BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8063

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU39465.1|  hypothetical protein MIMGU_mgv1a011231mg                122   2e-29   Erythranthe guttata [common monkey flower]
gb|AGH32912.1|  biotin carboxyl carrier protein subunit                 119   1e-28   Camellia chekiangoleosa
gb|KJB66285.1|  hypothetical protein B456_010G135200                    116   1e-27   Gossypium raimondii
ref|XP_011013395.1|  PREDICTED: biotin carboxyl carrier protein o...    116   2e-27   Populus euphratica
ref|XP_011013398.1|  PREDICTED: biotin carboxyl carrier protein o...    116   2e-27   Populus euphratica
ref|XP_011013394.1|  PREDICTED: biotin carboxyl carrier protein o...    116   2e-27   Populus euphratica
ref|XP_006480445.1|  PREDICTED: biotin carboxyl carrier protein o...    115   3e-27   Citrus sinensis [apfelsine]
ref|XP_006428625.1|  hypothetical protein CICLE_v10012287mg             115   3e-27   Citrus clementina [clementine]
gb|KDO54013.1|  hypothetical protein CISIN_1g021186mg                   115   3e-27   Citrus sinensis [apfelsine]
gb|KJB66284.1|  hypothetical protein B456_010G135200                    115   4e-27   Gossypium raimondii
gb|KJB66286.1|  hypothetical protein B456_010G135200                    115   5e-27   Gossypium raimondii
ref|XP_007029253.1|  Biotin carboxyl carrier protein subunit of o...    114   7e-27   Theobroma cacao [chocolate]
ref|XP_010245955.1|  PREDICTED: biotin carboxyl carrier protein o...    114   1e-26   Nelumbo nucifera [Indian lotus]
ref|XP_007029252.1|  Biotin carboxyl carrier protein subunit of o...    114   2e-26   Theobroma cacao [chocolate]
gb|ABU41516.1|  biotin carboxyl carrier protein subunit                 112   5e-26   Gossypium hirsutum [American cotton]
gb|KHG03380.1|  Biotin carboxyl carrier of acetyl-CoA carboxylase...    113   8e-26   Gossypium arboreum [tree cotton]
ref|XP_012085782.1|  PREDICTED: biotin carboxyl carrier protein o...    109   6e-25   Jatropha curcas
ref|XP_010038361.1|  PREDICTED: biotin carboxyl carrier protein o...    109   7e-25   Eucalyptus grandis [rose gum]
emb|CDP04187.1|  unnamed protein product                                108   1e-24   Coffea canephora [robusta coffee]
gb|KJB81173.1|  hypothetical protein B456_013G132300                    108   1e-24   Gossypium raimondii
gb|KJB81168.1|  hypothetical protein B456_013G132300                    108   1e-24   Gossypium raimondii
gb|KJB81172.1|  hypothetical protein B456_013G132300                    108   2e-24   Gossypium raimondii
gb|KJB81169.1|  hypothetical protein B456_013G132300                    108   2e-24   Gossypium raimondii
gb|KJB81171.1|  hypothetical protein B456_013G132300                    108   2e-24   Gossypium raimondii
gb|KJB81170.1|  hypothetical protein B456_013G132300                    108   2e-24   Gossypium raimondii
ref|NP_001234322.1|  biotin carboxylase carrier protein                 107   4e-24   Solanum lycopersicum
ref|XP_006345777.1|  PREDICTED: biotin carboxyl carrier protein o...    107   7e-24   Solanum tuberosum [potatoes]
ref|XP_010679318.1|  PREDICTED: biotin carboxyl carrier protein o...    106   7e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_974789.1|  chloroplastic acetylcoenzyme A carboxylase 1          104   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077153.1|  PREDICTED: biotin carboxyl carrier protein o...    104   4e-23   
ref|NP_197143.1|  chloroplastic acetylcoenzyme A carboxylase 1          103   6e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAB51193.1|  acetyl-CoA carboxylase biotin-containing subunit        103   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002325474.2|  hypothetical protein POPTR_0019s08170g             103   7e-23   
prf||2208465A  Ac-CoA carboxylase                                       103   7e-23
gb|AAC49114.1|  acetyl-CoA carboxylase biotin-containing subunit        103   8e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009588294.1|  PREDICTED: biotin carboxyl carrier protein o...    102   2e-22   Nicotiana tomentosiformis
ref|XP_009759359.1|  PREDICTED: biotin carboxyl carrier protein o...    102   2e-22   Nicotiana sylvestris
gb|AII99820.1|  biotin carboxylase carrier protein                      102   2e-22   Nicotiana tabacum [American tobacco]
ref|XP_006428626.1|  hypothetical protein CICLE_v10012287mg             103   2e-22   Citrus clementina [clementine]
gb|KDO54014.1|  hypothetical protein CISIN_1g021186mg                   103   2e-22   Citrus sinensis [apfelsine]
gb|KDO54015.1|  hypothetical protein CISIN_1g021186mg                   102   2e-22   Citrus sinensis [apfelsine]
ref|XP_010649227.1|  PREDICTED: biotin carboxyl carrier protein o...    102   2e-22   Vitis vinifera
ref|XP_009588296.1|  PREDICTED: biotin carboxyl carrier protein o...    102   2e-22   Nicotiana tomentosiformis
gb|AGB07441.1|  biotin carboxyl carrier protein                         102   3e-22   Persea americana
ref|XP_009759358.1|  PREDICTED: biotin carboxyl carrier protein o...    102   4e-22   Nicotiana sylvestris
ref|XP_007204703.1|  hypothetical protein PRUPE_ppa009574mg             101   4e-22   
gb|ACF17635.1|  putative biotin carboxyl carrier protein 2              101   4e-22   Capsicum annuum
ref|XP_002276955.2|  PREDICTED: biotin carboxyl carrier protein o...    101   5e-22   Vitis vinifera
ref|XP_010101225.1|  Biotin carboxyl carrier protein of acetyl-Co...    102   5e-22   
ref|XP_008240458.1|  PREDICTED: biotin carboxyl carrier protein o...    101   6e-22   Prunus mume [ume]
ref|XP_010676827.1|  PREDICTED: biotin carboxyl carrier protein o...    100   1e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU39717.1|  hypothetical protein MIMGU_mgv1a011080mg                100   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_002514825.1|  Biotin carboxyl carrier protein subunit of o...    100   2e-21   Ricinus communis
ref|XP_007029254.1|  Biotin carboxyl carrier protein subunit of o...  99.8    3e-21   
gb|AEI16464.1|  chloroplast acetyl-CoA carboxylase biotin-contain...  99.0    5e-21   Brassica napus [oilseed rape]
ref|XP_012085781.1|  PREDICTED: biotin carboxyl carrier protein o...  97.8    1e-20   Jatropha curcas
gb|AEI16463.1|  chloroplast acetyl-CoA carboxylase biotin-contain...  97.1    2e-20   Brassica napus [oilseed rape]
gb|AFK33449.1|  unknown                                               96.3    4e-20   Lotus japonicus
ref|XP_007204704.1|  hypothetical protein PRUPE_ppa009574mg           95.9    5e-20   
gb|KJB66288.1|  hypothetical protein B456_010G135200                  94.7    5e-20   Gossypium raimondii
gb|ACO53610.1|  biotin carboxyl carrier protein 1-2                   95.9    6e-20   Arachis hypogaea [goober]
ref|XP_008240457.1|  PREDICTED: biotin carboxyl carrier protein o...  95.9    6e-20   Prunus mume [ume]
ref|XP_008240456.1|  PREDICTED: biotin carboxyl carrier protein o...  95.5    8e-20   Prunus mume [ume]
gb|AEI16461.1|  chloroplast acetyl-CoA carboxylase biotin-contain...  95.1    9e-20   Brassica napus [oilseed rape]
ref|XP_010492538.1|  PREDICTED: biotin carboxyl carrier protein o...  95.1    9e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009131537.1|  PREDICTED: biotin carboxyl carrier protein o...  95.1    9e-20   Brassica rapa
gb|AEI16460.1|  chloroplast acetyl-CoA carboxylase biotin-contain...  95.1    9e-20   Brassica rapa
gb|ACN85391.1|  acetyl-coenzyme A carboxylase                         94.0    2e-19   Suaeda salsa
gb|AEI16462.1|  chloroplast acetyl-CoA carboxylase biotin-contain...  94.0    2e-19   Brassica napus [oilseed rape]
gb|ACO53609.1|  biotin carboxyl carrier protein 1-1                   94.0    3e-19   Arachis hypogaea [goober]
ref|XP_009126109.1|  PREDICTED: biotin carboxyl carrier protein o...  94.0    3e-19   Brassica rapa
gb|KJB81167.1|  hypothetical protein B456_013G132300                  93.6    3e-19   Gossypium raimondii
gb|AEI16459.1|  chloroplast acetyl-CoA carboxylase biotin-contain...  93.6    3e-19   Brassica rapa
ref|XP_010456549.1|  PREDICTED: biotin carboxyl carrier protein o...  92.8    4e-19   Camelina sativa [gold-of-pleasure]
emb|CAN80851.1|  hypothetical protein VITISV_040144                   94.4    4e-19   Vitis vinifera
