e-14    Naumovozyma castellii CBS 4309
gb|KFO84422.1|  Sphingosine-1-phosphate phosphatase 2                 79.7    1e-13    Buceros rhinoceros silvestris
gb|EPS32686.1|  hypothetical protein PDE_07646                        80.9    1e-13    Penicillium oxalicum 114-2
ref|XP_007007244.1|  hypothetical protein TREMEDRAFT_74652            80.5    2e-13    Tremella mesenterica DSM 1558
ref|XP_007755493.1|  hypothetical protein A1O7_03280                  80.5    2e-13    Cladophialophora yegresii CBS 114405
ref|XP_008727660.1|  hypothetical protein G647_05105                  80.5    2e-13    Cladophialophora carrionii CBS 160.54
ref|XP_011390033.1|  hypothetical protein UMAG_03610                  80.5    2e-13    Ustilago maydis 521
ref|XP_002176056.1|  sphingosine-1-phosphate phosphatase              79.7    2e-13    Schizosaccharomyces japonicus yFS275
ref|XP_008087014.1|  Acid phosphatase/Vanadium-dependent halopero...  79.7    3e-13    Glarea lozoyensis ATCC 20868
ref|XP_007775437.1|  hypothetical protein CONPUDRAFT_133096           79.7    3e-13    Coniophora puteana RWD-64-598 SS2
emb|CCF51494.1|  related to YSR3-dihydrosphingosine-1-phosphate p...  79.7    3e-13    Ustilago hordei
gb|KIW71288.1|  hypothetical protein PV04_03471                       79.7    4e-13    Phialophora americana
gb|EST09595.1|  hypothetical protein PSEUBRA_SCAF10g05555             79.3    5e-13    Kalmanozyma brasiliensis GHG001
ref|XP_007711108.1|  hypothetical protein COCCADRAFT_92919            79.0    5e-13    Bipolaris zeicola 26-R-13
ref|XP_007695004.1|  hypothetical protein COCSADRAFT_177466           79.0    5e-13    Bipolaris sorokiniana ND90Pr
ref|XP_009029573.1|  hypothetical protein HELRODRAFT_122845           76.3    6e-13    Helobdella robusta
ref|XP_007682752.1|  hypothetical protein COCMIDRAFT_81233            79.0    6e-13    Bipolaris oryzae ATCC 44560
dbj|GAM34868.1|  hypothetical protein TCE0_015f02734                  79.0    7e-13    Talaromyces cellulolyticus
dbj|BAE63171.1|  unnamed protein product                              78.6    7e-13    Aspergillus oryzae RIB40
ref|XP_011274514.1|  sphingosine-1-phosphate phosphatase              78.6    8e-13    Wickerhamomyces ciferrii
dbj|GAC93675.1|  hypothetical protein PHSY_001240                     79.0    8e-13    Pseudozyma hubeiensis SY62
ref|XP_002145408.1|  PAP2 domain protein                              78.6    8e-13    Talaromyces marneffei ATCC 18224
gb|KIN01283.1|  hypothetical protein OIDMADRAFT_54416                 78.6    8e-13    Oidiodendron maius Zn
ref|XP_002381410.1|  PAP2 domain protein                              78.2    9e-13    Aspergillus flavus NRRL3357
gb|KJK68678.1|  PAP2 superfamily protein                              78.2    9e-13    Aspergillus parasiticus SU-1
gb|KGK36644.1|  hypothetical protein JL09_g4219                       77.4    1e-12    Pichia kudriavzevii
gb|EIE75966.1|  hypothetical protein RO3G_00670                       77.0    1e-12    Rhizopus delemar RA 99-880
gb|KEQ91888.1|  hypothetical protein AUEXF2481DRAFT_8118              78.6    1e-12    Aureobasidium subglaciale EXF-2481
ref|XP_008025524.1|  hypothetical protein SETTUDRAFT_135482           78.2    1e-12    Exserohilum turcica Et28A
gb|EMD95479.1|  hypothetical protein COCHEDRAFT_1165572               77.8    1e-12    Bipolaris maydis C5
ref|XP_003172289.1|  sphingosine-1-phosphate phosphohydrolase         77.8    1e-12    Nannizzia gypsea CBS 118893
gb|EAS34898.3|  sphingosine-1-phosphate phosphohydrolase              77.8    1e-12    Coccidioides immitis RS
dbj|GAK65500.1|  PAP2 superfamily protein                             77.8    2e-12    Moesziomyces antarcticus
ref|XP_002540824.1|  conserved hypothetical protein                   77.4    2e-12    Uncinocarpus reesii 1704
gb|KEQ84542.1|  acid phosphatase/Vanadium-dependent haloperoxidase    77.4    2e-12    Aureobasidium pullulans EXF-150
emb|CAK42112.1|  unnamed protein product                              77.4    2e-12    Aspergillus niger
ref|XP_001401174.2|  PAP2 domain protein                              77.4    2e-12    Aspergillus niger CBS 513.88
gb|ETS61780.1|  hypothetical protein PaG_03877                        77.4    2e-12    Moesziomyces aphidis DSM 70725
ref|XP_003849567.1|  hypothetical protein MYCGRDRAFT_62752            77.0    2e-12    Zymoseptoria tritici IPO323
dbj|GAC73017.1|  sphingoid base-phosphate phosphatase                 77.4    2e-12    Moesziomyces antarcticus T-34
gb|EZF33917.1|  hypothetical protein H101_02535                       77.0    2e-12    Trichophyton interdigitale H6
gb|KIX98090.1|  hypothetical protein Z520_06170                       77.0    2e-12    Fonsecaea multimorphosa CBS 102226
gb|EFW18306.1|  sphingosine-1-phosphate phosphohydrolase              77.0    3e-12    Coccidioides posadasii str. Silveira
gb|EGE01302.1|  sphingosine-1-phosphate phosphohydrolase              76.6    3e-12    Trichophyton equinum CBS 127.97
ref|XP_003024429.1|  hypothetical protein TRV_01392                   76.6    3e-12    Trichophyton verrucosum HKI 0517
emb|CBQ73983.1|  related to YSR3-dihydrosphingosine-1-phosphate p...  77.0    3e-12    Sporisorium reilianum SRZ2
gb|KIV85098.1|  hypothetical protein PV11_00833                       76.6    3e-12    Exophiala sideris
ref|XP_003066700.1|  PAP2 superfamily protein                         76.6    3e-12    Coccidioides posadasii C735 delta SOWgp
gb|EGD97016.1|  sphingosine-1-phosphate phosphohydrolase              76.6    3e-12    Trichophyton tonsurans CBS 112818
ref|XP_003868166.1|  Lcb3 protein                                     76.6    3e-12    Candida orthopsilosis Co 90-125
ref|XP_001215294.1|  conserved hypothetical protein                   76.6    4e-12    Aspergillus terreus NIH2624
ref|XP_002487135.1|  PAP2 domain protein                              76.6    4e-12    Talaromyces stipitatus ATCC 10500
dbj|GAA90686.1|  PAP2 domain protein                                  76.3    4e-12    Aspergillus kawachii IFO 4308
ref|XP_007799989.1|  hypothetical protein EPUS_01966                  76.3    4e-12    Endocarpon pusillum Z07020
ref|XP_002844102.1|  sphingosine-1-phosphate phosphohydrolase         76.3    4e-12    Microsporum canis CBS 113480
ref|XP_003015182.1|  hypothetical protein ARB_06305                   76.3    4e-12    Trichophyton benhamiae CBS 112371
ref|XP_660292.1|  hypothetical protein AN2688.2                       76.3    5e-12    Aspergillus nidulans FGSC A4
ref|XP_007588354.1|  putative sphingosine-1-phosphate phosphohydr...  76.3    5e-12    
ref|XP_002165225.1|  PREDICTED: sphingosine-1-phosphate phosphata...  75.5    5e-12    Hydra vulgaris
gb|KFH70364.1|  hypothetical protein MVEG_03215                       76.3    5e-12    Mortierella verticillata NRRL 6337
tpe|CBF84209.1|  TPA: conserved hypothetical protein similar to s...  76.3    5e-12    Aspergillus nidulans FGSC A4
ref|XP_003032085.1|  hypothetical protein SCHCODRAFT_76490            76.3    5e-12    Schizophyllum commune H4-8
ref|XP_571366.1|  sphingosine-1-phosphate phosphatase                 75.9    5e-12    Cryptococcus neoformans var. neoformans JEC21
ref|XP_007727515.1|  hypothetical protein A1O1_08464                  75.9    6e-12    Capronia coronata CBS 617.96
ref|XP_003237055.1|  sphingosine-1-phosphate phosphohydrolase         75.9    6e-12    Trichophyton rubrum CBS 118892
emb|CDM31062.1|  Phosphatidic acid phosphatase type 2/haloperoxidase  75.9    7e-12    Penicillium roqueforti FM164
ref|XP_002492823.1|  Long-chain base-1-phosphate phosphatase with...  75.5    7e-12    Komagataella phaffii GS115
ref|XP_001621147.1|  hypothetical protein NEMVEDRAFT_v1g16544         72.4    7e-12    Nematostella vectensis
gb|KEQ73749.1|  PAP2-domain-containing protein                        75.5    8e-12    Aureobasidium namibiae CBS 147.97
gb|KJY00463.1|  putative sphingosine-1-phosphate phosphohydrolase...  75.5    8e-12    Zymoseptoria brevis
gb|KDR16780.1|  Sphingosine-1-phosphate phosphatase 1                 75.5    8e-12    Zootermopsis nevadensis
ref|XP_003837203.1|  similar to sphingosine-1-phosphate phosphohy...  75.5    8e-12    Leptosphaeria maculans JN3
gb|KIK28333.1|  hypothetical protein PISMIDRAFT_27717                 75.5    9e-12    Pisolithus microcarpus 441
ref|XP_012050458.1|  sphingosine-1-phosphate phosphatase              75.5    9e-12    Cryptococcus neoformans var. grubii H99
ref|XP_001526586.1|  conserved hypothetical protein                   75.1    1e-11    Lodderomyces elongisporus NRRL YB-4239
gb|KIJ63094.1|  hypothetical protein HYDPIDRAFT_29782                 75.1    1e-11    Hydnomerulius pinastri MD-312
ref|XP_010129810.1|  PREDICTED: sphingosine-1-phosphate phosphata...  74.3    1e-11    Buceros rhinoceros silvestris
ref|XP_001259276.1|  sphingosine-1-phosphate phosphohydrolase         75.1    1e-11    Aspergillus fischeri NRRL 181
emb|CDR38604.1|  CYFA0S02e03576g1_1                                   75.1    1e-11    Cyberlindnera fabianii
dbj|GAD91780.1|  PAP2 domain protein                                  74.7    1e-11    Byssochlamys spectabilis No. 5
gb|KIV91097.1|  hypothetical protein, variant 1                       74.7    1e-11    Exophiala mesophila
gb|KIW75819.1|  hypothetical protein Z517_10563                       74.7    1e-11    Fonsecaea pedrosoi CBS 271.37
ref|XP_001274683.1|  sphingosine-1-phosphate phosphohydrolase         74.7    1e-11    Aspergillus clavatus NRRL 1
gb|EMR88247.1|  putative long-chain base protein 3 protein            74.7    1e-11    Botrytis cinerea BcDW1
dbj|BAO37964.1|  dihydrosphingosine 1-phosphate phosphatase LCB3      74.7    1e-11    Kluyveromyces marxianus DMKU3-1042
dbj|BAP69516.1|  dihydrosphingosine 1-phosphate phosphatase LCB3      74.3    1e-11    Kluyveromyces marxianus
emb|CCK69241.1|  hypothetical protein KNAG_0C01280                    74.3    1e-11    Kazachstania naganishii CBS 8797
gb|KEZ46091.1|  PAP2 superfamily protein                              74.7    2e-11    Scedosporium apiospermum
ref|XP_006965353.1|  predicted protein                                74.7    2e-11    Trichoderma reesei QM6a
ref|XP_009157905.1|  PAP2 domain-containing protein                   74.3    2e-11    Exophiala dermatitidis NIH/UT8656
emb|CCD54501.1|  similar to sphingosine-1-phosphate phosphohydrolase  74.7    2e-11    Botrytis cinerea T4
gb|KJJ28170.1|  Phosphatidic acid phosphatase type 2haloperoxidase    74.3    2e-11    
gb|KIV91096.1|  hypothetical protein PV10_05677                       74.3    2e-11    Exophiala mesophila
gb|KGO41590.1|  Phosphatidic acid phosphatase type 2/haloperoxidase   74.3    2e-11    Penicillium expansum
gb|KIW97044.1|  hypothetical protein Z519_02436                       74.3    2e-11    Cladophialophora bantiana CBS 173.52
ref|XP_447437.1|  hypothetical protein                                73.9    2e-11    [Candida] glabrata
gb|EHK40742.1|  hypothetical protein TRIATDRAFT_85410                 74.3    2e-11    Trichoderma atroviride IMI 206040
gb|KEQ60952.1|  sphingosine-1-phosphate phosphohydrolase-like pro...  74.3    2e-11    Aureobasidium melanogenum CBS 110374
gb|KIW47551.1|  hypothetical protein PV06_00242                       73.9    2e-11    Exophiala oligosperma
emb|CDI54343.1|  related to YSR3-dihydrosphingosine-1-phosphate p...  73.9    3e-11    Melanopsichium pennsylvanicum 4
gb|EHK15496.1|  hypothetical protein TRIVIDRAFT_39143                 73.9    3e-11    Trichoderma virens Gv29-8
dbj|GAM88621.1|  hypothetical protein ANO11243_066550                 73.9    3e-11    fungal sp. No.11243
ref|XP_007930990.1|  hypothetical protein MYCFIDRAFT_205133           73.6    3e-11    Pseudocercospora fijiensis CIRAD86
gb|EEQ90992.1|  sphingosine-1-phosphate phosphohydrolase              73.9    3e-11    Blastomyces dermatitidis ER-3
ref|XP_002623067.1|  sphingosine-1-phosphate phosphohydrolase         73.9    3e-11    Blastomyces gilchristii SLH14081
gb|KDQ22460.1|  hypothetical protein PLEOSDRAFT_1059960               73.6    3e-11    Pleurotus ostreatus PC15
gb|EGE87063.1|  sphingosine-1-phosphate phosphohydrolase              73.6    3e-11    Blastomyces dermatitidis ATCC 18188
gb|EQL36074.1|  hypothetical protein, variant                         73.6    3e-11    Blastomyces dermatitidis ATCC 26199
gb|KIM59073.1|  hypothetical protein SCLCIDRAFT_16570                 73.6    4e-11    Scleroderma citrinum Foug A
gb|EMD34637.1|  hypothetical protein CERSUDRAFT_116813                73.6    4e-11    Gelatoporia subvermispora B
ref|XP_001939379.1|  sphingosine-1-phosphate phosphohydrolase         73.6    4e-11    Pyrenophora tritici-repentis Pt-1C-BFP
gb|KEF61564.1|  hypothetical protein A1O9_03132                       73.2    5e-11    Exophiala aquamarina CBS 119918
ref|XP_448581.1|  hypothetical protein                                72.8    5e-11    [Candida] glabrata
gb|KIW27105.1|  hypothetical protein PV07_06880                       73.2    5e-11    Cladophialophora immunda
gb|KGL86892.1|  Sphingosine-1-phosphate phosphatase 2                 72.0    6e-11    Charadrius vociferus
gb|KIW16902.1|  hypothetical protein PV08_04092                       72.8    6e-11    Exophiala spinifera
ref|XP_007743402.1|  hypothetical protein A1O5_04608                  72.8    7e-11    Cladophialophora psammophila CBS 110553
gb|EOA96450.1|  Sphingosine-1-phosphate phosphatase 2                 72.0    7e-11    Anas platyrhynchos [duck]
ref|XP_009970260.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.3    7e-11    Tyto alba [Schleiereule]
gb|EMF09591.1|  sphingosine-1-phosphate phosphohydrolase              72.8    7e-11    Sphaerulina musiva SO2202
ref|XP_009888515.1|  PREDICTED: sphingosine-1-phosphate phosphata...  72.4    8e-11    Charadrius vociferus
ref|XP_003306259.1|  hypothetical protein PTT_19375                   72.4    8e-11    
ref|XP_005232339.1|  PREDICTED: sphingosine-1-phosphate phosphata...  72.0    9e-11    
ref|XP_001946730.1|  PREDICTED: sphingosine-1-phosphate phosphata...  72.0    9e-11    Acyrthosiphon pisum
gb|KJZ80254.1|  hypothetical protein HIM_00104                        72.4    9e-11    Hirsutella minnesotensis 3608
gb|KFY85696.1|  hypothetical protein V500_08197                       72.4    1e-10    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_008717552.1|  hypothetical protein HMPREF1541_04988            72.0    1e-10    Cyphellophora europaea CBS 101466
gb|KFW67813.1|  Sphingosine-1-phosphate phosphatase 2                 71.2    1e-10    Pygoscelis adeliae
gb|KFZ03523.1|  hypothetical protein V502_10875                       72.4    1e-10    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFM05728.1|  Sphingosine-1-phosphate phosphatase 2                 71.2    1e-10    Aptenodytes forsteri
ref|XP_009942309.1|  PREDICTED: sphingosine-1-phosphate phosphata...  71.6    1e-10    Opisthocomus hoazin [hoatzin]
gb|ELK30561.1|  Sphingosine-1-phosphate phosphatase 2                 69.3    1e-10    Myotis davidii
ref|XP_007878242.1|  hypothetical protein PFL1_02535                  72.4    1e-10    Anthracocystis flocculosa PF-1
ref|XP_004864533.1|  PREDICTED: sphingosine-1-phosphate phosphata...  71.6    1e-10    
gb|KFO56014.1|  Sphingosine-1-phosphate phosphatase 2                 71.2    1e-10    Corvus brachyrhynchos
ref|XP_007263693.1|  hypothetical protein FOMMEDRAFT_79789            72.0    1e-10    Fomitiporia mediterranea MF3/22
ref|XP_006690726.1|  dihydrosphingosine 1-phosphate phosphatase-l...  72.0    1e-10    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_004864532.1|  PREDICTED: sphingosine-1-phosphate phosphata...  71.6    1e-10    Heterocephalus glaber [naked mole rat]
ref|XP_009697986.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.2    1e-10    Cariama cristata
ref|XP_006463641.1|  hypothetical protein AGABI2DRAFT_225504          72.0    1e-10    Agaricus bisporus var. bisporus H97
gb|KFP11370.1|  Sphingosine-1-phosphate phosphatase 2                 71.2    1e-10    Egretta garzetta
ref|XP_009274912.1|  PREDICTED: sphingosine-1-phosphate phosphata...  71.2    1e-10    
ref|XP_007308885.1|  hypothetical protein STEHIDRAFT_103330           72.0    1e-10    Stereum hirsutum FP-91666 SS1
gb|EKG13367.1|  Phosphatidic acid phosphatase type 2/haloperoxidase   72.0    1e-10    Macrophomina phaseolina MS6
ref|XP_003512384.2|  PREDICTED: sphingosine-1-phosphate phosphata...  71.2    1e-10    
gb|KFV81734.1|  Sphingosine-1-phosphate phosphatase 2                 69.7    1e-10    Struthio camelus australis
gb|KFR01609.1|  Sphingosine-1-phosphate phosphatase 2                 70.9    1e-10    Opisthocomus hoazin [hoatzin]
gb|KIM69348.1|  hypothetical protein SCLCIDRAFT_1170555               71.6    1e-10    Scleroderma citrinum Foug A
ref|XP_008512611.1|  PREDICTED: sphingosine-1-phosphate phosphata...  71.2    1e-10    Equus przewalskii [Przewalski horse]
ref|XP_009647389.1|  PREDICTED: sphingosine-1-phosphate phosphata...  71.2    1e-10    Egretta garzetta
ref|XP_008627835.1|  PREDICTED: sphingosine-1-phosphate phosphata...  71.2    1e-10    
gb|KFY16309.1|  hypothetical protein V491_05367                       71.6    2e-10    Pseudogymnoascus sp. VKM F-3775
ref|XP_007731815.1|  hypothetical protein A1O3_03488                  71.6    2e-10    Capronia epimyces CBS 606.96
gb|EHB01094.1|  Sphingosine-1-phosphate phosphatase 2                 68.9    2e-10    Heterocephalus glaber [naked mole rat]
gb|KIJ29297.1|  hypothetical protein M422DRAFT_188721                 71.6    2e-10    Sphaerobolus stellatus SS14
ref|XP_010178437.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.2    2e-10    Mesitornis unicolor
gb|ELR05779.1|  hypothetical protein GMDG_01857                       71.6    2e-10    Pseudogymnoascus destructans 20631-21
ref|XP_006972188.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.9    2e-10    
gb|KFZ05620.1|  hypothetical protein V501_08185                       71.6    2e-10    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
ref|XP_010123707.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.8    2e-10    Chlamydotis macqueenii
ref|XP_011500152.1|  PREDICTED: sphingosine-1-phosphate phosphata...  71.2    2e-10    Ceratosolen solmsi marchali
gb|KHJ35959.1|  putative sphingosine-1-phosphate phosphohydrolase     71.6    2e-10    Erysiphe necator
ref|XP_005070674.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.9    2e-10    
ref|XP_011236997.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    2e-10    Mus musculus [mouse]
ref|XP_005441779.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.9    2e-10    
ref|XP_004178889.1|  hypothetical protein TBLA_0B05410                71.2    2e-10    Tetrapisispora blattae CBS 6284
gb|KGO75490.1|  Phosphatidic acid phosphatase type 2/haloperoxidase   71.2    2e-10    Penicillium italicum
ref|NP_001178740.1|  sphingosine-1-phosphate phosphatase 2            70.9    2e-10    Rattus norvegicus [brown rat]
gb|EPY52418.1|  sphingosine-1-phosphate phosphatase                   71.2    2e-10    Schizosaccharomyces cryophilus OY26
ref|XP_007776220.1|  hypothetical protein W97_00113                   71.2    2e-10    Coniosporium apollinis CBS 100218
gb|KFY11713.1|  hypothetical protein V492_04299                       71.2    2e-10    
gb|EFB24593.1|  hypothetical protein PANDA_021773                     67.8    2e-10    
ref|XP_001850800.1|  sphingosine-1-phosphate phosphohydrolase         70.9    2e-10    
gb|KFY77806.1|  hypothetical protein V499_02888                       71.2    2e-10    
gb|KGL78117.1|  Sphingosine-1-phosphate phosphatase 2                 70.5    2e-10    
ref|XP_005361609.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.9    2e-10    
gb|KFY01708.1|  hypothetical protein O988_02583                       71.2    2e-10    
gb|EQL04156.1|  PAP2 domain protein                                   71.2    2e-10    
ref|XP_007521199.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    2e-10    
gb|KFY54229.1|  hypothetical protein V496_07307                       71.2    2e-10    
ref|XP_004262706.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.9    2e-10    
gb|KFX93941.1|  hypothetical protein V490_04597                       71.2    2e-10    
gb|ERE86545.1|  sphingosine-1-phosphate phosphatase 2-like protein    70.9    2e-10    
ref|XP_006686726.1|  hypothetical protein CANTEDRAFT_114236           70.9    2e-10    
gb|KFY34626.1|  hypothetical protein V494_06612                       71.2    2e-10    
ref|XP_006686725.1|  PAP2-domain-containing protein                   70.9    2e-10    
ref|NP_001004173.1|  sphingosine-1-phosphate phosphatase 2            70.5    3e-10    
ref|XP_006906734.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.9    3e-10    
ref|XP_008824034.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.5    3e-10    
ref|XP_010162565.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.1    3e-10    
gb|KFQ97224.1|  Sphingosine-1-phosphate phosphatase 2                 70.1    3e-10    
gb|KFP54387.1|  Sphingosine-1-phosphate phosphatase 2                 70.1    3e-10    
ref|XP_007291091.1|  PAP2 superfamily protein                         70.9    3e-10    
ref|XP_010835408.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.1    3e-10    
ref|XP_010403834.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.1    3e-10    
ref|XP_007332869.1|  hypothetical protein AGABI1DRAFT_78483           70.9    3e-10    
ref|XP_010008909.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.1    3e-10    
gb|KFY31034.1|  hypothetical protein V493_01457                       70.9    4e-10    
gb|KFQ13955.1|  Sphingosine-1-phosphate phosphatase 2                 69.7    4e-10    
gb|KFQ07524.1|  Sphingosine-1-phosphate phosphatase 2                 69.7    4e-10    
ref|XP_003052061.1|  predicted protein                                70.5    4e-10    
ref|XP_001636092.1|  predicted protein                                70.5    4e-10    
ref|XP_003133728.2|  PREDICTED: sphingosine-1-phosphate phosphata...  70.1    4e-10    
gb|KFO95271.1|  Sphingosine-1-phosphate phosphatase 2                 69.7    4e-10    
gb|KIX10441.1|  hypothetical protein Z518_01523                       70.5    4e-10    
ref|XP_005395554.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.7    4e-10    
ref|XP_005971198.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.1    4e-10    
ref|XP_007681211.1|  hypothetical protein BAUCODRAFT_126761           70.5    4e-10    
emb|CCE40882.1|  hypothetical protein CPAR2_109200                    70.5    4e-10    
gb|EMC78861.1|  Sphingosine-1-phosphate phosphatase 2                 69.7    4e-10    
ref|XP_011356975.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.1    4e-10    
ref|XP_005677003.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.1    4e-10    
gb|KIL91417.1|  hypothetical protein FAVG1_05033                      70.5    4e-10    
emb|CEP64484.1|  LALA0S11e05204g1_1                                   70.1    5e-10    
ref|XP_004638219.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.7    5e-10    
gb|AAX88957.1|  unknown                                               69.7    5e-10    
ref|XP_009509075.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.7    5e-10    
ref|XP_009463707.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.1    5e-10    
gb|KIW56990.1|  hypothetical protein PV05_05597                       70.1    5e-10    
gb|KFW97152.1|  Sphingosine-1-phosphate phosphatase 2                 69.3    5e-10    
ref|XP_009988584.1|  PREDICTED: sphingosine-1-phosphate phosphata...  70.1    5e-10    
gb|EPQ62938.1|  Dihydrosphingosine 1-phosphate phosphatase            70.1    5e-10    
ref|XP_011576004.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.7    5e-10    
gb|KFV05651.1|  Sphingosine-1-phosphate phosphatase 2                 69.3    5e-10    
ref|XP_006890375.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.7    5e-10    
ref|XP_009812614.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.3    5e-10    
gb|ETN61151.1|  sphingosine-1-phosphate phosphohydrolase              70.1    5e-10    
ref|XP_422628.3|  PREDICTED: sphingosine-1-phosphate phosphatase 2    69.7    5e-10    
ref|XP_010714751.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.3    5e-10    
ref|XP_005395553.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.7    5e-10    
ref|XP_003980281.1|  hypothetical protein NDAI_0G06220                69.7    5e-10    
ref|XP_001493091.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.7    5e-10    
gb|KFV65136.1|  Sphingosine-1-phosphate phosphatase 2                 69.3    6e-10    
ref|XP_010714750.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.3    6e-10    
ref|XP_009072665.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.3    6e-10    
emb|CEP07772.1|  hypothetical protein                                 69.7    6e-10    
ref|XP_009921560.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.7    6e-10    
ref|XP_009953433.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.7    6e-10    
ref|XP_005150274.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.3    6e-10    
ref|XP_009674106.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.3    6e-10    
ref|XP_007301166.1|  hypothetical protein STEHIDRAFT_153999           69.7    7e-10    
gb|KFP33256.1|  Sphingosine-1-phosphate phosphatase 2                 68.9    7e-10    
ref|XP_004807329.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.3    7e-10    
gb|KIY51066.1|  hypothetical protein FISHEDRAFT_13986                 69.7    7e-10    
gb|EME40674.1|  hypothetical protein DOTSEDRAFT_74279                 69.7    7e-10    
ref|XP_006818827.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.6    7e-10    
ref|XP_009490446.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    7e-10    
ref|XP_002618523.1|  hypothetical protein CLUG_01982                  69.7    8e-10    
ref|XP_002613479.1|  hypothetical protein BRAFLDRAFT_57810            68.9    8e-10    
ref|XP_005395552.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.3    8e-10    
emb|CCF32440.1|  PAP2 superfamily protein                             69.7    8e-10    
gb|EWC47973.1|  hypothetical protein DRE_02855                        69.3    9e-10    
ref|XP_010610266.1|  PREDICTED: sphingosine-1-phosphate phosphata...  69.3    9e-10    
ref|XP_010989267.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.0    9e-10    
ref|XP_002554455.1|  KLTH0F05742p                                     69.3    9e-10    
gb|KIJ95299.1|  hypothetical protein K443DRAFT_683135                 69.3    9e-10    
ref|XP_005026480.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
ref|XP_459141.2|  DEHA2D15158p                                        69.3    1e-09    
ref|XP_010214253.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
gb|EWZ48446.1|  hypothetical protein FOZG_03998                       69.3    1e-09    
ref|XP_006134911.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
gb|EWZ93513.1|  hypothetical protein FOWG_06235                       69.3    1e-09    
gb|EWZ02361.1|  hypothetical protein FOYG_01663                       68.9    1e-09    
ref|XP_008490259.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
ref|XP_003585820.1|  PREDICTED: LOW QUALITY PROTEIN: sphingosine-...  68.9    1e-09    
ref|XP_003464036.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.6    1e-09    
ref|XP_005330593.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.6    1e-09    
ref|XP_011968964.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
ref|XP_006079702.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
gb|EFQ31192.1|  PAP2 superfamily protein                              69.3    1e-09    
ref|XP_006082636.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
ref|XP_007464399.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
ref|XP_009999956.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
ref|XP_010566716.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
gb|KFW87031.1|  Sphingosine-1-phosphate phosphatase 2                 68.2    1e-09    
ref|XP_005051387.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.6    1e-09    
ref|NP_689599.2|  sphingosine-1-phosphate phosphatase 2               68.9    1e-09    
ref|XP_009323384.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
emb|CEI86809.1|  hypothetical protein RMCBS344292_01237               67.0    1e-09    
ref|XP_002749876.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.6    1e-09    
ref|XP_005513163.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.9    1e-09    
ref|XP_011216244.1|  PREDICTED: sphingosine-1-phosphate phosphata...  66.6    1e-09    
ref|XP_010353753.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.6    1e-09    
ref|XP_007177449.1|  PREDICTED: uncharacterized protein LOC102998333  68.6    1e-09    
gb|KIM45566.1|  hypothetical protein M413DRAFT_430272                 68.9    1e-09    
gb|EEH06859.1|  sphingosine-1-phosphate phosphohydrolase              68.9    1e-09    
gb|AJS32076.1|  Ysr3p                                                 68.6    1e-09    
ref|XP_004881693.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.8    1e-09    
gb|AJS30582.1|  Ysr3p                                                 68.6    1e-09    
ref|XP_009895910.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.6    1e-09    
gb|AAI06905.1|  SGPP2 protein                                         68.6    1e-09    
ref|XP_004180579.1|  hypothetical protein TBLA_0D05680                68.9    1e-09    
gb|KIW56991.1|  hypothetical protein, variant                         68.6    1e-09    
ref|XP_003687018.1|  hypothetical protein TPHA_0I00780                68.6    1e-09    
gb|EWG43003.1|  hypothetical protein FVEG_04658                       68.9    1e-09    
emb|CCE26839.1|  related to sphingoid base-phosphate phosphatase      68.9    1e-09    
ref|XP_007595320.1|  PAP2 superfamily protein                         68.9    1e-09    
ref|XP_007793894.1|  putative long-chain base protein 3 protein       68.9    2e-09    
ref|NP_593838.1|  sphingosine-1-phosphate phosphatase (predicted)     68.6    2e-09    
gb|KIM36693.1|  hypothetical protein M413DRAFT_449032                 68.6    2e-09    
gb|EWZ02360.1|  hypothetical protein FOYG_01663                       68.6    2e-09    
ref|XP_004033321.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.6    2e-09    
ref|XP_526109.2|  PREDICTED: sphingosine-1-phosphate phosphatase 2    68.2    2e-09    
ref|XP_005883602.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.6    2e-09    
ref|XP_001661054.1|  AAEL010728-PA                                    68.6    2e-09    
gb|KFU92607.1|  Sphingosine-1-phosphate phosphatase 2                 67.8    2e-09    
ref|XP_011324647.1|  hypothetical protein FGSG_06028                  68.6    2e-09    
ref|XP_009254338.1|  hypothetical protein FPSE_02944                  68.6    2e-09    
gb|EWZ48445.1|  hypothetical protein FOZG_03998                       68.6    2e-09    
gb|EMT68228.1|  hypothetical protein FOC4_g10012641                   68.6    2e-09    
ref|XP_005001088.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.2    2e-09    
gb|EWZ93512.1|  hypothetical protein FOWG_06235                       68.6    2e-09    
ref|XP_003666762.1|  hypothetical protein MYCTH_2311737               68.6    2e-09    
gb|KIJ15159.1|  hypothetical protein PAXINDRAFT_169324                68.6    2e-09    
gb|AJS34123.1|  Ysr3p                                                 68.2    2e-09    
emb|CCT67043.1|  related to sphingoid base-phosphate phosphatase      68.6    2e-09    
gb|AJS49353.1|  Ysr3p                                                 68.2    2e-09    
ref|XP_003657602.1|  hypothetical protein THITE_2123464               68.6    2e-09    
ref|XP_004194289.1|  Piso0_004776                                     68.2    2e-09    
ref|XP_003646788.1|  hypothetical protein Ecym_5202                   68.2    2e-09    
ref|XP_006763507.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.8    2e-09    
gb|AJS33517.1|  Ysr3p                                                 68.2    2e-09    
ref|XP_010203937.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.2    2e-09    
ref|XP_004195389.1|  Piso0_004776                                     68.2    2e-09    
ref|XP_008257452.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.2    2e-09    
gb|EDV13133.1|  hypothetical protein SCRG_04068                       68.2    2e-09    
ref|NP_012979.3|  sphinganine kinase YSR3                             68.2    2e-09    
emb|CDH09454.1|  related to Dihydrosphingosine 1-phosphate phosph...  68.2    2e-09    
ref|XP_005330592.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.2    2e-09    
gb|AJS57107.1|  Ysr3p                                                 68.2    2e-09    
gb|AJS53848.1|  Ysr3p                                                 68.2    2e-09    
ref|XP_011397326.1|  Dihydrosphingosine 1-phosphate phosphatase YSR3  67.8    2e-09    
gb|AJS53249.1|  Ysr3p                                                 68.2    2e-09    
gb|AJS52962.1|  Ysr3p                                                 68.2    2e-09    
gb|AJS32975.1|  Ysr3p                                                 68.2    2e-09    
gb|EYE92931.1|  PAP2 domain protein                                   68.2    2e-09    
gb|EDN59956.1|  DHS-1-P phosphatase                                   68.2    2e-09    
ref|XP_012062566.1|  PREDICTED: sphingosine-1-phosphate phosphata...  68.2    2e-09    
ref|XP_001387372.2|  Yeast Sphingolipid Resistance Gene               68.2    2e-09    
gb|AJS46418.1|  Ysr3p                                                 67.8    2e-09    
gb|AJS30880.1|  Ysr3p                                                 67.8    2e-09    
ref|XP_008197340.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.8    2e-09    
emb|CCK69375.1|  hypothetical protein KNAG_0C02640                    67.8    2e-09    
ref|XP_005424743.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.8    2e-09    
gb|EMT68229.1|  hypothetical protein FOC4_g10012642                   68.2    2e-09    
ref|XP_008929481.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.8    2e-09    
gb|ENH81395.1|  sphingosine-1-phosphate phosphohydrolase              68.2    2e-09    
gb|ENN75878.1|  hypothetical protein YQE_07607                        67.8    3e-09    
gb|KFO75767.1|  Sphingosine-1-phosphate phosphatase 2                 67.4    3e-09    
dbj|GAA24774.1|  K7_Ysr3p                                             67.8    3e-09    
gb|EWG43002.1|  hypothetical protein FVEG_04658                       68.2    3e-09    
ref|XP_004576835.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.8    3e-09    
ref|XP_004345040.1|  hypothetical protein CAOG_06290                  67.8    3e-09    
gb|AJR63985.1|  Lcb3p                                                 67.8    3e-09    
ref|XP_005816073.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.8    3e-09    
ref|XP_004427677.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.4    3e-09    
gb|EFN62311.1|  Sphingosine-1-phosphate phosphatase 1                 67.4    3e-09    
ref|XP_010334795.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.8    3e-09    
ref|XP_007441330.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.8    3e-09    
ref|XP_004662885.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.4    3e-09    
ref|XP_007566315.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.4    3e-09    
ref|XP_008143330.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.4    4e-09    
ref|XP_004762991.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.4    4e-09    
gb|AJV42867.1|  Lcb3p                                                 67.4    4e-09    
emb|CEJ79953.1|  Putative PAP2 domain protein                         67.4    4e-09    
gb|EHH21714.1|  hypothetical protein EGK_04842                        67.0    4e-09    
ref|XP_006266135.1|  PREDICTED: sphingosine-1-phosphate phosphata...  64.7    4e-09    
ref|XP_004407534.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.4    4e-09    
gb|EMG46624.1|  hypothetical protein G210_3120                        67.4    4e-09    
ref|XP_005489394.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.0    4e-09    
emb|CCU74252.1|  ysr3/Dihydrosphingosine 1-phosphate phosphatase      67.4    4e-09    
ref|XP_010947155.1|  PREDICTED: sphingosine-1-phosphate phosphata...  66.6    4e-09    
gb|KFA63762.1|  hypothetical protein S40285_01955                     67.4    4e-09    
ref|XP_001909382.1|  hypothetical protein                             67.4    4e-09    
gb|KFQ26764.1|  Sphingosine-1-phosphate phosphatase 1                 66.6    5e-09    
ref|XP_011265149.1|  PREDICTED: sphingosine-1-phosphate phosphata...  64.3    5e-09    
ref|XP_006186955.1|  PREDICTED: sphingosine-1-phosphate phosphata...  66.2    5e-09    
ref|XP_004624976.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.0    5e-09    
gb|EGA82295.1|  Lcb3p                                                 66.6    5e-09    
gb|AJR60711.1|  Lcb3p                                                 67.0    5e-09    
gb|EHH55203.1|  hypothetical protein EGM_04360                        66.6    5e-09    
gb|AJR73328.1|  Lcb3p                                                 67.0    5e-09    
ref|XP_007914805.1|  putative long-chain base protein 3 protein       67.0    5e-09    
emb|CDF87399.1|  BN860_05490g1_1                                      66.6    6e-09    
ref|XP_006208031.1|  PREDICTED: sphingosine-1-phosphate phosphata...  67.0    6e-09    
ref|XP_318734.3|  AGAP009675-PA                                       66.6    6e-09    
ref|XP_003344669.1|  hypothetical protein SMAC_07238                  67.0    6e-09    
ref|XP_009181434.1|  PREDICTED: sphingosine-1-phosphate phosphata...  66.6    6e-09    
ref|XP_011646791.1|  PREDICTED: sphingosine-1-phosphate phosphata...  66.6    6e-09    
emb|CCL98041.1|  predicted protein                                    67.0    6e-09    
gb|KKA02875.1|  hypothetical protein D499_0E00180                     66.6    6e-09    