ref|XP_010420330.1|  PREDICTED: biotin carboxyl carrier protein o...  93.6    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010453799.1|  PREDICTED: biotin carboxyl carrier protein o...  93.2    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_008456473.1|  PREDICTED: biotin carboxyl carrier protein o...  93.2    4e-19   Cucumis melo [Oriental melon]
ref|XP_010321292.1|  PREDICTED: biotin carboxylase carrier protei...  93.2    5e-19   
ref|XP_006286538.1|  hypothetical protein CARUB_v10001679mg           92.8    6e-19   Capsella rubella
ref|XP_006345776.1|  PREDICTED: biotin carboxyl carrier protein o...  92.8    8e-19   Solanum tuberosum [potatoes]
ref|XP_002873773.1|  BCCP/BCCP-1/BCCP1/CAC1-A/CAC1A                   92.4    9e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_011013396.1|  PREDICTED: biotin carboxyl carrier protein o...  91.7    1e-18   Populus euphratica
ref|XP_011013397.1|  PREDICTED: biotin carboxyl carrier protein o...  91.7    2e-18   Populus euphratica
ref|XP_006400177.1|  hypothetical protein EUTSA_v10014313mg           91.3    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_003624197.1|  Acetyl-CoA carboxylase biotin carboxyl carri...  90.9    2e-18   Medicago truncatula
ref|XP_010558581.1|  PREDICTED: biotin carboxyl carrier protein o...  90.9    3e-18   Tarenaya hassleriana [spider flower]
ref|XP_010420331.1|  PREDICTED: biotin carboxyl carrier protein o...  90.5    4e-18   
ref|XP_008456465.1|  PREDICTED: biotin carboxyl carrier protein o...  90.5    5e-18   Cucumis melo [Oriental melon]
ref|XP_004139256.1|  PREDICTED: biotin carboxyl carrier protein o...  90.1    6e-18   Cucumis sativus [cucumbers]
gb|KHN29258.1|  Biotin carboxyl carrier protein of acetyl-CoA car...  89.7    6e-18   Glycine soja [wild soybean]
emb|CDY38117.1|  BnaC02g06560D                                        89.7    7e-18   Brassica napus [oilseed rape]
ref|XP_011648731.1|  PREDICTED: biotin carboxyl carrier protein o...  89.7    7e-18   Cucumis sativus [cucumbers]
ref|XP_004493036.1|  PREDICTED: biotin carboxyl carrier protein o...  89.0    1e-17   
gb|KHN40485.1|  Biotin carboxyl carrier protein of acetyl-CoA car...  87.4    1e-17   Glycine soja [wild soybean]
gb|AFK47404.1|  unknown                                               89.0    1e-17   Medicago truncatula
gb|KFK25879.1|  hypothetical protein AALP_AA8G174100                  88.6    2e-17   Arabis alpina [alpine rockcress]
ref|XP_007139713.1|  hypothetical protein PHAVU_008G053000g           87.8    3e-17   Phaseolus vulgaris [French bean]
ref|NP_001238375.1|  biotin carboxyl carrier protein of acetyl-Co...  87.8    3e-17   Glycine max [soybeans]
ref|XP_003534503.1|  PREDICTED: biotin carboxyl carrier protein o...  87.0    5e-17   Glycine max [soybeans]
emb|CAA62261.1|  biotin carboxyl carrier protein                      84.0    3e-16   Brassica napus [oilseed rape]
gb|ERM99905.1|  hypothetical protein AMTR_s00110p00065160             85.1    3e-16   Amborella trichopoda
gb|AEI16458.1|  chloroplast acetyl-CoA carboxylase biotin-contain...  85.1    3e-16   Brassica oleracea
ref|XP_011621080.1|  PREDICTED: biotin carboxyl carrier protein o...  84.7    3e-16   Amborella trichopoda
ref|XP_009412715.1|  PREDICTED: biotin carboxyl carrier protein o...  83.2    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAM75182.1|  biotin carboxyl carrier protein                      82.0    2e-15   Ricinus communis
ref|XP_007032701.1|  Biotin carboxyl carrier protein of acetyl-Co...  82.4    2e-15   Theobroma cacao [chocolate]
ref|XP_002526099.1|  Biotin carboxyl carrier protein subunit of o...  81.6    4e-15   Ricinus communis
ref|XP_010525094.1|  PREDICTED: biotin carboxyl carrier protein o...  81.6    4e-15   Tarenaya hassleriana [spider flower]
ref|XP_007151304.1|  hypothetical protein PHAVU_004G035000g           81.6    5e-15   Phaseolus vulgaris [French bean]
ref|XP_007151303.1|  hypothetical protein PHAVU_004G035000g           81.3    5e-15   Phaseolus vulgaris [French bean]
gb|KJB33436.1|  hypothetical protein B456_006G011100                  80.1    1e-14   Gossypium raimondii
gb|KJB33440.1|  hypothetical protein B456_006G011100                  80.5    1e-14   Gossypium raimondii
gb|KJB75635.1|  hypothetical protein B456_012G049400                  79.7    1e-14   Gossypium raimondii
gb|KJB75636.1|  hypothetical protein B456_012G049400                  79.7    2e-14   Gossypium raimondii
gb|KJB75633.1|  hypothetical protein B456_012G049400                  79.3    2e-14   Gossypium raimondii
gb|KHG02691.1|  Biotin carboxyl carrier of acetyl-CoA carboxylase...  79.3    2e-14   Gossypium arboreum [tree cotton]
ref|XP_011072842.1|  PREDICTED: biotin carboxyl carrier protein o...  78.2    6e-14   Sesamum indicum [beniseed]
ref|XP_011072841.1|  PREDICTED: biotin carboxyl carrier protein o...  78.2    6e-14   Sesamum indicum [beniseed]
gb|ACT33948.1|  biotin carboxyl carrier protein subunit               77.8    8e-14   Jatropha curcas
ref|XP_011000101.1|  PREDICTED: biotin carboxyl carrier protein o...  77.4    1e-13   Populus euphratica
ref|XP_010032526.1|  PREDICTED: biotin carboxyl carrier protein o...  77.0    1e-13   Eucalyptus grandis [rose gum]
ref|XP_002323896.2|  hypothetical protein POPTR_0017s12810g           77.0    2e-13   
ref|XP_009360536.1|  PREDICTED: biotin carboxyl carrier protein o...  77.0    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_007151296.1|  hypothetical protein PHAVU_004G034300g           76.6    2e-13   Phaseolus vulgaris [French bean]
gb|KHN48816.1|  Biotin carboxyl carrier protein of acetyl-CoA car...  77.0    2e-13   Glycine soja [wild soybean]
ref|NP_001241523.1|  uncharacterized protein LOC100777962             76.6    2e-13   Glycine max [soybeans]
ref|XP_010661139.1|  PREDICTED: biotin carboxyl carrier protein o...  75.9    4e-13   
ref|XP_002284374.1|  PREDICTED: biotin carboxyl carrier protein o...  75.9    4e-13   Vitis vinifera
gb|EYU31591.1|  hypothetical protein MIMGU_mgv1a011799mg              75.5    5e-13   Erythranthe guttata [common monkey flower]
ref|XP_010259375.1|  PREDICTED: biotin carboxyl carrier protein o...  75.1    9e-13   Nelumbo nucifera [Indian lotus]
gb|KJB33439.1|  hypothetical protein B456_006G011100                  73.6    1e-12   Gossypium raimondii
gb|AFP99173.1|  biotin carboxyl carrier protein                       73.6    2e-12   Vernicia fordii [tung oil tree]
gb|KJB75634.1|  hypothetical protein B456_012G049400                  73.9    2e-12   Gossypium raimondii
ref|XP_006384298.1|  hypothetical protein POPTR_0004s11800g           73.2    2e-12   
ref|XP_008451672.1|  PREDICTED: biotin carboxyl carrier protein o...  73.6    3e-12   Cucumis melo [Oriental melon]
ref|XP_002305399.1|  hypothetical protein POPTR_0004s11800g           73.6    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011013434.1|  PREDICTED: biotin carboxyl carrier protein o...  73.2    3e-12   Populus euphratica
ref|XP_010089617.1|  Biotin carboxyl carrier protein of acetyl-Co...  73.2    5e-12   
ref|XP_012084810.1|  PREDICTED: biotin carboxyl carrier protein o...  72.4    6e-12   
ref|XP_008792772.1|  PREDICTED: biotin carboxyl carrier protein o...  72.0    7e-12   
gb|KHN07141.1|  Biotin carboxyl carrier protein of acetyl-CoA car...  72.4    8e-12   Glycine soja [wild soybean]
ref|XP_011072843.1|  PREDICTED: biotin carboxyl carrier protein o...  72.0    9e-12   Sesamum indicum [beniseed]
gb|EPS63946.1|  hypothetical protein M569_10835                       72.0    9e-12   Genlisea aurea
ref|XP_003543944.1|  PREDICTED: biotin carboxyl carrier protein o...  72.0    1e-11   Glycine max [soybeans]
gb|AFK44602.1|  unknown                                               70.9    2e-11   Lotus japonicus
ref|XP_008379410.1|  PREDICTED: biotin carboxyl carrier protein o...  70.9    2e-11   
gb|KJB33437.1|  hypothetical protein B456_006G011100                  68.9    5e-11   Gossypium raimondii
ref|XP_004137199.1|  PREDICTED: biotin carboxyl carrier protein o...  69.7    6e-11   Cucumis sativus [cucumbers]
ref|XP_009613066.1|  PREDICTED: biotin carboxyl carrier protein o...  69.3    6e-11   Nicotiana tomentosiformis
ref|XP_004491870.1|  PREDICTED: biotin carboxyl carrier protein o...  69.3    7e-11   
ref|XP_004489502.1|  PREDICTED: biotin carboxyl carrier protein o...  69.7    8e-11   Cicer arietinum [garbanzo]
emb|CDX69519.1|  BnaA10g18680D                                        68.9    9e-11   
ref|XP_008230865.1|  PREDICTED: biotin carboxyl carrier protein o...  69.3    9e-11   Prunus mume [ume]