>ref|XP_009769700.1| PREDICTED: lipid phosphate phosphatase delta [Nicotiana sylvestris]
Length=407

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A+WVV+SSIFNVTQKIRSLTQ WVS  VVSGTPI+L+IQKYQH YLD  FSGLSC VSVP
Sbjct  16   ATWVVLSSIFNVTQKIRSLTQYWVSSYVVSGTPITLRIQKYQHKYLDALFSGLSCVVSVP  75

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFWSGH KLARQMTLLMAFCDY+GNCIKDVV APRP+SPPVRRITATEDEKE
Sbjct  76   FYTAFLPLLFWSGHCKLARQMTLLMAFCDYVGNCIKDVVCAPRPSSPPVRRITATEDEKE  135

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NALEYG+PSSHTLNT+CLSG+LL Y+LS+T+NED    +AG A++ + V LI +GRIYLG
Sbjct  136  NALEYGLPSSHTLNTVCLSGFLLQYILSYTENEDAIIGLAGFAVVCVFVFLIAVGRIYLG  195

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSLIDIIGGLAFGLAILAFWLSV
Sbjct  196  MHSLIDIIGGLAFGLAILAFWLSV  219



>emb|CDP14282.1| unnamed protein product [Coffea canephora]
Length=407

 Score =   311 bits (797),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            ASWVV SS+ NVT KIRSLTQPWVS QV+S TPISL+IQKYQHG+LDG F+ LSC VSVP
Sbjct  16   ASWVVFSSMLNVTGKIRSLTQPWVSHQVISSTPISLKIQKYQHGFLDGLFTALSCVVSVP  75

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFWSGH KLARQMTLLMAFCDY+GNCIKDVV+APRP+SPPVRR+TATEDEKE
Sbjct  76   FYTAFLPLLFWSGHCKLARQMTLLMAFCDYIGNCIKDVVAAPRPSSPPVRRVTATEDEKE  135

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSHTLNT+CLSGYLLHYVLS+ +  D+ST++ G+A I L+VGLIGLGRIYLG
Sbjct  136  NAMEYGLPSSHTLNTVCLSGYLLHYVLSYAEISDISTQLVGLATICLVVGLIGLGRIYLG  195

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSLID+IGGL  GL +LA WLS+
Sbjct  196  MHSLIDVIGGLIIGLGVLAIWLSI  219



>ref|XP_009590582.1| PREDICTED: lipid phosphate phosphatase delta [Nicotiana tomentosiformis]
Length=407

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A+WVV+SSIFNVTQK RS TQ WVS  VVSGTPI+L+IQKYQH YLD  FSGLSC VSVP
Sbjct  16   ATWVVLSSIFNVTQKTRSFTQHWVSSYVVSGTPITLRIQKYQHKYLDALFSGLSCVVSVP  75

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFWSGH KLARQMTLLMAFCDY+GNCIKDVV APRP+S  VRRITATEDEKE
Sbjct  76   FYTAFLPLLFWSGHCKLARQMTLLMAFCDYVGNCIKDVVCAPRPSSSVVRRITATEDEKE  135

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NALEYG+PSSHTLNT+CLSG+LL Y+LS+T+NED    +AG A++ L V LI +GRIYLG
Sbjct  136  NALEYGLPSSHTLNTVCLSGFLLQYILSYTQNEDAIIGLAGFAVVCLFVFLIAVGRIYLG  195

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSLIDIIGGLAFGLAILAFWLSV
Sbjct  196  MHSLIDIIGGLAFGLAILAFWLSV  219



>ref|XP_004234755.1| PREDICTED: lipid phosphate phosphatase delta [Solanum lycopersicum]
Length=404

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
             +WV++SSIFNVTQKIRSLTQPWVS  VVS TPI+L+IQKY + YLD FFS LSC VSVP
Sbjct  13   GTWVILSSIFNVTQKIRSLTQPWVSSYVVSTTPITLKIQKYHNKYLDAFFSALSCVVSVP  72

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFWSGH KLARQMTLLMA CDY+GNCIKDVV APRP+ PPVRRITATEDEKE
Sbjct  73   FYTAFLPLLFWSGHCKLARQMTLLMALCDYIGNCIKDVVCAPRPSGPPVRRITATEDEKE  132

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NALEYG+PSSHTLNT+CLSG+LL Y+LS+T+N+D+ T +AG+A++ L +  I +GRIYLG
Sbjct  133  NALEYGLPSSHTLNTVCLSGFLLQYILSYTQNDDVITGLAGLAIVCLFIFFIAVGRIYLG  192

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSLIDII GLAFGLAILA WLSV
Sbjct  193  MHSLIDIIAGLAFGLAILASWLSV  216



>ref|XP_002323347.1| phosphatidic acid phosphatase family protein [Populus trichocarpa]
 gb|EEF05108.1| phosphatidic acid phosphatase family protein [Populus trichocarpa]
Length=407

 Score =   304 bits (779),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+ ISS  NVTQK+R+L QPWVS  V++GTPI LQIQKYQHG+LD  FSGLSC VSVPF
Sbjct  17   SWIFISSCLNVTQKLRNLVQPWVSHHVITGTPIILQIQKYQHGFLDALFSGLSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMAFCDY GNCIKDVVSAPRP+ PPV+R+TAT+DE+EN
Sbjct  77   YTAFLPLLFWSGHGKLARQMTLLMAFCDYSGNCIKDVVSAPRPSCPPVKRMTATKDEEEN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNTICLSGYLLHYVLS+T+N+D S + AG A+  L+V L GLGRIYLGM
Sbjct  137  ALEYGLPSSHTLNTICLSGYLLHYVLSYTQNQDASLKFAGFAIFCLIVCLTGLGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS+IDII GLA G AILAFWLSV
Sbjct  197  HSVIDIIAGLAIGFAILAFWLSV  219



>ref|XP_002281162.1| PREDICTED: lipid phosphate phosphatase delta [Vitis vinifera]
Length=407

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+VISS  NVTQK+RS TQPWVSR V++GTP+ LQIQK+QHG+LD  FSGLSC VSVPF
Sbjct  17   SWIVISSTLNVTQKLRSFTQPWVSRHVLTGTPLILQIQKFQHGFLDALFSGLSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLLMAFCDY+GNCIKD VSAPRP+ PPVRR+TAT+DEKEN
Sbjct  77   YTAFLPLLFWSGHVRLARQMTLLMAFCDYLGNCIKDSVSAPRPSCPPVRRVTATKDEKEN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYVLS+  N D    +AG++++ LLV LIG GRIYLGM
Sbjct  137  AMEYGLPSSHTLNTVCLSGYLLHYVLSYAHNRDAVMILAGVSMVCLLVALIGTGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSL+DIIGGLA GLAILAFWL++
Sbjct  197  HSLVDIIGGLAIGLAILAFWLTM  219



>ref|XP_006360606.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11-like 
[Solanum tuberosum]
Length=407

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
             +WV++SS+FNVTQKIRSLTQPWVS  VVS TPI+L+IQKY + YLD FFS LSC VSVP
Sbjct  16   GTWVILSSMFNVTQKIRSLTQPWVSSYVVSTTPITLKIQKYHNKYLDAFFSALSCVVSVP  75

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFWSGH KLARQMTLLMA CDY+GNCIKDVV APRP++PPVRRITATEDEKE
Sbjct  76   FYTAFLPLLFWSGHCKLARQMTLLMALCDYIGNCIKDVVCAPRPSAPPVRRITATEDEKE  135

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NALEYG+PSSHTLNT+CLSG+LL Y+LS+T+N+D  T +AG+ ++ L V  I LGRIYLG
Sbjct  136  NALEYGLPSSHTLNTVCLSGFLLQYILSYTQNDDAITGLAGLVIVCLFVFFIALGRIYLG  195

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSLIDII GLAFGLAILA WLSV
Sbjct  196  MHSLIDIIAGLAFGLAILASWLSV  219



>ref|XP_012090848.1| PREDICTED: lipid phosphate phosphatase delta [Jatropha curcas]
 gb|KDP21901.1| hypothetical protein JCGZ_03039 [Jatropha curcas]
Length=406

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            ASW+VISS  NVT KIRS  QPWV+  V+ GTP  L+IQK+QHG+LD  FSGLSC VSVP
Sbjct  16   ASWIVISSCLNVTLKIRSFLQPWVTHHVICGTPFILRIQKHQHGFLDALFSGLSCVVSVP  75

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLPFLFWSGH KLARQMTLL+AFCDY GNCIKDVVSAPRP  PPVRRITAT+DE++
Sbjct  76   FYTAFLPFLFWSGHGKLARQMTLLIAFCDYAGNCIKDVVSAPRPNCPPVRRITATKDEED  135

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NALEYG+PSSHTLNT+CLSGYLLHY LSHT+N+D S E+AG A+  LLVGLIGLGR+YLG
Sbjct  136  NALEYGLPSSHTLNTVCLSGYLLHYFLSHTRNQDFSVELAGFAIACLLVGLIGLGRVYLG  195

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSL+DIIGG   GLAILAFWL+V
Sbjct  196  MHSLVDIIGGFFTGLAILAFWLTV  219



>ref|XP_011039508.1| PREDICTED: lipid phosphate phosphatase delta-like [Populus euphratica]
Length=407

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+ ISS  NVTQK+R+L QPWVS  V++GTPI LQIQKYQHG+LD  FSGLSC VSVPF
Sbjct  17   SWIFISSCLNVTQKLRTLVQPWVSHHVITGTPIILQIQKYQHGFLDALFSGLSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMAFCDY GNCIKDVVSAPRP+ PPV+R+TAT+DE++N
Sbjct  77   YTAFLPLLFWSGHGKLARQMTLLMAFCDYSGNCIKDVVSAPRPSCPPVKRMTATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNTICLSGYLLHYVLS+T+N+D S ++AG A++  +V L GLGRIYLGM
Sbjct  137  ALEYGLPSSHTLNTICLSGYLLHYVLSYTQNQDASLKLAGFAIVCFIVCLTGLGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS+IDII GLA G AIL FWLSV
Sbjct  197  HSVIDIIAGLAIGFAILVFWLSV  219



>emb|CBI29969.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
             SW+VISS  NVTQK+RS TQPWVSR V++GTP+ LQIQK+QHG+LD  FSGLSC VSVP
Sbjct  51   VSWIVISSTLNVTQKLRSFTQPWVSRHVLTGTPLILQIQKFQHGFLDALFSGLSCVVSVP  110

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFWSGH +LARQMTLLMAFCDY+GNCIKD VSAPRP+ PPVRR+TAT+DEKE
Sbjct  111  FYTAFLPLLFWSGHVRLARQMTLLMAFCDYLGNCIKDSVSAPRPSCPPVRRVTATKDEKE  170

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSHTLNT+CLSGYLLHYVLS+  N D    +AG++++ LLV LIG GRIYLG
Sbjct  171  NAMEYGLPSSHTLNTVCLSGYLLHYVLSYAHNRDAVMILAGVSMVCLLVALIGTGRIYLG  230

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSL+DIIGGLA GLAILAFWL++
Sbjct  231  MHSLVDIIGGLAIGLAILAFWLTM  254



>ref|XP_002531164.1| sphingosine-1-phosphate phosphohydrolase, putative [Ricinus communis]
 gb|EEF31207.1| sphingosine-1-phosphate phosphohydrolase, putative [Ricinus communis]
Length=406

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
             SW+VISS FNVT KIRS  QPWV+  V+SGTP+ ++IQKYQHG LD FFSGLSC VSVP
Sbjct  16   VSWIVISSCFNVTLKIRSFLQPWVTHHVISGTPLIIRIQKYQHGLLDAFFSGLSCVVSVP  75

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFWSGH KLARQMTLLMAFCDY GNCIKDVVSAPRP  P VRR+TAT+DE++
Sbjct  76   FYTAFLPLLFWSGHGKLARQMTLLMAFCDYTGNCIKDVVSAPRPNCPLVRRVTATKDEED  135

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NALEYG+PSSHTLNT+CLSGYLLHYVLS+T+N++ S E AG+A++ L VGLIG GR+YLG
Sbjct  136  NALEYGLPSSHTLNTVCLSGYLLHYVLSYTQNQNASVEFAGLAIVCLFVGLIGFGRVYLG  195

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHS+IDIIGGL  GLAILAFWL+V
Sbjct  196  MHSVIDIIGGLVIGLAILAFWLTV  219



>gb|EYU39977.1| hypothetical protein MIMGU_mgv1a007447mg [Erythranthe guttata]
Length=407

 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W++ISS FNVT+ +RSLTQPWVSR+V+SG PI L+IQKYQH YLD  FSGLSC VSVPFY
Sbjct  18   WILISSFFNVTRNLRSLTQPWVSRRVISGIPIILKIQKYQHRYLDALFSGLSCIVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFW+GH KLARQMTLLMAFCDY+GNCIKDVVSAPRP+SPPVRR+TAT+DE+ENA
Sbjct  78   TAFLPLLFWTGHCKLARQMTLLMAFCDYIGNCIKDVVSAPRPSSPPVRRVTATKDEEENA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            +EYG+PSSHTLNT+CLSGYLLHY+L++  + D  T+I G  ++ L+VGL G GRIYLGMH
Sbjct  138  MEYGLPSSHTLNTVCLSGYLLHYILAYNGSSDAFTQIFGFTMVCLVVGLTGFGRIYLGMH  197

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            SLIDII GLAFGL ILA WL V
Sbjct  198  SLIDIIAGLAFGLGILAIWLFV  219



>ref|XP_011047097.1| PREDICTED: lipid phosphate phosphatase delta isoform X2 [Populus 
euphratica]
Length=388

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+VISS  +VT+K+R+L QPWVS  V++GTPI LQIQKYQHG+LD  FSG SC VSVPFY
Sbjct  18   WIVISSSLDVTRKLRTLVQPWVSHHVITGTPIILQIQKYQHGFLDALFSGSSCVVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLM+ CDY GNCIKDVVSAPRP+ PPVRRITAT+DE+ENA
Sbjct  78   TAFLPLLFWSGHGKLARQMTLLMSLCDYSGNCIKDVVSAPRPSCPPVRRITATKDEQENA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLLHYVLS+T+NED S + AG A++ L+V L GLGRIYLGMH
Sbjct  138  LEYGLPSSHTLNTVCLSGYLLHYVLSYTQNEDASLKFAGYAIVCLIVCLAGLGRIYLGMH  197

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            S+IDII GLA G  ILAFWLSV
Sbjct  198  SVIDIIAGLAVGFVILAFWLSV  219



>ref|XP_011047096.1| PREDICTED: lipid phosphate phosphatase delta isoform X1 [Populus 
euphratica]
Length=407

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+VISS  +VT+K+R+L QPWVS  V++GTPI LQIQKYQHG+LD  FSG SC VSVPFY
Sbjct  18   WIVISSSLDVTRKLRTLVQPWVSHHVITGTPIILQIQKYQHGFLDALFSGSSCVVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLM+ CDY GNCIKDVVSAPRP+ PPVRRITAT+DE+ENA
Sbjct  78   TAFLPLLFWSGHGKLARQMTLLMSLCDYSGNCIKDVVSAPRPSCPPVRRITATKDEQENA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLLHYVLS+T+NED S + AG A++ L+V L GLGRIYLGMH
Sbjct  138  LEYGLPSSHTLNTVCLSGYLLHYVLSYTQNEDASLKFAGYAIVCLIVCLAGLGRIYLGMH  197

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            S+IDII GLA G  ILAFWLSV
Sbjct  198  SVIDIIAGLAVGFVILAFWLSV  219



>ref|XP_002308348.1| phosphatidic acid phosphatase family protein [Populus trichocarpa]
 gb|EEE91871.1| phosphatidic acid phosphatase family protein [Populus trichocarpa]
Length=407

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
             SW+V+SS  +VT+K+R+L QPWVS  V++GTPI LQIQKYQHG+LD  FSGLSC VSVP
Sbjct  16   VSWIVLSSSLDVTRKLRTLVQPWVSHHVITGTPIILQIQKYQHGFLDALFSGLSCVVSVP  75

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFWSGH KLARQMTLLM+ CDY GNCIKDVVSAPRP+ PPVRRITAT+DE+E
Sbjct  76   FYTAFLPLLFWSGHGKLARQMTLLMSLCDYSGNCIKDVVSAPRPSCPPVRRITATKDEQE  135

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NALEYG+PSSHTLNT+CLSGYLLHYVLS+T+NED S + AG A++ L+V L GLGRIYLG
Sbjct  136  NALEYGLPSSHTLNTVCLSGYLLHYVLSYTQNEDASLKFAGFAVVCLIVCLTGLGRIYLG  195

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHS IDII GLA G  IL+FWLSV
Sbjct  196  MHSGIDIIAGLAVGFVILSFWLSV  219



>ref|XP_008241159.1| PREDICTED: lipid phosphate phosphatase delta [Prunus mume]
Length=407

 Score =   293 bits (750),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W++++S  +VT+K+RS  QPWV++ V + TP+ LQIQ YQH +LD FFSGLSC VSVPFY
Sbjct  18   WIIVASYLDVTRKLRSFLQPWVAQHVTTDTPLILQIQNYQHRFLDAFFSGLSCVVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLMAFCDYMGNCIKDVVSAPRP+ PPVRRITAT+DE++NA
Sbjct  78   TAFLPLLFWSGHGKLARQMTLLMAFCDYMGNCIKDVVSAPRPSCPPVRRITATKDEEDNA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLLHY+LS+T+NED   + AG AL+ LLVGLIGLGRIYLGMH
Sbjct  138  LEYGLPSSHTLNTVCLSGYLLHYILSYTQNEDSHVKFAGFALVCLLVGLIGLGRIYLGMH  197

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            S++DIIGGLA GL IL FWLSV
Sbjct  198  SVVDIIGGLAIGLVILRFWLSV  219



>gb|EPS61952.1| phosphatidic acid phosphatase family protein, partial [Genlisea 
aurea]
Length=395

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            WV ISS FNVTQK+RS+TQPWV+R+V  GTPI L+IQKYQH YLD  FSGLSC VSVPFY
Sbjct  12   WVTISSSFNVTQKLRSVTQPWVTRRVAYGTPIILKIQKYQHPYLDALFSGLSCVVSVPFY  71

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFW+GH  LARQMTLLMAFCDY+GNCIKDV+SAPRP+SPPVRRITAT DE ENA
Sbjct  72   TAFLPLLFWTGHCALARQMTLLMAFCDYVGNCIKDVISAPRPSSPPVRRITATRDEVENA  131

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            +EYG+PSSHTLNT+CLSGYLLHY+L+ T     S ++ G++L+ LLV LIGLGRIYLGMH
Sbjct  132  MEYGLPSSHTLNTVCLSGYLLHYILAFTGANGASAQVVGLSLVCLLVFLIGLGRIYLGMH  191

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            SLIDII G+ FGL ILA WLSV
Sbjct  192  SLIDIISGVVFGLGILAIWLSV  213



>ref|XP_007202172.1| hypothetical protein PRUPE_ppa006528mg [Prunus persica]
 gb|EMJ03371.1| hypothetical protein PRUPE_ppa006528mg [Prunus persica]
Length=407

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W++++S  +VT+K+RS  QPWV++ V + TP+ LQIQ YQH +LD FF+GLSC VSVPFY
Sbjct  18   WIIVASYLDVTRKLRSFLQPWVAQHVTTDTPLILQIQNYQHRFLDAFFAGLSCVVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLMAFCDYMGNCIKDVVSAPRP+ PPVRRITAT+DE++NA
Sbjct  78   TAFLPLLFWSGHGKLARQMTLLMAFCDYMGNCIKDVVSAPRPSCPPVRRITATKDEEDNA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLLHY+LS+T+NED   + AG AL+ LLVGLIGLGRIYLGMH
Sbjct  138  LEYGLPSSHTLNTVCLSGYLLHYILSYTQNEDSHVKFAGFALVCLLVGLIGLGRIYLGMH  197

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            S++DIIGGLA GL IL FWLSV
Sbjct  198  SVVDIIGGLAIGLVILRFWLSV  219



>gb|KJB36159.1| hypothetical protein B456_006G144600 [Gossypium raimondii]
Length=273

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+VI+  F+VT+KIRSL QPWVS  VVSGT I L+IQK+QH +LD  FSGLSC VSVPF
Sbjct  16   SWIVITCYFDVTKKIRSLLQPWVSHHVVSGTSIILKIQKHQHKFLDALFSGLSCIVSVPF  75

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMA CDY+GNCIKDVVSAPRP  PPVRRITAT+DE+EN
Sbjct  76   YTAFLPLLFWSGHGKLARQMTLLMALCDYLGNCIKDVVSAPRPNCPPVRRITATKDEEEN  135

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CLSG+L+ YVLS+T++ED   ++  + L  LLVG IG GRIYLGM
Sbjct  136  ALEYGLPSSHTLNTVCLSGFLVCYVLSYTQSEDAFVKLGAVTLACLLVGFIGFGRIYLGM  195

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLIDIIGGL FG  ILA WLSV
Sbjct  196  HSLIDIIGGLVFGFMILAIWLSV  218



>gb|KDO70817.1| hypothetical protein CISIN_1g015391mg [Citrus sinensis]
Length=281

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW++ISS  NVTQK+RSL QPWV+  V+ GT   LQIQKYQH +LD  FSGLSC VSVPF
Sbjct  18   SWIMISSCLNVTQKLRSLLQPWVTHYVIIGTAFILQIQKYQHKFLDSLFSGLSCVVSVPF  77

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP +FWSGH KLAR MTLLMAFCDY+GN IKD VSAPRP+ PPVRR+TAT+DEKEN
Sbjct  78   YTGFLPLVFWSGHVKLARHMTLLMAFCDYLGNTIKDTVSAPRPSCPPVRRVTATKDEKEN  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CL+GYLLHYVLS+++N    T+ AG+AL+ LLVGLI +GRIYLGM
Sbjct  138  ALEYGLPSSHTLNTVCLAGYLLHYVLSYSQNNYAVTQFAGVALLCLLVGLIAVGRIYLGM  197

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSL+DII GLA GLA+LAFWL+V
Sbjct  198  HSLVDIIAGLALGLAVLAFWLTV  220



>ref|XP_010257589.1| PREDICTED: lipid phosphate phosphatase delta [Nelumbo nucifera]
Length=407

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            WV ISS FNVTQK+RSLTQPWV+  V++GTP+ LQ+Q +QH + D  FSGLSC VSVPFY
Sbjct  19   WVAISSFFNVTQKLRSLTQPWVTYHVLTGTPLILQVQNFQHSFFDALFSGLSCVVSVPFY  78

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLMAFCDY+GNCIKD+VSAPRP+ PPVRR+TAT+DEKENA
Sbjct  79   TAFLPLLFWSGHCKLARQMTLLMAFCDYIGNCIKDLVSAPRPSCPPVRRLTATKDEKENA  138

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            +EYG+PSSHTLNT+CLSGYLLHY+L +++N D +  +A +    LLVGLIGLGRIYLGMH
Sbjct  139  MEYGLPSSHTLNTVCLSGYLLHYILHYSQNRDGAVVLAALITAYLLVGLIGLGRIYLGMH  198

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            S++D+I GL  GL+ILAFW+ V
Sbjct  199  SVVDVIAGLVIGLSILAFWIMV  220



>gb|KJB36156.1| hypothetical protein B456_006G144600 [Gossypium raimondii]
 gb|KJB36158.1| hypothetical protein B456_006G144600 [Gossypium raimondii]
Length=406

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+VI+  F+VT+KIRSL QPWVS  VVSGT I L+IQK+QH +LD  FSGLSC VSVPF
Sbjct  16   SWIVITCYFDVTKKIRSLLQPWVSHHVVSGTSIILKIQKHQHKFLDALFSGLSCIVSVPF  75

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMA CDY+GNCIKDVVSAPRP  PPVRRITAT+DE+EN
Sbjct  76   YTAFLPLLFWSGHGKLARQMTLLMALCDYLGNCIKDVVSAPRPNCPPVRRITATKDEEEN  135

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CLSG+L+ YVLS+T++ED   ++  + L  LLVG IG GRIYLGM
Sbjct  136  ALEYGLPSSHTLNTVCLSGFLVCYVLSYTQSEDAFVKLGAVTLACLLVGFIGFGRIYLGM  195

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLIDIIGGL FG  ILA WLSV
Sbjct  196  HSLIDIIGGLVFGFMILAIWLSV  218



>ref|XP_010101090.1| Dihydrosphingosine 1-phosphate phosphatase [Morus notabilis]
 gb|EXB86902.1| Dihydrosphingosine 1-phosphate phosphatase [Morus notabilis]
Length=410

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 177/203 (87%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SWVV+SS FNVTQK+RSL Q WVS  VV+GTP+ +QIQKY +G+LD  FSGLSC VSVPF
Sbjct  17   SWVVVSSFFNVTQKLRSLLQSWVSHHVVTGTPLIIQIQKYHNGFLDSLFSGLSCIVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFW+GH KLARQMTLLMAFCDY+GNCIKDVVSAPRP+SPP+RRITAT+DE++N
Sbjct  77   YTAFLPLLFWTGHGKLARQMTLLMAFCDYLGNCIKDVVSAPRPSSPPIRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSG+LL+YVLS+T+ E      AG+ L+SLLV LIG GRIYLGM
Sbjct  137  AMEYGLPSSHTLNTVCLSGFLLYYVLSYTQLESAFLNFAGVLLVSLLVSLIGFGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLID+I GLA GL ILAFWL V
Sbjct  197  HSLIDVISGLAMGLVILAFWLIV  219



>ref|XP_004303367.1| PREDICTED: lipid phosphate phosphatase delta [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W++++S  N+T K+RSL QPWV+  V++GTP+ LQIQ YQH +LD FFS LSC VSVPF
Sbjct  17   TWILMASYLNLTPKLRSLLQPWVAHHVITGTPLILQIQNYQHRFLDAFFSALSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMAFCDY+GNCIKDVVSAPRP+ PPVRRITAT DE++N
Sbjct  77   YTAFLPLLFWSGHGKLARQMTLLMAFCDYLGNCIKDVVSAPRPSCPPVRRITATRDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CLSGYLLHY+LS+ +NED   +  G+AL+ LLV LIGLGRIYLGM
Sbjct  137  ALEYGLPSSHTLNTVCLSGYLLHYILSYAQNEDAYLKFGGLALVCLLVSLIGLGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS +DIIGGLA GL IL+FWL+V
Sbjct  197  HSPVDIIGGLAVGLLILSFWLTV  219



>ref|XP_006429943.1| hypothetical protein CICLE_v10011869mg [Citrus clementina]
 gb|ESR43183.1| hypothetical protein CICLE_v10011869mg [Citrus clementina]
Length=408

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW++ISS  NVTQK+RSL QPWV+  V+ GTP  LQIQKYQH +LD  FSGLSC VSVPF
Sbjct  18   SWIMISSCLNVTQKLRSLLQPWVTHYVIIGTPFILQIQKYQHKFLDSLFSGLSCVVSVPF  77

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP +FWSGH KLAR MTLLMAFCDY+GN IKD VSAPRP+ PPVRR+TAT+DEKEN
Sbjct  78   YTGFLPVVFWSGHVKLARHMTLLMAFCDYLGNTIKDTVSAPRPSCPPVRRVTATKDEKEN  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CL+GYLLHYVLS+++N    T+ AG+AL+ LLVGLI +GRIYLGM
Sbjct  138  ALEYGLPSSHTLNTVCLAGYLLHYVLSYSQNNYAVTQFAGVALLCLLVGLIAVGRIYLGM  197

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSL+DII GLA GLA+LAFWL+V
Sbjct  198  HSLVDIIAGLALGLAVLAFWLTV  220



>gb|KHG30564.1| hypothetical protein F383_14690 [Gossypium arboreum]
Length=394

 Score =   285 bits (730),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+VI+  F+VT+KIRSL QPWVS  VVSGT I L+IQK+QH +LD  FSGLSC VSVPF
Sbjct  16   SWIVITCYFDVTKKIRSLLQPWVSHHVVSGTSIILKIQKHQHKFLDALFSGLSCIVSVPF  75

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMA CDY+GNCIKDVVSAPRP  PPVRRITAT+DE+EN
Sbjct  76   YTAFLPLLFWSGHGKLARQMTLLMALCDYLGNCIKDVVSAPRPNCPPVRRITATKDEEEN  135

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CLSG+L+ YVLS+T+ ED   ++  + L  LLVG IG GRIYLGM
Sbjct  136  ALEYGLPSSHTLNTVCLSGFLVCYVLSYTQCEDAFVKLGAVTLACLLVGFIGFGRIYLGM  195

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLIDIIGGL FG  ILA WL+V
Sbjct  196  HSLIDIIGGLVFGFMILAIWLTV  218



>gb|KDO70814.1| hypothetical protein CISIN_1g015391mg [Citrus sinensis]
Length=408

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW++ISS  NVTQK+RSL QPWV+  V+ GT   LQIQKYQH +LD  FSGLSC VSVPF
Sbjct  18   SWIMISSCLNVTQKLRSLLQPWVTHYVIIGTAFILQIQKYQHKFLDSLFSGLSCVVSVPF  77

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP +FWSGH KLAR MTLLMAFCDY+GN IKD VSAPRP+ PPVRR+TAT+DEKEN
Sbjct  78   YTGFLPLVFWSGHVKLARHMTLLMAFCDYLGNTIKDTVSAPRPSCPPVRRVTATKDEKEN  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CL+GYLLHYVLS+++N    T+ AG+AL+ LLVGLI +GRIYLGM
Sbjct  138  ALEYGLPSSHTLNTVCLAGYLLHYVLSYSQNNYAVTQFAGVALLCLLVGLIAVGRIYLGM  197

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSL+DII GLA GLA+LAFWL+V
Sbjct  198  HSLVDIIAGLALGLAVLAFWLTV  220



>ref|XP_006481548.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11-like 
[Citrus sinensis]
Length=408

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW++ISS  NVTQK+RSL QPWV+  V+ GT   LQIQKYQH +LD  FSGLSC VSVPF
Sbjct  18   SWIMISSCLNVTQKLRSLLQPWVTHYVIIGTAFILQIQKYQHKFLDSLFSGLSCVVSVPF  77

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP +FWSGH KLAR MTLLMAFCDY+GN IKD VSAPRP+ PPVRR+TAT+DEKEN
Sbjct  78   YTGFLPLVFWSGHVKLARHMTLLMAFCDYLGNTIKDTVSAPRPSCPPVRRVTATKDEKEN  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CL+GYLLHYVLS+++N    T+ AG+AL  LLVGLI +GRIYLGM
Sbjct  138  ALEYGLPSSHTLNTVCLAGYLLHYVLSYSQNNYAVTQFAGVALFCLLVGLIAVGRIYLGM  197

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSL+DII GLA GLA+LAFWL+V
Sbjct  198  HSLVDIIAGLALGLAVLAFWLTV  220



>ref|XP_007029091.1| Phosphatidic acid phosphatase (PAP2) family protein [Theobroma 
cacao]
 gb|EOY09593.1| Phosphatidic acid phosphatase (PAP2) family protein [Theobroma 
cacao]
Length=407

 Score =   283 bits (725),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+VIS+ FNVT+KIRSL QP V+ +VV+GT I L+IQK+QH   DG FS LS  VSVPF
Sbjct  17   SWIVISTYFNVTKKIRSLLQPRVAHRVVTGTSIILKIQKHQHKLWDGLFSVLSSIVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMAFCDYMGNCIKDVVSAPRP+ PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWSGHGKLARQMTLLMAFCDYMGNCIKDVVSAPRPSCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CLSGYLL+YVLS  ++ D   E+A +A   LLVGLIG+GRIYLGM
Sbjct  137  ALEYGLPSSHTLNTVCLSGYLLYYVLSSAQSRDACVELAAVAFAGLLVGLIGVGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLIDIIGGLA GL ILAFWL+V
Sbjct  197  HSLIDIIGGLAVGLVILAFWLTV  219



>emb|CDX67745.1| BnaA07g17850D [Brassica napus]
Length=411

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+ +SS   +TQK+RSL QPWV+RQVV G P+ LQIQK+Q G LD FFSGLSC VSVPF
Sbjct  17   TWICLSSYLKLTQKVRSLVQPWVARQVVGGVPLILQIQKHQSGVLDAFFSGLSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLL+AFCDY+GNCIKDVVSAPRP+ PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWSGHGRLARQMTLLIAFCDYLGNCIKDVVSAPRPSCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYVLS  ++ED + +  G AL  LLV LI LGRIYLGM
Sbjct  137  AMEYGLPSSHTLNTVCLSGYLLHYVLSSFEHEDAAIQYYGFALACLLVALIALGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS++DII GLA G+  L  WL+V
Sbjct  197  HSVVDIIAGLAIGVLTLGLWLTV  219



>ref|XP_006402782.1| hypothetical protein EUTSA_v10006516mg [Eutrema salsugineum]
 gb|ESQ44235.1| hypothetical protein EUTSA_v10006516mg [Eutrema salsugineum]
Length=411

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A+W+ +SS   +T K RSL QPWV+RQVV G P+ L+IQK+Q+G LD FFSGLSC VSVP
Sbjct  16   ATWICLSSYLKLTHKFRSLLQPWVARQVVGGVPLILEIQKHQNGLLDAFFSGLSCVVSVP  75

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFWSGH +LARQMTLL+AFCDY+GNCIKDVVSAPRP+ PPVRRITAT+DE++
Sbjct  76   FYTAFLPLLFWSGHGRLARQMTLLIAFCDYLGNCIKDVVSAPRPSCPPVRRITATKDEED  135

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSHTLNT+CLSGYLLHYVLS  ++E+ S +  G AL  LLV LI LGRIYLG
Sbjct  136  NAMEYGLPSSHTLNTVCLSGYLLHYVLSSYEHENASIQYYGFALACLLVALIALGRIYLG  195

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHS++DII GLA G+ IL  WL+V
Sbjct  196  MHSVVDIISGLAIGVLILGLWLTV  219



>ref|XP_010036523.1| PREDICTED: lipid phosphate phosphatase delta isoform X1 [Eucalyptus 
grandis]
 gb|KCW48138.1| hypothetical protein EUGRSUZ_K01870 [Eucalyptus grandis]
Length=407

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+++SS  NVT  +RSL QPWV+  V  G P+ LQIQ+++H  LD  FSGLSC VSVPFY
Sbjct  18   WILVSSYCNVTPALRSLLQPWVAHHVDVGVPLILQIQRFRHRALDALFSGLSCVVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLMAFCDYMGNC+KDVVSAPRP+ PPVRR+TAT+DE+ENA
Sbjct  78   TAFLPVLFWSGHGKLARQMTLLMAFCDYMGNCVKDVVSAPRPSCPPVRRVTATKDEEENA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            +EYG+PSSHTLNT+CLSGYLLHYVLS+ ++ D     AG A++ LLVGL+GLGRIYLGMH
Sbjct  138  MEYGLPSSHTLNTVCLSGYLLHYVLSYIQSRDALIAFAGFAVVCLLVGLVGLGRIYLGMH  197

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            SLIDIIGGL  GL ILAFWL+V
Sbjct  198  SLIDIIGGLIMGLVILAFWLTV  219



>ref|XP_009104145.1| PREDICTED: lipid phosphate phosphatase delta [Brassica rapa]
Length=411

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+ +SS   +TQK+RSL QPWV+RQVV G P+ LQIQK+Q G LD FFSGLSC VSVPF
Sbjct  17   TWICLSSYLKLTQKVRSLVQPWVARQVVGGVPLILQIQKHQSGVLDAFFSGLSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLL+AFCDY+GNCIKD+VSAPRP+ PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWSGHGRLARQMTLLIAFCDYLGNCIKDIVSAPRPSCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYVLS  + E+   +  G AL  LLV LI  GRIYLGM
Sbjct  137  AMEYGLPSSHTLNTVCLSGYLLHYVLSSFEQEESCIQYYGFALACLLVSLIAFGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS++DII GLA G+  L  WL+V
Sbjct  197  HSVVDIIAGLAIGVLTLGLWLTV  219



>emb|CDX98299.1| BnaC06g16600D [Brassica napus]
Length=411

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+ +SS   +TQK+RSL QPWV+RQVV G P+ L+IQK+Q G LD  FSGLSC VSVPF
Sbjct  17   TWICLSSYLRLTQKVRSLVQPWVARQVVGGVPLILEIQKHQSGVLDALFSGLSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLL+AFCDY+GNCIKDVVSAPRP+ PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWSGHGRLARQMTLLIAFCDYLGNCIKDVVSAPRPSCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYVLS  ++E+ S +  G A   LLV LI  GRIYLGM
Sbjct  137  AMEYGLPSSHTLNTVCLSGYLLHYVLSSFEHEESSIQYYGFAFACLLVALIAFGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS++DII GLA G+  L  WL+V
Sbjct  197  HSVVDIIAGLAIGVLTLGLWLTV  219



>ref|XP_010516498.1| PREDICTED: lipid phosphate phosphatase delta-like isoform X1 
[Camelina sativa]
 ref|XP_010516499.1| PREDICTED: lipid phosphate phosphatase delta-like isoform X1 
[Camelina sativa]
Length=417

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+ +SS  N T KIRSL QPWVSRQV+ G P+ L+IQK Q+G LD FFS LSC VSVPF
Sbjct  23   TWICVSSYLNFTHKIRSLIQPWVSRQVLGGVPLILRIQKCQNGVLDAFFSALSCVVSVPF  82

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLL+AFCDY+GNCIKDV+SAPRP+ PPVRRITAT+DE++N
Sbjct  83   YTAFLPLLFWSGHGRLARQMTLLIAFCDYLGNCIKDVISAPRPSCPPVRRITATKDEEDN  142

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYV S    E++S +  G AL  LLV L+  GRIYLGM
Sbjct  143  AMEYGLPSSHTLNTVCLSGYLLHYVSSSVGYENVSIQYYGFALACLLVALVAFGRIYLGM  202

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS++DI+GGLA G+ IL  WL+V
Sbjct  203  HSVVDIVGGLAIGVLILGLWLTV  225



>ref|XP_008350252.1| PREDICTED: LOW QUALITY PROTEIN: lipid phosphate phosphatase delta-like 
[Malus domestica]
Length=402

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW++++S  +VT+K+RS  QPWV+  V +GTP+ LQIQ YQH  LD FFS LSC VSVPF
Sbjct  17   SWMIVASYLDVTRKLRSFLQPWVAHHVTAGTPLILQIQNYQHRSLDSFFSALSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFW+GH KLARQMTLLMAFCDY GNCIKDVVSAPRP  PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWTGHGKLARQMTLLMAFCDYTGNCIKDVVSAPRPCCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSH LNT+CLSG+LLHY+LS+++NED   +IAG AL+ LLVG IGLGRIYLGM
Sbjct  137  ALEYGLPSSHALNTVCLSGFLLHYILSYSQNEDARVKIAGFALVCLLVGFIGLGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS ID+I GLA GL IL  WLSV
Sbjct  197  HSPIDVISGLAIGLVILWLWLSV  219



>ref|XP_008387206.1| PREDICTED: lipid phosphate phosphatase delta-like [Malus domestica]
Length=407

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW++++S  +VT+K+RS  QPWV+  V +GTP+ LQIQ YQH  LD FFS LSC VSVPF
Sbjct  17   SWMIVASYLDVTRKLRSFLQPWVAHHVTAGTPLILQIQNYQHRSLDSFFSALSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFW+GH KLARQMTLLMAFCDY GNCIKDVVSAPRP  PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWTGHGKLARQMTLLMAFCDYTGNCIKDVVSAPRPCCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSH LNT+CLSG+LLHY+LS+++NED   +IAG AL+ LLVG IGLGRIYLGM
Sbjct  137  ALEYGLPSSHALNTVCLSGFLLHYILSYSQNEDARVKIAGFALVCLLVGFIGLGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS ID+I GLA GL IL  WLSV
Sbjct  197  HSPIDVISGLAIGLVILWLWLSV  219



>ref|XP_010427754.1| PREDICTED: lipid phosphate phosphatase delta-like isoform X1 
[Camelina sativa]
Length=415

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+ +SS  N T KIRSL QPWVSRQV+ G P+ L+IQK Q+G LD FFS LSC VSVPF
Sbjct  21   TWICVSSHLNFTHKIRSLIQPWVSRQVLGGVPLILRIQKCQNGVLDAFFSALSCVVSVPF  80

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLL+AFCDY+GNCIKDV+SAPRP+ PPVRRITAT+DE++N
Sbjct  81   YTAFLPLLFWSGHGRLARQMTLLIAFCDYLGNCIKDVISAPRPSCPPVRRITATKDEEDN  140

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYV S    E++S +  G +L  LLV LI  GRIYLGM
Sbjct  141  AMEYGLPSSHTLNTVCLSGYLLHYVSSSVGFENVSIQYYGFSLACLLVALIAFGRIYLGM  200

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS++DI+GGLA G+ IL+ WL+V
Sbjct  201  HSVVDIVGGLAIGVLILSLWLTV  223



>gb|KFK35109.1| hypothetical protein AALP_AA5G237200 [Arabis alpina]
Length=411

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+ +SS   +T ++RSL QPWVSRQVV G P  L IQK+Q+G LD  FSGLSC VSVPF
Sbjct  17   TWICVSSYLKLTHRVRSLVQPWVSRQVVGGVPFILNIQKHQNGVLDALFSGLSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLL+AFCDY+GNCIKDVVSAPRP+ PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWSGHGRLARQMTLLIAFCDYLGNCIKDVVSAPRPSCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYVLS  ++E  S +  GIAL  LLV LI  GRIYLGM
Sbjct  137  AMEYGLPSSHTLNTVCLSGYLLHYVLSSFEHEKASIQYYGIALACLLVALIAFGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS++DII G A G+ IL  WL+V
Sbjct  197  HSVVDIIAGFAIGVLILGLWLTV  219



>gb|KEH24326.1| phosphatidic acid phosphatase (PAP2) family protein [Medicago 
truncatula]
Length=287

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W++ SS  N+T K+RS  QP+V+  V SGTPI LQIQ Y+ GYLD  FSGLSC VSVPFY
Sbjct  18   WLLSSSYLNLTLKLRSFLQPFVTHYVQSGTPILLQIQSYRAGYLDAIFSGLSCVVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAF+P LFWSGH +LARQMTLLMAFCDY+GNCIKDVVSAPRP SPPVRR+TAT+DE+ENA
Sbjct  78   TAFIPMLFWSGHGQLARQMTLLMAFCDYIGNCIKDVVSAPRPASPPVRRVTATKDEEENA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLLHYVL+HT+ +       G++L  L V L+GLGRIYLGMH
Sbjct  138  LEYGLPSSHTLNTVCLSGYLLHYVLTHTQIQGAYITYFGVSLACLFVALVGLGRIYLGMH  197

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            SLID++ GL  GL IL  WL+V
Sbjct  198  SLIDVVAGLFIGLGILGLWLTV  219



>ref|XP_010504804.1| PREDICTED: lipid phosphate phosphatase delta isoform X1 [Camelina 
sativa]
Length=415

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+ +SS  N T KIRSL QPWV RQV+ G P+ L+IQK Q+G LD FFS LSC VSVPF
Sbjct  21   TWICVSSYLNFTHKIRSLIQPWVGRQVLGGVPLILRIQKCQNGVLDAFFSALSCVVSVPF  80

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLL+AFCDY+GNCIKDV+SAPRP+ PPVRRITAT+DE++N
Sbjct  81   YTAFLPLLFWSGHGRLARQMTLLIAFCDYLGNCIKDVISAPRPSCPPVRRITATKDEEDN  140

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYV S    E++S +  G AL  LLV LI  GRIYLGM
Sbjct  141  AMEYGLPSSHTLNTVCLSGYLLHYVSSSVGYENVSIQYYGFALACLLVALIAFGRIYLGM  200

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS++DI+GGLA G+ IL  WL++
Sbjct  201  HSVVDIVGGLAIGVLILGLWLTI  223



>ref|XP_006604689.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11-like 
[Glycine max]
Length=406

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+V +S  NVT+K+RS  QPWV+  VV+ TPI L+IQ Y  G+LD  FSGLSC VSVPFY
Sbjct  20   WLVSASYLNVTRKLRSFLQPWVTHHVVTQTPIILKIQSYGFGFLDALFSGLSCVVSVPFY  79

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLMAFCDY+GNCIKDVVSAPRP SPPV+R+TAT DE++NA
Sbjct  80   TAFLPLLFWSGHGKLARQMTLLMAFCDYLGNCIKDVVSAPRPASPPVKRVTATRDEEDNA  139

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLLHYVL+HT+ +       G++L  +LV  IGLGRIYLGMH
Sbjct  140  LEYGLPSSHTLNTVCLSGYLLHYVLTHTQIQGAYVTYLGVSLACMLVFFIGLGRIYLGMH  199

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            S++D++ GL  GL +LAFWL+V
Sbjct  200  SVVDVLAGLLIGLVVLAFWLTV  221



>ref|NP_191408.1| sphingoid phosphate phosphatase 1 [Arabidopsis thaliana]
 sp|Q9M2G7.1|LPPD_ARATH RecName: Full=Lipid phosphate phosphatase delta; Short=AtLPPD; 
AltName: Full=Phosphatidic acid phosphatase delta; AltName: 
Full=Sphingoid phosphate phosphatase 1; Short=AtSSP1; AltName: 
Full=Sphingosine-1-phosphate phosphatase; Short=AtSPPASE 
[Arabidopsis thaliana]
 emb|CAB68187.1| putative protein [Arabidopsis thaliana]
 dbj|BAE46997.1| sphingosine-1-phosphate phosphatase [Arabidopsis thaliana]
 gb|AEE79788.1| sphingoid phosphate phosphatase 1 [Arabidopsis thaliana]
Length=416

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+  SS    T K RSL QPWV+RQVV G P+ L+IQK Q+G LD FFSGLSC VSVPF
Sbjct  25   TWICASSYLKFTHKFRSLLQPWVARQVVGGVPLILRIQKCQNGVLDAFFSGLSCVVSVPF  84

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLL+AFCDY+GNCIKDVVSAPRP+ PPVRRITAT+DE++N
Sbjct  85   YTAFLPLLFWSGHGRLARQMTLLIAFCDYLGNCIKDVVSAPRPSCPPVRRITATKDEEDN  144

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYVLS  + E +S +  G AL  LLV LI  GR+YLGM
Sbjct  145  AMEYGLPSSHTLNTVCLSGYLLHYVLSSLEYESVSIQYYGFALACLLVALIAFGRVYLGM  204

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS++DI+ GLA G+ IL  WL+V
Sbjct  205  HSVVDIVSGLAIGVLILGLWLTV  227



>ref|XP_010693832.1| PREDICTED: lipid phosphate phosphatase delta [Beta vulgaris subsp. 
vulgaris]
Length=402

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+V+SSI +VT+KIR L QPWV   V +G P+ LQIQK QH  LD  FSG+SC VSVPF
Sbjct  18   AWIVMSSILDVTRKIRFLIQPWVIHHVKTGIPLILQIQKSQHKVLDALFSGVSCIVSVPF  77

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP LFWSGH KLARQMTLLMAFCDY+GNCIKDV+SAPRP+ PPVRR+TAT+DE+EN
Sbjct  78   YTGFLPLLFWSGHGKLARQMTLLMAFCDYIGNCIKDVISAPRPSCPPVRRLTATKDEEEN  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A EYG+PSSHTLNT+CLSGYLL Y+LS+    D      G A+I LL+GLI LGRIYLGM
Sbjct  138  AQEYGLPSSHTLNTVCLSGYLLSYILSYNPRSDGPEVFVGFAMICLLIGLIALGRIYLGM  197

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLIDIIGGLA GL ILAFWL+V
Sbjct  198  HSLIDIIGGLALGLIILAFWLTV  220



>ref|XP_008359537.1| PREDICTED: lipid phosphate phosphatase delta-like [Malus domestica]
Length=407

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW++++S  +VT+ +RS  QPWV+  V +GTP+ LQIQ YQH  LD FFS LSC VSVPF
Sbjct  17   SWMIVASYLDVTRXLRSFLQPWVAHHVTAGTPLILQIQNYQHRSLDSFFSALSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFW+GH KLARQMTLLMAFCDY GNCIKDVVSAPRP  PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWTGHGKLARQMTLLMAFCDYTGNCIKDVVSAPRPCCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSH LNT+CLSG+LLHY+LS+++NED   +IAG AL+ LLVG IGLGRIYLGM
Sbjct  137  ALEYGLPSSHALNTVCLSGFLLHYILSYSQNEDARVKIAGFALVCLLVGFIGLGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS ID+I GLA GL IL  WLSV
Sbjct  197  HSPIDVISGLAIGLVILWLWLSV  219



>ref|XP_002876465.1| phosphatidic acid phosphatase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52724.1| phosphatidic acid phosphatase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=411

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+  SS    T K RSL QPWV+RQVV G P+ L+IQK Q+G LD FFSGLSC VSVPF
Sbjct  17   TWICASSYLKFTHKFRSLLQPWVTRQVVGGVPLILRIQKCQNGVLDAFFSGLSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLL+AFCDY+GNCIKDVVSAPRP+ PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWSGHGRLARQMTLLIAFCDYLGNCIKDVVSAPRPSCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYVLS  ++E +S +  G AL  LLV LI  GRIYLGM
Sbjct  137  AMEYGLPSSHTLNTVCLSGYLLHYVLSSLEHETVSIQYYGFALACLLVVLIAFGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS++DII GLA G+ IL  WL V
Sbjct  197  HSVVDIISGLAIGVLILGLWLIV  219



>gb|KHN43572.1| Dihydrosphingosine 1-phosphate phosphatase [Glycine soja]
Length=436

 Score =   273 bits (699),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+V +S  NVT+K+RS  QPWV+  VV+ TPI L+IQ Y  G+LD  FSGLSC VSVPFY
Sbjct  20   WLVSASYLNVTRKLRSFLQPWVTHHVVTQTPIILKIQSYGFGFLDALFSGLSCVVSVPFY  79

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLMAFCDY+GNCIKDVVSAPRP SPPV+R+TAT DE++NA
Sbjct  80   TAFLPLLFWSGHGKLARQMTLLMAFCDYLGNCIKDVVSAPRPASPPVKRVTATRDEEDNA  139

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLLHYVL+HT+ +       G++L  +LV  IGLGRIYLGMH
Sbjct  140  LEYGLPSSHTLNTVCLSGYLLHYVLTHTQIQGAYVTYLGVSLACMLVFFIGLGRIYLGMH  199

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            S++D++ GL  GL +LAFWL+V
Sbjct  200  SVVDVLAGLLIGLVVLAFWLTV  221



>ref|XP_010524833.1| PREDICTED: lipid phosphate phosphatase delta [Tarenaya hassleriana]
Length=408

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+ +SS   +TQK RSL QPWV+RQVV G P  ++IQK+Q+  LD FFSGLSC VSVPF
Sbjct  17   SWIWVSSYLRLTQKFRSLLQPWVTRQVVDGAPFIIKIQKHQNSVLDAFFSGLSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQ+TLL+AFCDY+GN +KDVVSAPRP+ PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWSGHGRLARQVTLLIAFCDYLGNSLKDVVSAPRPSCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLLHYVLS   NE  S    GIAL SLLVGLI  GRIYLGM
Sbjct  137  AMEYGLPSSHTLNTVCLSGYLLHYVLSTLDNESTSILYCGIALASLLVGLIAFGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS+IDII GLA GL IL+FWL+V
Sbjct  197  HSVIDIISGLAMGLVILSFWLTV  219



>ref|XP_003638097.1| Sphingosine-1-phosphate phosphatase [Medicago truncatula]
 gb|AFK42029.1| unknown [Medicago truncatula]
 gb|KEH24325.1| phosphatidic acid phosphatase (PAP2) family protein [Medicago 
truncatula]
Length=389

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W++ SS  N+T K+RS  QP+V+  V SGTPI LQIQ Y+ GYLD  FSGLSC VSVPFY
Sbjct  18   WLLSSSYLNLTLKLRSFLQPFVTHYVQSGTPILLQIQSYRAGYLDAIFSGLSCVVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAF+P LFWSGH +LARQMTLLMAFCDY+GNCIKDVVSAPRP SPPVRR+TAT+DE+ENA
Sbjct  78   TAFIPMLFWSGHGQLARQMTLLMAFCDYIGNCIKDVVSAPRPASPPVRRVTATKDEEENA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLLHYVL+HT+ +       G++L  L V L+GLGRIYLGMH
Sbjct  138  LEYGLPSSHTLNTVCLSGYLLHYVLTHTQIQGAYITYFGVSLACLFVALVGLGRIYLGMH  197

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            SLID++ GL  GL IL  WL+V
Sbjct  198  SLIDVVAGLFIGLGILGLWLTV  219



>ref|XP_009389049.1| PREDICTED: lipid phosphate phosphatase delta-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389050.1| PREDICTED: lipid phosphate phosphatase delta-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389051.1| PREDICTED: lipid phosphate phosphatase delta-like [Musa acuminata 
subsp. malaccensis]
Length=407

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
             WVV SS+F++T+++R+LTQPWV+R+V++ TP  L++Q++ HG+LD  FS LSC VSVPF
Sbjct  18   GWVVASSLFDLTRRVRALTQPWVTRRVLADTPSILRVQRFHHGFLDNMFSVLSCGVSVPF  77

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP LFWSGHSKLARQMTLLMAFCDY+GN IKDVVSAPRP+ PPVRR+TATEDEKEN
Sbjct  78   YTGFLPILFWSGHSKLARQMTLLMAFCDYIGNSIKDVVSAPRPSCPPVRRVTATEDEKEN  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSH LNT+CL GY+LHYVL+H    D         L+ L V LIG+GR+YLGM
Sbjct  138  AMEYGLPSSHCLNTVCLLGYMLHYVLAHYPQRDGIDIAIWFGLVFLFVMLIGVGRVYLGM  197

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLID++ G++FGL I AFWL V
Sbjct  198  HSLIDVVAGISFGLVIFAFWLMV  220



>ref|XP_008442198.1| PREDICTED: lipid phosphate phosphatase delta [Cucumis melo]
Length=405

 Score =   270 bits (690),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+ ++S  N+T K+RS  QPWV+R VV+G P+ L+IQKYQ+ + D  FSGLSC VSVPF
Sbjct  17   SWIGLASYINITHKLRSSLQPWVTRHVVTGAPLILRIQKYQNSFFDALFSGLSCIVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMAFCDY+GN IKDV+SAPRP+ PPVRRITAT+DE+EN
Sbjct  77   YTAFLPLLFWSGHGKLARQMTLLMAFCDYLGNSIKDVISAPRPSCPPVRRITATKDEEEN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CLSGYLL+Y+LS+T+N   S   AG AL+ LLVGLIGLGRIYLGM
Sbjct  137  ALEYGLPSSHTLNTVCLSGYLLYYILSYTENIHASYTFAGFALVCLLVGLIGLGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS IDII GL FGL IL FW +V
Sbjct  197  HSPIDIISGLVFGLMILLFWSNV  219



>ref|XP_011075072.1| PREDICTED: lipid phosphate phosphatase delta-like [Sesamum indicum]
Length=403

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A W++ISS FN+TQK+RSLTQPWVS  V+SGTPI L+IQKYQH +LD FFS LSC VSVP
Sbjct  12   AFWILISSKFNLTQKLRSLTQPWVSHSVISGTPIILKIQKYQHRHLDAFFSLLSCVVSVP  71

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFW+GH KLARQMTLLMAFCDY GNCIKDVVSAPRP  PPVRR+TAT+DE++
Sbjct  72   FYTAFLPLLFWTGHCKLARQMTLLMAFCDYTGNCIKDVVSAPRPCCPPVRRVTATKDEED  131

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSHTLNT+CLSGYLLHY+L++T N D   +I GI  +SL+VGLIGLGRIYLG
Sbjct  132  NAMEYGLPSSHTLNTVCLSGYLLHYILAYTGNHDAFAQIIGITTVSLVVGLIGLGRIYLG  191

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSLIDIIGGLA GL IL  WL V
Sbjct  192  MHSLIDIIGGLALGLGILTIWLYV  215



>ref|XP_007163033.1| hypothetical protein PHAVU_001G200400g [Phaseolus vulgaris]
 gb|ESW35027.1| hypothetical protein PHAVU_001G200400g [Phaseolus vulgaris]
Length=406

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+V +S  +VT+K+RS  QPWVS  V + TP+ L+IQ Y  G+LD  FSGLSC VSVPFY
Sbjct  20   WLVSASYLDVTRKLRSFFQPWVSHHVDTQTPVILKIQSYGFGFLDALFSGLSCVVSVPFY  79

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            T FLP LFWSGH KLARQMTLLMAFCDY+GNCIKDVVSAPRP SPPV+RITAT+DE+ENA
Sbjct  80   TGFLPLLFWSGHGKLARQMTLLMAFCDYLGNCIKDVVSAPRPASPPVKRITATKDEEENA  139

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLLHYVL+HT+ +       G++L  +LV LIGLGRIYLGMH
Sbjct  140  LEYGLPSSHTLNTVCLSGYLLHYVLTHTQIQGAYVTYLGVSLAFMLVLLIGLGRIYLGMH  199

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            S++D++ GL  G  +LAFWL+V
Sbjct  200  SVVDVLAGLLIGFVVLAFWLTV  221



>ref|XP_006291211.1| hypothetical protein CARUB_v10017341mg [Capsella rubella]
 gb|EOA24109.1| hypothetical protein CARUB_v10017341mg [Capsella rubella]
Length=415

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W+ +SS  N T K+RSL QPWV+R V+ G P+ L IQK Q+G LD FFS LSC VSVPF
Sbjct  21   TWICVSSYLNFTYKLRSLLQPWVARHVLGGVPLILSIQKCQNGVLDAFFSALSCVVSVPF  80

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH +LARQMTLL+AFCDY GNCIKDV+SAPRP+ PPVRRITAT+DE++N
Sbjct  81   YTAFLPLLFWSGHGRLARQMTLLIAFCDYFGNCIKDVISAPRPSCPPVRRITATKDEQDN  140

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLL+YV S    E++S +  G AL  LLV LI  GRIYLGM
Sbjct  141  AMEYGLPSSHTLNTVCLSGYLLYYVSSSVGFENVSIQYYGFALACLLVALIAFGRIYLGM  200

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS++DI+GGLA G+ IL  WLSV
Sbjct  201  HSVVDIVGGLAIGVLILGLWLSV  223



>ref|XP_004144672.1| PREDICTED: lipid phosphate phosphatase delta [Cucumis sativus]
 gb|KGN54853.1| hypothetical protein Csa_4G551650 [Cucumis sativus]
Length=406

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+ ++S  N+T K+RS  QPWV++ VV+G P+ L+IQKYQ+ + D  FSGLSC VSVPF
Sbjct  17   SWIALASYINITHKLRSSLQPWVTQHVVTGAPLILRIQKYQNSFFDALFSGLSCIVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMAFCDY+GN IKDV+SAPRP+ PPVRRITAT+DE+EN
Sbjct  77   YTAFLPLLFWSGHGKLARQMTLLMAFCDYLGNSIKDVISAPRPSCPPVRRITATKDEEEN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSHTLNT+CLSGYLL+Y+LS+T+N   S   AG AL+ LLVGLIGLGRIYLGM
Sbjct  137  AMEYGLPSSHTLNTVCLSGYLLYYILSYTENIHASYAFAGFALVCLLVGLIGLGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS IDII G  FGL IL FW +V
Sbjct  197  HSPIDIICGFVFGLMILLFWSNV  219



>ref|XP_010923351.1| PREDICTED: lipid phosphate phosphatase delta-like isoform X2 
[Elaeis guineensis]
Length=407

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 170/202 (84%), Gaps = 1/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            WV+ SS F++T+++R+LTQPWV+R+V+  TP  L++Q+ QH +LD  FS LSC VSVPFY
Sbjct  19   WVLASSAFDLTRRVRALTQPWVTRRVIVDTPSILRLQRIQHRFLDNMFSVLSCVVSVPFY  78

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            T FLP LFWSGHSKLARQMTLLMAFCDY+GN IKD+VSAPRP+SPPVRR+TAT+DEKENA
Sbjct  79   TGFLPLLFWSGHSKLARQMTLLMAFCDYIGNSIKDMVSAPRPSSPPVRRVTATKDEKENA  138

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            +EYG+PSSH LNT+CLSGYLLHYVL+H     + T   G ALI  LV LIG+GRIYLGMH
Sbjct  139  MEYGLPSSHALNTVCLSGYLLHYVLTHGVQNGV-TVAVGFALIFTLVMLIGIGRIYLGMH  197

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            SLID+  G++FGL ILAFWL++
Sbjct  198  SLIDVAAGISFGLVILAFWLTI  219



>ref|XP_008370944.1| PREDICTED: lipid phosphate phosphatase delta-like [Malus domestica]
Length=407

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 177/203 (87%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SWV+++S  +VT+K+RSL QPWV+  V +GTP+ LQIQ YQH +LD FFS LSC VSVPF
Sbjct  17   SWVIVASYLDVTRKLRSLLQPWVAHHVTAGTPLILQIQNYQHRFLDAFFSALSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMAFCDYMGNCIKDVVSAPRP  PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWSGHGKLARQMTLLMAFCDYMGNCIKDVVSAPRPRCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNTICLSG+LLHY+LS+++NED   +IAG+AL+ LLVG IGLGRIYLGM
Sbjct  137  ALEYGLPSSHTLNTICLSGFLLHYILSYSQNEDAHVKIAGLALVCLLVGFIGLGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS IDII GLA GL IL FWLSV
Sbjct  197  HSPIDIISGLAIGLVILWFWLSV  219



>gb|KDO70815.1| hypothetical protein CISIN_1g015391mg [Citrus sinensis]
Length=389

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 155/203 (76%), Gaps = 19/203 (9%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW++ISS  NVTQK+RSL QPWV+  V+ GT   LQIQKYQH +LD  FSGLSC VSVPF
Sbjct  18   SWIMISSCLNVTQKLRSLLQPWVTHYVIIGTAFILQIQKYQHKFLDSLFSGLSCVVSVPF  77

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP +FWSGH KLAR MTLLMAFCDY+GN IKD VSAPRP+ PPVRR+TAT+DEKEN
Sbjct  78   YTGFLPLVFWSGHVKLARHMTLLMAFCDYLGNTIKDTVSAPRPSCPPVRRVTATKDEKEN  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CL+GYLLHYVLS+++N    T+ AG+AL                 
Sbjct  138  ALEYGLPSSHTLNTVCLAGYLLHYVLSYSQNNYAVTQFAGVAL-----------------  180

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
              L  ++G +A GLA+LAFWL+V
Sbjct  181  --LCLLVGLIAVGLAVLAFWLTV  201



>ref|XP_006577115.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11-like 
[Glycine max]
Length=406

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+V +S  N T+K+RS  QPWV+  V + TPI L+IQ Y  G+LD  FSGLSC VSVPFY
Sbjct  20   WLVSASYLNATRKLRSFLQPWVTHHVDTQTPIILKIQSYGFGFLDALFSGLSCVVSVPFY  79

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLMAFCDY+GNC KDVVSAPRP SPPV+R+TAT+DE++NA
Sbjct  80   TAFLPLLFWSGHGKLARQMTLLMAFCDYIGNCTKDVVSAPRPASPPVKRVTATKDEEDNA  139

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLL YVL+HT+ +       G++L  +LV LIGLGRIYLGMH
Sbjct  140  LEYGLPSSHTLNTVCLSGYLLRYVLTHTQIQGAYVTYLGVSLACMLVFLIGLGRIYLGMH  199

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            S++D++ GL  GL +LAFWL V
Sbjct  200  SVVDVLAGLLIGLVVLAFWLMV  221



>ref|XP_010934504.1| PREDICTED: lipid phosphate phosphatase delta-like [Elaeis guineensis]
Length=408

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
             WV+ SS+F++T+++R+LTQPWV+R+V+  TP+ L +Q  QH +LD  FS LSC VSVPF
Sbjct  18   GWVLASSVFDLTRRVRALTQPWVTRRVIVDTPLILGLQWIQHRFLDDMFSVLSCIVSVPF  77

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP LFWSGH KLARQMTLLMAFCDY+GN IKD++SAPRP+ PPVRR+TAT+DEKEN
Sbjct  78   YTGFLPLLFWSGHGKLARQMTLLMAFCDYIGNSIKDMISAPRPSCPPVRRVTATKDEKEN  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSH LNT+CLSGYLLHYVL+H    D      G +L+  LV LIG+GRIYLGM
Sbjct  138  AMEYGLPSSHALNTVCLSGYLLHYVLNHGVQNDGVAIAVGFSLVFALVMLIGIGRIYLGM  197

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLID++ G+ FGL IL FWL+V
Sbjct  198  HSLIDVVAGIIFGLVILFFWLTV  220



>ref|XP_009335872.1| PREDICTED: lipid phosphate phosphatase delta [Pyrus x bretschneideri]
 ref|XP_009335874.1| PREDICTED: lipid phosphate phosphatase delta [Pyrus x bretschneideri]
Length=407

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW++I+S  +VT+K+RS  QPWV+  V +GTP+ LQIQ YQH +LD FFS LSC VSVPF
Sbjct  17   SWMIIASYLDVTRKLRSFLQPWVAHHVTAGTPLILQIQNYQHRFLDAFFSALSCVVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMAFCDYMGNCIKDVVSAPRP  PPVRRITAT+DE++N
Sbjct  77   YTAFLPLLFWSGHGKLARQMTLLMAFCDYMGNCIKDVVSAPRPRCPPVRRITATKDEEDN  136

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CLSG+LLHY+LS+ +NED   +IAG+AL+ LLVG IGLGRIYLGM
Sbjct  137  ALEYGLPSSHTLNTVCLSGFLLHYILSYVQNEDAHVKIAGLALVCLLVGFIGLGRIYLGM  196

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS IDII GLA GL IL FWLSV
Sbjct  197  HSSIDIISGLAIGLVILWFWLSV  219



>gb|KHN22563.1| Dihydrosphingosine 1-phosphate phosphatase [Glycine soja]
Length=406

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+V +S  N T+K+RS  QPWV+  V + TPI L+IQ Y  G+LD  FSGLSC VSVPFY
Sbjct  20   WLVSASYLNATRKLRSFLQPWVTHHVDTQTPIILKIQSYGFGFLDALFSGLSCVVSVPFY  79

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLMAFCDY+GNC KDVVSAPRP SPPV+R+TAT+DE++NA
Sbjct  80   TAFLPLLFWSGHGKLARQMTLLMAFCDYIGNCTKDVVSAPRPASPPVKRVTATKDEEDNA  139

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLL YVL+HT+ +       G++L  +LV LIGLGRIYLGMH
Sbjct  140  LEYGLPSSHTLNTVCLSGYLLRYVLTHTQIQGAYVTYLGVSLACMLVFLIGLGRIYLGMH  199

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            S++D++ GL  GL +LAFWL V
Sbjct  200  SVVDVLAGLLIGLVVLAFWLMV  221



>gb|KJB36157.1| hypothetical protein B456_006G144600 [Gossypium raimondii]
Length=370

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 145/203 (71%), Gaps = 36/203 (18%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+VI+  F+VT+KIRSL QPWVS  VVSGT I L+IQK+QH +LD  FSGLSC VSVPF
Sbjct  16   SWIVITCYFDVTKKIRSLLQPWVSHHVVSGTSIILKIQKHQHKFLDALFSGLSCIVSVPF  75

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMA CDY+GNCIKDVVSAPRP  PPVRRITAT+DE+EN
Sbjct  76   YTAFLPLLFWSGHGKLARQMTLLMALCDYLGNCIKDVVSAPRPNCPPVRRITATKDEEEN  135

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CLSG  L                                    GM
Sbjct  136  ALEYGLPSSHTLNTVCLSGIYL------------------------------------GM  159

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLIDIIGGL FG  ILA WLSV
Sbjct  160  HSLIDIIGGLVFGFMILAIWLSV  182



>ref|XP_010923350.1| PREDICTED: lipid phosphate phosphatase delta-like isoform X1 
[Elaeis guineensis]
Length=408

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            WV+ SS F++T+++R+LTQPWV+R+V+  TP  L++Q+ QH +LD  FS LSC VSVPFY
Sbjct  19   WVLASSAFDLTRRVRALTQPWVTRRVIVDTPSILRLQRIQHRFLDNMFSVLSCVVSVPFY  78

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            T FLP LFWSGHSKLARQMTLLMAFCDY+GN IKD+VSAPRP+SPPVRR+TAT+DEKENA
Sbjct  79   TGFLPLLFWSGHSKLARQMTLLMAFCDYIGNSIKDMVSAPRPSSPPVRRVTATKDEKENA  138

Query  689  LEYGMPSSHTLNTICLSG-YLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            +EYG+PSSH LNT+CLSG YLLHYVL+H     + T   G ALI  LV LIG+GRIYLGM
Sbjct  139  MEYGLPSSHALNTVCLSGRYLLHYVLTHGVQNGV-TVAVGFALIFTLVMLIGIGRIYLGM  197

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLID+  G++FGL ILAFWL++
Sbjct  198  HSLIDVAAGISFGLVILAFWLTI  220



>ref|XP_008789078.1| PREDICTED: lipid phosphate phosphatase delta [Phoenix dactylifera]
Length=408

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            WV+ SS F++T+++R+LTQPWV+R+V+  TP+ L +Q+ QH  LD  FS LSC VSVPFY
Sbjct  19   WVLASSAFDLTRRVRALTQPWVTRRVIVDTPLILGLQRIQHRLLDDMFSVLSCVVSVPFY  78

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            T FLP LFWSGHSKLARQMTLLMAFCDY+GN +KD++SAPRP+ PPVRR+TAT+DEKENA
Sbjct  79   TGFLPLLFWSGHSKLARQMTLLMAFCDYIGNSMKDMISAPRPSCPPVRRVTATKDEKENA  138

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            +EYG+PSSH LNT+CLSGYLLHYVL+     D      G++L+  LV LI +GRIYLGMH
Sbjct  139  MEYGLPSSHALNTVCLSGYLLHYVLNTCVQNDGVAIAVGVSLVFALVMLIAIGRIYLGMH  198

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            SLIDI+ G+ FGL IL FWL+V
Sbjct  199  SLIDIVAGIIFGLVILFFWLTV  220



>ref|XP_011078801.1| PREDICTED: lipid phosphate phosphatase delta [Sesamum indicum]
Length=407

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A W+ ISSI NVTQ +RS TQP VSR V+SGTPI L+IQKYQ  +LD  FSGLSC VSVP
Sbjct  16   ALWISISSILNVTQYLRSFTQPCVSRLVISGTPIILKIQKYQRRHLDALFSGLSCVVSVP  75