ref|XP_009121569.1|  PREDICTED: biotin carboxyl carrier protein o...  68.6    1e-10   Brassica rapa
gb|AFS89700.1|  biotin carboxyl carrier protein                       68.6    1e-10   Vernicia fordii [tung oil tree]
gb|AEI16469.1|  acetyl-CoA carboxylase biotin-containing subunit      68.6    1e-10   Brassica rapa
gb|KFK25777.1|  hypothetical protein AALP_AA8G159100                  68.6    1e-10   Arabis alpina [alpine rockcress]
ref|XP_006400073.1|  hypothetical protein EUTSA_v10014486mg           68.2    1e-10   Eutrema salsugineum [saltwater cress]
gb|AAS46758.1|  biotin carboxyl carrier protein                       68.2    2e-10   Brassica napus [oilseed rape]
ref|XP_009792449.1|  PREDICTED: biotin carboxyl carrier protein o...  68.2    2e-10   Nicotiana sylvestris
ref|XP_010420218.1|  PREDICTED: biotin carboxyl carrier protein o...  67.8    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_007215770.1|  hypothetical protein PRUPE_ppa009593mg           68.2    2e-10   
gb|AEI16468.1|  acetyl-CoA carboxylase biotin-containing subunit      67.8    2e-10   Brassica rapa
ref|XP_010492396.1|  PREDICTED: biotin carboxyl carrier protein o...  67.8    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010453692.1|  PREDICTED: biotin carboxyl carrier protein o...  67.4    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004304236.1|  PREDICTED: biotin carboxyl carrier protein o...  67.8    3e-10   Fragaria vesca subsp. vesca
ref|XP_006431276.1|  hypothetical protein CICLE_v10012388mg           67.4    3e-10   
gb|AFK45654.1|  unknown                                               67.8    3e-10   Lotus japonicus
gb|AFK43158.1|  unknown                                               67.8    3e-10   Lotus japonicus
ref|XP_007037521.1|  Biotin carboxyl carrier protein of acetyl-Co...  67.4    3e-10   
gb|AEI16467.1|  acetyl-CoA carboxylase biotin-containing subunit      67.4    3e-10   Brassica napus [oilseed rape]
gb|AAG44776.1|AF271796_1  biotin carboxyl carrier protein subunit     67.8    4e-10   Glycine max [soybeans]
ref|NP_001235174.1|  biotin carboxyl carrier protein subunit          67.8    4e-10   Glycine max [soybeans]
gb|ERN09068.1|  hypothetical protein AMTR_s00163p00066960             67.0    4e-10   Amborella trichopoda
emb|CDX78635.1|  BnaA03g05470D                                        67.0    4e-10   
ref|XP_010525117.1|  PREDICTED: biotin carboxyl carrier protein o...  67.0    4e-10   Tarenaya hassleriana [spider flower]
ref|XP_006288243.1|  hypothetical protein CARUB_v10001485mg           67.8    4e-10   
ref|XP_009775160.1|  PREDICTED: biotin carboxyl carrier protein o...  67.0    5e-10   Nicotiana sylvestris
ref|XP_009131471.1|  PREDICTED: biotin carboxyl carrier protein o...  66.6    5e-10   Brassica rapa
gb|AEI16466.1|  acetyl-CoA carboxylase biotin-containing subunit      66.6    6e-10   Brassica napus [oilseed rape]
ref|XP_010551815.1|  PREDICTED: biotin carboxyl carrier protein o...  66.6    6e-10   Tarenaya hassleriana [spider flower]
ref|XP_011624494.1|  PREDICTED: biotin carboxyl carrier protein o...  67.0    6e-10   Amborella trichopoda
ref|XP_006431277.1|  hypothetical protein CICLE_v10012388mg           67.0    7e-10   Citrus clementina [clementine]
gb|KDO72741.1|  hypothetical protein CISIN_1g023188mg                 67.0    7e-10   Citrus sinensis [apfelsine]
ref|XP_006482733.1|  PREDICTED: biotin carboxyl carrier protein o...  67.0    7e-10   Citrus sinensis [apfelsine]
gb|KDO72742.1|  hypothetical protein CISIN_1g023188mg                 67.0    7e-10   Citrus sinensis [apfelsine]
ref|XP_006482734.1|  PREDICTED: biotin carboxyl carrier protein o...  67.0    7e-10   Citrus sinensis [apfelsine]
ref|XP_009365859.1|  PREDICTED: biotin carboxyl carrier protein o...  66.6    7e-10   
ref|XP_002871669.1|  hypothetical protein ARALYDRAFT_909527           66.2    8e-10   Arabidopsis lyrata subsp. lyrata
ref|NP_568316.1|  biotin carboxyl carrier protein 2                   66.2    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003618716.1|  Biotin carboxyl carrier protein of acetyl-Co...  66.2    1e-09   Medicago truncatula
gb|AEI16472.1|  acetyl-CoA carboxylase biotin-containing subunit      65.9    1e-09   Brassica oleracea
ref|XP_004241599.1|  PREDICTED: biotin carboxyl carrier protein o...  65.9    1e-09   Solanum lycopersicum
emb|CAA62264.1|  Biotin carboxyl carrier protein                      65.9    1e-09   Brassica napus [oilseed rape]
ref|XP_006354759.1|  PREDICTED: biotin carboxyl carrier protein o...  65.9    1e-09   Solanum tuberosum [potatoes]
ref|XP_009616596.1|  PREDICTED: biotin carboxyl carrier protein o...  65.9    1e-09   Nicotiana tomentosiformis
gb|ACJ84238.1|  unknown                                               65.5    1e-09   Medicago truncatula
emb|CDX70616.1|  BnaC03g07000D                                        65.5    1e-09   
ref|XP_008805109.1|  PREDICTED: biotin carboxyl carrier protein o...  66.2    1e-09   Phoenix dactylifera
gb|AEI16473.1|  acetyl-CoA carboxylase biotin-containing subunit      65.5    2e-09   Brassica oleracea
gb|ACO53613.1|  biotin carboxyl carrier protein 2-3                   65.1    3e-09   Arachis hypogaea [goober]
gb|ACO53615.1|  biotin carboxyl carrier protein 2-5                   65.1    3e-09   Arachis hypogaea [goober]
ref|XP_010030547.1|  PREDICTED: biotin carboxyl carrier protein o...  65.1    3e-09   Eucalyptus grandis [rose gum]
gb|ACO53614.1|  biotin carboxyl carrier protein 2-4                   65.1    3e-09   Arachis hypogaea [goober]
gb|ACO53612.1|  biotin carboxyl carrier protein 2-2                   65.1    3e-09   Arachis hypogaea [goober]
emb|CAC01752.1|  biotin carboxyl carrier protein precursor-like p...  65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010030540.1|  PREDICTED: biotin carboxyl carrier protein o...  65.1    3e-09   Eucalyptus grandis [rose gum]
ref|XP_010030553.1|  PREDICTED: biotin carboxyl carrier protein o...  65.1    3e-09   Eucalyptus grandis [rose gum]
gb|ACO53611.1|  biotin carboxyl carrier protein 2-1                   65.1    3e-09   Arachis hypogaea [goober]
gb|AEI16465.1|  acetyl-CoA carboxylase biotin-containing subunit      63.9    5e-09   Brassica napus [oilseed rape]
ref|XP_004489456.1|  PREDICTED: biotin carboxyl carrier protein o...  64.3    6e-09   Cicer arietinum [garbanzo]
ref|XP_004489455.1|  PREDICTED: biotin carboxyl carrier protein o...  64.3    7e-09   Cicer arietinum [garbanzo]
ref|XP_010939149.1|  PREDICTED: biotin carboxyl carrier protein o...  62.4    3e-08   Elaeis guineensis
gb|AGT55821.1|  biotin carboxyl carrier protein                       61.6    5e-08   Cocos nucifera
emb|CAA62265.1|  Biotin carboxyl carrier protein                      61.2    6e-08   Brassica napus [oilseed rape]
ref|XP_009394324.1|  PREDICTED: biotin carboxyl carrier protein o...  60.5    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003621415.1|  Biotin carboxyl carrier protein of acetyl-Co...  60.1    2e-07   Medicago truncatula
gb|ABK26424.1|  unknown                                               60.1    2e-07   Picea sitchensis
ref|XP_010936328.1|  PREDICTED: biotin carboxyl carrier protein o...  58.5    6e-07   Elaeis guineensis
ref|XP_008805110.1|  PREDICTED: biotin carboxyl carrier protein o...  58.2    8e-07   Phoenix dactylifera
gb|KJB66287.1|  hypothetical protein B456_010G135200                  55.5    2e-06   Gossypium raimondii
ref|XP_009411120.1|  PREDICTED: biotin carboxyl carrier protein o...  57.0    2e-06   
ref|XP_008805111.1|  PREDICTED: biotin carboxyl carrier protein o...  55.8    5e-06   Phoenix dactylifera
ref|XP_010936329.1|  PREDICTED: biotin carboxyl carrier protein o...  54.3    2e-05   
gb|AGG36123.1|  biotin carboxyl carrier protein subunit               51.6    2e-05   Jatropha curcas
gb|AGG36117.1|  biotin carboxyl carrier protein subunit               51.6    2e-05   Jatropha curcas
gb|KHG26758.1|  Biotin carboxyl carrier of acetyl-CoA carboxylase...  53.5    3e-05   Gossypium arboreum [tree cotton]
gb|AGG36122.1|  biotin carboxyl carrier protein subunit               50.8    4e-05   Jatropha platyphylla
gb|KCW51917.1|  hypothetical protein EUGRSUZ_J01371                   50.4    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010939150.1|  PREDICTED: biotin carboxyl carrier protein o...  50.1    5e-04   Elaeis guineensis