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYTAFLP LFW+GH KLARQMTLLMAFCDY+GNCIKDVVSAPRP+ PPVRR+TAT+DE+E
Sbjct  76   FYTAFLPLLFWTGHCKLARQMTLLMAFCDYVGNCIKDVVSAPRPSCPPVRRVTATKDEEE  135

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSHTLNT+CLSGYLLHY+L +  +  +  E+ G A++ L VGLIGLGRIYLG
Sbjct  136  NAMEYGLPSSHTLNTVCLSGYLLHYILDYNGSNGVFLEVVGFAMVCLFVGLIGLGRIYLG  195

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSL+DIIGGLA GL ILA WLSV
Sbjct  196  MHSLVDIIGGLALGLGILAMWLSV  219



>ref|XP_008796692.1| PREDICTED: lipid phosphate phosphatase delta-like [Phoenix dactylifera]
Length=408

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 176/221 (80%), Gaps = 1/221 (0%)
 Frame = +2

Query  272  MESVAgwqwqglflgglASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQH  451
            ME+     WQ L L  +  WV+ SS F++T+++R+L QPWV+R+V+  TP  L++Q+ QH
Sbjct  1    MEAAGMPFWQALTLSSIVGWVLASSAFDLTRRVRALMQPWVTRRVIVDTPWILRLQRIQH  60

Query  452  GYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPR  631
             +LD  FS +SC VSVPFYT F+P LFWSGHSKLARQM LL+AFCD++GN IKDVVSAPR
Sbjct  61   RFLDNMFSVMSCVVSVPFYTGFIPLLFWSGHSKLARQMILLLAFCDFIGNSIKDVVSAPR  120

Query  632  PTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagia  811
            P+SPPVRR+TAT+DEKENA+EYG+PSSH LNT+CLSGYLLHY L+H     + T   G A
Sbjct  121  PSSPPVRRVTATKDEKENAMEYGLPSSHALNTVCLSGYLLHYALTHGVQNGV-TVAVGFA  179

Query  812  lisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWLSV  934
            L+  LV +IG+GRIYLGMHSLID++ G++FGL ILAFWL++
Sbjct  180  LVFTLVMIIGIGRIYLGMHSLIDVVSGISFGLVILAFWLTI  220



>ref|XP_009397684.1| PREDICTED: lipid phosphate phosphatase delta-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            WVV SS+F +T+++R++TQPWV+R+V++ TP  L++Q+  H  LD  FS LSC VSVPFY
Sbjct  19   WVVASSLFGLTRRVRAMTQPWVTRRVLADTPSILRLQRLHHWSLDNMFSVLSCVVSVPFY  78

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            T FLP LFWSGH KLARQMTLLMAFCDY+GN IKD+VSAPRP+SPPVRR+TAT+DEKENA
Sbjct  79   TGFLPILFWSGHGKLARQMTLLMAFCDYVGNSIKDLVSAPRPSSPPVRRVTATKDEKENA  138

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            +EYG+PSSH LNT+CLSGYLLHYVL +    +     A   L+ LLV LIG+GR+YLGMH
Sbjct  139  MEYGLPSSHCLNTVCLSGYLLHYVLIYYPQREGIAVAAMFGLVFLLVMLIGVGRVYLGMH  198

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            SLID++ G+ FGL IL+FWL V
Sbjct  199  SLIDVMAGVGFGLVILSFWLMV  220



>ref|NP_001051628.1| Os03g0805400 [Oryza sativa Japonica Group]
 gb|AAS07224.1| putative phosphatase [Oryza sativa Japonica Group]
 gb|ABF99433.1| phosphatidic acid phosphatase family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13542.1| Os03g0805400 [Oryza sativa Japonica Group]
 dbj|BAG92642.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95434.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60133.1| hypothetical protein OsJ_13019 [Oryza sativa Japonica Group]
Length=415

 Score =   258 bits (659),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A WV  +S F++T++ R+L QPWV+R+V++ TP  ++ QK  H  LD FFS LSC VSVP
Sbjct  25   AGWVWAASSFDLTRRSRALVQPWVTRRVLAETPSIVRFQKVHHKLLDSFFSVLSCVVSVP  84

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYT FLP LFWSGHSKLARQMTLLMAFCDY+GN +KD VSAPRP+SPPVRR+TATEDEKE
Sbjct  85   FYTGFLPLLFWSGHSKLARQMTLLMAFCDYLGNSVKDAVSAPRPSSPPVRRVTATEDEKE  144

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSH LNT+CL GYLLHYVL++  ++++   + G++L  LLV L+G+GRIYLG
Sbjct  145  NAMEYGLPSSHALNTVCLMGYLLHYVLTYGSHDNVMV-VTGLSLAFLLVMLVGIGRIYLG  203

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSLID+I G+ FG+ ILAFWL+V
Sbjct  204  MHSLIDVIAGICFGVVILAFWLAV  227



>gb|EEC76370.1| hypothetical protein OsI_13971 [Oryza sativa Indica Group]
Length=415

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 168/202 (83%), Gaps = 1/202 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            WV  +S F++T++ R+L QPWV+R+V++ TP  ++ QK  H  LD FFS LSC VSVPFY
Sbjct  27   WVWAASSFDLTRRSRALVQPWVTRRVLAETPSIVRFQKVHHKLLDSFFSVLSCVVSVPFY  86

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            T FLP LFWSGHSKLARQMTLLMAFCDY+GN +KD VSAPRP+SPPVRR+TATEDEKENA
Sbjct  87   TGFLPLLFWSGHSKLARQMTLLMAFCDYLGNSVKDAVSAPRPSSPPVRRVTATEDEKENA  146

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            +EYG+PSSH LNT+CL GYLLHYVL++  ++++   + G++L  LLV L+G+GRIYLGMH
Sbjct  147  MEYGLPSSHALNTVCLMGYLLHYVLTYGSHDNVMV-VTGLSLAFLLVMLVGIGRIYLGMH  205

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            SLID+I G+ FG+ ILAFWL+V
Sbjct  206  SLIDVIAGICFGVVILAFWLAV  227



>gb|KDO70816.1| hypothetical protein CISIN_1g015391mg [Citrus sinensis]
Length=372

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 143/203 (70%), Gaps = 36/203 (18%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW++ISS  NVTQK+RSL QPWV+  V+ GT   LQIQKYQH +LD  FSGLSC VSVPF
Sbjct  18   SWIMISSCLNVTQKLRSLLQPWVTHYVIIGTAFILQIQKYQHKFLDSLFSGLSCVVSVPF  77

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP +FWSGH KLAR MTLLMAFCDY+GN IKD VSAPRP+ PPVRR+TAT+DEKEN
Sbjct  78   YTGFLPLVFWSGHVKLARHMTLLMAFCDYLGNTIKDTVSAPRPSCPPVRRVTATKDEKEN  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ALEYG+PSSHTLNT+CL+G  L                                    GM
Sbjct  138  ALEYGLPSSHTLNTVCLAGIYL------------------------------------GM  161

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSL+DII GLA GLA+LAFWL+V
Sbjct  162  HSLVDIIAGLALGLAVLAFWLTV  184



>ref|NP_001146142.1| hypothetical protein [Zea mays]
 gb|ACF85230.1| unknown [Zea mays]
 gb|ACL53346.1| unknown [Zea mays]
 gb|AFW67293.1| hypothetical protein ZEAMMB73_714627 [Zea mays]
Length=419

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 166/203 (82%), Gaps = 1/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
             WV  +S +++T++ R+L QPWV+R+V + TP  L+ QK +H  LD FFS LSC VSVPF
Sbjct  31   GWVWAASFYDLTRRARALVQPWVTRRVHAETPAILRFQKLEHKLLDNFFSVLSCVVSVPF  90

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP LFWSGH +LARQMTLLMAFCDY+GN +KD+VSAPRP SPP+RR+TATEDEKEN
Sbjct  91   YTGFLPLLFWSGHGRLARQMTLLMAFCDYLGNSVKDMVSAPRPCSPPIRRVTATEDEKEN  150

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSH LNT+CL+GYLLHYVL++ ++  L T  AG++L  LLV L+G+ RIYLGM
Sbjct  151  AMEYGLPSSHALNTVCLTGYLLHYVLTYGEHGSL-TVAAGLSLALLLVMLVGIARIYLGM  209

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSL D++ G+ FG+ ILAFWL+V
Sbjct  210  HSLTDVVAGIGFGIVILAFWLAV  232



>ref|XP_004981368.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11-like 
[Setaria italica]
Length=416

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 163/204 (80%), Gaps = 1/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A WV  +S +++T++ R+L QPWV+R+V + TP  L+ Q+ QH  LD FFS LSC VSVP
Sbjct  25   AGWVWAASFYDLTRRARALVQPWVTRRVHAETPAILRFQRLQHKLLDNFFSVLSCVVSVP  84

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYT FLP LFWSGH+KLARQMTLLMA CDY+GN +KD++SAPRP SPPVRR+TATEDEKE
Sbjct  85   FYTGFLPLLFWSGHNKLARQMTLLMALCDYLGNSVKDMISAPRPCSPPVRRVTATEDEKE  144

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSH LNT+CL GYLLHYVL++    ++    AG++L  L V LIG+ RIYLG
Sbjct  145  NAMEYGLPSSHALNTVCLMGYLLHYVLTYGDAGNVMIA-AGLSLAFLFVMLIGIARIYLG  203

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSLID+I G+ FG+ ILAFWL V
Sbjct  204  MHSLIDVIAGICFGIVILAFWLVV  227



>ref|XP_004494305.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11-like 
[Cicer arietinum]
Length=389

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+  SS  N+T K+RS  QP+V+  V +GTPI LQIQ Y+ G+LD  FSGLSC VSVPFY
Sbjct  18   WLFSSSYLNLTLKLRSFLQPFVTHYVETGTPILLQIQSYRAGFLDALFSGLSCVVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH +LARQMTLLMAFCDY+GNCIKDVVSAPRP SPPVRR+TAT+DE+ENA
Sbjct  78   TAFLPLLFWSGHGQLARQMTLLMAFCDYIGNCIKDVVSAPRPASPPVRRVTATKDEEENA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            LEYG+PSSHTLNT+CLSGYLLHYVL+HT+ +       G++L  L V L+GLGRIYLGMH
Sbjct  138  LEYGLPSSHTLNTVCLSGYLLHYVLTHTQIQGAYINYFGVSLACLFVALVGLGRIYLGMH  197

Query  869  SLIDI  883
            SLID+
Sbjct  198  SLIDV  202



>dbj|BAJ98189.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 160/204 (78%), Gaps = 1/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A WV  +S +++T++ R+L QPWV+R+V + TP  +  Q+ QH  LD FFS LSC VSVP
Sbjct  26   AGWVWAASHYDLTRRARALAQPWVTRRVHAETPDIITFQRLQHRLLDNFFSVLSCVVSVP  85

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYT FLP LFWSGH KLARQMTLL+AFCDY+GN +KD+VSAPRP SPPVRR+TATEDEKE
Sbjct  86   FYTGFLPLLFWSGHGKLARQMTLLLAFCDYLGNAVKDLVSAPRPCSPPVRRVTATEDEKE  145

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSH LNT+CL GY+LHYVL++           G++L  LLV LIG+ R+YLG
Sbjct  146  NAMEYGLPSSHALNTVCLMGYMLHYVLTYGPCNGFMIA-TGLSLAFLLVTLIGIARVYLG  204

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSL D+I G++FG+ ILAFWL V
Sbjct  205  MHSLTDVIAGISFGIVILAFWLVV  228



>ref|XP_010036524.1| PREDICTED: lipid phosphate phosphatase delta isoform X2 [Eucalyptus 
grandis]
Length=371

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 142/202 (70%), Gaps = 36/202 (18%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+++SS  NVT  +RSL QPWV+  V  G P+ LQIQ+++H  LD  FSGLSC VSVPFY
Sbjct  18   WILVSSYCNVTPALRSLLQPWVAHHVDVGVPLILQIQRFRHRALDALFSGLSCVVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLP LFWSGH KLARQMTLLMAFCDYMGNC+KDVVSAPRP+ PPVRR+TAT+DE+ENA
Sbjct  78   TAFLPVLFWSGHGKLARQMTLLMAFCDYMGNCVKDVVSAPRPSCPPVRRVTATKDEEENA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMH  868
            +EYG+PSSHTLNT+CLSG  L                                    GMH
Sbjct  138  MEYGLPSSHTLNTVCLSGIYL------------------------------------GMH  161

Query  869  SLIDIIGGLAFGLAILAFWLSV  934
            SLIDIIGGL  GL ILAFWL+V
Sbjct  162  SLIDIIGGLIMGLVILAFWLTV  183



>ref|XP_003564191.1| PREDICTED: lipid phosphate phosphatase delta [Brachypodium distachyon]
Length=414

 Score =   251 bits (640),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 159/204 (78%), Gaps = 1/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A WV  +S F++T++ R+LTQPWV+R+V + TP  L+ Q+ QH  LD FFS LSC VSVP
Sbjct  24   AGWVWAASYFDLTRRARALTQPWVTRRVHAETPSILRFQRTQHRLLDNFFSVLSCVVSVP  83

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYT FLP LFWSGH KLARQMTLLMAFCDY+GN +KD+VSAPRP SPPVRR+TATEDEKE
Sbjct  84   FYTGFLPLLFWSGHGKLARQMTLLMAFCDYLGNAVKDLVSAPRPCSPPVRRVTATEDEKE  143

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSH LNT+CL GY+LHYVL++            ++L  LLV LIG+ RIYLG
Sbjct  144  NAMEYGLPSSHALNTVCLMGYILHYVLTYGPCSAFMVA-TCLSLALLLVMLIGIARIYLG  202

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSL D+I G+ FG  ILAFWL V
Sbjct  203  MHSLTDVIAGICFGTVILAFWLVV  226



>gb|EMS59474.1| Sphingosine-1-phosphate phosphatase 1 [Triticum urartu]
Length=435

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 162/204 (79%), Gaps = 1/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A WV  +S +++T++ R+L QPWV+R+V + TP  L  Q+ QH  LD FFS LSC VSVP
Sbjct  41   AGWVWAASYYDLTRRARALAQPWVTRRVHAETPSILTFQRLQHKLLDNFFSVLSCVVSVP  100

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYT FLP LFWSGH KLARQMTLL+AFCDY+GN +KD+VSAPRP SPPVRR+TATEDEKE
Sbjct  101  FYTGFLPLLFWSGHGKLARQMTLLLAFCDYLGNAVKDLVSAPRPCSPPVRRVTATEDEKE  160

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSH LNT+CL GY+LHYVL++   +   T   G++L  +LV LIG+ R+YLG
Sbjct  161  NAMEYGLPSSHALNTVCLMGYMLHYVLTYGPCDGF-TIAMGLSLAFMLVTLIGIARVYLG  219

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSL D+I G++FG+ ILAFWL V
Sbjct  220  MHSLTDVIAGISFGIVILAFWLVV  243



>ref|NP_001151171.1| phosphoric ester hydrolase [Zea mays]
 gb|ACG41854.1| phosphoric ester hydrolase [Zea mays]
Length=413

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 164/204 (80%), Gaps = 1/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A WV  +S +++T++ R+L QPWV+R+V + T   L+ Q+ +H  LD  FS LSC VSVP
Sbjct  24   AGWVWAASFYDLTRRARALVQPWVTRRVHAETAAILRFQRLEHKLLDNIFSVLSCVVSVP  83

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYT FLP LFWSGH +LARQMTLLMAFCDY+GN +KD++SAPRP SPPVRR+TATEDEKE
Sbjct  84   FYTGFLPLLFWSGHGRLARQMTLLMAFCDYLGNSVKDIMSAPRPCSPPVRRVTATEDEKE  143

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSH LNT+CL+GYLLHYVL+  ++  + T  AG++L  LLV L+G+ RIYLG
Sbjct  144  NAMEYGLPSSHALNTVCLTGYLLHYVLTFGEHGSV-TVAAGLSLAFLLVMLVGIARIYLG  202

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSL D++ G+ FG+ ILAFWLSV
Sbjct  203  MHSLTDVVAGIGFGIVILAFWLSV  226



>ref|NP_001137127.1| uncharacterized protein LOC100217309 [Zea mays]
 gb|ACF83323.1| unknown [Zea mays]
Length=417

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 164/204 (80%), Gaps = 1/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A WV  +S +++T++ R+L QPWV+R+V + T   L+ Q+ +H  LD  FS LSC VSVP
Sbjct  28   AGWVWAASFYDLTRRARALVQPWVTRRVHAETAAILRFQRLEHKLLDNIFSMLSCVVSVP  87

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYT FLP LFWSGH +LARQMTLLMAFCDY+GN +KD+VSAPRP SPPVRR+TATEDEKE
Sbjct  88   FYTGFLPLLFWSGHGRLARQMTLLMAFCDYLGNSVKDIVSAPRPCSPPVRRVTATEDEKE  147

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSH LNT+CL+GYLLHYVL++ ++  + T  AG++L  LLV L+G+ RIYLG
Sbjct  148  NAMEYGLPSSHALNTVCLTGYLLHYVLTYGEHGSV-TVAAGLSLAFLLVMLVGIARIYLG  206

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSL D+  G+ FG+ ILAFWLSV
Sbjct  207  MHSLTDVGAGIGFGIVILAFWLSV  230



>ref|NP_001146363.1| phosphoric ester hydrolase [Zea mays]
 gb|ACL53779.1| unknown [Zea mays]
 tpg|DAA52018.1| TPA: phosphoric ester hydrolase [Zea mays]
Length=419

 Score =   245 bits (626),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 163/204 (80%), Gaps = 1/204 (0%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A WV  +S +++T++ R+L QPWV+R+V + T   L+ Q+ +H  LD  FS LSC VSVP
Sbjct  28   AGWVWAASFYDLTRRARALVQPWVTRRVHAETAAILRFQRLEHKLLDNIFSVLSCVVSVP  87

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FYT FLP LFWSGH +LARQMTLLMAFCDY+GN +KD+VSA RP SPPVRR+TATEDEKE
Sbjct  88   FYTGFLPLLFWSGHGRLARQMTLLMAFCDYLGNSVKDIVSAARPCSPPVRRVTATEDEKE  147

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            NA+EYG+PSSH LNT+CL+GYLLHY+L+  ++  + T  AG++L  LLV L+G+ RIYLG
Sbjct  148  NAMEYGLPSSHALNTVCLTGYLLHYILTFGEHGSV-TVAAGLSLAFLLVMLVGIARIYLG  206

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHSL D++ G+ FG+ ILAFWL+V
Sbjct  207  MHSLTDVVAGIGFGVVILAFWLAV  230



>ref|XP_009402139.1| PREDICTED: LOW QUALITY PROTEIN: lipid phosphate phosphatase delta-like 
[Musa acuminata subsp. malaccensis]
Length=403

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
             WVV SS F++T++IRSL QPWV+R+V++ TP  L +Q  +HG+LD  FS LSC VSVPF
Sbjct  18   GWVVASSWFDLTKRIRSLAQPWVTRRVLADTPSILWLQSMRHGFLDCIFSVLSCFVSVPF  77

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YT FLP ++WSGH KLARQMTLLMAFCDY+GN IKDVVSAPRP+ PPV R+ AT DEK N
Sbjct  78   YTGFLPVVYWSGHRKLARQMTLLMAFCDYIGNSIKDVVSAPRPSCPPVTRVMATNDEKGN  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A+EYG+PSSH LNT+CL GY+LH+ L+H    D    +A + L+ LL+  IG+GR+YLGM
Sbjct  138  AMEYGLPSSHCLNTVCLLGYMLHHFLTHGAKIDAIIPVAFLGLVCLLIISIGMGRMYLGM  197

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSL D++ G+ FGL ILA WL +
Sbjct  198  HSLTDVVAGIIFGLVILALWLMI  220



>ref|XP_011653921.1| PREDICTED: lipid phosphate phosphatase delta-like [Cucumis sativus]
Length=194

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+ ++S  N+T K+RS  QPWV++ VV+G P+ L+IQKYQ+ + D  FSGLSC VSVPF
Sbjct  17   SWIALASYINITHKLRSSLQPWVTQHVVTGAPLILRIQKYQNSFFDALFSGLSCIVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMAFCDY+GN IKDV+SAPRP+ PPVRRITAT+DE+EN
Sbjct  77   YTAFLPLLFWSGHGKLARQMTLLMAFCDYLGNSIKDVISAPRPSCPPVRRITATKDEEEN  136

Query  686  ALEYGMPSSHTLNTICLSGYLL  751
            A+EYG+PSSHTLNT+CLSGY++
Sbjct  137  AMEYGLPSSHTLNTVCLSGYVV  158



>gb|KGN54852.1| hypothetical protein Csa_4G551640 [Cucumis sativus]
Length=236

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            SW+ ++S  N+T K+RS  QPWV++ VV+G P+ L+IQKYQ+ + D  FSGLSC VSVPF
Sbjct  17   SWIALASYINITHKLRSSLQPWVTQHVVTGAPLILRIQKYQNSFFDALFSGLSCIVSVPF  76

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            YTAFLP LFWSGH KLARQMTLLMAFCDY+GN IKDV+SAPRP+ PPVRRITAT+DE+EN
Sbjct  77   YTAFLPLLFWSGHGKLARQMTLLMAFCDYLGNSIKDVISAPRPSCPPVRRITATKDEEEN  136

Query  686  ALEYGMPSSHTLNTICLSG  742
            A+EYG+PSSHTLNT+CLSG
Sbjct  137  AMEYGLPSSHTLNTVCLSG  155



>gb|ABR18474.1| unknown [Picea sitchensis]
Length=410

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 155/203 (76%), Gaps = 1/203 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W++ S + N+T ++RS TQP+V+ QV +     L++Q  +H +LD FFS LSC VSVPFY
Sbjct  18   WILFSRLTNLTVRVRSFTQPFVTSQVENWISFVLRVQSLKHPFLDAFFSYLSCIVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            T FLP LFWSGH KL RQMTLLMAFC+Y GNCIKD+VSAPRP SPPVRR+  TE+EKENA
Sbjct  78   TGFLPLLFWSGHCKLGRQMTLLMAFCNYTGNCIKDIVSAPRPLSPPVRRLVITEEEKENA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNED-LSTEiagialisllvgliglgriylgM  865
            LEYG+PSSHTLNTICLSGYLL+Y++++  + +    ++  I+L+  L  LIG+GRIYLGM
Sbjct  138  LEYGLPSSHTLNTICLSGYLLYYIINNFDSTNGFVFKLVVISLLVTLSLLIGIGRIYLGM  197

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HSLID++G    G  IL  W +V
Sbjct  198  HSLIDVLGAAVLGTMILVLWFTV  220



>ref|XP_006842772.1| PREDICTED: lipid phosphate phosphatase delta [Amborella trichopoda]
 gb|ERN04447.1| hypothetical protein AMTR_s00133p00106740 [Amborella trichopoda]
Length=406

 Score =   232 bits (592),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 159/203 (78%), Gaps = 3/203 (1%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            W+ +S + N+T  +RSLTQP V+R V + TP  L+IQ +Q   LD FFS LSC VSVPFY
Sbjct  18   WIWVSRLTNLTILLRSLTQPGVTRHVNAETPFILKIQGFQCPTLDVFFSALSCIVSVPFY  77

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            TAFLPFLFWSGHSKLARQMTLLMAFCDY+GN +KD++SAPRP+SPPVRR+TAT+DEK NA
Sbjct  78   TAFLPFLFWSGHSKLARQMTLLMAFCDYVGNALKDLISAPRPSSPPVRRVTATKDEKGNA  137

Query  689  LEYGMPSSHTLNTICLSGYLLHYVL-SHTKNEDLSTEiagialisllvgliglgriylgM  865
             EYG+PSSH LNT+CL G L  Y L SH  N  L  ++  + ++ +L GLIGLGRIYLGM
Sbjct  138  QEYGLPSSHALNTVCLFGLLFSYTLSSHAGNPGL--KLLALIMVCVLDGLIGLGRIYLGM  195

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS ID++GG+  G AILA WLSV
Sbjct  196  HSPIDVLGGVVLGSAILAAWLSV  218



>ref|XP_011470743.1| PREDICTED: lipid phosphate phosphatase delta-like [Fragaria vesca 
subsp. vesca]
Length=135

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +2

Query  338  ISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAF  517
            ++S  N+T K+RSL QPWV+   ++GTP+ LQIQ YQ+ +LD FF  LSC VSVPFYTAF
Sbjct  1    MASYLNLTPKLRSLLQPWVAHHFITGTPLILQIQNYQNRFLDAFFFALSCVVSVPFYTAF  60

Query  518  LPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEY  697
            LP LFWSGH KLARQMTLLMAFCDY+GNCIKDVVSA RP+ PPVRRITAT DE++NALEY
Sbjct  61   LPLLFWSGHGKLARQMTLLMAFCDYLGNCIKDVVSALRPSCPPVRRITATRDEEDNALEY  120

Query  698  GMPSSHTLNTICLS  739
            G+PSSHTLNT+CLS
Sbjct  121  GLPSSHTLNTVCLS  134



>gb|AFW75795.1| hypothetical protein ZEAMMB73_354014 [Zea mays]
Length=269

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            WV  +S +++T++ R+L QPWV+RQV + TP  L+ QK +H  LD FFS LSC VSVPFY
Sbjct  74   WVWAASFYDLTRRARALVQPWVTRQVHAETPTILRFQKLEHKMLDNFFSVLSCVVSVPFY  133

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            T FLP LFWSGH +LA QMTLLMAFCDY+ N +KD+VSAPRP S P+RR+TATEDE+ENA
Sbjct  134  TGFLPLLFWSGHGRLAGQMTLLMAFCDYLSNSVKDMVSAPRPCSSPIRRVTATEDERENA  193

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDL  787
            +EYG+PSSH LNT+CL+GYLLHYVL++ ++  L
Sbjct  194  MEYGLPSSHALNTVCLTGYLLHYVLTYGEHGSL  226



>gb|AFW75794.1| hypothetical protein ZEAMMB73_354014 [Zea mays]
Length=361

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            WV  +S +++T++ R+L QPWV+RQV + TP  L+ QK +H  LD FFS LSC VSVPFY
Sbjct  74   WVWAASFYDLTRRARALVQPWVTRQVHAETPTILRFQKLEHKMLDNFFSVLSCVVSVPFY  133

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            T FLP LFWSGH +LA QMTLLMAFCDY+ N +KD+VSAPRP S P+RR+TATEDE+ENA
Sbjct  134  TGFLPLLFWSGHGRLAGQMTLLMAFCDYLSNSVKDMVSAPRPCSSPIRRVTATEDERENA  193

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDL  787
            +EYG+PSSH LNT+CL+GYLLHYVL++ ++  L
Sbjct  194  MEYGLPSSHALNTVCLTGYLLHYVLTYGEHGSL  226



>ref|XP_008648866.1| PREDICTED: uncharacterized protein LOC103629566 [Zea mays]
Length=364

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +2

Query  329  WVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFY  508
            WV  +S +++T++ R+L QPWV+RQV + TP  L+ QK +H  LD FFS LSC VSVPFY
Sbjct  32   WVWAASFYDLTRRARALVQPWVTRQVHAETPTILRFQKLEHKMLDNFFSVLSCVVSVPFY  91

Query  509  TAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENA  688
            T FLP LFWSGH +LA QMTLLMAFCDY+ N +KD+VSAPRP S P+RR+TATEDE+ENA
Sbjct  92   TGFLPLLFWSGHGRLAGQMTLLMAFCDYLSNSVKDMVSAPRPCSSPIRRVTATEDERENA  151

Query  689  LEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDL  787
            +EYG+PSSH LNT+CL+GYLLHYVL++ ++  L
Sbjct  152  MEYGLPSSHALNTVCLTGYLLHYVLTYGEHGSL  184



>ref|XP_006651931.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase LCB3-like 
[Oryza brachyantha]
Length=376

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 137/165 (83%), Gaps = 1/165 (1%)
 Frame = +2

Query  440  KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVV  619
            K  H  LD FFS LSC VSVPFYT FLP LFW+GHSKLARQMTLLMAFCDY+GN +KD V
Sbjct  25   KVHHKLLDNFFSVLSCVVSVPFYTGFLPLLFWTGHSKLARQMTLLMAFCDYLGNSVKDAV  84

Query  620  SAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEi  799
            SAPRP+SPPVRR+TATEDEKENA+EYG+PSSH LNT+CL GYLL+YVL++  ++ +    
Sbjct  85   SAPRPSSPPVRRVTATEDEKENAMEYGLPSSHALNTVCLMGYLLYYVLTYGPHDSVMVA-  143

Query  800  agialisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWLSV  934
             G+++  LLV L+GLGRIYLGMHS ID+I G+ FG+ ILAFWL+V
Sbjct  144  MGLSIALLLVMLVGLGRIYLGMHSSIDVIAGVCFGVVILAFWLAV  188



>ref|XP_002964339.1| hypothetical protein SELMODRAFT_405511 [Selaginella moellendorffii]
 gb|EFJ34672.1| hypothetical protein SELMODRAFT_405511 [Selaginella moellendorffii]
Length=412

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 154/222 (69%), Gaps = 1/222 (0%)
 Frame = +2

Query  272  MESVAgwqwqglflgglASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQH  451
            ME+V    WQ + L  + SW+  SS  N+T + RS+ QP V+++V+ GT   L IQ+ ++
Sbjct  1    MEAVGVPVWQVITLVTILSWLRFSSFTNLTLRARSILQPLVTQRVLKGTETILHIQRSKN  60

Query  452  GYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPR  631
             + D  F+  S  VSV FYTAFLP LFW G ++LARQMT+LMA C Y+GNC+KDVVSAPR
Sbjct  61   PFWDVVFAVASSVVSVEFYTAFLPLLFWCGQTRLARQMTILMAVCIYVGNCVKDVVSAPR  120

Query  632  PTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTK-NEDLSTEiagi  808
            P SPPVRR+TA + E+E+A+E+G+PSSHT+NTICLS YL +Y ++H +   D       +
Sbjct  121  PASPPVRRLTAIKCEEESAMEFGLPSSHTINTICLSLYLFNYFMNHQQFPSDSRVWWLVL  180

Query  809  alisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWLSV  934
             +I L++ L+  GR+YLGMH+ ID+  G+  GL +L FW  V
Sbjct  181  GIICLVIVLVAYGRLYLGMHTPIDVYAGIPIGLCLLMFWCCV  222



>ref|XP_002967695.1| hypothetical protein SELMODRAFT_88434 [Selaginella moellendorffii]
 gb|EFJ31042.1| hypothetical protein SELMODRAFT_88434 [Selaginella moellendorffii]
Length=412

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 154/222 (69%), Gaps = 1/222 (0%)
 Frame = +2

Query  272  MESVAgwqwqglflgglASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQH  451
            ME+V    WQ + L  + SW+  SS  N+T + RS+ QP V+++V+ GT   L IQ+ ++
Sbjct  1    MEAVGVPVWQVITLVTILSWLRFSSFTNLTLRARSILQPLVTQRVLKGTETILHIQRSKN  60

Query  452  GYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPR  631
             + D  F+  S  VSV FYTAFLP LFW G ++LARQMT+LMA C Y+GNC+KDVVSAPR
Sbjct  61   PFWDVVFAVASSVVSVEFYTAFLPLLFWCGQTRLARQMTILMAVCIYVGNCVKDVVSAPR  120

Query  632  PTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTK-NEDLSTEiagi  808
            P SPPVRR+TA + E+E+A+E+G+PSSHT+NTICLS YL +Y ++H +   D       +
Sbjct  121  PASPPVRRLTAIKCEEESAMEFGLPSSHTINTICLSLYLFNYFMNHQQFPSDSRVWWLVL  180

Query  809  alisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWLSV  934
             +I L++ L+  GR+YLGMH+ ID+  G+  GL +L FW  V
Sbjct  181  GIICLVIVLVAYGRLYLGMHTPIDVYAGIPIGLCLLMFWCCV  222



>dbj|BAE99276.1| hypothetical protein [Arabidopsis thaliana]
Length=346

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +2

Query  545  SKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLN  724
            S LARQMTLL+AFCDY+GNCIKDVVSAPRP+ PPVRRITAT+DE++NA+EYG+PSSHTLN
Sbjct  28   SGLARQMTLLIAFCDYLGNCIKDVVSAPRPSCPPVRRITATKDEEDNAMEYGLPSSHTLN  87

Query  725  TICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFG  904
            T+CLSGYLLHYVLS  + E +S +  G AL  LLV LI  GR+YLGMHS++DI+ GLA G
Sbjct  88   TVCLSGYLLHYVLSSLEYESVSIQYYGFALACLLVALIAFGRVYLGMHSVVDIVSGLAIG  147

Query  905  LAILAFWLSV  934
            + IL  WL+V
Sbjct  148  VLILGLWLTV  157



>ref|NP_001078308.1| sphingoid phosphate phosphatase 1 [Arabidopsis thaliana]
 gb|AEE79789.1| sphingoid phosphate phosphatase 1 [Arabidopsis thaliana]
Length=346

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +2

Query  545  SKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLN  724
            S LARQMTLL+AFCDY+GNCIKDVVSAPRP+ PPVRRITAT+DE++NA+EYG+PSSHTLN
Sbjct  28   SGLARQMTLLIAFCDYLGNCIKDVVSAPRPSCPPVRRITATKDEEDNAMEYGLPSSHTLN  87

Query  725  TICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFG  904
            T+CLSGYLLHYVLS  + E +S +  G AL  LLV LI  GR+YLGMHS++DI+ GLA G
Sbjct  88   TVCLSGYLLHYVLSSLEYESVSIQYYGFALACLLVALIAFGRVYLGMHSVVDIVSGLAIG  147

Query  905  LAILAFWLSV  934
            + IL  WL+V
Sbjct  148  VLILGLWLTV  157



>ref|XP_010516500.1| PREDICTED: lipid phosphate phosphatase delta-like isoform X2 
[Camelina sativa]
Length=349

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +2

Query  545  SKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLN  724
            S LARQMTLL+AFCDY+GNCIKDV+SAPRP+ PPVRRITAT+DE++NA+EYG+PSSHTLN
Sbjct  28   SGLARQMTLLIAFCDYLGNCIKDVISAPRPSCPPVRRITATKDEEDNAMEYGLPSSHTLN  87

Query  725  TICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFG  904
            T+CLSGYLLHYV S    E++S +  G AL  LLV L+  GRIYLGMHS++DI+GGLA G
Sbjct  88   TVCLSGYLLHYVSSSVGYENVSIQYYGFALACLLVALVAFGRIYLGMHSVVDIVGGLAIG  147

Query  905  LAILAFWLSV  934
            + IL  WL+V
Sbjct  148  VLILGLWLTV  157



>ref|XP_010504805.1| PREDICTED: lipid phosphate phosphatase delta isoform X2 [Camelina 
sativa]
Length=349

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +2

Query  545  SKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLN  724
            S LARQMTLL+AFCDY+GNCIKDV+SAPRP+ PPVRRITAT+DE++NA+EYG+PSSHTLN
Sbjct  28   SGLARQMTLLIAFCDYLGNCIKDVISAPRPSCPPVRRITATKDEEDNAMEYGLPSSHTLN  87

Query  725  TICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFG  904
            T+CLSGYLLHYV S    E++S +  G AL  LLV LI  GRIYLGMHS++DI+GGLA G
Sbjct  88   TVCLSGYLLHYVSSSVGYENVSIQYYGFALACLLVALIAFGRIYLGMHSVVDIVGGLAIG  147

Query  905  LAILAFWLSV  934
            + IL  WL++
Sbjct  148  VLILGLWLTI  157



>ref|XP_010427756.1| PREDICTED: lipid phosphate phosphatase delta-like isoform X2 
[Camelina sativa]
Length=349

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  551  LARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTI  730
            LARQMTLL+AFCDY+GNCIKDV+SAPRP+ PPVRRITAT+DE++NA+EYG+PSSHTLNT+
Sbjct  30   LARQMTLLIAFCDYLGNCIKDVISAPRPSCPPVRRITATKDEEDNAMEYGLPSSHTLNTV  89

Query  731  CLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGLA  910
            CLSGYLLHYV S    E++S +  G +L  LLV LI  GRIYLGMHS++DI+GGLA G+ 
Sbjct  90   CLSGYLLHYVSSSVGFENVSIQYYGFSLACLLVALIAFGRIYLGMHSVVDIVGGLAIGVL  149

Query  911  ILAFWLSV  934
            IL+ WL+V
Sbjct  150  ILSLWLTV  157



>gb|EMT19170.1| Sphingosine-1-phosphate phosphatase 1 [Aegilops tauschii]
Length=367

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = +2

Query  536  SGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSH  715
            SGH KLARQMTLL+AFCDY+GN +KD+VSAPRP SPPVRR+TATEDEKENA+EYG+PSSH
Sbjct  44   SGHGKLARQMTLLLAFCDYLGNAVKDLVSAPRPCSPPVRRVTATEDEKENAMEYGLPSSH  103