>gb|EYU39465.1| hypothetical protein MIMGU_mgv1a011231mg [Erythranthe guttata]
Length=288

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 94/139 (68%), Gaps = 6/139 (4%)
 Frame = +1

Query  211  NVLNSSKCLPLFRHHYS-----QSHPklklklrfssskdlHSNWNHSVVAKAQLNKVSVD  375
            N   SS CLPL RH +S      +    +L  R        + WN S + KAQLN+V+VD
Sbjct  19   NAHKSSTCLPLGRHRHSFLRSNSNKVSFRLSPRSRLHFSSKTGWNCSAMIKAQLNEVAVD  78

Query  376  GSSNAAPGTPPEPEVSSA-SNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIA  552
            GS  AA  T  + E+ S  + DVKLS+E+ P VLA+EESI+EF++QVS+L+KLVDS+DI 
Sbjct  79   GSPKAAASTASKSELLSVEAKDVKLSNESPPTVLATEESISEFITQVSSLLKLVDSKDIV  138

Query  553  ELKLKQLDCELIIRKKEAL  609
            EL LKQLDCE++IRKKEAL
Sbjct  139  ELHLKQLDCEILIRKKEAL  157



>gb|AGH32912.1| biotin carboxyl carrier protein subunit [Camellia chekiangoleosa]
Length=283

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 2/99 (2%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSAS-NDVKLSSETSPAVLASEESI  492
             S+WN S V KAQLN+V+VD SSNAA  TP + EV +A   D K SS  SPA LASEESI
Sbjct  51   QSSWNRSNVIKAQLNEVAVDESSNAA-STPTKSEVPAAEPKDAKPSSVPSPAALASEESI  109

Query  493  AEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +EF+SQV+ LVKLVDSRDI EL+LKQ DCEL+IRKKEA+
Sbjct  110  SEFISQVANLVKLVDSRDIVELQLKQFDCELLIRKKEAM  148



>gb|KJB66285.1| hypothetical protein B456_010G135200 [Gossypium raimondii]
Length=234

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 11/102 (11%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNA--AP----GTPPEPEVSSASNDVKLSSETSPAVLASE  483
              N   V KAQLN+V++DGSSNA  AP    G P     ++ + D K SS+ SP  +A+E
Sbjct  54   GQNSKTVVKAQLNEVAIDGSSNASAAPTMKSGAP-----TAEAKDAKTSSDVSPPAMATE  108

Query  484  ESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ESIAEFL+QVS+LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  109  ESIAEFLNQVSSLVKLVDSRDIVELQLKQLDCELVIRKKEAL  150



>ref|XP_011013395.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X2 [Populus euphratica]
Length=284

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVS-SASNDVKLSSETSPAVLASEESIAEFL  504
            N + + KAQLN+V+VDGSSNAA  T  + EV+   S D K S+E SP  LA+EESI+EF+
Sbjct  54   NGTYLVKAQLNEVAVDGSSNAAASTLAKSEVTLQESKDAKPSNEPSPPSLATEESISEFI  113

Query  505  SQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            SQVS+LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  114  SQVSSLVKLVDSRDIVELQLKQLDCELLIRKKEAL  148



>ref|XP_011013398.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X5 [Populus euphratica]
Length=276

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVS-SASNDVKLSSETSPAVLASEESIAEFL  504
            N + + KAQLN+V+VDGSSNAA  T  + EV+   S D K S+E SP  LA+EESI+EF+
Sbjct  54   NGTYLVKAQLNEVAVDGSSNAAASTLAKSEVTLQESKDAKPSNEPSPPSLATEESISEFI  113

Query  505  SQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            SQVS+LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  114  SQVSSLVKLVDSRDIVELQLKQLDCELLIRKKEAL  148



>ref|XP_011013394.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X1 [Populus euphratica]
Length=284

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVS-SASNDVKLSSETSPAVLASEESIAEFL  504
            N + + KAQLN+V+VDGSSNAA  T  + EV+   S D K S+E SP  LA+EESI+EF+
Sbjct  54   NGTYLVKAQLNEVAVDGSSNAAASTLAKSEVTLQESKDAKPSNEPSPPSLATEESISEFI  113

Query  505  SQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            SQVS+LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  114  SQVSSLVKLVDSRDIVELQLKQLDCELLIRKKEAL  148



>ref|XP_006480445.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like isoform X2 [Citrus sinensis]
Length=285

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 77/96 (80%), Gaps = 6/96 (6%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEF  501
            +W  + V K+QLN+V+ DGSSNA+  TP     ++ + D K  +E SP++LASEESI+EF
Sbjct  61   SWKCATVVKSQLNEVAFDGSSNAS-ATP-----AAETKDAKQPNEPSPSILASEESISEF  114

Query  502  LSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +SQVS+L+KLVDSRDI EL+LKQLDCELIIRKKEAL
Sbjct  115  ISQVSSLIKLVDSRDIVELQLKQLDCELIIRKKEAL  150



>ref|XP_006428625.1| hypothetical protein CICLE_v10012287mg [Citrus clementina]
 ref|XP_006480446.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like isoform X3 [Citrus sinensis]
 gb|ESR41865.1| hypothetical protein CICLE_v10012287mg [Citrus clementina]
Length=277

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 77/96 (80%), Gaps = 6/96 (6%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEF  501
            +W  + V K+QLN+V+ DGSSNA+  TP     ++ + D K  +E SP++LASEESI+EF
Sbjct  53   SWKCATVVKSQLNEVAFDGSSNAS-ATP-----AAETKDAKQPNEPSPSILASEESISEF  106

Query  502  LSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +SQVS+L+KLVDSRDI EL+LKQLDCELIIRKKEAL
Sbjct  107  ISQVSSLIKLVDSRDIVELQLKQLDCELIIRKKEAL  142



>gb|KDO54013.1| hypothetical protein CISIN_1g021186mg [Citrus sinensis]
Length=277

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 77/96 (80%), Gaps = 6/96 (6%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEF  501
            +W  + V K+QLN+V+ DGSSNA+  TP     ++ + D K  +E SP++LASEESI+EF
Sbjct  53   SWKCATVVKSQLNEVAFDGSSNAS-ATP-----AAETKDAKQPNEPSPSILASEESISEF  106

Query  502  LSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +SQVS+L+KLVDSRDI EL+LKQLDCELIIRKKEAL
Sbjct  107  ISQVSSLIKLVDSRDIVELQLKQLDCELIIRKKEAL  142



>gb|KJB66284.1| hypothetical protein B456_010G135200 [Gossypium raimondii]
Length=282

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 11/102 (11%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNA--AP----GTPPEPEVSSASNDVKLSSETSPAVLASE  483
              N   V KAQLN+V++DGSSNA  AP    G P     ++ + D K SS+ SP  +A+E
Sbjct  54   GQNSKTVVKAQLNEVAIDGSSNASAAPTMKSGAP-----TAEAKDAKTSSDVSPPAMATE  108

Query  484  ESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ESIAEFL+QVS+LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  109  ESIAEFLNQVSSLVKLVDSRDIVELQLKQLDCELVIRKKEAL  150



>gb|KJB66286.1| hypothetical protein B456_010G135200 [Gossypium raimondii]
Length=285

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 11/102 (11%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNA--AP----GTPPEPEVSSASNDVKLSSETSPAVLASE  483
              N   V KAQLN+V++DGSSNA  AP    G P     ++ + D K SS+ SP  +A+E
Sbjct  54   GQNSKTVVKAQLNEVAIDGSSNASAAPTMKSGAP-----TAEAKDAKTSSDVSPPAMATE  108

Query  484  ESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ESIAEFL+QVS+LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  109  ESIAEFLNQVSSLVKLVDSRDIVELQLKQLDCELVIRKKEAL  150



>ref|XP_007029253.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), 
putative isoform 2 [Theobroma cacao]
 gb|EOY09755.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), 
putative isoform 2 [Theobroma cacao]
Length=251

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSA-SNDVKLSSETSPAVLASEESIAE  498
            + N S+V KAQLN+VSVDGSS A+  +P +    +A + D K SS+ SP  LA+EESI+E
Sbjct  54   SQNCSIVVKAQLNEVSVDGSSKASATSPDKSGPPTAEAKDAKPSSDASPPALATEESISE  113

Query  499  FLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            FL+QVS+LVKLVDSRDI EL+LKQLDCEL IRKKEA+
Sbjct  114  FLNQVSSLVKLVDSRDIVELQLKQLDCELTIRKKEAM  150



>ref|XP_010245955.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic [Nelumbo nucifera]
Length=293

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIA  495
            HSN NHS   KAQLN+V+VDGSSNA      + ++     D    +E SP+ LA+E SI+
Sbjct  60   HSNRNHSTPLKAQLNEVAVDGSSNAVATPENKSKIPPVEKDDNPGNELSPSALATETSIS  119

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            EF++QVS+L+KLVDSRD+ EL+LKQLDCELIIRKKEAL
Sbjct  120  EFITQVSSLIKLVDSRDVVELQLKQLDCELIIRKKEAL  157



>ref|XP_007029252.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), 
putative isoform 1 [Theobroma cacao]
 gb|EOY09754.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), 
putative isoform 1 [Theobroma cacao]
Length=279

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSA-SNDVKLSSETSPAVLASEESIAE  498
            + N S+V KAQLN+VSVDGSS A+  +P +    +A + D K SS+ SP  LA+EESI+E
Sbjct  54   SQNCSIVVKAQLNEVSVDGSSKASATSPDKSGPPTAEAKDAKPSSDASPPALATEESISE  113

Query  499  FLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            FL+QVS+LVKLVDSRDI EL+LKQLDCEL IRKKEA+
Sbjct  114  FLNQVSSLVKLVDSRDIVELQLKQLDCELTIRKKEAM  150



>gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypium hirsutum]
Length=282

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 11/102 (11%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNA--AP----GTPPEPEVSSASNDVKLSSETSPAVLASE  483
              N   V KAQLN+V++DGSSNA  AP    G P     ++ + D K SS+ SP  +A+E
Sbjct  54   GQNSKTVVKAQLNEVAIDGSSNASAAPTIKSGAP-----TAEAKDAKTSSDVSPLAMATE  108

Query  484  ESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ESIAEFL+QVS+LVKLVDSR I EL+LKQLDCEL+IRKKEAL
Sbjct  109  ESIAEFLNQVSSLVKLVDSRGIVELQLKQLDCELVIRKKEAL  150



>gb|KHG03380.1| Biotin carboxyl carrier of acetyl-CoA carboxylase 1, chloroplastic 
-like protein [Gossypium arboreum]
Length=412

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 76/100 (76%), Gaps = 11/100 (11%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNA--AP----GTPPEPEVSSASNDVKLSSETSPAVLASEES  489
            N   V KAQLN+V++DGSSNA  AP    G P     ++ + D K SS+ SP  +A+EES
Sbjct  56   NSKTVVKAQLNEVAIDGSSNASAAPTIKSGAP-----TAEAKDAKTSSDVSPLAMATEES  110

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            IAEFL+QVS+LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  111  IAEFLNQVSSLVKLVDSRDIVELQLKQLDCELVIRKKEAL  150



>ref|XP_012085782.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X2 [Jatropha curcas]
 ref|XP_012085783.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X3 [Jatropha curcas]
 gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha curcas]
 gb|KDP26884.1| hypothetical protein JCGZ_18042 [Jatropha curcas]
Length=285

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPPEPEV-SSASNDVKLSSETSPAVLASEESIAEFL  504
            N+S + KAQLN+V+VDG SNAA   P    V S    D K S+E S   LA+EESI+EF+
Sbjct  56   NNSTLVKAQLNEVAVDGPSNAAASPPTRSGVPSQEKKDAKPSNEPSAPALATEESISEFI  115

Query  505  SQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +QV++LVKLVDSRDI EL+LKQLDCE+IIRKKEAL
Sbjct  116  TQVASLVKLVDSRDIVELQLKQLDCEVIIRKKEAL  150



>ref|XP_010038361.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic [Eucalyptus grandis]
 gb|KCW84589.1| hypothetical protein EUGRSUZ_B01425 [Eucalyptus grandis]
Length=279

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEV-SSASNDVKLSSETSPAVLASEESI  492
            H     S V KAQ  +VSVDGSSNAA   P +P V +S + D +   + S A LA+E+SI
Sbjct  50   HHTSRSSAVVKAQSKEVSVDGSSNAAATPPSKPAVPASETKDAQPPVDPSSASLATEQSI  109