Query  716  TLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGL  895
             LNT+CL GY+LHYVL++   +       G++L  +LV LIG+ R+YLGMHSL D+I G+
Sbjct  104  ALNTVCLMGYMLHYVLTYGPCDGFMIA-TGLSLAFMLVTLIGIARVYLGMHSLTDVIAGI  162

Query  896  AFGLAILAFWLSV  934
            +FG+ ILAFWL V
Sbjct  163  SFGIVILAFWLVV  175



>ref|XP_001756514.1| predicted protein [Physcomitrella patens]
 gb|EDQ78910.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = +2

Query  332  VVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFYT  511
            V+I+ + + T+ +R L QP+V R+V SG P+ L IQ+Y+H  LD     ++  VS PFYT
Sbjct  40   VIIARLSSCTEYLRGLVQPFVLRRVESGVPVILAIQEYRHWLLDNILGTIATVVSAPFYT  99

Query  512  AFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENAL  691
              LP LFW G  KL RQ+TLL+A C Y+GN  KD V APRP + PV RI +   EK+ + 
Sbjct  100  VLLPMLFWHGQPKLGRQLTLLLATCIYVGNSFKDTVCAPRPPA-PVCRIASIGSEKKGSE  158

Query  692  EYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHS  871
            EYG+PSSH++N  C SGY+L+Y+       D  T      + + LV L+  G +YLGMHS
Sbjct  159  EYGLPSSHSINITCFSGYILYYLWGQKVEPD--TIFMASIMFTTLVTLVIFGTLYLGMHS  216

Query  872  LIDIIGGLAFGLAILAFWLSV  934
             IDI  G A G ++L  W +V
Sbjct  217  PIDIFVGCAIGASLLLVWFNV  237



>gb|AFW67294.1| hypothetical protein ZEAMMB73_714627 [Zea mays]
Length=310

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  563  MTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSG  742
            MTLLMAFCDY+GN +KD+VSAPRP SPP+RR+TATEDEKENA+EYG+PSSH LNT+CL+G
Sbjct  1    MTLLMAFCDYLGNSVKDMVSAPRPCSPPIRRVTATEDEKENAMEYGLPSSHALNTVCLTG  60

Query  743  YLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
            YLLHYVL++ ++  L T  AG++L  LLV L+G+ RIYLGMHSL D++ G+ FG+ ILAF
Sbjct  61   YLLHYVLTYGEHGSL-TVAAGLSLALLLVMLVGIARIYLGMHSLTDVVAGIGFGIVILAF  119

Query  923  WLSV  934
            WL+V
Sbjct  120  WLAV  123



>ref|XP_008669419.1| PREDICTED: lipid phosphate phosphatase delta-like [Zea mays]
Length=129

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +H  LD FFS LSC +SVPFYT FLP LFWSGH +LARQMTLLMAFCDY+GN +KD+
Sbjct  45   RKLEHKMLDNFFSVLSCVISVPFYTGFLPLLFWSGHGRLARQMTLLMAFCDYLGNSVKDM  104

Query  617  VSAPRPTSPPVRRITATEDEKENAL  691
            VSAPRP S P+RR+TATEDEKENA+
Sbjct  105  VSAPRPCSLPIRRVTATEDEKENAM  129



>ref|XP_001753925.1| predicted protein [Physcomitrella patens]
 gb|EDQ81247.1| predicted protein [Physcomitrella patens]
Length=420

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 130/203 (64%), Gaps = 3/203 (1%)
 Frame = +2

Query  326  SWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPF  505
            +W++ + +  +++ +R+L QP+V R V  G P+ L IQKY+H  LD F   L+  VS  F
Sbjct  33   TWLIFAQLTALSKHLRALVQPFVLRHVEEGVPVVLAIQKYRHPQLDYFVGVLATLVSTEF  92

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            Y+  LP LFW G +KLARQ+TLLMA C Y+GNC+KDVV A     PPV R+ ++  E+ +
Sbjct  93   YSLVLPLLFWHGQTKLARQLTLLMATCIYVGNCVKDVVCA-PRPPPPVHRVVSSGTEETS  151

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            A EYG+PSSHT+N IC +GY+LHY+  + +  +         L +++V L+  GR+YLGM
Sbjct  152  AEEYGLPSSHTINIICFAGYVLHYL--NGQLVEPRAFATTAVLFTIVVLLVISGRLYLGM  209

Query  866  HSLIDIIGGLAFGLAILAFWLSV  934
            HS ID++ G   G  +L  W  +
Sbjct  210  HSPIDVLAGCTIGTVLLLCWCCI  232



>ref|XP_005844914.1| hypothetical protein CHLNCDRAFT_138478 [Chlorella variabilis]
 gb|EFN52812.1| hypothetical protein CHLNCDRAFT_138478 [Chlorella variabilis]
Length=479

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 122/210 (58%), Gaps = 7/210 (3%)
 Frame = +2

Query  323  ASWVVISSIFNVTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVP  502
            A ++ +  I  +   +R+  +P     V SG  + L  Q++Q  +L   F+  S SVSV 
Sbjct  25   AGFLTLVMIPRLHTPVRAWLRPHAIHHVESGLDLVLAAQRWQSPWLTQLFTKSSHSVSVT  84

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTS-----PPVRRITAT  667
            FY +FLP LFW G  +L R +  LMA   Y+GN IKD+V +PRP S       ++ + A+
Sbjct  85   FYASFLPMLFWLGLPELGRDLVCLMALALYVGNAIKDLVCSPRPLSVSYGKQRLKFLGAS  144

Query  668  EDEKE-NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgligl  844
            ++E E NA EYG+PSSHTLNT+CL+ Y++ + L   +     T      L++L V  I  
Sbjct  145  DEEVELNAKEYGLPSSHTLNTLCLN-YMIVWYLYDRQLIAAGTAAILYCLVALWVMWIAA  203

Query  845  griylgMHSLIDIIGGLAFGLAILAFWLSV  934
             R+YLG+H+ IDI+ G   GLA+L  ++++
Sbjct  204  SRLYLGLHTPIDILAGAVAGLAVLVCFIAI  233



>gb|KFH62932.1| hypothetical protein MVEG_11456 [Mortierella verticillata NRRL 
6337]
Length=523

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 99/186 (53%), Gaps = 5/186 (3%)
 Frame = +2

Query  368  IRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGH  544
            +R+  + W+   + S TPI   +Q K +H  LD +F+  + S +  F+   LP LFW G 
Sbjct  42   LRATLRRWLLPYIRSETPILHAMQLKVRHPVLDVYFTMTAFSGNHTFFMIALPVLFWFGF  101

Query  545  SKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLN  724
            S++AR  TL+ A   Y     KD +  PRP SPP+ R++ +   K   LEYG PSSH+ N
Sbjct  102  SEIARGFTLIAAMGVYWAGFFKDYLCLPRPLSPPIVRLSRS---KSTCLEYGFPSSHSTN  158

Query  725  TICLSGYLL-HYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAF  901
             I ++ +L  H + +   +    T    I  + +    I  GR+Y GMHS+ D IGG   
Sbjct  159  AISVALFLYCHLLTTDPASWSPYTRELSIFGLIVYAVSIVYGRLYCGMHSITDCIGGSLI  218

Query  902  GLAILA  919
            G++I A
Sbjct  219  GISIWA  224



>gb|KDD74787.1| hypothetical protein H632_c1074p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=200

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 82/141 (58%), Gaps = 9/141 (6%)
 Frame = +2

Query  518  LPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT-------SPPVRRITATEDE  676
            LP +FW+G  +L  Q+  LMA   Y+GN IKD+V APRP        +P VR +    +E
Sbjct  2    LPAIFWAGLPELGMQLVTLMALSLYVGNAIKDLVCAPRPMALRPRRGAPRVRLLGRAFEE  61

Query  677  KE-NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgri  853
             E NA EYG+PSSH +N++C + Y++ Y+L        ST     + + + V  I + R+
Sbjct  62   AELNAREYGLPSSHAMNSVCFNFYVVWYLLDRGLLAS-STAGVLYSAVLVWVLWIAVSRL  120

Query  854  ylgMHSLIDIIGGLAFGLAIL  916
            YLG+H+ +DI+ G   GL ++
Sbjct  121  YLGLHTPVDILAGALAGLTVV  141



>ref|XP_504221.1| YALI0E21197p [Yarrowia lipolytica]
 emb|CAG79816.1| YALI0E21197p [Yarrowia lipolytica CLIB122]
Length=559

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 97/198 (49%), Gaps = 13/198 (7%)
 Frame = +2

Query  359  TQKIRSLTQPWVSRQVVS-------GTPISLQIQKYQHG-YLDGFFSGLSCSVSVPFYTA  514
            T   +S   PW  R   +        TP   QIQK     +LD +F+  +   +  FY  
Sbjct  61   TDHYKSRMSPWRYRMRSAMLPLIRWETPYLAQIQKSSRNIWLDVYFAMTANLGTHTFYVI  120

Query  515  FLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALE  694
             LP LFW G + +AR +  ++A+  Y+   IKD++  PRP SPP+ RIT +      ALE
Sbjct  121  MLPVLFWFGQADMARGLVFVLAYGVYVSGVIKDLLCLPRPLSPPLHRITMS---GSAALE  177

Query  695  YGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSL  874
            YG PS+HT N + ++   L  +     N    +  +  AL  L    I  GRIY GMH  
Sbjct  178  YGFPSTHTTNAVSVTLLFLQKLYECKDNLSSFSFESLRALCVLYGASIICGRIYCGMHGF  237

Query  875  IDIIGGLAFGLAILAFWL  928
            +D+I G  F L  L +W+
Sbjct  238  LDVISG--FLLGALLWWI  253



>dbj|GAA96100.1| hypothetical protein E5Q_02761 [Mixia osmundae IAM 14324]
Length=1137

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 73/126 (58%), Gaps = 5/126 (4%)
 Frame = +2

Query  389  WVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQM  565
            W+ R V   TP+ L++Q +Y+  +LD +F   S   +  F+ A LP  +W G     RQ+
Sbjct  229  WMVRHVEYETPLLLELQTRYRTKWLDHYFVQTSLLGTHTFFLAVLPLFWWFGQPDWGRQL  288

Query  566  TLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGY  745
               +A   ++ + +KD    PRP SPP+ R+T +     +ALEYG+PS+H+  T+C++  
Sbjct  289  LYCLAIGGWLSSYLKDYFCIPRPFSPPLTRLTVS----YHALEYGLPSTHSTTTVCIALS  344

Query  746  LLHYVL  763
            L+ +VL
Sbjct  345  LIEHVL  350



>gb|KEI39240.1| hypothetical protein L969DRAFT_103179 [Mixia osmundae IAM 14324]
Length=1139

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 73/126 (58%), Gaps = 5/126 (4%)
 Frame = +2

Query  389  WVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQM  565
            W+ R V   TP+ L++Q +Y+  +LD +F   S   +  F+ A LP  +W G     RQ+
Sbjct  231  WMVRHVEYETPLLLELQTRYRTKWLDHYFVQTSLLGTHTFFLAVLPLFWWFGQPDWGRQL  290

Query  566  TLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGY  745
               +A   ++ + +KD    PRP SPP+ R+T +     +ALEYG+PS+H+  T+C++  
Sbjct  291  LYCLAIGGWLSSYLKDYFCIPRPFSPPLTRLTVS----YHALEYGLPSTHSTTTVCIALS  346

Query  746  LLHYVL  763
            L+ +VL
Sbjct  347  LIEHVL  352



>ref|XP_003675262.1| hypothetical protein NCAS_0B08070 [Naumovozyma castellii CBS 
4309]
 emb|CCC68891.1| hypothetical protein NCAS_0B08070 [Naumovozyma castellii CBS 
4309]
Length=404

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 87/156 (56%), Gaps = 4/156 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            + Y+ G+ D FF   +   +  FY  FLP   W G+ +L R M  ++A+  Y+   +KD 
Sbjct  71   ETYRTGFGDVFFPYTALMGAHTFYVIFLPMPIWFGYHELTRDMVYILAYSIYLSGYLKDY  130

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPPVRRIT +   K  A EYG PSSH+ N   +S  L  + +  +K+     +
Sbjct  131  LCLPRPKSPPVRRITLS---KYTAKEYGAPSSHSANATGVS-MLFFWRILQSKDLPSMMK  186

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFG  904
            +  + ++S+    + +GR+Y GMH ++D+I G A G
Sbjct  187  LGLLGIVSIYYLTLVVGRVYCGMHGMLDLISGSAVG  222



>gb|KFO84422.1| Sphingosine-1-phosphate phosphatase 2, partial [Buceros rhinoceros 
silvestris]
Length=328

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 85/153 (56%), Gaps = 8/153 (5%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   +   FY  FLPF++W+    ++R+M ++ +   Y+G   KD
Sbjct  8    VKNYFYYYLFKFSAALGEEI---FYITFLPFIYWNIDHSVSRRMVIVWSIVMYIGQVSKD  64

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLST  793
            ++  PRP SPPV ++ A  + + NA EYGMPS+H +    +S  LL    +H K      
Sbjct  65   ILKWPRPLSPPVVKLEARTNAETNA-EYGMPSTHAMAATAISFSLLTATANHYKYP----  119

Query  794  EiagialisllvgliglgriylgMHSLIDIIGG  892
               G+    +   L+ L R+Y GMH+++D+IGG
Sbjct  120  FELGLVAALVFSALVCLSRLYTGMHTVLDVIGG  152



>gb|EPS32686.1| hypothetical protein PDE_07646 [Penicillium oxalicum 114-2]
Length=530

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 84/159 (53%), Gaps = 3/159 (2%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLPFLFW GH+ L R +  ++A   ++   IKD+
Sbjct  52   EKMRTPALDSYFAFTANLGTHTFFMVFLPFLFWCGHTSLGRGLVHILAAGVFISGFIKDL  111

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L  + S        T 
Sbjct  112  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYALALLKSPDSTVPSQTN  168

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFGLAI  913
                 +  L V  I +GR+Y GMH   D++ G   G  I
Sbjct  169  FILQIVTYLYVTSIVIGRLYCGMHGFFDVVIGCLLGALI  207



>ref|XP_007007244.1| hypothetical protein TREMEDRAFT_74652 [Tremella mesenterica DSM 
1558]
 gb|EIW67130.1| hypothetical protein TREMEDRAFT_74652 [Tremella mesenterica DSM 
1558]
Length=538

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 80/144 (56%), Gaps = 4/144 (3%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            F+  FLP  F+SGH+   R M  ++ F  Y+ +C KD++  PRP SPP+ R++ +     
Sbjct  120  FFLTFLPIFFFSGHTAKGRGMLSVVGFGIYLSSCAKDLMCCPRPYSPPLIRLSMS----T  175

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            +A EYG  SSH+ NTI ++ YL  ++    K    ST + G  ++ +    +  GR+Y G
Sbjct  176  HADEYGFLSSHSTNTITVALYLAQWLWEVRKQTSTSTLLVGFTVLLIYAASVVGGRLYTG  235

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHS  D+I G   G A  A WL +
Sbjct  236  MHSTADVIVGSLLGAACWAIWLVI  259



>ref|XP_007755493.1| hypothetical protein A1O7_03280 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ62839.1| hypothetical protein A1O7_03280 [Cladophialophora yegresii CBS 
114405]
Length=532

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 83/154 (54%), Gaps = 6/154 (4%)
 Frame = +2

Query  446  QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSA  625
            + G LD +F+  +   +  F+   LP LFW G+++LAR M  ++A   +    IKD++  
Sbjct  52   RSGALDTYFAFTANLGTHTFFMIMLPILFWCGNTRLARAMVHVLAAGVFFSGFIKDLLCL  111

Query  626  PRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE-DLSTEia  802
            PRP SPP+ RIT +      ALEYG PS+H+ N + ++ Y L+  L H  NE D + +  
Sbjct  112  PRPLSPPLTRITMS---GSAALEYGFPSTHSTNAVSVAVYSLY--LLHQPNEMDPNVKSG  166

Query  803  gialisllvgliglgriylgMHSLIDIIGGLAFG  904
                       I LGR+Y GMH   D+I G A G
Sbjct  167  LQIAAYFYAISIVLGRLYCGMHGFFDVIWGSALG  200



>ref|XP_008727660.1| hypothetical protein G647_05105 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI23305.1| hypothetical protein G647_05105 [Cladophialophora carrionii CBS 
160.54]
Length=532

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 84/154 (55%), Gaps = 6/154 (4%)
 Frame = +2

Query  446  QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSA  625
            + G LD +F+  +   +  F+   LP LFW G+++L R M  ++A   +    IKD++  
Sbjct  52   RSGALDTYFAFTANLGTHTFFMIMLPILFWCGNTRLGRAMVHVLASGVFFSGFIKDLLCL  111

Query  626  PRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE-DLSTEia  802
            PRP SPP+ RIT +      ALEYG PS+H+ N + ++ Y LH  L H  NE D + ++ 
Sbjct  112  PRPLSPPLTRITMS---GSAALEYGFPSTHSTNAVSVAVYSLH--LLHQSNEMDPNLKLG  166

Query  803  gialisllvgliglgriylgMHSLIDIIGGLAFG  904
               +       I LGR+Y GMH   D+I G A G
Sbjct  167  LQIMAYFYAVSIVLGRLYCGMHGFFDVIWGSALG  200



>ref|XP_011390033.1| hypothetical protein UMAG_03610 [Ustilago maydis 521]
 gb|KIS68523.1| hypothetical protein UMAG_03610 [Ustilago maydis 521]
Length=682

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 89/173 (51%), Gaps = 10/173 (6%)
 Frame = +2

Query  419  PISLQIQK-YQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYM  595
            P+  Q Q+  +  +LD +F   S   +  F+  FLP +FW G  +  R +  ++AF  Y+
Sbjct  144  PLHQQHQRLMRRPWLDRYFVNTSLLGTHSFFLVFLPMVFWLGSPRFGRGLINVLAFGVYL  203

Query  596  GNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTK  775
             + IKD+   PRP SPPV R+T       + LEYG PS+H+ N++ ++ Y+  +V    +
Sbjct  204  SSAIKDLFCVPRPYSPPVTRLTV----GTHHLEYGFPSTHSTNSVSIALYVYLWVRRMRQ  259

Query  776  NED-----LSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
              D     L       A +      +  GRIY GMHS+ID I G A G AI A
Sbjct  260  AADPTHSTLFDSAFWEAGLLFYATSVVYGRIYAGMHSVIDCIAGSALGAAITA  312



>ref|XP_002176056.1| sphingosine-1-phosphate phosphatase [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB09763.1| sphingosine-1-phosphate phosphatase [Schizosaccharomyces japonicus 
yFS275]
Length=412

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 99/188 (53%), Gaps = 9/188 (5%)
 Frame = +2

Query  365  KIRSLTQPWVSRQVVSGTPISLQIQK-YQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSG  541
            +IR++  P +  +    TP+   +QK ++   LD +F+  +   +  F+   LP  FWSG
Sbjct  40   RIRTILYPIIRGE----TPLISSLQKRFRKPSLDTYFALSAFFGTHFFFLISLPISFWSG  95

Query  542  HSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTL  721
            H      M  L A   Y+   IKD    PRP SPPV+RI+ T   K    EYG PS+HT+
Sbjct  96   HLSFTIAMVQLFASGCYITGFIKDYCCLPRPRSPPVKRISYT---KGANFEYGFPSTHTM  152

Query  722  NTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAF  901
            N +  + Y L  VL ++++  L      I++I L    I +GR+Y GMH  +DI  G   
Sbjct  153  NAVSTATYSLFTVLHYSRDVPLWQTFTLISVIFLYAFSIMIGRLYCGMHGFLDISSGCVM  212

Query  902  GLAILAFW  925
            G+ ILA++
Sbjct  213  GV-ILAYF  219



>ref|XP_008087014.1| Acid phosphatase/Vanadium-dependent haloperoxidase [Glarea lozoyensis 
ATCC 20868]
 gb|EPE25695.1| Acid phosphatase/Vanadium-dependent haloperoxidase [Glarea lozoyensis 
ATCC 20868]
Length=590

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 83/161 (52%), Gaps = 3/161 (2%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
             K +   LD +F+  +   +  F+   LP LFW GH+ L R M  ++A   ++   +KD 
Sbjct  73   NKMRSPALDSYFAITANLGTHTFFMVVLPILFWCGHTSLGRGMVHILASGVFITGFLKDF  132

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
             S PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L  V S       ST+
Sbjct  133  FSLPRPLSPPLQRITMS---GSAALEYGFPSTHSANAVSVAVYALFSVNSPESQLQASTK  189

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
            +    +       I LGR+Y GMH  +D+I G   G  I A
Sbjct  190  LIIEVVSYSYAFSIILGRLYCGMHGFLDVIVGSIIGAMISA  230



>ref|XP_007775437.1| hypothetical protein CONPUDRAFT_133096 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW74419.1| hypothetical protein CONPUDRAFT_133096 [Coniophora puteana RWD-64-598 
SS2]
Length=524

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 95/193 (49%), Gaps = 9/193 (5%)
 Frame = +2

Query  371  RSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHS  547
            R+  + W  + V   +P+  ++Q K +  +LD +F   S   +  F+   LP LF+ G+ 
Sbjct  56   RAAIRAWALKAVERESPVIARVQAKVRRPWLDAYFVSTSSLGTHTFFMIALPMLFFFGYD  115

Query  548  KLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNT  727
            +L R +   +AF  Y  + +KD+V +PRP SPPV R+T +       LEYG PS+H+ N 
Sbjct  116  ELGRGLLFNLAFGVYTSSFVKDLVCSPRPFSPPVTRLTISTHH----LEYGFPSTHSTNA  171

Query  728  ICLSGYLLHYV-LSHTKNEDLSTEiagialisllvgliglgr---iylgMHSLIDIIGGL  895
            + ++ ++  +V  ++T      T        ++L           +Y  MHS  D + G+
Sbjct  172  VSIALFVFSHVHAAYTAPASTMTPAGYALACTVLAVYAFSIVLGRVYTAMHSATDCVAGV  231

Query  896  AFGLAILAFWLSV  934
              G A+ A +  V
Sbjct  232  VMGAAVWAAYEGV  244



>emb|CCF51494.1| related to YSR3-dihydrosphingosine-1-phosphate phosphatase [Ustilago 
hordei]
Length=695

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 86/160 (54%), Gaps = 9/160 (6%)
 Frame = +2

Query  455  YLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRP  634
            +LD +F   S   +  F+  FLP +FW G  +  R M  ++AF  Y+ + IKD+   PRP
Sbjct  163  WLDRYFVNTSLLGTHSFFLVFLPMIFWLGDPRFGRGMINVLAFGVYLSSAIKDLFCLPRP  222

Query  635  TSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYV-----LSHTKNEDLSTEi  799
             SPPV R+T       + LEYG PS+H+ N++ ++ Y+  ++     ++  ++  + +  
Sbjct  223  YSPPVTRLTV----GTHHLEYGFPSTHSTNSVSIALYIYLWIRKLRQITPVESIGIFSSP  278

Query  800  agialisllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
               A +      +  GRIY GMHS+ID I G A G AI A
Sbjct  279  LWEAGLLFYATSVVYGRIYAGMHSIIDCIAGSALGAAITA  318



>gb|KIW71288.1| hypothetical protein PV04_03471 [Capronia semiimmersa]
Length=533

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 82/153 (54%), Gaps = 3/153 (2%)
 Frame = +2

Query  446  QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSA  625
            + G LD +F+  +   +  F+   LP LFW G++++AR M  ++A   +    IKD++  
Sbjct  52   RSGALDTYFAFTANLGTHTFFMIMLPILFWCGNTRVARAMVHVLASGVFFSGFIKDLLCL  111

Query  626  PRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiag  805
            PRP SPP+ RIT +      ALEYG PS+H+ N + ++ Y L+++       D +  I  
Sbjct  112  PRPLSPPLTRITMS---GSAALEYGFPSTHSTNAVSVAVYCLYFLHQPNNEMDPNLRIGL  168

Query  806  ialisllvgliglgriylgMHSLIDIIGGLAFG  904
              +       I LGR+Y GMH   D+I G A G
Sbjct  169  QIIAHFYAMSIVLGRLYCGMHGFFDVIWGSALG  201



>gb|EST09595.1| hypothetical protein PSEUBRA_SCAF10g05555 [Pseudozyma brasiliensis 
GHG001]
Length=679

 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 90/175 (51%), Gaps = 12/175 (7%)
 Frame = +2

Query  419  PISLQIQKY-QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYM  595
            PI  + Q + +  +LD +F   S   +  F+  FLP +FW G  +  R +  ++AF  Y+
Sbjct  137  PIHERHQNWIRRPWLDRYFVNTSLLGTHSFFLVFLPMVFWLGSPRFGRGLINVLAFGVYI  196

Query  596  GNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTK  775
             + IKD+   PRP SPPV R+T       + LEYG PS+H+ N++ ++ Y+  +V    +
Sbjct  197  SSAIKDLFCIPRPYSPPVTRLTV----GTHHLEYGFPSTHSTNSVSIALYIYLWVRKMRE  252

Query  776  NEDLSTEiag-------ialisllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
               L +  +         A +      +  GRIY GMHS+ID I G A G AI A
Sbjct  253  AAQLDSTGSALFDSWLWEAGLLFYATSVVYGRIYAGMHSIIDCIAGSALGAAITA  307



>ref|XP_007711108.1| hypothetical protein COCCADRAFT_92919 [Bipolaris zeicola 26-R-13]
 gb|EUC34649.1| hypothetical protein COCCADRAFT_92919 [Bipolaris zeicola 26-R-13]
 gb|EUN27315.1| hypothetical protein COCVIDRAFT_37630 [Bipolaris victoriae FI3]
Length=559

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 88/169 (52%), Gaps = 3/169 (2%)
 Frame = +2

Query  422  ISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGN  601
            ++L   K +  +LD +F+  +   +  F+  FLP  FW G++ + R    ++A   Y   
Sbjct  52   LALLQDKLRSPFLDSYFAYTANLGTHTFFMVFLPIQFWCGYTSVGRATVFMLAAGVYSTG  111

Query  602  CIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE  781
             +KD++  PRP SPP+ RI+ +      ALEYG PSSH+ N + ++ Y ++ +    + +
Sbjct  112  FLKDLLCLPRPLSPPLARISMS---GSAALEYGFPSSHSANAVSVAFYAIYTLRQSAQQD  168

Query  782  DLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWL  928
            + +  +   AL       I  GR+Y GMH  +D+I G   G  I AF L
Sbjct  169  NPNVNMGLQALFYFYALSIIAGRLYCGMHGFLDVIVGSVMGALITAFQL  217



>ref|XP_007695004.1| hypothetical protein COCSADRAFT_177466 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD69779.1| hypothetical protein COCSADRAFT_177466 [Bipolaris sorokiniana 
ND90Pr]
Length=559

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 88/169 (52%), Gaps = 3/169 (2%)
 Frame = +2

Query  422  ISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGN  601
            ++L   K +  +LD +F+  +   +  F+  FLP  FW G++ + R    ++A   Y   
Sbjct  52   LALLQDKLRSPFLDSYFAYTANLGTHTFFMVFLPIQFWCGYTSVGRATVFMLAAGVYSTG  111

Query  602  CIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE  781
             +KD++  PRP SPP+ RI+ +      ALEYG PSSH+ N + ++ Y ++ +    + +
Sbjct  112  FLKDLLCLPRPLSPPLARISMS---GSAALEYGFPSSHSANAVSVAFYAIYTLRQSAQQD  168

Query  782  DLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWL  928
            + +  +   AL       I  GR+Y GMH  +D+I G   G  I AF L
Sbjct  169  NTNLNMGLQALFYFYALSIIAGRLYCGMHGFLDVIVGSVMGALITAFQL  217



>ref|XP_009029573.1| hypothetical protein HELRODRAFT_122845, partial [Helobdella robusta]
 gb|ESN92334.1| hypothetical protein HELRODRAFT_122845, partial [Helobdella robusta]
Length=226

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 81/146 (55%), Gaps = 11/146 (8%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FY +F PF FW+    + R++ +      Y+G   KD++  PRPTSPPV ++     EK 
Sbjct  21   FYISFFPFWFWNIDGYVGRRLCIFWGAFMYLGQATKDILKIPRPTSPPVVKL-----EKR  75

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
             +LEYGMPS+H +    +   L   +   T++  L   +  ++   +   ++ L RIY+G
Sbjct  76   YSLEYGMPSTHAM----VGAGLPFGIYFLTRDRYLFPSMVTLSGAIIWCSVVCLSRIYMG  131

Query  863  MHSLIDIIGGL--AFGLAILAFWLSV  934
            MH+L+DI+GGL   F L  + F+ S+
Sbjct  132  MHTLLDIVGGLLYVFSLMFVCFYFSI  157



>ref|XP_007682752.1| hypothetical protein COCMIDRAFT_81233 [Bipolaris oryzae ATCC 
44560]
 gb|EUC50776.1| hypothetical protein COCMIDRAFT_81233 [Bipolaris oryzae ATCC 
44560]
Length=560

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 88/169 (52%), Gaps = 3/169 (2%)
 Frame = +2

Query  422  ISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGN  601
            ++L   K +  +LD +F+  +   +  F+  FLP  FW G++ + R    ++A   Y   
Sbjct  52   LALLQDKLRSPFLDSYFAYTANLGTHTFFMVFLPIQFWCGYTSVGRATVFMLAAGVYSTG  111

Query  602  CIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE  781
             +KD++  PRP SPP+ RI+ +      ALEYG PSSH+ N + ++ Y ++ +    + +
Sbjct  112  FLKDLLCLPRPLSPPLARISMS---GSAALEYGFPSSHSANAVSVAFYAIYTLRQSAQQD  168

Query  782  DLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWL  928
            + +  +   AL       I  GR+Y GMH  +D+I G   G  I AF L
Sbjct  169  NANLNMGLQALFYFYALSIIAGRLYCGMHGFLDVIVGSVMGALITAFQL  217



>dbj|GAM34868.1| hypothetical protein TCE0_015f02734 [Talaromyces cellulolyticus]
Length=518

 Score = 79.0 bits (193),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+T FLP LFW G+  L R M  ++A   +    IKD++  PRP 
Sbjct  57   LDSYFAFTANLGTHTFFTVFLPVLFWCGYPSLGRGMVNVLAAGVFFSGFIKDLLCLPRPL  116

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
            SPP++RIT +      ALEYG PS+H+ N + ++ YLL  + S T
Sbjct  117  SPPLQRITMS---GSAALEYGFPSTHSTNAVSVAIYLLSLLWSDT  158



>dbj|BAE63171.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=479

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLP LFW+G++ L R M  L+A   Y    IKD+
Sbjct  4    EKVRTPALDSYFAFTANLGTHTFFMVFLPILFWNGYTSLGRGMVNLLASGVYFSGFIKDL  63

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLL  751
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L
Sbjct  64   LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYAL  105



>ref|XP_011274514.1| sphingosine-1-phosphate phosphatase [Wickerhamomyces ciferrii]
 gb|AEX09419.1| sphingolipid long-chain base-1-phosphate phosphatase [Wickerhamomyces 
ciferrii]
 emb|CCH43610.1| sphingosine-1-phosphate phosphatase [Wickerhamomyces ciferrii]
Length=541

 Score = 78.6 bits (192),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 68/136 (50%), Gaps = 8/136 (6%)
 Frame = +2

Query  365  KIRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSG  541
            K R    PW+     S +PI   IQ   +  +LD FF+  +   S  FY   LP   W G
Sbjct  105  KFRQFLLPWIR----SESPILSSIQSNIRTNFLDYFFAYTANFASHTFYVLMLPLPIWCG  160

Query  542  HSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTL  721
            + + AR +  ++ +  Y    +KD    PRP SPP+ RIT +      A EYG PSSH+ 
Sbjct  161  YGREARDLIFIIGYGIYFTGFLKDFCCLPRPRSPPLHRITLS---GYTAKEYGFPSSHSA  217

Query  722  NTICLSGYLLHYVLSH  769
            N   +S YLL  ++++
Sbjct  218  NATAVSLYLLTKIINN  233



>dbj|GAC93675.1| hypothetical protein PHSY_001240 [Pseudozyma hubeiensis SY62]
Length=770

 Score = 79.0 bits (193),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 82/160 (51%), Gaps = 9/160 (6%)
 Frame = +2

Query  455  YLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRP  634
            +LD +F   S   +  F+  FLP +FW G  +  R +  ++AF  Y+ + IKD+   PRP
Sbjct  242  WLDRYFVNTSLLGTHSFFLVFLPMVFWLGSPRFGRGLINVLAFGVYLSSAIKDLFCVPRP  301

Query  635  TSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiag---  805
             SPPV R+T       + LEYG PS+H+ N++ ++ Y+  +V    +  D S        
Sbjct  302  YSPPVTRLTV----GTHHLEYGFPSTHSTNSVSIALYIYLWVRKMREAADPSDSSLFDSY  357

Query  806  --ialisllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
               A +      +  GRIY GMHS+ID I G A G  I A
Sbjct  358  LWEAGLLFYATSVVYGRIYAGMHSVIDCIAGSALGAGITA  397



>ref|XP_002145408.1| PAP2 domain protein [Talaromyces marneffei ATCC 18224]
 gb|EEA28893.1| PAP2 domain protein [Talaromyces marneffei ATCC 18224]
 gb|KFX43169.1| Dihydrosphingosine 1-phosphate phosphatase [Talaromyces marneffei 
PM1]
Length=520

 Score = 78.6 bits (192),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 64/112 (57%), Gaps = 3/112 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
             K +   LD +F+  +   +  F+T FLP LFW G+  L R M  ++A   +    +KD+
Sbjct  50   DKVRSPMLDSYFAFTANLGTHTFFTVFLPVLFWCGYPSLGRGMVNVLAAGVFFSGFLKDL  109

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ YLL  + S T
Sbjct  110  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAIYLLSLLWSDT  158



>gb|KIN01283.1| hypothetical protein OIDMADRAFT_54416 [Oidiodendron maius Zn]
Length=584

 Score = 78.6 bits (192),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 63/110 (57%), Gaps = 3/110 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
             K +   LD +F+  +   +  F+  FLP LFW GH+ L R M  ++A   +    IKD+
Sbjct  73   DKMRSPTLDSYFAITANLGTHTFFMVFLPILFWCGHTSLGRGMVHILASGVFFTGFIKDM  132

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLS  766
            +S PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L  + S
Sbjct  133  LSLPRPLSPPLQRITMS---GSAALEYGFPSTHSANAVSVAVYTLFAIHS  179



>ref|XP_002381410.1| PAP2 domain protein [Aspergillus flavus NRRL3357]
 ref|XP_001824304.2| PAP2 domain protein [Aspergillus oryzae RIB40]
 gb|EED49509.1| PAP2 domain protein [Aspergillus flavus NRRL3357]
 gb|EIT82656.1| sphingoid base-phosphate phosphatase [Aspergillus oryzae 3.042]
 gb|KDE76114.1| sphingoid base-phosphate phosphatase [Aspergillus oryzae 100-8]
 gb|KJJ33081.1| PAP2 superfamily protein [Aspergillus flavus AF70]
Length=531

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLP LFW+G++ L R M  L+A   Y    IKD+
Sbjct  50   EKVRTPALDSYFAFTANLGTHTFFMVFLPILFWNGYTSLGRGMVNLLASGVYFSGFIKDL  109

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLL  751
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L
Sbjct  110  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYAL  151



>gb|KJK68678.1| PAP2 superfamily protein [Aspergillus parasiticus SU-1]
Length=531

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLP LFW+G++ L R M  L+A   Y    IKD+
Sbjct  50   EKVRTPALDSYFAFTANLGTHTFFMVFLPILFWNGYTSLGRGMVNLLASGVYFSGFIKDL  109

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLL  751
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L
Sbjct  110  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYAL  151



>gb|KGK36644.1| hypothetical protein JL09_g4219 [Pichia kudriavzevii]
Length=369

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 94/186 (51%), Gaps = 13/186 (7%)
 Frame = +2

Query  356  VTQKIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFW  535
            V  KIR   +P++  ++    PI   IQ +   +LD +F   +   S  FY   LP   W
Sbjct  26   VLYKIRHKIRPYIDYEL----PILEYIQSFHRNWLDQYFMYSANVGSHTFYVLMLPLPAW  81

Query  536  SGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSH  715
             G   L R +  ++    ++   +KD+++ PRPTSPP++R+T +    +   EYG PSSH
Sbjct  82   CGSLNLLRDLVQVLGLGIFLTGVVKDMLNLPRPTSPPLKRLTMSHYTSK---EYGCPSSH  138