Query  493  AEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +EF+SQVS LVKLVDSRDI EL+LKQLDCELIIRKKEAL
Sbjct  110  SEFISQVSNLVKLVDSRDIMELQLKQLDCELIIRKKEAL  148



>emb|CDP04187.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 89/139 (64%), Gaps = 12/139 (9%)
 Frame = +1

Query  208  RNVLNSSKCLPLFRHHYSQSHPklklklrfsss-----kdlHSNWNHSVVAKAQLNKVSV  372
            +N   SS  LP    H+  SH K+  +L          K L S  N S VAKAQLN+V+V
Sbjct  19   KNAPKSSPFLPQGHRHFHHSHSKVAFRLTPKPKLRFCSKSLQSTGNRSAVAKAQLNEVAV  78

Query  373  DGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIA  552
            DGSSNA   T   P  S+   DVK S+E     +ASEES+++F++QVS LVKLVDSRDI 
Sbjct  79   DGSSNA---TATSPAKSAEVKDVKSSNEP----VASEESMSQFMTQVSDLVKLVDSRDIV  131

Query  553  ELKLKQLDCELIIRKKEAL  609
            EL+LKQ DCEL+IRKKEAL
Sbjct  132  ELQLKQFDCELLIRKKEAL  150



>gb|KJB81173.1| hypothetical protein B456_013G132300 [Gossypium raimondii]
Length=254

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 13/105 (12%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTP-------PEPEVSSASNDVKLSSETSPAVL  474
             +  N S V KAQLN+V+VDGSSN +   P       PEP+      D K SS   P  L
Sbjct  49   QTGQNDSAVVKAQLNEVAVDGSSNDSTIPPVNSGSSTPEPQ------DAKPSSNVFPPAL  102

Query  475  ASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            A+EESI+EFL+QVS+LVKLVDSRDI EL+LKQLDCELIIRK  AL
Sbjct  103  ATEESISEFLNQVSSLVKLVDSRDIVELQLKQLDCELIIRKNVAL  147



>gb|KJB81168.1| hypothetical protein B456_013G132300 [Gossypium raimondii]
Length=262

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 13/105 (12%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTP-------PEPEVSSASNDVKLSSETSPAVL  474
             +  N S V KAQLN+V+VDGSSN +   P       PEP+      D K SS   P  L
Sbjct  49   QTGQNDSAVVKAQLNEVAVDGSSNDSTIPPVNSGSSTPEPQ------DAKPSSNVFPPAL  102

Query  475  ASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            A+EESI+EFL+QVS+LVKLVDSRDI EL+LKQLDCELIIRK  AL
Sbjct  103  ATEESISEFLNQVSSLVKLVDSRDIVELQLKQLDCELIIRKNVAL  147



>gb|KJB81172.1| hypothetical protein B456_013G132300 [Gossypium raimondii]
Length=268

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 13/105 (12%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTP-------PEPEVSSASNDVKLSSETSPAVL  474
             +  N S V KAQLN+V+VDGSSN +   P       PEP+      D K SS   P  L
Sbjct  51   QTGQNDSAVVKAQLNEVAVDGSSNDSTIPPVNSGSSTPEPQ------DAKPSSNVFPPAL  104

Query  475  ASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            A+EESI+EFL+QVS+LVKLVDSRDI EL+LKQLDCELIIRK  AL
Sbjct  105  ATEESISEFLNQVSSLVKLVDSRDIVELQLKQLDCELIIRKNVAL  149



>gb|KJB81169.1| hypothetical protein B456_013G132300 [Gossypium raimondii]
Length=266

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 13/105 (12%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTP-------PEPEVSSASNDVKLSSETSPAVL  474
             +  N S V KAQLN+V+VDGSSN +   P       PEP+      D K SS   P  L
Sbjct  49   QTGQNDSAVVKAQLNEVAVDGSSNDSTIPPVNSGSSTPEPQ------DAKPSSNVFPPAL  102

Query  475  ASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            A+EESI+EFL+QVS+LVKLVDSRDI EL+LKQLDCELIIRK  AL
Sbjct  103  ATEESISEFLNQVSSLVKLVDSRDIVELQLKQLDCELIIRKNVAL  147



>gb|KJB81171.1| hypothetical protein B456_013G132300 [Gossypium raimondii]
Length=283

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 13/105 (12%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTP-------PEPEVSSASNDVKLSSETSPAVL  474
             +  N S V KAQLN+V+VDGSSN +   P       PEP+      D K SS   P  L
Sbjct  51   QTGQNDSAVVKAQLNEVAVDGSSNDSTIPPVNSGSSTPEPQ------DAKPSSNVFPPAL  104

Query  475  ASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            A+EESI+EFL+QVS+LVKLVDSRDI EL+LKQLDCELIIRK  AL
Sbjct  105  ATEESISEFLNQVSSLVKLVDSRDIVELQLKQLDCELIIRKNVAL  149



>gb|KJB81170.1| hypothetical protein B456_013G132300 [Gossypium raimondii]
Length=281

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (69%), Gaps = 13/105 (12%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTP-------PEPEVSSASNDVKLSSETSPAVL  474
             +  N S V KAQLN+V+VDGSSN +   P       PEP+      D K SS   P  L
Sbjct  49   QTGQNDSAVVKAQLNEVAVDGSSNDSTIPPVNSGSSTPEPQ------DAKPSSNVFPPAL  102

Query  475  ASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            A+EESI+EFL+QVS+LVKLVDSRDI EL+LKQLDCELIIRK  AL
Sbjct  103  ATEESISEFLNQVSSLVKLVDSRDIVELQLKQLDCELIIRKNVAL  147



>ref|NP_001234322.1| biotin carboxylase carrier protein [Solanum lycopersicum]
 gb|AAO66472.1| biotin carboxylase carrier protein [Solanum lycopersicum]
Length=285

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 6/96 (6%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIA  495
             SNWNHSVV +AQ N+V++ GSSN A  TP      + S +VK  SETS A   SEE+I+
Sbjct  61   QSNWNHSVVTRAQSNEVALGGSSNNA-ATP-----ITQSEEVKSPSETSSATSVSEEAIS  114

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
             F+SQVS+LVKLVDSRD+ EL+LKQ DCE++IRKKE
Sbjct  115  NFISQVSSLVKLVDSRDVVELQLKQFDCEILIRKKE  150



>ref|XP_006345777.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like isoform X2 [Solanum tuberosum]
Length=285

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 6/98 (6%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIA  495
             S+WNHS V +AQ N+V++ GSSN +  TP      + S +VK  SETS A   SEE+I+
Sbjct  63   QSSWNHSAVTRAQSNEVALGGSSNNS-ATP-----ITQSEEVKSPSETSSATSVSEEAIS  116

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
             F+SQVS+LVKLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  117  NFISQVSSLVKLVDSRDIVELQLKQLDCEILIRKKEAL  154



>ref|XP_010679318.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=276

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 74/94 (79%), Gaps = 5/94 (5%)
 Frame = +1

Query  337  VVAKAQLNKVSVDGSSNAAPGTP---PEPEVSSASNDVKLSSETSPAVLASEESIAEFLS  507
            V  KAQLNKV++D S+NA P TP   P P     +N+ ++S  +SP V ASEESI+EF+S
Sbjct  57   VAVKAQLNKVALDNSNNAPP-TPQAKPAPPAEETTNN-EVSGGSSPTVSASEESISEFVS  114

Query  508  QVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            QV++LVKLVDSRDI ELKLKQLDCE++IRKKEA+
Sbjct  115  QVASLVKLVDSRDIVELKLKQLDCEILIRKKEAV  148



>ref|NP_974789.1| chloroplastic acetylcoenzyme A carboxylase 1 [Arabidopsis thaliana]
 gb|AED92287.1| chloroplastic acetylcoenzyme A carboxylase 1 [Arabidopsis thaliana]
Length=254

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKVS   SSNAA    P        N +K SS +SP  LA+EESI+EFL+QV+T
Sbjct  59   VVKAQSNKVSTGASSNAAKVDGPSSAEGKEKNSLKESSASSPE-LATEESISEFLTQVTT  117

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  118  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  147



>ref|XP_011077153.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic [Sesamum indicum]
 ref|XP_011077154.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic [Sesamum indicum]
Length=280