Query  716  TLNTICLSGYLLHYVLSHTKNEDLST--EiagialisllvgliglgriylgMHSLIDIIG  889
            + N   +S      +L HT + +LS   +   I +       + LGR+Y GMH L+D++ 
Sbjct  139  SANATSVS----MVILIHTLSSELSLFWKSTVILITIGYWITLLLGRLYCGMHGLVDVLS  194

Query  890  GLAFGL  907
            G   G+
Sbjct  195  GTLVGI  200



>gb|EIE75966.1| hypothetical protein RO3G_00670 [Rhizopus delemar RA 99-880]
Length=333

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 86/172 (50%), Gaps = 7/172 (4%)
 Frame = +2

Query  416  TPISLQIQKY-QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDY  592
            TPI   +QK+ ++  LD +F   +   +  F+  FLP L W G+++L R    L A   +
Sbjct  46   TPIIASLQKHIRNSVLDNYFVWTANLGTHTFFMVFLPILIWFGNAELGRNACFLTASGVF  105

Query  593  MGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
                +KD +  PRP SPPV R+T +      ALEYG PS+H+ N++ ++ + +       
Sbjct  106  WSGFLKDFLCLPRPLSPPVHRLTMSPSV---ALEYGFPSTHSTNSVSVALFFISVACEKI  162

Query  773  KNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWL  928
              E   T    I         +  GRIY GMHS+ D +GG    LA L +W+
Sbjct  163  TPES-PTRFISILACIFYAASVVFGRIYCGMHSVTDCVGGTV--LAYLVYWV  211



>gb|KEQ91888.1| hypothetical protein AUEXF2481DRAFT_8118 [Aureobasidium subglaciale 
EXF-2481]
Length=4935

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 75/127 (59%), Gaps = 6/127 (5%)
 Frame = +2

Query  416  TPISLQIQKY-QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDY  592
            TP   ++Q+  +  +LD +F+  +   +  F+ A LP  FW G++ + R +  ++A   +
Sbjct  60   TPYLAKVQQTCRTPFLDSYFAMTANLGTHTFFMAALPVCFWCGYTSVGRALVHMLALGVF  119

Query  593  MGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
            +   IKD+V  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L+ +  HT
Sbjct  120  ISGWIKDLVCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVATYFLYQL--HT  174

Query  773  KNEDLST  793
              +D+++
Sbjct  175  SADDVAS  181



>ref|XP_008025524.1| hypothetical protein SETTUDRAFT_135482 [Setosphaeria turcica 
Et28A]
 gb|EOA86987.1| hypothetical protein SETTUDRAFT_135482 [Setosphaeria turcica 
Et28A]
Length=560

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 88/170 (52%), Gaps = 3/170 (2%)
 Frame = +2

Query  422  ISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGN  601
            ++L   K +   LD +F+  +   +  F+  FLP  FW G++ + R    ++A   Y   
Sbjct  56   LALLQDKMRSPALDSYFAYTANLGTHTFFMVFLPIQFWCGYTSVGRATVFMLAAGVYTTG  115

Query  602  CIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE  781
             +KD++  PRP SPP+ RI+ +      ALEYG PSSH+ N + ++ Y ++ +    + +
Sbjct  116  FLKDLLCLPRPLSPPLARISMS---GSAALEYGFPSSHSANAVSVAVYAIYTLRQSAQTD  172

Query  782  DLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWLS  931
            + +  +A   L       I  GR+Y GMH  +D+I G   G AI A  L+
Sbjct  173  NPNVNMALQGLFYFYALSIIAGRLYCGMHGFLDVIVGSIMGAAIAALQLA  222



>gb|EMD95479.1| hypothetical protein COCHEDRAFT_1165572 [Bipolaris maydis C5]
 gb|ENI10342.1| hypothetical protein COCC4DRAFT_67370 [Bipolaris maydis ATCC 
48331]
Length=549

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 88/169 (52%), Gaps = 3/169 (2%)
 Frame = +2

Query  422  ISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGN  601
            ++L   K +  +LD +F+  +   +  F+  FLP  FW G++ + R    ++A   Y   
Sbjct  42   LALLQDKLRSPFLDSYFAYTANLGTHTFFMVFLPIQFWCGYTSVGRATVFMLAAGVYSTG  101

Query  602  CIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE  781
             +KD++  PRP SPP+ RI+ +      ALEYG PSSH+ N + ++ Y ++ +    + +
Sbjct  102  FLKDLLCLPRPLSPPLARISMS---GSAALEYGFPSSHSANAVSVAFYAIYTLRQSAQQD  158

Query  782  DLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWL  928
            + + ++   AL       I  GR+Y GMH  +D+I G   G  I  F L
Sbjct  159  NANLKMGLQALFYFYALSIIAGRLYCGMHGFLDVIVGSVMGALITTFQL  207



>ref|XP_003172289.1| sphingosine-1-phosphate phosphohydrolase [Microsporum gypseum 
CBS 118893]
 gb|EFR01878.1| sphingosine-1-phosphate phosphohydrolase [Microsporum gypseum 
CBS 118893]
Length=541

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 85/155 (55%), Gaps = 5/155 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  FY   LP LFWSGH+ + R +  L+A   +    +KD++  PRP 
Sbjct  62   LDSWFAITANLGTHTFYMVMLPILFWSGHTGVGRAVVHLLAAGVFFSGFLKDLLCLPRPL  121

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP++RIT +      ALEYG PS+H+ N + +  Y LH + S +    L T       +
Sbjct  122  SPPLQRITMS---GSAALEYGFPSTHSTNAVSIVVYALHALRSQSDLAPL-TSTLLRTGL  177

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
             + V  I +GR+Y GMH  +D++ G   G A+L F
Sbjct  178  YVYVTSIVIGRLYCGMHGFLDVVVGSLLG-ALLGF  211



>gb|EAS34898.3| sphingosine-1-phosphate phosphohydrolase [Coccidioides immitis 
RS]
Length=540

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 4/140 (3%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FY   LP LFW GHS+  R    L+A   +    IKD++  PRP SPP++RIT +     
Sbjct  71   FYMVMLPILFWCGHSQFGRATVHLLASGVFFSGFIKDLLCLPRPLSPPLQRITMS---GS  127

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
             ALEYG PS+H+ N + +  Y +H + S       +++ A   L+ +    I LGR+Y G
Sbjct  128  AALEYGFPSTHSTNAVSVVVYAMHNLNSAASAFSPTSKAALQFLLFIYGTSIVLGRLYCG  187

Query  863  MHSLIDIIGGLAFGLAILAF  922
            MH  +D++ G   G A+L F
Sbjct  188  MHGFLDVVAGCLLG-ALLGF  206



>dbj|GAK65500.1| PAP2 superfamily protein [Pseudozyma antarctica]
Length=660

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 91/176 (52%), Gaps = 12/176 (7%)
 Frame = +2

Query  416  TPISLQIQKY-QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDY  592
             P+  + Q++ +  +LD +F   S   +  F+  FLP +FW G  +  R +  ++AF  Y
Sbjct  139  APLHERHQRWIRRPWLDRYFVNTSLLGTHSFFLVFLPMIFWLGSPRFGRGLINVLAFGVY  198

Query  593  MGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
            + + IKD+   PRP SPPV R+T       + LEYG PS+H+ N++ ++ Y+  +V    
Sbjct  199  LSSAIKDLFCVPRPYSPPVTRLTV----GTHHLEYGFPSTHSTNSVSIALYIYLWVRRMR  254

Query  773  K----NEDLS---TEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
            +    N D S         A +      +  GRIY GMHS+ID + G A G AI A
Sbjct  255  EHAVGNVDASGIFDSWLWEAGLLFYATSVVYGRIYAGMHSVIDCVAGSALGAAITA  310



>ref|XP_002540824.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP75491.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=552

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 88/162 (54%), Gaps = 4/162 (2%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            ++ +  +LD +F+  +   +  FY   LP LFW G+++L R +  L+A   +    IKD+
Sbjct  68   ERMRTPFLDTWFAVSANLGTHTFYMVMLPILFWCGYTQLGRAIVHLLASGVFFSGFIKDL  127

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPP++RIT +      ALEYG PS+H+ N + +  Y +H + S         +
Sbjct  128  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVVVYAIHSLNSAESTLSPFAK  184

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
                 L+ +    I +GR+Y GMH  +D++ G A G A+L F
Sbjct  185  ALFQFLLFVYGTSIVVGRLYCGMHGFLDVVAGCALG-ALLGF  225



>gb|KEQ84542.1| acid phosphatase/Vanadium-dependent haloperoxidase [Aureobasidium 
pullulans EXF-150]
Length=571

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 75/127 (59%), Gaps = 6/127 (5%)
 Frame = +2

Query  416  TPISLQIQKY-QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDY  592
            TP   ++Q+  +  +LD +F+  +   +  F+ A LP  FW G++ + R +  ++A   +
Sbjct  58   TPYLAKLQQTCRTPFLDSYFAMTANLGTHTFFMAALPVCFWCGYTSVGRALVHMLALGVF  117

Query  593  MGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
            +   IKD+V  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L+ +  HT
Sbjct  118  LSGWIKDLVCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAFYFLYQL--HT  172

Query  773  KNEDLST  793
              +D+++
Sbjct  173  STDDVAS  179



>emb|CAK42112.1| unnamed protein product [Aspergillus niger]
Length=533

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 89/166 (54%), Gaps = 5/166 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            ++ +   LD +F+  +   +  F+  FLP LFW G++ L R M  L+A   +    IKD+
Sbjct  74   ERVRTPALDSYFAFTANLGTHTFFMVFLPILFWCGYTSLGRGMVHLLASGVFFSGFIKDL  133

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L  + S          
Sbjct  134  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAAYALALLNSSESTLSPQVN  190

Query  797  iagialisllvgliglgriylgMHSLIDIIGG--LAFGLAILAFWL  928
            IA  A+  L V  I LGR+Y GMH   D++ G  L F LA L + L
Sbjct  191  IALQAITYLYVCSIVLGRLYCGMHGFFDVVIGCLLGFLLAFLQYTL  236



>ref|XP_001401174.2| PAP2 domain protein [Aspergillus niger CBS 513.88]
 gb|EHA27947.1| hypothetical protein ASPNIDRAFT_185579 [Aspergillus niger ATCC 
1015]
Length=529

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 89/166 (54%), Gaps = 5/166 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            ++ +   LD +F+  +   +  F+  FLP LFW G++ L R M  L+A   +    IKD+
Sbjct  50   ERVRTPALDSYFAFTANLGTHTFFMVFLPILFWCGYTSLGRGMVHLLASGVFFSGFIKDL  109

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L  + S          
Sbjct  110  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAAYALALLNSSESTLSPQVN  166

Query  797  iagialisllvgliglgriylgMHSLIDIIGG--LAFGLAILAFWL  928
            IA  A+  L V  I LGR+Y GMH   D++ G  L F LA L + L
Sbjct  167  IALQAITYLYVCSIVLGRLYCGMHGFFDVVIGCLLGFLLAFLQYTL  212



>gb|ETS61780.1| hypothetical protein PaG_03877 [Pseudozyma aphidis DSM 70725]
Length=660

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 91/175 (52%), Gaps = 12/175 (7%)
 Frame = +2

Query  419  PISLQIQKY-QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYM  595
            P+  + Q++ +  +LD +F   S   +  F+  FLP +FW G  +  R +  ++AF  Y+
Sbjct  140  PLHERHQRWIRRPWLDRYFVNTSLLGTHSFFLVFLPMIFWLGSPRFGRGLINVLAFGVYL  199

Query  596  GNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTK  775
             + IKD+   PRP SPPV R+T       + LEYG PS+H+ N++ ++ Y+  +V    +
Sbjct  200  SSAIKDLFCVPRPYSPPVTRLTV----GTHHLEYGFPSTHSTNSVSIALYIYLWVRRMRE  255

Query  776  ----NEDLS---TEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
                N D S         A +      +  GRIY GMHS+ID + G A G AI A
Sbjct  256  HAIGNVDASGIFDSWLWEAGLLFYGTSVVYGRIYAGMHSVIDCVAGSALGAAITA  310



>ref|XP_003849567.1| hypothetical protein MYCGRDRAFT_62752, partial [Zymoseptoria 
tritici IPO323]
 gb|EGP84543.1| hypothetical protein MYCGRDRAFT_62752, partial [Zymoseptoria 
tritici IPO323]
Length=544

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 5/138 (4%)
 Frame = +2

Query  371  RSLTQPWVSRQVVSGTPISLQIQK-YQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHS  547
            R L + W+   V   TP    +Q   +  +LD +F+  +   +  F+   LP  FW G++
Sbjct  39   RHLLRQWLIPIVRRETPYLASLQDALRSRWLDSYFAMTANLGTHTFFMTALPICFWCGYA  98

Query  548  KLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNT  727
            +L   +  ++A   Y+   +KD+V  PRP SPP++RIT +      ALEYG PS+HT N 
Sbjct  99   ELGIALVHMLAAGVYLSGYVKDLVCLPRPLSPPLQRITMS---GSAALEYGFPSTHTTNA  155

Query  728  ICLSGYLLHYVLSHTKNE  781
            + ++ Y LH + S T++E
Sbjct  156  VSVAFYCLHNLWS-TQDE  172



>dbj|GAC73017.1| sphingoid base-phosphate phosphatase [Pseudozyma antarctica T-34]
Length=660

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 91/175 (52%), Gaps = 12/175 (7%)
 Frame = +2

Query  419  PISLQIQKY-QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYM  595
            P+  + Q++ +  +LD +F   S   +  F+  FLP +FW G  +  R +  ++AF  Y+
Sbjct  140  PLHERHQRWIRRPWLDRYFVNTSLLGTHSFFLVFLPMIFWLGSPRFGRGLINVLAFGVYL  199

Query  596  GNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTK  775
             + IKD+   PRP SPPV R+T       + LEYG PS+H+ N++ ++ Y+  +V    +
Sbjct  200  SSAIKDLFCVPRPYSPPVTRLTV----GTHHLEYGFPSTHSTNSVSIALYIYLWVRRMRE  255

Query  776  ----NEDLS---TEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
                N D S         A +      +  GRIY GMHS+ID + G A G AI A
Sbjct  256  HAIGNLDASGIFDSWLWEAGLLFYGTSVVYGRIYAGMHSVIDCVAGSALGAAITA  310



>gb|EZF33917.1| hypothetical protein H101_02535 [Trichophyton interdigitale H6]
 gb|KDB23514.1| hypothetical protein H109_04584 [Trichophyton interdigitale MR816]
Length=541

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 98/187 (52%), Gaps = 10/187 (5%)
 Frame = +2

Query  365  KIRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSG  541
            K+R  T P V  +    TP    +Q + +   LD +F+  +   +  FY   LP LFW+G
Sbjct  34   KLRQRTLPLVRWE----TPYLAWLQERIRTPSLDSWFAITANLGTHTFYMVMLPVLFWTG  89

Query  542  HSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTL  721
            H+ + R +  L+A   +    +KD++  PRP SPP++RIT +      ALEYG PS+H+ 
Sbjct  90   HTGIGRAVVHLLAAGVFFSGFLKDLLCLPRPLSPPLQRITMS---GSAALEYGFPSTHST  146

Query  722  NTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAF  901
            N + +  Y LH + S +    L T       + + V  I +GR+Y GMH  +D++ G   
Sbjct  147  NAVSIVVYALHALRSQSDIAPL-TSTLLQTGLYVYVISIVIGRLYCGMHGFLDVVVGSML  205

Query  902  GLAILAF  922
            G A+L F
Sbjct  206  G-ALLGF  211



>gb|KIX98090.1| hypothetical protein Z520_06170 [Fonsecaea multimorphosa CBS 
102226]
Length=535

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 73/137 (53%), Gaps = 3/137 (2%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            F+   LP LFW G++ L R M  ++A   ++   IKD++  PRP SPP+ RIT +     
Sbjct  71   FFMVMLPILFWCGNTSLGRGMVHVLASGVFLSGFIKDLLCLPRPLSPPLTRITMS---GS  127

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
             ALEYG PS+H+ N + ++ Y L+ +   T N D + +     L       I LGR+Y G
Sbjct  128  AALEYGFPSTHSTNAVSVAVYSLYLLRQETNNLDPNLKFGLQILAYFYAISIVLGRLYCG  187

Query  863  MHSLIDIIGGLAFGLAI  913
            MH   D+I G   G  I
Sbjct  188  MHGFFDVIWGSILGALI  204



>gb|EFW18306.1| sphingosine-1-phosphate phosphohydrolase [Coccidioides posadasii 
str. Silveira]
Length=540

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 4/140 (3%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FY   LP LFW GHS+  R    L+A   +    IKD++  PRP SPP++RIT +     
Sbjct  71   FYMIMLPILFWCGHSQFGRGTVHLLASGVFFSGFIKDLLCLPRPLSPPLQRITMS---GS  127

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
             ALEYG PS+H+ N + +  Y +H + S       +++ A   L+ +    I LGR+Y G
Sbjct  128  AALEYGFPSTHSTNAVSVVVYAMHNLNSAASAFSPTSKAALQFLLFIYGTSIVLGRLYCG  187

Query  863  MHSLIDIIGGLAFGLAILAF  922
            MH  +D++ G   G A+L F
Sbjct  188  MHGFLDVVAGCLLG-ALLGF  206



>gb|EGE01302.1| sphingosine-1-phosphate phosphohydrolase [Trichophyton equinum 
CBS 127.97]
Length=541

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 85/155 (55%), Gaps = 5/155 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  FY   LP LFW+GH+ + R +  L+A   +    +KD++  PRP 
Sbjct  62   LDSWFAITANLGTHTFYMVMLPVLFWTGHTGIGRAVVHLLAAGVFFSGFLKDLLCLPRPL  121

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP++RIT +      ALEYG PS+H+ N + +  Y LH + S +    L T       +
Sbjct  122  SPPLQRITMS---GSAALEYGFPSTHSTNAVSIVVYALHALRSQSDIAPL-TSTLLQTGL  177

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
             + V  I +GR+Y GMH  +D++ G   G A+L F
Sbjct  178  YVYVISIVIGRLYCGMHGFLDVVVGSMLG-ALLGF  211



>ref|XP_003024429.1| hypothetical protein TRV_01392 [Trichophyton verrucosum HKI 0517]
 gb|EFE43818.1| hypothetical protein TRV_01392 [Trichophyton verrucosum HKI 0517]
Length=542

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 99/187 (53%), Gaps = 10/187 (5%)
 Frame = +2

Query  365  KIRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSG  541
            K+R  T P V  +    TP    +Q + +   LD +F+  +   +  FY   LP LFW+G
Sbjct  34   KLRQRTLPLVRWE----TPYLAWLQERIRTPSLDSWFAITANLGTHTFYMVMLPVLFWTG  89

Query  542  HSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTL  721
            H+ + R +  L+A   +    +KD++  PRP SPP++RIT +      ALEYG PS+H+ 
Sbjct  90   HTGIGRAVVHLLAAGVFFSGFLKDLLCLPRPLSPPLQRITMS---GSAALEYGFPSTHST  146

Query  722  NTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAF  901
            N + +  Y LH + S +    L++       + + V  I +GR+Y GMH  +D++ G   
Sbjct  147  NAVSIVVYALHALRSQSDLAPLAS-TLLQTGLYVYVTSIVIGRLYCGMHGFLDVVVGSML  205

Query  902  GLAILAF  922
            G A+L F
Sbjct  206  G-ALLGF  211



>emb|CBQ73983.1| related to YSR3-dihydrosphingosine-1-phosphate phosphatase [Sporisorium 
reilianum SRZ2]
Length=674

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 85/162 (52%), Gaps = 8/162 (5%)
 Frame = +2

Query  446  QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSA  625
            +  +LD +F   S   +  F+  FLP +FW G  +  R +  ++AF  Y+ + IKD+   
Sbjct  151  RRPWLDRYFVNTSLLGTHSFFLVFLPMVFWLGSPRFGRGLINVLAFGVYLSSAIKDLFCV  210

Query  626  PRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiag  805
            PRP SPPV R+T       + LEYG PS+H+ N++ ++ Y+  +V    ++   +T +  
Sbjct  211  PRPYSPPVTRLTV----GTHHLEYGFPSTHSTNSVSIALYIYLWVRKMRESSPGATPLFD  266

Query  806  i----alisllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
                 A +      +  GRIY GMHS+ID + G A G  I A
Sbjct  267  SWLWEAGLLFYATSVVYGRIYAGMHSIIDCVAGSALGATITA  308



>gb|KIV85098.1| hypothetical protein PV11_00833 [Exophiala sideris]
Length=528

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAF---LPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAP  628
            LD +F+    S ++  +TAF   LP LFW GH+ L R MT ++A   +    +KD++  P
Sbjct  56   LDTYFA---TSANLGTHTAFMVLLPILFWCGHTSLGRGMTQVLAAGVFWSGFVKDMLCLP  112

Query  629  RPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE  781
            RP SPP++RIT +      ALEYG PS+H+ N + ++ Y L Y+L + K++
Sbjct  113  RPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYAL-YLLRNVKDQ  159



>ref|XP_003066700.1| PAP2 superfamily protein [Coccidioides posadasii C735 delta SOWgp]
 gb|EER24555.1| PAP2 superfamily protein [Coccidioides posadasii C735 delta SOWgp]
Length=551

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 77/140 (55%), Gaps = 4/140 (3%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FY   LP LFW GHS+  R    L+A   +    IKD++  PRP SPP++RIT +     
Sbjct  71   FYMIMLPILFWCGHSQFGRGTVHLLASGVFFSGFIKDLLCLPRPLSPPLQRITMS---GS  127

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
             ALEYG PS+H+ N + +  Y +H + S       +++ A   L+ +    I LGR+Y G
Sbjct  128  AALEYGFPSTHSTNAVSVVVYAMHNLNSAASAFSPTSKAALQFLLFIYGTSIVLGRLYCG  187

Query  863  MHSLIDIIGGLAFGLAILAF  922
            MH  +D++ G   G A+L F
Sbjct  188  MHGFLDVVAGCLLG-ALLGF  206



>gb|EGD97016.1| sphingosine-1-phosphate phosphohydrolase [Trichophyton tonsurans 
CBS 112818]
Length=490

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 85/155 (55%), Gaps = 5/155 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  FY   LP LFW+GH+ + R +  L+A   +    +KD++  PRP 
Sbjct  62   LDSWFAITANLGTHTFYMVMLPVLFWTGHTGIGRAVVHLLAAGVFFSGFLKDLLCLPRPL  121

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP++RIT +      ALEYG PS+H+ N + +  Y LH + S +    L T       +
Sbjct  122  SPPLQRITMS---GSAALEYGFPSTHSTNAVSIVVYALHALRSQSDIAPL-TSTLLQTGL  177

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
             + V  I +GR+Y GMH  +D++ G   G A+L F
Sbjct  178  YVYVISIVIGRLYCGMHGFLDVVVGSMLG-ALLGF  211



>ref|XP_003868166.1| Lcb3 protein [Candida orthopsilosis Co 90-125]
 emb|CCG22731.1| Lcb3 protein [Candida orthopsilosis]
Length=488

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 96/187 (51%), Gaps = 8/187 (4%)
 Frame = +2

Query  365  KIRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSG  541
            K+RS   P+V  +    T +  ++Q K ++   D +F+  +   S  FY   LP   W G
Sbjct  59   KLRSYLLPFVRHE----TDVLYKLQSKLRNPVFDFYFAWTANLASHTFYILMLPPSVWFG  114

Query  542  HSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTL  721
             SK+AR +  ++ +  Y+   +KD    PRP SPP+ RIT +    +   EYG PSSH+ 
Sbjct  115  ASKMARDLVHVLGWGIYLTGFLKDYFCLPRPRSPPLHRITMSSYTTQ---EYGFPSSHSA  171

Query  722  NTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAF  901
            N   ++  ++  ++ +    D  T  + IA +++    +  GR+Y GMH  +DI  G A 
Sbjct  172  NATAVTLVVMSNIIMNQGAYDTKTYYSLIAGLAIYYFSLIFGRLYTGMHGFLDIFTGSAV  231

Query  902  GLAILAF  922
            GLA+  F
Sbjct  232  GLAVFLF  238



>ref|XP_001215294.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU33877.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=525

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 3/105 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLP LFW G+  L R M  L+A   +    IKD+
Sbjct  50   EKVRTPALDSYFAFTANLGTHTFFMVFLPILFWCGYPNLGRGMVDLLASGVFFSGFIKDL  109

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLL  751
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y+L
Sbjct  110  LCLPRPLSPPLQRITMSGSA---ALEYGFPSTHSTNAVSVAVYVL  151



>ref|XP_002487135.1| PAP2 domain protein [Talaromyces stipitatus ATCC 10500]
 gb|EED13024.1| PAP2 domain protein [Talaromyces stipitatus ATCC 10500]
Length=515

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 64/112 (57%), Gaps = 3/112 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
             K +   LD +F+  +   +  F+  FLP LFW G+  L R M  ++A   +    IKD+
Sbjct  50   DKVRSPMLDSYFAFTANLGTHTFFMIFLPVLFWCGYPSLGRGMVNVLAAGVFFSGFIKDL  109

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ YLL  + ++T
Sbjct  110  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAIYLLSLLWNNT  158



>dbj|GAA90686.1| PAP2 domain protein [Aspergillus kawachii IFO 4308]
Length=529

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 87/164 (53%), Gaps = 5/164 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            ++ +   LD +F+  +   +  F+  FLP LFW G++ L R M  L+A   +    IKD+
Sbjct  50   ERVRTPALDSYFAFTANLGTHTFFMVFLPILFWCGYTSLGRGMVHLLASGVFFSGFIKDL  109

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L  + S          
Sbjct  110  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAAYALALLNSPESTLSPQVN  166

Query  797  iagialisllvgliglgriylgMHSLIDIIGG--LAFGLAILAF  922
            I   A+  L V  I LGR+Y GMH   D++ G  L F LA L +
Sbjct  167  IVLQAITYLYVCSIVLGRLYCGMHGFFDVVIGCLLGFLLAFLQY  210



>ref|XP_007799989.1| hypothetical protein EPUS_01966 [Endocarpon pusillum Z07020]
 gb|ERF74279.1| hypothetical protein EPUS_01966 [Endocarpon pusillum Z07020]
Length=541

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 83/159 (52%), Gaps = 4/159 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+   LP LFW GHS L R M  ++A   +    IKD+
Sbjct  49   EKLRSPALDTYFAITANLGTHTFFMIVLPILFWCGHSDLGRGMVHILASGVFFSGFIKDL  108

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
               PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L Y+L+   +      
Sbjct  109  WCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYAL-YLLNTNSSLSPKIN  164

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFGLAI  913
            I   A+       I LGR+Y GMH   D+I G   G AI
Sbjct  165  ILLQAISYFYASSIVLGRLYCGMHGFFDVIIGSMLGAAI  203



>ref|XP_002844102.1| sphingosine-1-phosphate phosphohydrolase [Arthroderma otae CBS 
113480]
 gb|EEQ35066.1| sphingosine-1-phosphate phosphohydrolase [Arthroderma otae CBS 
113480]
Length=531

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 86/155 (55%), Gaps = 5/155 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  FY   LP LFWSG++ + R +  L+A   +    +KD++  PRP 
Sbjct  52   LDSWFAITANLGTHTFYMVMLPVLFWSGYTGVGRAVVHLLAAGVFFSGFMKDLLCLPRPL  111

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP++RIT +      ALEYG PS+H+ N + +  Y LH + S T+   L T       +
Sbjct  112  SPPLQRITMS---GSAALEYGFPSTHSTNAVSIVVYALHALRSQTELAPL-TSTLLRVGL  167

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
             + V  I +GR+Y GMH  +D++ G   G A+L F
Sbjct  168  CIYVTSIVVGRLYCGMHGFLDVVVGSFLG-ALLGF  201



>ref|XP_003015182.1| hypothetical protein ARB_06305 [Arthroderma benhamiae CBS 112371]
 gb|EFE34542.1| hypothetical protein ARB_06305 [Arthroderma benhamiae CBS 112371]
Length=542

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 99/187 (53%), Gaps = 10/187 (5%)
 Frame = +2

Query  365  KIRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSG  541
            K+R  T P V  +    TP    +Q + +   LD +F+  +   +  FY   LP LFW+G
Sbjct  34   KLRQRTLPLVRWE----TPYLAWLQERIRTPSLDSWFAITANLGTHTFYMVMLPVLFWTG  89

Query  542  HSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTL  721
            H+ + R +  L+A   +    +KD++  PRP SPP++RIT +      ALEYG PS+H+ 
Sbjct  90   HTGIGRAVVHLLAAGVFFSGFLKDLLCLPRPLSPPLQRITMS---GSAALEYGFPSTHST  146

Query  722  NTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAF  901
            N + +  Y LH + S +    L++       + + V  I +GR+Y GMH  +D++ G   
Sbjct  147  NAVSIVVYALHALRSQSDLAPLAS-TLLQTGLYVYVTSIVIGRLYCGMHGFLDVVVGSML  205

Query  902  GLAILAF  922
            G A+L F
Sbjct  206  G-ALLGF  211



>ref|XP_660292.1| hypothetical protein AN2688.2 [Aspergillus nidulans FGSC A4]
 gb|EAA63090.1| hypothetical protein AN2688.2 [Aspergillus nidulans FGSC A4]
Length=503

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 85/162 (52%), Gaps = 5/162 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLP  FWSG+  L R M  L+A   +    IKD+
Sbjct  49   EKIRTPALDSYFAFTANLGTHTFFMVFLPIFFWSGYPSLGRGMVHLLASGVFFSGFIKDL  108

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L+ + S          
Sbjct  109  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYALYLLNSPDSTLSDGLN  165

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFG--LAIL  916
                 +  L V  I LGR+Y GMH   D++ G A G  LA+L
Sbjct  166  FFLQGITYLYVTSIVLGRLYCGMHGFFDVVVGSALGVLLAVL  207



>ref|XP_007588354.1| putative sphingosine-1-phosphate phosphohydrolase protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD44174.1| putative sphingosine-1-phosphate phosphohydrolase protein [Neofusicoccum 
parvum UCRNP2]
Length=511

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 80/152 (53%), Gaps = 3/152 (2%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+   LP LFW G++ L + M  ++A   +    +KD++  PRP 
Sbjct  58   LDSYFAFTANLGTHTFFMIMLPILFWCGYTNLGKAMVHVLASGVFWSGFVKDMLCLPRPL  117

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP++RIT +      ALEYG PS+H+ N + ++ Y +H + +  +  D +T  A    +
Sbjct  118  SPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYAIHMLHTSGEASDSTTHTALQVAL  174

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAI  913
                  I  GR+Y GMH   D+I G   G  I
Sbjct  175  YFYAVSIVFGRLYCGMHGFFDVIIGTILGALI  206



>ref|XP_002165225.1| PREDICTED: sphingosine-1-phosphate phosphatase 2-like [Hydra 
vulgaris]
Length=368

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 75/142 (53%), Gaps = 9/142 (6%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FY  FLPF+ W+    + R++ LL  FC Y G  IKD++  PRP SPPV R+     EK 
Sbjct  70   FYITFLPFVSWNIDEYICRRLILLWVFCMYAGQGIKDILCWPRPESPPVIRL-----EKI  124

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
               EYGMPS+H +  + +   L+++     + + +     GI    L   L+   R+Y G
Sbjct  125  YESEYGMPSTHAIAGVVIPFSLIYFSYGRFQYDLV----YGILFHILWTSLVCFSRVYRG  180

Query  863  MHSLIDIIGGLAFGLAILAFWL  928
            MHS  DI+ G++    + A WL
Sbjct  181  MHSFHDIVAGISVAFFVTALWL  202



>gb|KFH70364.1| hypothetical protein MVEG_03215 [Mortierella verticillata NRRL 
6337]
Length=528

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 101/185 (55%), Gaps = 8/185 (4%)
 Frame = +2

Query  368  IRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHS  547
            IR    P V  +  +G   +LQ ++++  +LD +F+  + +    F+   LP +FW GHS
Sbjct  49   IRRRLLPLVRGE--TGRLAALQ-ERWRTPFLDSYFTLTAFAGHPLFFVCILPIMFWYGHS  105

Query  548  KLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNT  727
              AR    +     ++ + +KD +  PRP SPP+ R++ +   K   LEYG+PS+HT N 
Sbjct  106  VFARGFVNVACLGVFVTSWVKDYLCLPRPLSPPLIRLSRS---KRVHLEYGLPSTHTSNA  162

Query  728  ICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGL  907
            + ++ YL  Y++    N  +S++I  +  +++ +  +  GR+Y GMHS  D++ G   G+
Sbjct  163  VSIALYLFSYLM--YSNWSISSKILSVFGLAVYLFSVVFGRLYCGMHSSTDLVAGALIGI  220

Query  908  AILAF  922
             + A 
Sbjct  221  FVWAL  225



>tpe|CBF84209.1| TPA: conserved hypothetical protein similar to sphingosine-1-phosphatase 
(Eurofung) [Aspergillus nidulans FGSC A4]
Length=505

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 85/162 (52%), Gaps = 5/162 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLP  FWSG+  L R M  L+A   +    IKD+
Sbjct  51   EKIRTPALDSYFAFTANLGTHTFFMVFLPIFFWSGYPSLGRGMVHLLASGVFFSGFIKDL  110

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L+ + S          
Sbjct  111  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYALYLLNSPDSTLSDGLN  167

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFG--LAIL  916
                 +  L V  I LGR+Y GMH   D++ G A G  LA+L
Sbjct  168  FFLQGITYLYVTSIVLGRLYCGMHGFFDVVVGSALGVLLAVL  209



>ref|XP_003032085.1| hypothetical protein SCHCODRAFT_76490 [Schizophyllum commune 
H4-8]
 gb|EFI97182.1| hypothetical protein SCHCODRAFT_76490 [Schizophyllum commune 
H4-8]
Length=572

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 83/148 (56%), Gaps = 8/148 (5%)
 Frame = +2

Query  332  VVISSIFNVT-QKIRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPF  505
            +V   ++  T   +R+  + W  + V   +PI  ++Q + +  +LD +F   S   +  F
Sbjct  22   IVDEDVYEATLSPLRAAVRRWTLKAVERESPILARMQARIRSPFLDSYFLYTSSLGTHTF  81

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            +T  LP  F+ G+ +L R + L++A   ++ + +KD V +PRP +PPV+R+T       +
Sbjct  82   FTILLPTFFFFGNDQLGRSLCLIVALGVWVTSIMKDFVCSPRPFAPPVQRLTI----GTH  137

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSH  769
             LEYG PS+H+ N++ ++  L  YV+ H
Sbjct  138  HLEYGFPSTHSANSVSIA--LWFYVILH  163



>ref|XP_571366.1| sphingosine-1-phosphate phosphatase [Cryptococcus neoformans 
var. neoformans JEC21]
 ref|XP_775026.1| hypothetical protein CNBF1890 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL20379.1| hypothetical protein CNBF1890 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW44059.1| sphingosine-1-phosphate phosphatase, putative [Cryptococcus neoformans 
var. neoformans JEC21]
Length=503

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 79/144 (55%), Gaps = 4/144 (3%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            F+  FLP LF+ GH    R +  ++    Y+ +  KD+V  PRP SPPV R++ +     
Sbjct  96   FFMMFLPILFFFGHPLEGRGLLHVVGLGIYISSFAKDLVCTPRPYSPPVIRLSMSTHHH-  154

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
               EYG PSSH+ N++ ++ YL  ++          T +    ++++ +  +  GR+Y G
Sbjct  155  ---EYGFPSSHSTNSVSIALYLGQWIFKLQDRLGWPTVLLSWLMLAVYMTSVIGGRVYTG  211

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHS+ DI+GG   G+A   FW+++
Sbjct  212  MHSIADIVGGSIMGVACWLFWIAI  235



>ref|XP_007727515.1| hypothetical protein A1O1_08464 [Capronia coronata CBS 617.96]
 gb|EXJ80321.1| hypothetical protein A1O1_08464 [Capronia coronata CBS 617.96]
Length=535

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 80/154 (52%), Gaps = 4/154 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+   LP LFW GH+ + R M  ++A   +    IKD++  PRP 
Sbjct  56   LDTYFAMTANLGTHTFFMIMLPILFWCGHTSVGRGMVHILASGVFFSGFIKDLLCLPRPL  115

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP++RIT +      ALEYG PS+H+ N + ++ Y  H +       +    +    L 
Sbjct  116  SPPLQRITMS---GSAALEYGFPSTHSTNAVSVAIYSFHLLQQQDSQLNPHVNLCLRVLC  172

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
                  I +GR+Y GMH   D+I G A G AILA
Sbjct  173  YCYAFSIVVGRLYCGMHGFFDVIVGSALG-AILA  205