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 69/96 (72%), Gaps = 6/96 (6%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIA  495
             S W  S + KAQLN V+ DGSS A   TP   EVS A       S+ +P  LASEESI+
Sbjct  59   QSGWKCSAMVKAQLNDVATDGSSKAEASTPATSEVSPAK------SKDTPIALASEESIS  112

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            EF++QV++LVKLVD++DI EL+LKQLDCE++IRKKE
Sbjct  113  EFITQVASLVKLVDAKDIVELELKQLDCEVLIRKKE  148



>ref|NP_197143.1| chloroplastic acetylcoenzyme A carboxylase 1 [Arabidopsis thaliana]
 sp|Q42533.2|BCCP1_ARATH RecName: Full=Biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic; Short=AtBCCP1; Short=BCCP-1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF80594.1|AF236873_1 biotin carboxyl carrier protein isoform 1 [Arabidopsis thaliana]
 dbj|BAB09606.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase precursor 
[Arabidopsis thaliana]
 gb|AAK96808.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase precursor 
[Arabidopsis thaliana]
 gb|AAL66875.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase precursor 
[Arabidopsis thaliana]
 gb|AAM65409.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase precursor 
(BCCP) [Arabidopsis thaliana]
 gb|AED92286.1| chloroplastic acetylcoenzyme A carboxylase 1 [Arabidopsis thaliana]
Length=280

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKVS   SSNAA    P        N +K SS +SP  LA+EESI+EFL+QV+T
Sbjct  59   VVKAQSNKVSTGASSNAAKVDGPSSAEGKEKNSLKESSASSPE-LATEESISEFLTQVTT  117

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  118  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  147



>gb|AAB51193.1| acetyl-CoA carboxylase biotin-containing subunit [Arabidopsis 
thaliana]
Length=280

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKVS   SSNAA    P        N +K SS +SP  LA+EESI+EFL+QV+T
Sbjct  59   VVKAQSNKVSTGASSNAAKVDGPSSAEGKEKNSLKESSASSPE-LATEESISEFLTQVTT  117

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  118  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  147



>ref|XP_002325474.2| hypothetical protein POPTR_0019s08170g, partial [Populus trichocarpa]
 gb|EEE99855.2| hypothetical protein POPTR_0019s08170g, partial [Populus trichocarpa]
Length=286

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTPPEPEVS-SASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVD  537
            KV+VDGSSNAA  T  + EV    + D K S+E SP  LA+EESI+EF+SQVS+LVKLVD
Sbjct  96   KVAVDGSSNAAASTLAKSEVPLQEAKDAKPSNEPSPPSLATEESISEFISQVSSLVKLVD  155

Query  538  SRDIAELKLKQLDCELIIRKKEAL  609
            SRDI EL+LKQLDCEL+IRKKEAL
Sbjct  156  SRDIVELQLKQLDCELLIRKKEAL  179



>prf||2208465A Ac-CoA carboxylase
Length=285

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKVS   SSNAA    P        N +K SS +SP  LA+EESI+EFL+QV+T
Sbjct  59   VVKAQSNKVSTGASSNAAKVDGPSSAEGKEKNSLKESSASSPE-LATEESISEFLTQVTT  117

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  118  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  147



>gb|AAC49114.1| acetyl-CoA carboxylase biotin-containing subunit [Arabidopsis 
thaliana]
Length=285

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKVS   SSNAA    P        N +K SS +SP  LA+EESI+EFL+QV+T
Sbjct  59   VVKAQSNKVSTGASSNAAKVDGPSSAEGKEKNSLKESSASSPE-LATEESISEFLTQVTT  117

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  118  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  147



>ref|XP_009588294.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like isoform X1 [Nicotiana tomentosiformis]
Length=287

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIA  495
             ++ NHS VA+AQLN+V+V GSSN A  TP      + S +VK   ETS A   SEESI+
Sbjct  67   QTSRNHSAVARAQLNEVAVGGSSNDA-ATP-----ITQSEEVKSPCETSSATSVSEESIS  120

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
             F+SQVS+LVKLVDSRD+ EL LKQLDCE++IRKKE
Sbjct  121  NFISQVSSLVKLVDSRDVVELHLKQLDCEILIRKKE  156



>ref|XP_009759359.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic isoform X2 [Nicotiana sylvestris]
Length=284

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIA  495
             ++ NHS V +AQLN+V+V GSSN A  TP      + S +VK  SETS A   SEESI+
Sbjct  62   QTSRNHSAVVRAQLNEVAVGGSSNDA-ATP-----ITQSEEVKSPSETSSATPVSEESIS  115

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
             F+SQVS+LVKLVDSRD+ EL LKQLDCE++IRKKE
Sbjct  116  NFISQVSSLVKLVDSRDVVELHLKQLDCEILIRKKE  151



>gb|AII99820.1| biotin carboxylase carrier protein [Nicotiana tabacum]
Length=284

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIA  495
             ++ NHS V +AQLN+V+V GSSN A  TP      + S +VK  SETS A   SEESI+
Sbjct  62   QTSRNHSAVVRAQLNEVAVGGSSNDA-ATP-----ITQSEEVKSPSETSSATPVSEESIS  115

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
             F+SQVS+LVKLVDSRD+ EL LKQLDCE++IRKKE
Sbjct  116  NFISQVSSLVKLVDSRDVVELHLKQLDCEILIRKKE  151



>ref|XP_006428626.1| hypothetical protein CICLE_v10012287mg [Citrus clementina]
 ref|XP_006480444.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like isoform X1 [Citrus sinensis]
 gb|ESR41866.1| hypothetical protein CICLE_v10012287mg [Citrus clementina]
Length=308

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 6/83 (7%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDS  540
            KV+ DGSSNA+  TP     ++ + D K  +E SP++LASEESI+EF+SQVS+L+KLVDS
Sbjct  97   KVAFDGSSNAS-ATP-----AAETKDAKQPNEPSPSILASEESISEFISQVSSLIKLVDS  150

Query  541  RDIAELKLKQLDCELIIRKKEAL  609
            RDI EL+LKQLDCELIIRKKEAL
Sbjct  151  RDIVELQLKQLDCELIIRKKEAL  173



>gb|KDO54014.1| hypothetical protein CISIN_1g021186mg [Citrus sinensis]
Length=308

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 6/83 (7%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDS  540
            KV+ DGSSNA+  TP     ++ + D K  +E SP++LASEESI+EF+SQVS+L+KLVDS
Sbjct  97   KVAFDGSSNAS-ATP-----AAETKDAKQPNEPSPSILASEESISEFISQVSSLIKLVDS  150

Query  541  RDIAELKLKQLDCELIIRKKEAL  609
            RDI EL+LKQLDCELIIRKKEAL
Sbjct  151  RDIVELQLKQLDCELIIRKKEAL  173



>gb|KDO54015.1| hypothetical protein CISIN_1g021186mg [Citrus sinensis]
Length=316

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 6/83 (7%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDS  540
            KV+ DGSSNA+  TP     ++ + D K  +E SP++LASEESI+EF+SQVS+L+KLVDS
Sbjct  105  KVAFDGSSNAS-ATP-----AAETKDAKQPNEPSPSILASEESISEFISQVSSLIKLVDS  158

Query  541  RDIAELKLKQLDCELIIRKKEAL  609
            RDI EL+LKQLDCELIIRKKEAL
Sbjct  159  RDIVELQLKQLDCELIIRKKEAL  181



>ref|XP_010649227.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X2 [Vitis vinifera]
 emb|CBI17609.3| unnamed protein product [Vitis vinifera]
Length=280

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 7/99 (7%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSA-SNDVKLSSETSPAVLASEESI  492
             S    S V KAQLN+V VD S      TPP+ +  +  + DVK S++ SPA LASEESI
Sbjct  55   QSRLIRSPVVKAQLNEV-VDESP-----TPPKSDAPAVEAKDVKSSNKPSPAALASEESI  108

Query  493  AEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +EF++QV++LVKLVDSRDI EL++KQLDCELIIRKKEAL
Sbjct  109  SEFITQVASLVKLVDSRDIVELQMKQLDCELIIRKKEAL  147



>ref|XP_009588296.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like isoform X2 [Nicotiana tomentosiformis]
Length=276