>ref|XP_003237055.1| sphingosine-1-phosphate phosphohydrolase [Trichophyton rubrum 
CBS 118892]
 gb|EGD85506.1| hypothetical protein TERG_01778 [Trichophyton rubrum CBS 118892]
Length=511

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 74/137 (54%), Gaps = 8/137 (6%)
 Frame = +2

Query  365  KIRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSG  541
            K+R  T P V  +    TP    +Q + +   LD +F+  +   +  FY   LP LFW+G
Sbjct  34   KLRQRTLPLVRWE----TPYLAWLQERIRTPSLDSWFAITANLGTHTFYMVMLPVLFWTG  89

Query  542  HSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTL  721
            H+ + R +  L+A   +    +KD++  PRP SPP++RIT +      ALEYG PS+H+ 
Sbjct  90   HTGIGRAVVHLLAAGVFFSGFLKDLLCLPRPLSPPLQRITMS---GSAALEYGFPSTHST  146

Query  722  NTICLSGYLLHYVLSHT  772
            N + +  Y LH + S +
Sbjct  147  NAVSIVVYALHALRSQS  163



>emb|CDM31062.1| Phosphatidic acid phosphatase type 2/haloperoxidase [Penicillium 
roqueforti FM164]
Length=523

 Score = 75.9 bits (185),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 85/159 (53%), Gaps = 3/159 (2%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLPFLFW G   + R +  ++A   +    +KD+
Sbjct  50   EKVRTPTLDSYFAFTANLGTHTFFMVFLPFLFWCGSPSMGRGLVHILASGVFWSGFLKDL  109

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L  + S          
Sbjct  110  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYALALLGSPDSTLGTQVT  166

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFGLAI  913
            +   A+  + V  I LGR+Y GMH ++D + G A G AI
Sbjct  167  LLLQAVTYVYVVSIVLGRLYCGMHGMLDCVVGCAMGAAI  205



>ref|XP_002492823.1| Long-chain base-1-phosphate phosphatase with specificity for 
dihydrosphingosine-1-phosphate [Komagataella pastoris GS115]
 emb|CAY70644.1| Long-chain base-1-phosphate phosphatase with specificity for 
dihydrosphingosine-1-phosphate [Komagataella pastoris GS115]
 emb|CCA39566.1| putative membrane protein [Komagataella pastoris CBS 7435]
Length=412

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 96/196 (49%), Gaps = 19/196 (10%)
 Frame = +2

Query  359  TQKIRSLTQP--WVSRQVV------SGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFYTA  514
            ++  RS   P  + SRQ++         P+     K +   LD +FS  +   S  FY  
Sbjct  37   SEYYRSRLSPVRFASRQLILSLVEKETEPLGRWQAKVRTPLLDAYFSLTATLGSHTFYVL  96

Query  515  FLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALE  694
             LP   W G+ KLAR +  ++ F  Y    +KD +  PRP SPP+ RIT +      A E
Sbjct  97   MLPIPVWFGYFKLARDLVFILGFGIYFSGLLKDYLCLPRPKSPPLHRITRSH---YTAQE  153

Query  695  YGMPSSHTLN----TICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
            YG PSSH+ N    T+ L+ Y  HY  S+T +   +T    I    + +  + LGR+Y G
Sbjct  154  YGCPSSHSANAISVTLTLATYWYHY--SYTYSTLFNT--VSIIFGLIYLVSLVLGRLYCG  209

Query  863  MHSLIDIIGGLAFGLA  910
            MH  +D+  GL  G++
Sbjct  210  MHGFVDVGSGLVIGIS  225



>ref|XP_001621147.1| hypothetical protein NEMVEDRAFT_v1g16544 [Nematostella vectensis]
 gb|EDO29047.1| predicted protein, partial [Nematostella vectensis]
Length=179

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 73/138 (53%), Gaps = 9/138 (7%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FY  F PF+FW+    +AR++  L     Y+G C KDV+  PRP  PPV  +     EK 
Sbjct  19   FYITFFPFVFWNMDEYVARRLVFLWCLFMYVGQCAKDVIQWPRPPCPPVISV-----EKR  73

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
               EYGMPS+H +    +   L++Y    T +        GIA+      L+   R+Y+G
Sbjct  74   FECEYGMPSTHAIVGALIPFTLVYY----TYDRYEYPLPVGIAVFVCWCLLVCSSRLYMG  129

Query  863  MHSLIDIIGGLAFGLAIL  916
            MH+L D++ GLA  +A+L
Sbjct  130  MHTLQDVLAGLALTVAML  147



>gb|KEQ73749.1| PAP2-domain-containing protein [Aureobasidium namibiae CBS 147.97]
Length=573

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 93/173 (54%), Gaps = 4/173 (2%)
 Frame = +2

Query  416  TPISLQIQKY-QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDY  592
            TP   ++Q+  +  +LD +F+  +   +  F+ A LP  FW G++ + R +  ++    +
Sbjct  58   TPYLAKLQQTCRTPFLDSYFAMTANLGTHTFFMAALPVCFWCGYTGVGRALVHMLGLGVF  117

Query  593  MGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
            +   IKD+V  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L+++ + T
Sbjct  118  LSGWIKDLVCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVALYFLYHLHTST  174

Query  773  KNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWLS  931
                    IAG+ L       I LGR+Y GMH   D+I G A G  I    L+
Sbjct  175  DETASLQRIAGLCLGYFYAISIVLGRMYCGMHGFFDVIVGSALGTLIAVLQLA  227



>gb|KJY00463.1| putative sphingosine-1-phosphate phosphohydrolase protein [Zymoseptoria 
brevis]
Length=545

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 75/142 (53%), Gaps = 6/142 (4%)
 Frame = +2

Query  371  RSLTQPWVSRQVVSGTPISLQIQK-YQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHS  547
            R L + W+   V   TP    +Q   +  +LD +F+  +   +  F+   LP  FW G +
Sbjct  39   RYLLRQWLIPIVRRETPYLASLQDALRSRWLDSYFAMTANLGTHTFFMTALPICFWCGSA  98

Query  548  KLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNT  727
            +L   +  ++A   Y+   +KD+V  PRP SPP++RIT +      ALEYG PS+HT N 
Sbjct  99   ELGIALVHMLAAGVYLSGYVKDLVCLPRPLSPPLQRITMS---GSAALEYGFPSTHTTNA  155

Query  728  ICLSGYLLHYVLSHTKNEDLST  793
            + ++ Y LH + S    E+ ST
Sbjct  156  VSVAFYCLHNLWS--TQEEYST  175



>gb|KDR16780.1| Sphingosine-1-phosphate phosphatase 1 [Zootermopsis nevadensis]
Length=442

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 79/139 (57%), Gaps = 9/139 (6%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            FY +F+PF FW+    + R++ L+     Y+G  IKDVV  PRP+ PPV R+     +K+
Sbjct  131  FYASFIPFWFWNIDGAVGRRVVLVWTVIMYIGQGIKDVVRWPRPSCPPVIRL-----QKK  185

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
             ALEYGMPS+H +  + +   ++ Y    T N    +   G+        +I L R+YLG
Sbjct  186  WALEYGMPSTHAMVGVSIPLSVILY----TMNRYQYSVSLGVLFAIGWCSVICLSRLYLG  241

Query  863  MHSLIDIIGGLAFGLAILA  919
            MHS++DI+ G+   LA++ 
Sbjct  242  MHSVLDIVVGVMLALALMV  260



>ref|XP_003837203.1| similar to sphingosine-1-phosphate phosphohydrolase [Leptosphaeria 
maculans JN3]
 emb|CBX93763.1| similar to sphingosine-1-phosphate phosphohydrolase [Leptosphaeria 
maculans JN3]
Length=573

 Score = 75.5 bits (184),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 86/170 (51%), Gaps = 5/170 (3%)
 Frame = +2

Query  422  ISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGN  601
            ++L   K +   LD +F+  +   +  F+  FLP  FW G++ + R    ++A   Y   
Sbjct  66   LALMQDKIRSPALDSYFAYTANLGTHTFFMIFLPIQFWCGYTSVGRATVFMLAAGVYGTG  125

Query  602  CIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE  781
             +KD+V  PRP SPP+ RI+ +      ALEYG PSSH+ N + ++ Y + Y L  +  E
Sbjct  126  FLKDMVCLPRPLSPPLARISMS---GSAALEYGFPSSHSANAVSVAFYAI-YTLRQSATE  181

Query  782  DLS-TEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAFWL  928
            D S T     AL       I +GR+Y GMH  +D++ G   G  I    L
Sbjct  182  DGSYTNTILQALFYFYAMSIIVGRLYCGMHGFLDVLVGSVMGAMITGIQL  231



>gb|KIK28333.1| hypothetical protein PISMIDRAFT_27717 [Pisolithus microcarpus 
441]
Length=478

 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 105/199 (53%), Gaps = 10/199 (5%)
 Frame = +2

Query  353  NVTQKIRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFL  529
             V  + RS  +  + + V   +P+  ++Q ++++ +LD +F   SC  +  F+   LP L
Sbjct  19   TVLPRWRSAIRNVILKAVEHESPVLARLQTRFRNPWLDVYFLYTSCLGTHTFFMIALPIL  78

Query  530  FWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPS  709
            F+ G+  L R +  ++A   Y  + IKD+V APRP SPP+ R+        + LEYG PS
Sbjct  79   FFFGYHNLGRGLIFVLASGVYFSSFIKDLVCAPRPFSPPLTRLIV----GTHHLEYGFPS  134

Query  710  SHTLNTICLSGYLLHYV----LSHTKNEDLSTEiagialisllvgliglgriylgMHSLI  877
            +H+ N++ ++ ++  +V      H+   DL+       ++ + V  I  GR+Y+GMHS  
Sbjct  135  THSTNSVSMALFIFGHVHRAYTEHSAMSDLA-YFGSCIVLVVYVISIVFGRLYMGMHSAT  193

Query  878  DIIGGLAFGLAILAFWLSV  934
            D + G A G  I   ++ V
Sbjct  194  DCVVGAALGAGIWGAYVMV  212



>ref|XP_012050458.1| sphingosine-1-phosphate phosphatase [Cryptococcus neoformans 
var. grubii H99]
 gb|AFR96010.1| sphingosine-1-phosphate phosphatase [Cryptococcus neoformans 
var. grubii H99]
Length=503

 Score = 75.5 bits (184),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 79/144 (55%), Gaps = 4/144 (3%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            F+  FLP LF+ GH    R +  ++    Y+ +  KD+V  PRP SPPV R++ +     
Sbjct  96   FFMMFLPILFFFGHPLEGRGLLHVVGLGIYISSFAKDLVCTPRPYSPPVIRLSMSTHHH-  154

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
               EYG PSSH+ N++ ++ YL  ++          T +    ++++ +  +  GR+Y G
Sbjct  155  ---EYGFPSSHSTNSVSIALYLGQWMFKLQDRLGWPTVLFSWLMLAVYMTSVIGGRVYTG  211

Query  863  MHSLIDIIGGLAFGLAILAFWLSV  934
            MHS+ DI+GG   G+A   FW++V
Sbjct  212  MHSIADIVGGSIMGVACWLFWIAV  235



>ref|XP_001526586.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL 
YB-4239]
 gb|EDK43236.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL 
YB-4239]
Length=545

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 95/187 (51%), Gaps = 8/187 (4%)
 Frame = +2

Query  365  KIRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSG  541
            K+RSL  P +  +    T I  Q+Q K ++  LD +F+  +   S  FY   LP  FW G
Sbjct  102  KLRSLLLPLIRYE----TDILFQLQTKLRNPILDFYFAWTANLASHTFYVLMLPPPFWFG  157

Query  542  HSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTL  721
             S L+R +  ++    Y    +KD    PRP SPP+ RIT +    +   EYG PSSH+ 
Sbjct  158  ASDLSRDLVYVLGLGIYFTGFLKDFFCLPRPRSPPLHRITMSSYTSQ---EYGFPSSHSA  214

Query  722  NTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAF  901
            N   ++  +L  ++ + ++ +  +  + +  + L    +  GR+Y GMH  +DII G + 
Sbjct  215  NATAVTLVVLASLIKNKESFNTGSFYSLVVGLGLYYSSLIFGRLYCGMHGFLDIIVGSSV  274

Query  902  GLAILAF  922
            GL +  F
Sbjct  275  GLILFLF  281



>gb|KIJ63094.1| hypothetical protein HYDPIDRAFT_29782 [Hydnomerulius pinastri 
MD-312]
Length=508

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 104/191 (54%), Gaps = 10/191 (5%)
 Frame = +2

Query  371  RSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHS  547
            R+  +  + + V   +PI  ++Q + +  +LD +F   S   +  F+   LP LF+ G+ 
Sbjct  58   RAAIRAQILKAVERESPILARMQARLRSPWLDKYFVYTSSLGTHTFFMIALPLLFFFGYG  117

Query  548  KLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNT  727
            +L R +  ++AF  Y  + IKD+V +PRP +PPV R+T       + LEYG PS+H+ N+
Sbjct  118  ELGRGLIFVLAFGVYFSSFIKDLVCSPRPFAPPVTRLTI----GTHHLEYGFPSTHSTNS  173

Query  728  ICLSGYLLHYV----LSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGL  895
            + ++ ++  +V      H+   D+ T     AL+++    I  GR+Y GMHS  D   G+
Sbjct  174  VSMALFIFGHVHRAYSEHSAISDV-TYYISCALLAVYAVSIVFGRLYTGMHSFTDCGVGV  232

Query  896  AFGLAILAFWL  928
            A G AI A ++
Sbjct  233  ALGAAIWAGYM  243



>ref|XP_010129810.1| PREDICTED: sphingosine-1-phosphate phosphatase 2, partial [Buceros 
rhinoceros silvestris]
Length=326

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 84/153 (55%), Gaps = 12/153 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   +   FY  FLPF++W+    ++R+M ++ +   Y+G   KD
Sbjct  10   VKNYFYYYLFKFSAALGEEI---FYITFLPFIYWNIDHSVSRRMVIVWSIVMYIGQVSKD  66

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLST  793
            ++  PRP SPPV ++ A    + NA EYGMPS+H +    +S  LL    +H K      
Sbjct  67   ILKWPRPLSPPVVKLEA----RTNA-EYGMPSTHAMAATAISFSLLTATANHYKYP----  117

Query  794  EiagialisllvgliglgriylgMHSLIDIIGG  892
               G+    +   L+ L R+Y GMH+++D+IGG
Sbjct  118  FELGLVAALVFSALVCLSRLYTGMHTVLDVIGG  150



>ref|XP_001259276.1| sphingosine-1-phosphate phosphohydrolase [Neosartorya fischeri 
NRRL 181]
 gb|EAW17379.1| sphingosine-1-phosphate phosphohydrolase [Neosartorya fischeri 
NRRL 181]
Length=518

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLP LFWSG++ L R    ++A   +    IKD+
Sbjct  50   EKIRTPTLDSYFAFTANLGTHTFFMIFLPMLFWSGYTNLGRGFVQVLASGVFFSGFIKDL  109

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLL  751
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y+L
Sbjct  110  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYVL  151



>emb|CDR38604.1| CYFA0S02e03576g1_1 [Cyberlindnera fabianii]
Length=507

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 67/138 (49%), Gaps = 4/138 (3%)
 Frame = +2

Query  368  IRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGH  544
            +R   + W+   V + TPI   IQ K +   +D +F+  +   S  FY   LP   W G+
Sbjct  75   LRFKVRQWLLPYVRAETPILASIQQKLRTPLIDFYFAYTANLASHTFYVLMLPLPIWFGY  134

Query  545  SKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLN  724
              + R +  ++ +  Y     KD    PRP SPP+ RIT +      A EYG PSSH  N
Sbjct  135  GNMTRDLVFMLGYGIYFSGFAKDFCCLPRPRSPPLHRITMS---GYTAKEYGFPSSHAAN  191

Query  725  TICLSGYLLHYVLSHTKN  778
               +S ++L+ +LS+   
Sbjct  192  ATAVSVFMLNVILSNADK  209



>dbj|GAD91780.1| PAP2 domain protein [Byssochlamys spectabilis No. 5]
Length=504

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 3/110 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLPFLFW G++ L R M  ++A   +    IKD+
Sbjct  3    EKMRTPSLDTWFAITANLGTHTFFMIFLPFLFWCGYTSLGRGMVHILASGVFFSGFIKDL  62

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLS  766
               PRP SPP+ RIT +      ALEYG PS+H+ N + ++ Y L+ + S
Sbjct  63   FCLPRPLSPPLTRITMS---GSAALEYGFPSTHSTNAVSVAVYALYLLTS  109



>gb|KIV91097.1| hypothetical protein, variant 1 [Exophiala mesophila]
Length=512

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 3/152 (2%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+   LP  FW G++ L R MT ++A   +    IKD+V  PRP 
Sbjct  36   LDTYFAMSANLGTHTFFNIMLPIWFWCGYTDLGRGMTHILAMGVFFSGFIKDLVCLPRPL  95

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP++RIT +      ALEYG PS+H+ N + ++ Y +  +  ++     +  +A   L 
Sbjct  96   SPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYAILLLRENSAELSPNMSLAIQVLA  152

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAI  913
                  I LGR+Y GMH   D++ G A G A+
Sbjct  153  YFYACSIILGRLYCGMHGFFDVVFGSALGAAL  184



>gb|KIW75819.1| hypothetical protein Z517_10563 [Fonsecaea pedrosoi CBS 271.37]
Length=535

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 73/137 (53%), Gaps = 3/137 (2%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            F+   LP LFW G++ L R M  ++A   +    +KD++  PRP SPP+ RIT +     
Sbjct  71   FFMVMLPILFWCGNTNLGRGMVHVLASGVFFSGFLKDLLCLPRPLSPPLTRITMS---GS  127

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
             ALEYG PS+H+ N + ++ Y L+ +   T + D + ++    L       I LGR+Y G
Sbjct  128  AALEYGFPSTHSTNAVSVAVYSLYLLRQETNDLDTNLKLGLQILAYFYAVSIVLGRLYCG  187

Query  863  MHSLIDIIGGLAFGLAI  913
            MH   D+I G   G  I
Sbjct  188  MHGFFDVIWGSILGALI  204



>ref|XP_001274683.1| sphingosine-1-phosphate phosphohydrolase [Aspergillus clavatus 
NRRL 1]
 gb|EAW13257.1| sphingosine-1-phosphate phosphohydrolase [Aspergillus clavatus 
NRRL 1]
Length=529

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLP LFWSG++ L R    ++A   +    IKD+
Sbjct  50   EKIRTPSLDSYFAFTANLGTHTFFMVFLPLLFWSGYTNLGRGFVQVLASGVFFSGFIKDL  109

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLL  751
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y++
Sbjct  110  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYVI  151



>gb|EMR88247.1| putative long-chain base protein 3 protein [Botrytis cinerea 
BcDW1]
Length=580

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 81/152 (53%), Gaps = 3/152 (2%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+   LP LFW GH+ L R M  ++A   ++   IKD+ S PRP 
Sbjct  82   LDTYFAVTANLGTHTFFMIVLPILFWCGHTSLGRGMVHILATGVFITGFIKDMFSLPRPL  141

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP+ RIT +      ALEYG PS+H+ N + ++ Y L  + S       +T++A   + 
Sbjct  142  SPPLHRITMS---GSAALEYGFPSTHSANAVSVAVYALFTLHSPECQLLPTTKLALEIVS  198

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAI  913
                  I LGR+Y GMH  +D+I G   G  I
Sbjct  199  YSYAFSIVLGRLYCGMHGFVDVIVGSIIGALI  230



>dbj|BAO37964.1| dihydrosphingosine 1-phosphate phosphatase LCB3 [Kluyveromyces 
marxianus DMKU3-1042]
Length=406

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 78/154 (51%), Gaps = 4/154 (3%)
 Frame = +2

Query  461  DGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTS  640
            D FF+  +   S  FY   LP   W+G S   R +  ++ +  Y+   +KD    PRP S
Sbjct  78   DVFFASTAIMGSHTFYVVMLPIPRWTGFSAATRDLVYILGYSIYLSGHLKDYWCLPRPKS  137

Query  641  PPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialis  820
            PPV RIT ++   +   EYG PSSHT N   +S  +L Y+ S  K +D S       L +
Sbjct  138  PPVHRITLSDYTTK---EYGAPSSHTANATGVSMLILWYI-SQIKLDDESNRGIFYLLAA  193

Query  821  llvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
            +   ++  GR+Y GMH ++D+  G+  G+   A 
Sbjct  194  VYFFILTFGRLYCGMHGILDLSSGIVIGIVCCAL  227



>dbj|BAP69516.1| dihydrosphingosine 1-phosphate phosphatase LCB3 [Kluyveromyces 
marxianus]
Length=406

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 78/154 (51%), Gaps = 4/154 (3%)
 Frame = +2

Query  461  DGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTS  640
            D FF+  +   S  FY   LP   W+G S   R +  ++ +  Y+   +KD    PRP S
Sbjct  78   DVFFASTAIMGSHTFYVVMLPIPRWTGFSAATRDLVYILGYSIYLSGHLKDYWCLPRPKS  137

Query  641  PPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialis  820
            PPV RIT ++   +   EYG PSSHT N   +S  +L Y+ S  K +D S       L +
Sbjct  138  PPVHRITLSDYTTK---EYGAPSSHTANATGVSMLILWYI-SQIKLDDESNRGIFYLLAA  193

Query  821  llvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
            +   ++  GR+Y GMH ++D+  G+  G+   A 
Sbjct  194  VYFFILTFGRLYCGMHGILDLSSGIVIGIVCCAL  227



>emb|CCK69241.1| hypothetical protein KNAG_0C01280 [Kazachstania naganishii CBS 
8797]
Length=399

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 80/160 (50%), Gaps = 4/160 (3%)
 Frame = +2

Query  440  KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVV  619
            K+Q  + D FF   +   S  FY  FLP   W GH +L R +  ++ +  Y+   +KD  
Sbjct  68   KHQSHFGDVFFPYTALLGSHTFYVLFLPMPVWFGHYELTRDLVYILGYSIYLSGFLKDYW  127

Query  620  SAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEi  799
              PRP SPPV+R T ++     A EYG PSSH  N    S Y L Y +       L+ +I
Sbjct  128  CLPRPRSPPVKRSTLSD---YTAKEYGAPSSHAANATGASIYFL-YCIWACAPFSLTYKI  183

Query  800  agialisllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
                L       + +GR+Y GMH ++D+  G+A G+  +A
Sbjct  184  LFTLLTCFYYFSLVVGRVYCGMHGMLDLTAGIACGVVCVA  223



>gb|KEZ46091.1| PAP2 superfamily protein [Scedosporium apiospermum]
Length=563

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 77/152 (51%), Gaps = 3/152 (2%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  FY   LP LFW G+S   + +  ++A   +    IKD++S PRP 
Sbjct  86   LDSYFAITANLGTHTFYMVGLPLLFWCGYSSYGKALVHVLASGVFFTGFIKDMLSLPRPL  145

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP+ RIT T      ALEYG PS+H+ N + ++ Y L  +          T+     L 
Sbjct  146  SPPLHRITMT---GYAALEYGFPSTHSANAVSVAAYALLLLRDPENTLSEGTKTGLEYLA  202

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAI  913
                  I +GR+Y GMH  +D+I G   GL I
Sbjct  203  YFYAFSIVIGRLYCGMHGFLDVIFGSILGLFI  234



>ref|XP_006965353.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR48606.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS01530.1| PAP2 domain protein [Trichoderma reesei RUT C-30]
Length=540

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 89/173 (51%), Gaps = 6/173 (3%)
 Frame = +2

Query  416  TPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDY  592
            TP    +Q K +   LD +F+  +   +  F+  FLP LFW G+   A+ +  ++A   +
Sbjct  50   TPYLAALQAKLRTPALDSYFAITANLGTHTFFMIFLPMLFWGGYPAFAKGLVHILALGVF  109

Query  593  MGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
                +KD  S PRP SPP+ RIT +      ALEYG PS+H+ N + ++ Y + ++ S  
Sbjct  110  WTGFVKDFYSLPRPLSPPLNRITMS---GSAALEYGFPSTHSANAVSVAVYAVLHLRSPD  166

Query  773  KNEDLSTEiagialisllvgliglgriylgMHSLIDIIGG--LAFGLAILAFW  925
                 +T++    L       I  GR+Y GMH  +D+I G  +  G+ IL ++
Sbjct  167  NTFSDTTKLLLEVLAYFYAVSIVFGRLYCGMHGFLDVIVGSIMGAGITILEYY  219



>ref|XP_009157905.1| PAP2 domain-containing protein [Exophiala dermatitidis NIH/UT8656]
 gb|EHY57444.1| PAP2 domain-containing protein [Exophiala dermatitidis NIH/UT8656]
Length=535

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 79/152 (52%), Gaps = 3/152 (2%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+   LP LFW GH+ + R M  ++A   +    IKD++  PRP 
Sbjct  56   LDTYFAMTANLGTHTFFMVMLPILFWCGHTSIGRGMVHILASGVFFSGFIKDLLCLPRPL  115

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP++RIT +      ALEYG PS+H+ N + ++ Y L+ + +          +    + 
Sbjct  116  SPPLQRITMS---GSAALEYGFPSTHSTNAVSVAIYSLYLLRAPNSQMSPQFNLGLQVIC  172

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAI  913
                  I LGR+Y GMH   D+I G A G A+
Sbjct  173  YFYAFSIVLGRLYCGMHGFFDVIWGSALGAAL  204



>emb|CCD54501.1| similar to sphingosine-1-phosphate phosphohydrolase [Botrytis 
cinerea T4]
Length=622

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 81/152 (53%), Gaps = 3/152 (2%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+   LP LFW GH+ L R M  ++A   ++   IKD+ S PRP 
Sbjct  124  LDTYFAVTANLGTHTFFMIVLPILFWCGHTSLGRGMVHILATGVFITGFIKDMFSLPRPL  183

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP+ RIT +      ALEYG PS+H+ N + ++ Y L  + S       +T++A   + 
Sbjct  184  SPPLHRITMS---GSAALEYGFPSTHSANAVSVAVYALFTLHSPECQLLPTTKLALEIVS  240

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAI  913
                  I LGR+Y GMH  +D+I G   G  I
Sbjct  241  YSYAFSIVLGRLYCGMHGFVDVIVGSIIGALI  272



>gb|KJJ28170.1| Phosphatidic acid phosphatase type 2haloperoxidase [Penicillium 
solitum]
Length=522

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 84/159 (53%), Gaps = 3/159 (2%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLPFLFW G   + R +  ++A   +    +KD+
Sbjct  49   EKVRTPTLDSYFAFTANLGTHTFFMVFLPFLFWCGSPSMGRGLVHILASGVFWSGFLKDL  108

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L  + S          
Sbjct  109  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYALALLGSPESTLSAQVT  165

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFGLAI  913
            +   A+  + V  I LGR+Y GMH ++D   G A G AI
Sbjct  166  LLLQAITYIYVVSIVLGRLYCGMHGMLDCTVGCAMGAAI  204



>gb|KIV91096.1| hypothetical protein PV10_05677 [Exophiala mesophila]
Length=532

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 3/152 (2%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+   LP  FW G++ L R MT ++A   +    IKD+V  PRP 
Sbjct  56   LDTYFAMSANLGTHTFFNIMLPIWFWCGYTDLGRGMTHILAMGVFFSGFIKDLVCLPRPL  115

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP++RIT +      ALEYG PS+H+ N + ++ Y +  +  ++     +  +A   L 
Sbjct  116  SPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYAILLLRENSAELSPNMSLAIQVLA  172

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAI  913
                  I LGR+Y GMH   D++ G A G A+
Sbjct  173  YFYACSIILGRLYCGMHGFFDVVFGSALGAAL  204



>gb|KGO41590.1| Phosphatidic acid phosphatase type 2/haloperoxidase [Penicillium 
expansum]
 gb|KGO60173.1| Phosphatidic acid phosphatase type 2/haloperoxidase [Penicillium 
expansum]
 gb|KGO65980.1| Phosphatidic acid phosphatase type 2/haloperoxidase [Penicillium 
expansum]
Length=522

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 84/159 (53%), Gaps = 3/159 (2%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+  FLPFLFW G   + R +  ++A   +    +KD+
Sbjct  49   EKVRTPTLDSYFAFTANLGTHTFFMVFLPFLFWCGSPSMGRGLVHILASGVFWSGFLKDL  108

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L  + S          
Sbjct  109  LCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYALALLGSPDSTLSAQVT  165

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFGLAI  913
            +   A+  + V  I LGR+Y GMH ++D   G A G AI
Sbjct  166  LLLQAITYIYVVSIVLGRLYCGMHGMLDCTVGCAMGAAI  204



>gb|KIW97044.1| hypothetical protein Z519_02436 [Cladophialophora bantiana CBS 
173.52]
Length=535

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 72/137 (53%), Gaps = 3/137 (2%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            F+   LP LFW G++ L R M  ++A   +    +KD++  PRP SPP+ RIT +     
Sbjct  71   FFMVMLPILFWCGNTSLGRGMVHVLASGVFFSGFLKDLLCLPRPLSPPLTRITMS---GS  127

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
             ALEYG PS+H+ N + ++ Y L+ +   T N + S +     L       I LGR+Y G
Sbjct  128  AALEYGFPSTHSTNAVSVALYSLYLLRQETNNFNPSLDFGLQILAYFYALSIVLGRLYCG  187

Query  863  MHSLIDIIGGLAFGLAI  913
            MH   D+I G   G  I
Sbjct  188  MHGFFDVIWGSILGALI  204



>ref|XP_447437.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60374.1| unnamed protein product [Candida glabrata]
Length=425

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 92/181 (51%), Gaps = 7/181 (4%)
 Frame = +2

Query  365  KIRSLTQPWVSRQVVSGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGH  544
            K+RS  + +V  Q  S T    Q  +++  +LD +FS  S   S  FY  FLP   + G+
Sbjct  68   KVRSWLRKYVDNQ--SETLYYWQ-SRWRCKFLDLYFSYTSLMGSHTFYVLFLPLPVYFGY  124

Query  545  SKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLN  724
             +  R M  ++ +  Y+   +KD    PRP SPP+ RIT +      A EYG PSSHT N
Sbjct  125  FEFTRDMVYILGYSIYLSGFLKDYCCLPRPRSPPLHRITLS---AYTAKEYGAPSSHTAN  181

Query  725  TICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGGLAFG  904
               +S   L  ++  T+    S +    A++      + LGRIY GMH ++D++ G A G
Sbjct  182  ATGVSLLFLIALMQSTRYSGFS-KAFLFAMVMFYYLTLVLGRIYCGMHGVLDLVSGTAVG  240

Query  905  L  907
            +
Sbjct  241  V  241



>gb|EHK40742.1| hypothetical protein TRIATDRAFT_85410 [Trichoderma atroviride 
IMI 206040]
Length=551

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 92/174 (53%), Gaps = 6/174 (3%)
 Frame = +2

Query  416  TPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDY  592
            TP    +Q K +   LD +F+  +   +  F+  FLP LFW G++  A+ +  ++A   +
Sbjct  53   TPYLAALQSKLRTPALDSYFAITANLGTHTFFMIFLPMLFWGGYAAFAKGLVHILALGVF  112

Query  593  MGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
                +KD  S PRP SPP+ RIT +      ALEYG PS+H+ N + ++ Y + ++ S  
Sbjct  113  WTGFVKDFYSLPRPLSPPLHRITMS---GSAALEYGFPSTHSANAVSVAVYAILHLRSPD  169

Query  773  KNEDLSTEiagialisllvgliglgriylgMHSLIDIIGG--LAFGLAILAFWL  928
                 +T++A   L       I  GR+Y GMH  +D+I G  +  G+ +L ++L
Sbjct  170  NPFSETTKLALEILSYFYGVSIIFGRLYCGMHGFLDVIIGSIMGAGITLLEYYL  223



>gb|KEQ60952.1| sphingosine-1-phosphate phosphohydrolase-like protein [Aureobasidium 
melanogenum CBS 110374]
Length=566

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 67/114 (59%), Gaps = 4/114 (4%)
 Frame = +2

Query  416  TPISLQIQKY-QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDY  592
            TP   ++Q+  +  +LD +F+  +   +  F+ A LP  FW G++ + R +  ++A   +
Sbjct  58   TPYLAKVQQTCRTPFLDSYFAMTANLGTHTFFMAALPVCFWCGYTGVGRALVHMLALGVF  117

Query  593  MGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLH  754
            +   IKD+V  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y L+
Sbjct  118  LSGWIKDLVCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAFYFLY  168



>gb|KIW47551.1| hypothetical protein PV06_00242 [Exophiala oligosperma]
Length=540

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 89/158 (56%), Gaps = 11/158 (7%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAF---LPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAP  628
            LD +F+    S ++  +TAF   LP LFW GH+ + R M  ++A   +    IKD++  P
Sbjct  56   LDTYFA---FSANLGTHTAFMVLLPILFWCGHTSVGRGMVHVLAAGVFFTGFIKDMLCLP  112

Query  629  RPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagi  808
            RP SPP++RIT +      ALEYG PS+H+ N++ ++ Y L Y+L      + +T+    
Sbjct  113  RPLSPPLQRITMS---GSAALEYGFPSTHSTNSVSVAIYSL-YLLHDNDQMNPNTKFGLQ  168

Query  809  alisllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
             +  L    I LGR+Y GMH   D+I G   G A+LA+
Sbjct  169  IMFYLYAFSIVLGRLYCGMHGFFDVIWGTFIG-AVLAW  205



>emb|CDI54343.1| related to YSR3-dihydrosphingosine-1-phosphate phosphatase [Melanopsichium 
pennsylvanicum 4]
Length=682

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 4/105 (4%)
 Frame = +2

Query  446  QHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSA  625
            +  +LD +F   S   +  F+  FLP +FW G  +  R +  ++AF  Y+ + IKD+   
Sbjct  157  RRPWLDRYFVNTSLLGTHSFFLVFLPMVFWLGSPRFGRGLINVLAFGVYLSSAIKDMFCV  216

Query  626  PRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYV  760
            PRP SPPV R+T       + LEYG PS+H+ N++ ++ Y+  +V
Sbjct  217  PRPYSPPVTRLTV----GTHHLEYGFPSTHSTNSVSIALYIYLWV  257



>gb|EHK15496.1| hypothetical protein TRIVIDRAFT_39143 [Trichoderma virens Gv29-8]
Length=549

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 90/174 (52%), Gaps = 8/174 (5%)
 Frame = +2

Query  416  TPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDY  592
            TP    +Q K +   LD +F+  +   +  F+  FLP LFW G+   A+ +  ++A   +
Sbjct  52   TPYLAALQSKLRTPALDSYFAITANLGTHTFFMVFLPMLFWGGYPAFAKGLVHILALGVF  111

Query  593  MGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGY-LLHYVLSH  769
                IKD  S PRP SPP+ RIT +      ALEYG PS+H+ N + ++ Y LLH    H
Sbjct  112  WTGFIKDFYSLPRPLSPPLHRITMS---GSAALEYGFPSTHSANAVSVAVYALLHLRDPH  168

Query  770  TKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGG--LAFGLAILAFW  925
                + +T++    L       I  GR+Y GMH  +D+I G  +  G+ +L ++
Sbjct  169  NTFSE-TTKLLLEILSYFYAVSIVFGRLYCGMHGFLDVIIGSIMGAGITVLEYY  221



>dbj|GAM88621.1| hypothetical protein ANO11243_066550 [fungal sp. No.11243]
Length=460

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 84/162 (52%), Gaps = 3/162 (2%)
 Frame = +2

Query  428  LQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCI  607
            + I   +   LD +F+ ++   +  FY  FLP  FW G +   R +  ++A   +    +
Sbjct  1    MTIDAVRSPTLDTYFAYVANLGTHTFYMMFLPVCFWCGQTTGGRALVHMLALGVFWSGWV  60

Query  608  KDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDL  787
            KD++  PRP SPP++RIT +      ALEYG PS+H+ N + ++ Y+++++     +   
Sbjct  61   KDLLCLPRPLSPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYMIYHIQDGGTSLPE  117

Query  788  STEiagialisllvgliglgriylgMHSLIDIIGGLAFGLAI  913
            S ++  I         I +GR+Y GMH   D++ G   G AI
Sbjct  118  SFQLPAIIACYWYAISIIIGRLYCGMHGFFDVVIGSLLGAAI  159



>ref|XP_007930990.1| hypothetical protein MYCFIDRAFT_205133 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME78678.1| hypothetical protein MYCFIDRAFT_205133 [Pseudocercospora fijiensis 
CIRAD86]
Length=501

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 66/118 (56%), Gaps = 4/118 (3%)
 Frame = +2

Query  404  VVSGTPISLQIQK-YQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMA  580
            V   TP   +IQ+  +  +LD +F+  +   +  F+   LP  FW G+ +L   +  ++A
Sbjct  39   VRKETPYLAKIQETLRSPFLDSYFALTANLGTHTFFMTALPICFWCGYPELGVALVHMLA  98

Query  581  FCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLH  754
               Y+   +KD+V  PRP SPP++RIT +      A+EYG PS+HT N I ++ Y LH
Sbjct  99   AGVYLSGYVKDLVCLPRPLSPPLQRITMS---GSAAMEYGFPSTHTTNAISVAVYSLH  153



>gb|EEQ90992.1| sphingosine-1-phosphate phosphohydrolase [Blastomyces dermatitidis 
ER-3]
Length=573

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 4/155 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  FY   LP LFW G++++ R +  L+A   ++    KD++  PRP 
Sbjct  57   LDSWFAITANLGTHTFYMVMLPILFWCGYTEVGRGLVHLLASGVFISGWFKDMLCLPRPL  116

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP+ RIT +      ALEYG PS+H+ N I +  Y LH + S        T      ++
Sbjct  117  SPPLHRITMS---GSAALEYGFPSTHSTNAISVVVYALHLLNSPDSTASPVTNTIFRIVL  173

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
             +    I +GR+Y GMH   D+I G   G A+L F
Sbjct  174  YIFGTSIVIGRLYCGMHGFFDVIIGSFLG-ALLGF  207



>ref|XP_002623067.1| sphingosine-1-phosphate phosphohydrolase [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ71315.1| sphingosine-1-phosphate phosphohydrolase [Blastomyces dermatitidis 
SLH14081]
Length=573

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 4/155 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  FY   LP LFW G++++ R +  L+A   ++    KD++  PRP 
Sbjct  57   LDSWFAITANLGTHTFYMVMLPILFWCGYTEVGRGLVHLLASGVFISGWFKDMLCLPRPL  116

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP+ RIT +      ALEYG PS+H+ N I +  Y LH + S        T      ++
Sbjct  117  SPPLHRITMS---GSAALEYGFPSTHSTNAISVVVYALHLLNSPDSTASPVTNTIFRIVL  173

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
             +    I +GR+Y GMH   D+I G   G A+L F
Sbjct  174  YIFGTSIVIGRLYCGMHGFFDVIIGSFLG-ALLGF  207



>gb|KDQ22460.1| hypothetical protein PLEOSDRAFT_1059960 [Pleurotus ostreatus 
PC15]
Length=585

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 96/187 (51%), Gaps = 16/187 (9%)
 Frame = +2

Query  380  TQPW----VSRQVVSG----TPISLQIQKY-QHGYLDGFFSGLSCSVSVPFYTAFLPFLF  532
            T PW    + RQ+V      + +  +IQ Y +  +LD +F   S   +  F+   LP +F
Sbjct  47   TLPWWRAALRRQIVKNVTWESNVIARIQDYIRTPWLDAYFVYTSSLGTHTFFMIMLPMMF  106

Query  533  WSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSS  712
            + G+ +L  ++  ++A   Y  + IKD++ +PRP +PPV R+T       + LEYG PS+
Sbjct  107  FFGYEELGTELVTVLAAGVYFSSFIKDLICSPRPFAPPVTRLTI----GTHHLEYGFPST  162

Query  713  HTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGG  892
            H+ N++ ++  L  Y L H +    S       L+++    I  GRIY  MHS ID + G
Sbjct  163  HSTNSVSMA--LFFYALVH-QIASPSAYTTSTILLTVYAFSIVFGRIYTAMHSFIDCVAG  219

Query  893  LAFGLAI  913
               G AI
Sbjct  220  SCLGAAI  226



>gb|EGE87063.1| sphingosine-1-phosphate phosphohydrolase [Blastomyces dermatitidis 
ATCC 18188]
 gb|EQL36073.1| hypothetical protein BDFG_02333 [Blastomyces dermatitidis ATCC 
26199]
Length=573

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 4/155 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  FY   LP LFW G++++ R +  L+A   ++    KD++  PRP 
Sbjct  57   LDSWFAITANLGTHTFYMVMLPILFWCGYTEVGRGLVHLLASGVFISGWFKDMLCLPRPL  116

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP+ RIT +      ALEYG PS+H+ N I +  Y LH + S        T      ++
Sbjct  117  SPPLHRITMS---GSAALEYGFPSTHSTNAISVVVYALHLLNSPDSTASPVTNTIFRIVL  173

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
             +    I +GR+Y GMH   D+I G   G A+L F
Sbjct  174  YIFGTSIVIGRLYCGMHGFFDVIIGSFLG-ALLGF  207



>gb|EQL36074.1| hypothetical protein, variant [Blastomyces dermatitidis ATCC 
26199]
Length=522

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 4/155 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  FY   LP LFW G++++ R +  L+A   ++    KD++  PRP 
Sbjct  6    LDSWFAITANLGTHTFYMVMLPILFWCGYTEVGRGLVHLLASGVFISGWFKDMLCLPRPL  65

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP+ RIT +      ALEYG PS+H+ N I +  Y LH + S        T      ++
Sbjct  66   SPPLHRITMS---GSAALEYGFPSTHSTNAISVVVYALHLLNSPDSTASPVTNTIFRIVL  122

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
             +    I +GR+Y GMH   D+I G   G A+L F
Sbjct  123  YIFGTSIVIGRLYCGMHGFFDVIIGSFLG-ALLGF  156



>gb|KIM59073.1| hypothetical protein SCLCIDRAFT_16570 [Scleroderma citrinum Foug 
A]
Length=481

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 105/185 (57%), Gaps = 8/185 (4%)
 Frame = +2

Query  371  RSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHS  547
            RS  +  V + V   +P   ++Q + +H +LD +F  +S   +  F+   LP LF+ G+ 
Sbjct  35   RSSIRNMVLKVVERKSPFLAEMQHRVRHPWLDVYFLYMSSLGTHTFFLIGLPILFFFGYF  94

Query  548  KLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNT  727
            +L   + +++A   Y+ + IKD+V +PRP +PPV R+T       + LEYG PS+H+ ++
Sbjct  95   ELGLGLVVVLASGAYLSSFIKDLVCSPRPFAPPVTRLTI----GSHHLEYGFPSTHSTHS  150

Query  728  ICLSGYLL-HYVLSHTKNEDLS--TEiagialisllvgliglgriylgMHSLIDIIGGLA  898
            + ++ ++  H   ++T++  +S  T     A++ + V  I  GR+Y GMHS+ID   G+A
Sbjct  151  VSMTLFIFGHIHRAYTEHSAMSNITYFTSCAILLVYVVTIVFGRLYTGMHSIIDCTAGVA  210

Query  899  FGLAI  913
             G  I
Sbjct  211  LGTGI  215



>gb|EMD34637.1| hypothetical protein CERSUDRAFT_116813 [Ceriporiopsis subvermispora 
B]
Length=550

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 69/114 (61%), Gaps = 4/114 (4%)
 Frame = +2

Query  422  ISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGN  601
            I+    K ++G+LD +F   S   +  F+T FLP ++  G+++ AR + +++    Y+ +
Sbjct  104  IAAMQAKVRNGFLDTYFVYTSTLGTHTFFTIFLPAIWIFGYAESARALLMVLGLGVYLSS  163

Query  602  CIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVL  763
             +KD++ +PRP +PPV R+T       + LEYG PS+H+ N++ ++ YL   VL
Sbjct  164  FLKDLICSPRPFAPPVTRLTM----GNHHLEYGFPSTHSTNSVSIALYLYSLVL  213



>ref|XP_001939379.1| sphingosine-1-phosphate phosphohydrolase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU42098.1| sphingosine-1-phosphate phosphohydrolase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=587

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 82/157 (52%), Gaps = 3/157 (2%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+  FLP  FW G++ + R    ++A   Y+   +KD++  PRP 
Sbjct  88   LDSYFAYTANLGTHTFFMVFLPIQFWCGYTSIGRATVFMLAAGVYVTGFLKDMLCLPRPL  147

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP+ RI+ +      ALEYG PSSH+ N + ++ Y ++ +    + ++ +  +   AL 
Sbjct  148  SPPLARISMS---GSAALEYGFPSSHSANAVSVAFYAIYTLRQSAEQDNSNWNMGLQALF  204

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILAFWL  928
                  I  GR+Y GMH  +D+I G   G  I A  L
Sbjct  205  YFYALSIIAGRLYCGMHGFLDVIVGSIMGALITAIQL  241



>gb|KEF61564.1| hypothetical protein A1O9_03132 [Exophiala aquamarina CBS 119918]
Length=527

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 4/108 (4%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+   LP  FW G++ L R +  ++A   +    IKD+V  PRP 
Sbjct  56   LDTYFAMSANLGTHTFFNIMLPIWFWCGYTSLGRGIVRILAMGVFFSGFIKDLVCLPRPL  115

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE  781
            SPP++RIT +      ALEYG PS+H+ N + ++ Y + ++L H+ +E
Sbjct  116  SPPLQRITMS---GSAALEYGFPSTHSTNAVSVAVYAI-FLLRHSGDE  159



>ref|XP_448581.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG61544.1| unnamed protein product [Candida glabrata]
Length=404

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 74/151 (49%), Gaps = 4/151 (3%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F   +   +  FY   LP   W GH +L R +  +  +  Y+   +KD    PRP 
Sbjct  77   LDVYFKYSALMGAHTFYIIALPIPIWFGHWELTRDLVYIFGYSIYLSGFLKDYWCLPRPR  136

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPPV RIT +   K    EYG PSSHT N   +S Y L  +   + N  L+++      +
Sbjct  137  SPPVERITLS---KYTTREYGAPSSHTANATGVSAYFLWRIWVES-NFTLTSKALLSIGV  192

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLA  910
                  + +GR+Y GMH L+D+  G   GLA
Sbjct  193  MFYYLTLVVGRVYCGMHGLLDLYSGALVGLA  223



>gb|KIW27105.1| hypothetical protein PV07_06880 [Cladophialophora immunda]
Length=535

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 72/137 (53%), Gaps = 3/137 (2%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            F+   LP LFW G++ L R M  ++A   +    +KD++  PRP SPP+ RIT +     
Sbjct  71   FFMVMLPILFWCGNTGLGRGMVHILASGVFFSGFLKDLLCLPRPLSPPLTRITMS---GS  127

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
             ALEYG PS+H+ N + ++ Y L+ +   T + D +  +    L       I LGR+Y G
Sbjct  128  AALEYGFPSTHSTNAVSVAVYSLYLLRQETNSLDPNVNLGLQMLAYFYALSIVLGRLYCG  187

Query  863  MHSLIDIIGGLAFGLAI  913
            MH   D+I G   G  I
Sbjct  188  MHGFFDVIWGSILGALI  204



>gb|KGL86892.1| Sphingosine-1-phosphate phosphatase 2, partial [Charadrius vociferus]
Length=324

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 82/153 (54%), Gaps = 12/153 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   +   FY  FLPF++W+    ++R+M ++ +   Y+G   KD
Sbjct  8    VKNYFYYYLFKFSAALGEEI---FYITFLPFIYWNVDYSVSRRMIIIWSIVMYIGQVSKD  64

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLST  793
            ++  PRP SPPV ++    D      EYGMPS+H +    +S     ++++ T       
Sbjct  65   ILKWPRPLSPPVVKLEMRTDA-----EYGMPSTHAMAATAIS---FSFLIATTNQYKYPF  116

Query  794  EiagialisllvgliglgriylgMHSLIDIIGG  892
            E  G+    +   L+ L R+Y GMH+++D+IGG
Sbjct  117  E-LGLVAAFVFSTLVCLSRLYTGMHTVLDVIGG  148



>gb|KIW16902.1| hypothetical protein PV08_04092 [Exophiala spinifera]
Length=534

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 90/158 (57%), Gaps = 11/158 (7%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAF---LPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAP  628
            LD +F+    S ++  +TAF   LP LFW GH+ + R M  ++A   +    IKD++  P
Sbjct  56   LDTYFA---FSANLGTHTAFMVLLPILFWCGHTSVGRGMVHVLAAGVFFTGFIKDMLCLP  112

Query  629  RPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagi  808
            RP SPP++RIT +      ALEYG PS+H+ N++ ++ Y L Y+L      + +T++   
Sbjct  113  RPLSPPLQRITMS---GSAALEYGFPSTHSTNSVSVAIYSL-YLLHGNDQMNPNTKLGLQ  168

Query  809  alisllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
             L  L    I LGR+Y GMH   D++ G   G A+LA+
Sbjct  169  ILFYLYAFSIVLGRLYCGMHGFFDVVWGTFIG-AVLAW  205



>ref|XP_007743402.1| hypothetical protein A1O5_04608 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ72104.1| hypothetical protein A1O5_04608 [Cladophialophora psammophila 
CBS 110553]
Length=535

 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 71/137 (52%), Gaps = 3/137 (2%)
 Frame = +2

Query  503  FYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKE  682
            F+   LP LFW G++ L R M  ++A   +    +KD++  PRP SPP+ RIT +     
Sbjct  71   FFMVMLPILFWCGNTNLGRGMVHVLASGVFFSGFLKDLLCLPRPLSPPLTRITMS---GS  127

Query  683  NALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylg  862
             ALEYG PS+H+ N + ++ Y L+ +   T N + S       L       I LGR+Y G
Sbjct  128  AALEYGFPSTHSTNAVSVALYSLYLLRQETNNFNPSLNFGLQILAYFYALSIVLGRLYCG  187

Query  863  MHSLIDIIGGLAFGLAI  913
            MH   D++ G   G  I
Sbjct  188  MHGFFDVLWGSILGALI  204



>gb|EOA96450.1| Sphingosine-1-phosphate phosphatase 2, partial [Anas platyrhynchos]
Length=322

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 81/160 (51%), Gaps = 12/160 (8%)
 Frame = +2

Query  413  GTPISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDY  592
            G P    ++ Y + YL  F + L   +   FY  FLPF +W+    ++R+M ++ +   Y
Sbjct  1    GCPQKYVVKNYFYYYLFKFSAALGEEI---FYITFLPFTYWNIDHSVSRRMIIIWSIVMY  57

Query  593  MGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHT  772
            +G   KD++  PRP SPPV ++    D      EYGMPS+H +    +S       L  T
Sbjct  58   IGQVSKDILKWPRPLSPPVVKLEVRTDA-----EYGMPSTHAMAATAIS----FSFLIAT  108

Query  773  KNEDLSTEiagialisllvgliglgriylgMHSLIDIIGG  892
             N+       G+    +   L+ L R+Y GMH+++D+IGG
Sbjct  109  MNQYKYPFELGLMAAFVFSTLVCLSRLYTGMHTVLDVIGG  148



>ref|XP_009970260.1| PREDICTED: sphingosine-1-phosphate phosphatase 2-like, partial 
[Tyto alba]
Length=161

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 8/102 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   +   FY  FLPF +W+    ++R+M ++ +   Y+G   KD
Sbjct  26   VKNYFYYYLFKFSAALGEEI---FYITFLPFTYWNIDHSVSRRMIIIWSIVMYIGQVSKD  82

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLS  739
            ++  PRP SPPV ++    D      EYGMPS+H +    +S
Sbjct  83   ILKWPRPLSPPVVKLEMRADA-----EYGMPSTHAMAATAIS  119



>gb|EMF09591.1| sphingosine-1-phosphate phosphohydrolase [Sphaerulina musiva 
SO2202]
Length=548

 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 3/108 (3%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            Q  +   LD +F+  +   +  F+   LP  FW G+  L   +  ++A   Y+    KD+
Sbjct  62   QAARSPLLDSYFAMTANLGTHTFFMTALPVCFWCGYPVLGVALVQMLAAGVYLSGYAKDM  121

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYV  760
            V  PRP SPP++RIT +      ALEYG PS+HT N + ++ Y LHY+
Sbjct  122  VCLPRPLSPPLQRITMS---GSAALEYGFPSTHTTNAVSVAVYCLHYL  166



>ref|XP_009888515.1| PREDICTED: sphingosine-1-phosphate phosphatase 2 [Charadrius 
vociferus]
Length=405

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 85/161 (53%), Gaps = 12/161 (7%)
 Frame = +2

Query  410  SGTPISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCD  589
            SG+     ++ Y + YL  F + L   +   FY  FLPF++W+    ++R+M ++ +   
Sbjct  81   SGSAQKYIVKNYFYYYLFKFSAALGEEI---FYITFLPFIYWNVDYSVSRRMIIIWSIVM  137

Query  590  YMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSH  769
            Y+G   KD++  PRP SPPV ++    D      EYGMPS+H +    +S     ++++ 
Sbjct  138  YIGQVSKDILKWPRPLSPPVVKLEMRTDA-----EYGMPSTHAMAATAIS---FSFLIAT  189

Query  770  TKNEDLSTEiagialisllvgliglgriylgMHSLIDIIGG  892
            T       E  G+    +   L+ L R+Y GMH+++D+IGG
Sbjct  190  TNQYKYPFE-LGLVAAFVFSTLVCLSRLYTGMHTVLDVIGG  229



>ref|XP_003306259.1| hypothetical protein PTT_19375 [Pyrenophora teres f. teres 0-1]
 gb|EFQ85653.1| hypothetical protein PTT_19375 [Pyrenophora teres f. teres 0-1]
Length=574

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 82/157 (52%), Gaps = 3/157 (2%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+  FLP  FW G++ + R    ++A   Y    +KD++  PRP 
Sbjct  76   LDSYFAYTANLGTHTFFMVFLPIQFWCGYTSIGRATVFMLAAGVYATGFLKDMLCLPRPL  135

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP+ RI+ +      ALEYG PSSH+ N + ++ Y ++ +    + ++ +  +   AL 
Sbjct  136  SPPLARISMS---GSAALEYGFPSSHSANAVSVAFYAIYTLRQSAEQDNSNWNLGLQALF  192

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAILAFWL  928
                  I +GR+Y GMH  +D+I G   G  I A  L
Sbjct  193  YFYALSIIVGRLYCGMHGFLDVIVGSIMGALITAIQL  229



>ref|XP_005232339.1| PREDICTED: sphingosine-1-phosphate phosphatase 2 [Falco peregrinus]
Length=344

 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 85/153 (56%), Gaps = 12/153 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   +   FY  FLPF++W+    ++R+M ++ +   Y+G   KD
Sbjct  28   VKNYFYYYLFKFSAALGEEI---FYITFLPFIYWNIDHSVSRRMIIIWSIVMYIGQVSKD  84

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLST  793
            ++  PRP SPPV ++    + + NA EYGMPS+H +    +S     ++++ T       
Sbjct  85   ILKWPRPLSPPVVKL----EMRTNA-EYGMPSTHAMAATAIS---FSFLIATTNQYKYPF  136

Query  794  EiagialisllvgliglgriylgMHSLIDIIGG  892
            E  G+    +   L+ L R+Y GMH+++D+IGG
Sbjct  137  E-LGLVAAFVFSTLVCLSRLYTGMHTVLDVIGG  168



>ref|XP_001946730.1| PREDICTED: sphingosine-1-phosphate phosphatase 2-like [Acyrthosiphon 
pisum]
Length=394

 Score = 72.0 bits (175),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 77/137 (56%), Gaps = 9/137 (7%)
 Frame = +2

Query  506  YTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKEN  685
            Y   +PFL W+  S +AR+M L+ A   Y+G  IKD+V  PRP  PPV R+     + + 
Sbjct  85   YAIVIPFLIWNIDSAVARKMVLVWAAIMYIGQSIKDIVQWPRPECPPVIRL-----QTKW  139

Query  686  ALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvgliglgriylgM  865
            ++EYGMPS+H + +I L   +L+++ S+    + S  I  + L  +L+ L  L      M
Sbjct  140  SIEYGMPSTHAMISIALPFSVLYFI-SNRYQINFSIGIIVVFLWCMLISLSRLYLG---M  195

Query  866  HSLIDIIGGLAFGLAIL  916
            H+++D+I GL     +L
Sbjct  196  HTVLDVIAGLVLATILL  212



>gb|KJZ80254.1| hypothetical protein HIM_00104 [Hirsutella minnesotensis 3608]
Length=545

 Score = 72.4 bits (176),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 81/159 (51%), Gaps = 3/159 (2%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
            +K +   LD +F+  +   +  F+   LP LFW G +   + +  ++A   +    IKD 
Sbjct  66   EKLRTPALDSYFAITANLGTHTFFMVGLPILFWYGWASFGKGLVHILALGVFWTGFIKDF  125

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
             S PRP SPP+ RIT +      ALEYG PS+H+ N + ++ Y L  + S       ST+
Sbjct  126  FSLPRPLSPPLHRITMS---GSAALEYGFPSTHSANAVSVAVYALLILRSPENALSASTK  182

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFGLAI  913
            +   +L       I  GR+Y GMH  +D++ G  FG AI
Sbjct  183  LVFESLAWFYAVSIVFGRLYCGMHGFLDVLIGSTFGAAI  221



>gb|KFY85696.1| hypothetical protein V500_08197 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=607

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 82/159 (52%), Gaps = 3/159 (2%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
             K +   LD +F+  +   +  F+   LP LFW G++ L R M  ++A   +    +KD+
Sbjct  82   DKMRSPALDSYFAITANLGTHTFFMVVLPILFWCGYTSLGRGMVHILANGVFFTGFLKDM  141

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +S PRP SPP+ RIT +      ALEYG PS+H+ N + ++ Y L  + S       +T+
Sbjct  142  LSLPRPLSPPLHRITMS---GSAALEYGFPSTHSANAVSVAVYALFTLRSPDCTLAPTTK  198

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFGLAI  913
            +    L       I LGR+Y GMH  +D+I G   G  I
Sbjct  199  LILEGLSYAYALSIILGRLYCGMHGFLDVIIGSLMGATI  237



>ref|XP_008717552.1| hypothetical protein HMPREF1541_04988 [Cyphellophora europaea 
CBS 101466]
 gb|ETN40709.1| hypothetical protein HMPREF1541_04988 [Cyphellophora europaea 
CBS 101466]
Length=532

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = +2

Query  455  YLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRP  634
            +LD +F+  +   +  F+   LP +FW G++ + R M  ++A   Y     KD++  PRP
Sbjct  55   FLDSYFAMTANLGTHTFFMVMLPIIFWCGYNNVGRGMVYILAAGVYWSGFAKDLMCLPRP  114

Query  635  TSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLH  754
             SPP++RIT +      ALEYG PS+H+ N + ++ Y +H
Sbjct  115  LSPPLQRITMS---GSVALEYGFPSTHSANAVSVAIYCIH  151



>gb|KFW67813.1| Sphingosine-1-phosphate phosphatase 2, partial [Pygoscelis adeliae]
Length=324

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 80/153 (52%), Gaps = 12/153 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   +   FY  FLPF +W+    ++R+M ++ +   Y+G   KD
Sbjct  8    VKNYFYYYLFKFSAALGEEI---FYITFLPFTYWNIDHSVSRRMIIIWSIVMYIGQVSKD  64

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLST  793
            ++  PRP SPPV ++    D      EYGMPS+H +    +S       L+ T N+    
Sbjct  65   ILKWPRPLSPPVVKLEMRTDA-----EYGMPSTHAMAATAIS----FSFLTATTNQYKYP  115

Query  794  EiagialisllvgliglgriylgMHSLIDIIGG  892
               G+    +   L+ L R+Y GMH+++D+IGG
Sbjct  116  FELGLVAAFVFSMLVCLSRLYTGMHTVLDVIGG  148



>gb|KFZ03523.1| hypothetical protein V502_10875 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=607

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 82/159 (52%), Gaps = 3/159 (2%)
 Frame = +2

Query  437  QKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDV  616
             K +   LD +F+  +   +  F+   LP LFW G++ L R M  ++A   +    +KD+
Sbjct  82   DKMRSPALDSYFAITANLGTHTFFMVVLPILFWCGYTSLGRGMVHILANGVFFTGFLKDM  141

Query  617  VSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTE  796
            +S PRP SPP+ RIT +      ALEYG PS+H+ N + ++ Y L  + S       +T+
Sbjct  142  LSLPRPLSPPLHRITMS---GSAALEYGFPSTHSANAVSVAVYALFTLRSPDCTLAPTTK  198

Query  797  iagialisllvgliglgriylgMHSLIDIIGGLAFGLAI  913
            +    L       I LGR+Y GMH  +D+I G   G  I
Sbjct  199  LILEGLSYAYALSIILGRLYCGMHGFLDVIIGSLMGATI  237



>gb|KFM05728.1| Sphingosine-1-phosphate phosphatase 2, partial [Aptenodytes forsteri]
Length=324

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 80/153 (52%), Gaps = 12/153 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   +   FY  FLPF +W+    ++R+M ++ +   Y+G   KD
Sbjct  8    VKNYFYYYLFKFSAALGEEI---FYITFLPFTYWNIDHSVSRRMIIIWSIVMYIGQVSKD  64

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLST  793
            ++  PRP SPPV ++    D      EYGMPS+H +    +S       L+ T N+    
Sbjct  65   ILKWPRPLSPPVVKLEMRTDA-----EYGMPSTHAMAATAIS----FSFLTATTNQYKYP  115

Query  794  EiagialisllvgliglgriylgMHSLIDIIGG  892
               G+    +   L+ L R+Y GMH+++D+IGG
Sbjct  116  FELGLVAAFVFSMLVCLSRLYTGMHTVLDVIGG  148



>ref|XP_009942309.1| PREDICTED: sphingosine-1-phosphate phosphatase 2 [Opisthocomus 
hoazin]
Length=387

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 97/197 (49%), Gaps = 23/197 (12%)
 Frame = +2

Query  335  VISSIFNVTQKIRSLTQPWVSRQVVS------GTPISLQIQKYQ-----HGYLDGFFSGL  481
            V+SS   + +++ +  +  V RQ+ S      G P     QKY      + YL  F + L
Sbjct  27   VVSSGLTLGRRLNASGETEVCRQIGSVLTCGVGAPREGCAQKYIVKNYFYYYLFKFSAAL  86

Query  482  SCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRIT  661
               +   FY  FLPF +W+    ++R+M ++ +   Y+G   KD++  PRP SPPV ++ 
Sbjct  87   GQEI---FYITFLPFTYWNIDHSVSRRMIIIWSIVMYIGQVSKDILKWPRPLSPPVVKL-  142

Query  662  ATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagialisllvglig  841
                E+    EYGMPS+H +    +S       L  T N+       G+    +   L+ 
Sbjct  143  ----ERRTDAEYGMPSTHAMAATAIS----FSFLIATVNQYKYPFALGLVAAFVFSALVC  194

Query  842  lgriylgMHSLIDIIGG  892
            L R+Y GMH+++D+IGG
Sbjct  195  LSRLYTGMHTVLDVIGG  211



>gb|ELK30561.1| Sphingosine-1-phosphate phosphatase 2, partial [Myotis davidii]
Length=188

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 56/106 (53%), Gaps = 8/106 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   V   FY  FLPF  W+    L+R++ ++     Y+G   KD
Sbjct  9    VKNYFYYYLFRFSAALGQEV---FYITFLPFTHWNIDPYLSRRLVIIWVLVMYIGQVAKD  65

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLL  751
            ++  PRP SPPV ++     EK    E+GMPS+H +    +S  LL
Sbjct  66   ILKWPRPFSPPVVKL-----EKRVIAEFGMPSTHAMAATAISFTLL  106



>ref|XP_007878242.1| hypothetical protein PFL1_02535 [Pseudozyma flocculosa PF-1]
 gb|EPQ29862.1| hypothetical protein PFL1_02535 [Pseudozyma flocculosa PF-1]
Length=724

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 60/102 (59%), Gaps = 4/102 (4%)
 Frame = +2

Query  455  YLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRP  634
            +LD +F   S   +  F+  FLP  +W G++K AR +  ++A   Y+ + +KD+   PRP
Sbjct  157  WLDRYFVNTSLLGTHSFFLIFLPMAYWLGNAKFARGLVNVLALGVYLSSALKDLFCIPRP  216

Query  635  TSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYV  760
             SPPV R+T       + LEYG PS+H+ N++ ++ YL  +V
Sbjct  217  YSPPVTRLTI----GTHHLEYGFPSTHSTNSVSIALYLYLWV  254



>ref|XP_004864533.1| PREDICTED: sphingosine-1-phosphate phosphatase 2 isoform X2 [Heterocephalus 
glaber]
Length=357

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 83/154 (54%), Gaps = 12/154 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   V   FY  FLPF  W+    L+R++ L+     Y+G   KD
Sbjct  39   VKNYFYYYLFRFSAALGQEV---FYITFLPFTHWNIDPYLSRRLVLIWVLVMYVGQVAKD  95

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLST  793
            ++  PRP+SPPV ++     EK    E+GMPS+H +    +S  LL      TK+     
Sbjct  96   ILKWPRPSSPPVVKL-----EKRVMAEFGMPSTHAMAATAISFTLL----ISTKDRYQYP  146

Query  794  EiagialisllvgliglgriylgMHSLIDIIGGL  895
             + G+ +  +   L+ L R+Y GMH+++D++GG+
Sbjct  147  FVLGLTMAVVSSTLVCLSRLYTGMHTVLDVLGGV  180



>gb|KFO56014.1| Sphingosine-1-phosphate phosphatase 2, partial [Corvus brachyrhynchos]
Length=322

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 83/153 (54%), Gaps = 12/153 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   +   FY  FLPF +W+    ++R+M ++ +   Y+G   KD
Sbjct  7    VKNYFYYYLFKFSAALGEEI---FYITFLPFTYWNIDHSVSRRMIIVWSIVMYIGQVSKD  63

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLST  793
            ++  PRP SPPV ++    + + NA EYGMPS+H +    +S     + ++ T       
Sbjct  64   ILKWPRPLSPPVVKL----EMRTNA-EYGMPSTHAMAATAIS---FSFFIATTNQYKYPF  115

Query  794  EiagialisllvgliglgriylgMHSLIDIIGG  892
            E  G+    +   L+ L R+Y GMH+L+D+IGG
Sbjct  116  E-LGLVAAFVFSTLVCLSRLYTGMHTLLDVIGG  147



>ref|XP_007263693.1| hypothetical protein FOMMEDRAFT_79789 [Fomitiporia mediterranea 
MF3/22]
 gb|EJD05547.1| hypothetical protein FOMMEDRAFT_79789 [Fomitiporia mediterranea 
MF3/22]
Length=490

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 93/171 (54%), Gaps = 11/171 (6%)
 Frame = +2

Query  422  ISLQIQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGN  601
            I+   QK +  +LD +F   S   +  F+   LP LF+ G+ ++   +  ++A   Y+ +
Sbjct  43   IAKMQQKVRSPFLDSYFMYTSSLGTHTFFMMGLPCLFFFGYPEIGSGLIFVLATGVYVSS  102

Query  602  CIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNE  781
             +KD++ APRP +PPV R+T       + LEYG PS+H+ N++ ++ Y+  Y L HT+  
Sbjct  103  FLKDLICAPRPYTPPVSRLTM----GSHHLEYGFPSTHSTNSVSIALYV--YSLVHTQYF  156

Query  782  DLSTEiagial-----isllvgliglgriylgMHSLIDIIGGLAFGLAILA  919
              +T            +++ V  I  GR+Y GMHS++D +GG+  G  + A
Sbjct  157  TAATISTLTYSCFCIFLAIYVCSIVFGRLYTGMHSVVDCVGGVTLGAGVWA  207



>ref|XP_006690726.1| dihydrosphingosine 1-phosphate phosphatase-like protein [Chaetomium 
thermophilum var. thermophilum DSM 1495]
 gb|EGS23484.1| dihydrosphingosine 1-phosphate phosphatase-like protein [Chaetomium 
thermophilum var. thermophilum DSM 1495]
Length=552

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 77/152 (51%), Gaps = 3/152 (2%)
 Frame = +2

Query  458  LDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKDVVSAPRPT  637
            LD +F+  +   +  F+   LP LFW G     + +  ++A   +    IKD+ S PRP 
Sbjct  77   LDYYFAWTANLGTHTFFMIMLPVLFWCGEPAYGKGIVHILATGVFFTGFIKDMFSLPRPL  136

Query  638  SPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLSTEiagiali  817
            SPP+ RIT +      ALEYG PS+H+ N + ++ Y L  +  H+     ST +A   L 
Sbjct  137  SPPLHRITMS---GSAALEYGFPSTHSANAVSVAVYSLLKLREHSAAFSPSTALALEVLA  193

Query  818  sllvgliglgriylgMHSLIDIIGGLAFGLAI  913
                  I  GR+Y GMH  +D+I G A G  I
Sbjct  194  YFYAVSIVFGRLYCGMHGFLDVITGSALGALI  225



>ref|XP_004864532.1| PREDICTED: sphingosine-1-phosphate phosphatase 2 isoform X1 [Heterocephalus 
glaber]
Length=386

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 83/154 (54%), Gaps = 12/154 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   V   FY  FLPF  W+    L+R++ L+     Y+G   KD
Sbjct  68   VKNYFYYYLFRFSAALGQEV---FYITFLPFTHWNIDPYLSRRLVLIWVLVMYVGQVAKD  124

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLST  793
            ++  PRP+SPPV ++     EK    E+GMPS+H +    +S  LL      TK+     
Sbjct  125  ILKWPRPSSPPVVKL-----EKRVMAEFGMPSTHAMAATAISFTLL----ISTKDRYQYP  175

Query  794  EiagialisllvgliglgriylgMHSLIDIIGGL  895
             + G+ +  +   L+ L R+Y GMH+++D++GG+
Sbjct  176  FVLGLTMAVVSSTLVCLSRLYTGMHTVLDVLGGV  209



>ref|XP_009697986.1| PREDICTED: sphingosine-1-phosphate phosphatase 2-like, partial 
[Cariama cristata]
Length=143

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (55%), Gaps = 8/102 (8%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   +   FY  FLPF++W+    ++R+M ++ +   Y+G   KD
Sbjct  8    VKNYFYYYLFKFSAALGEEI---FYITFLPFIYWNIDHSVSRRMIIVWSTVMYIGQVSKD  64

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLS  739
            ++  PRP SPPV ++    D      EYGMPS+H +    +S
Sbjct  65   ILKWPRPLSPPVVKLEMRTDA-----EYGMPSTHAMAATAIS  101



>ref|XP_006463641.1| hypothetical protein AGABI2DRAFT_225504 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV44319.1| hypothetical protein AGABI2DRAFT_225504 [Agaricus bisporus var. 
bisporus H97]
Length=560

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 72/137 (53%), Gaps = 5/137 (4%)
 Frame = +2

Query  365  KIRSLTQPWVSRQVVSGTPISLQIQ-KYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSG  541
            K R+  + W+   +   + I  Q+Q K +  +LD +F   S   +  F+   LP  FW G
Sbjct  45   KWRAAPRRWLLPLIRKESQILAQMQEKIRTPWLDAYFVYTSSLGTHTFFMTTLPACFWFG  104

Query  542  HSKLARQMTLLMAFCDYMGNCIKDVVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTL  721
            ++ LAR +   ++   Y  + +KD+  +PRP SPPV R+T       + LEYG PS+H+ 
Sbjct  105  YTDLARGLLSALSIGVYCSSVVKDLFCSPRPFSPPVTRLTM----GSHHLEYGFPSTHST  160

Query  722  NTICLSGYLLHYVLSHT  772
            N+I ++  L  Y+   T
Sbjct  161  NSISIALLLFAYIYDLT  177



>gb|KFP11370.1| Sphingosine-1-phosphate phosphatase 2, partial [Egretta garzetta]
Length=324

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 82/163 (50%), Gaps = 12/163 (7%)
 Frame = +2

Query  434  IQKYQHGYLDGFFSGLSCSVSVPFYTAFLPFLFWSGHSKLARQMTLLMAFCDYMGNCIKD  613
            ++ Y + YL  F + L   +   FY  FLPF +W+    ++R+M ++ +   Y+G   KD
Sbjct  8    VKNYFYYYLFKFSAALGEEI---FYITFLPFTYWNIDHSVSRRMIIVWSVVMYIGQVSKD  64

Query  614  VVSAPRPTSPPVRRITATEDEKENALEYGMPSSHTLNTICLSGYLLHYVLSHTKNEDLST  793
            ++  PRP SPPV ++     E     EYGMPS+H +    +S       L  T N+    
Sbjct  65   ILKWPRPLSPPVVKL-----EMRTVAEYGMPSTHAMAATAIS----FSFLMATANQYKYP  115

Query  794  EiagialisllvgliglgriylgMHSLIDIIGGLAFGLAILAF  922
               G+    +   L+ L R+Y GMH+++D+IGG      +L F
Sbjct  116  FELGLVAAFVFSMLVCLSRLYTGMHTVLDVIGGALISAVLLMF  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2227596869306