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIA  495
             ++ NHS VA+AQLN+V+V GSSN A  TP      + S +VK   ETS A   SEESI+
Sbjct  67   QTSRNHSAVARAQLNEVAVGGSSNDA-ATP-----ITQSEEVKSPCETSSATSVSEESIS  120

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
             F+SQVS+LVKLVDSRD+ EL LKQLDCE++IRKKE
Sbjct  121  NFISQVSSLVKLVDSRDVVELHLKQLDCEILIRKKE  156



>gb|AGB07441.1| biotin carboxyl carrier protein [Persea americana]
Length=281

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEF  501
            NWN SVV +AQLN+VS+DGSSNA+  T P     + + + K ++E S     SEE I+EF
Sbjct  52   NWNRSVVTRAQLNEVSIDGSSNAS--TSPSKNSEAPALEDKDANEPSLEAPVSEEYISEF  109

Query  502  LSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++QV++LVKLVDSRDI EL+LKQ +CE+IIRKKEAL
Sbjct  110  INQVASLVKLVDSRDIVELQLKQHNCEVIIRKKEAL  145



>ref|XP_009759358.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic isoform X1 [Nicotiana sylvestris]
Length=289

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIA  495
             ++ NHS V +AQLN+V+V GSSN A  TP      + S +VK  SETS A   SEESI+
Sbjct  62   QTSRNHSAVVRAQLNEVAVGGSSNDA-ATP-----ITQSEEVKSPSETSSATPVSEESIS  115

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
             F+SQVS+LVKLVDSRD+ EL LKQLDCE++IRKKE
Sbjct  116  NFISQVSSLVKLVDSRDVVELHLKQLDCEILIRKKE  151



>ref|XP_007204703.1| hypothetical protein PRUPE_ppa009574mg [Prunus persica]
 gb|EMJ05902.1| hypothetical protein PRUPE_ppa009574mg [Prunus persica]
Length=255

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPPEPEV-SSASNDVKLSSETSPAVLASEESIAEFL  504
            N S V K QL++V  DGSSN A   P E E+ +  S D K S+E+ PAVL +EESI+EF+
Sbjct  58   NCSTVVKGQLDEV--DGSSNVAATPPRELELPAQESKDRKTSNESCPAVLDTEESISEFI  115

Query  505  SQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +QV++LVKLVDSRDI EL+LKQLD E+IIRKKEAL
Sbjct  116  AQVASLVKLVDSRDIVELQLKQLDFEVIIRKKEAL  150



>gb|ACF17635.1| putative biotin carboxyl carrier protein 2 [Capsicum annuum]
Length=263

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 66/98 (67%), Gaps = 22/98 (22%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIA  495
            HS+WNHS VA+AQLN+                      S +VK  SETS A   SEE+I+
Sbjct  57   HSSWNHSAVARAQLNE----------------------SEEVKSPSETSSATSVSEETIS  94

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
             F+SQVS+LVKLVDSRD+ ELKLKQLDCE++IRKKEAL
Sbjct  95   NFISQVSSLVKLVDSRDVVELKLKQLDCEILIRKKEAL  132



>ref|XP_002276955.2| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X1 [Vitis vinifera]
Length=286

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSA-SNDVKLSSETSPAVLASEESI  492
             S    S V KAQLN+ SV         TPP+ +  +  + DVK S++ SPA LASEESI
Sbjct  55   QSRLIRSPVVKAQLNEPSVAFKVVDESPTPPKSDAPAVEAKDVKSSNKPSPAALASEESI  114

Query  493  AEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +EF++QV++LVKLVDSRDI EL++KQLDCELIIRKKEAL
Sbjct  115  SEFITQVASLVKLVDSRDIVELQMKQLDCELIIRKKEAL  153



>ref|XP_010101225.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase [Morus 
notabilis]
 gb|EXB88149.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase [Morus 
notabilis]
Length=329

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 4/83 (5%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDS  540
            KV+VDGSSNAA      P   S +   K SSE SP+VLA+EESI+EF+SQV++LVKLVDS
Sbjct  97   KVAVDGSSNAAAS----PSTKSDAPTPKESSEPSPSVLATEESISEFISQVASLVKLVDS  152

Query  541  RDIAELKLKQLDCELIIRKKEAL  609
            RDI EL++KQLDCE++IRKKEAL
Sbjct  153  RDIVELRMKQLDCEVVIRKKEAL  175



>ref|XP_008240458.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X3 [Prunus mume]
Length=279

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPPEPEV-SSASNDVKLSSETSPAVLASEESIAEFL  504
            N S V K QL++V  DGSSN A   P E E+ +  S D K S+E+ PAVL +EESI+EF+
Sbjct  58   NCSTVVKGQLDEV--DGSSNVAATPPRELEIPAQESKDRKTSNESCPAVLDTEESISEFI  115

Query  505  SQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +QV++LVKLVDS+DI EL+LKQLD E+IIRKKEAL
Sbjct  116  AQVASLVKLVDSKDIVELQLKQLDFEVIIRKKEAL  150



>ref|XP_010676827.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +1

Query  325  WNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFL  504
            + H+V AKAQLN   + GSS+ A  +  E       N  K SSE+ P  LASE+SI+EF+
Sbjct  64   FTHAVAAKAQLNNAGLGGSSSGAAQSKSEAPSKEIKNG-KPSSESVPTPLASEDSISEFI  122

Query  505  SQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            SQV++LVKLVDSRDI EL++KQ DCEL+IRKKEA+
Sbjct  123  SQVASLVKLVDSRDIVELQMKQYDCELLIRKKEAI  157



>gb|EYU39717.1| hypothetical protein MIMGU_mgv1a011080mg [Erythranthe guttata]
 gb|EYU39718.1| hypothetical protein MIMGU_mgv1a011080mg [Erythranthe guttata]
Length=293

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSA-SNDVKLSSETSP-AVLASEES  489
             S  N S V +AQLN+V+VDGS  AA  T  + E S   +  +K S+E  P A L SEES
Sbjct  64   QSGSNCSTVVRAQLNEVAVDGSPKAAASTTVQSEGSPVEAKSIKSSNELPPSAALRSEES  123

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            I+EF+SQVS+LVKLVDS+DI EL LKQ DCE++IRKKEAL
Sbjct  124  ISEFISQVSSLVKLVDSKDIKELHLKQFDCEILIRKKEAL  163



>ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) 
[Ricinus communis]
 gb|EEF47379.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) 
[Ricinus communis]
Length=315

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 65/84 (77%), Gaps = 1/84 (1%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTPPEPEVS-SASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVD  537
            KV+VDGSSNAA  T  + EV      D   S+ETS   L SEESI+EF+SQV++LVKLVD
Sbjct  94   KVAVDGSSNAAASTSTKSEVPLQDPKDANPSNETSSPALVSEESISEFISQVASLVKLVD  153

Query  538  SRDIAELKLKQLDCELIIRKKEAL  609
            SRDI EL+LKQLDCELIIRKKEAL
Sbjct  154  SRDIVELQLKQLDCELIIRKKEAL  177



>ref|XP_007029254.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), 
putative isoform 3 [Theobroma cacao]
 gb|EOY09756.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), 
putative isoform 3 [Theobroma cacao]
Length=310

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTPPEPEVSSA-SNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVD  537
            KVSVDGSS A+  +P +    +A + D K SS+ SP  LA+EESI+EFL+QVS+LVKLVD
Sbjct  98   KVSVDGSSKASATSPDKSGPPTAEAKDAKPSSDASPPALATEESISEFLNQVSSLVKLVD  157

Query  538  SRDIAELKLKQLDCELIIRKKEAL  609
            SRDI EL+LKQLDCEL IRKKEA+
Sbjct  158  SRDIVELQLKQLDCELTIRKKEAM  181



>gb|AEI16464.1| chloroplast acetyl-CoA carboxylase biotin-containing subunit 
[Brassica napus]
 emb|CDX70691.1| BnaC03g07750D [Brassica napus]
Length=278

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 66/91 (73%), Gaps = 5/91 (5%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNA-APGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVS  516
            V KAQ NKV    SSNA AP    EPE S    D   SS T    LA+EESI+EFL+QV+
Sbjct  59   VVKAQSNKVGSGASSNASAPTKTDEPE-SDEGKDRNSSSSTD---LATEESISEFLTQVT  114

Query  517  TLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            TLVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  115  TLVKLVDSRDIVELQLKQLDCELVIRKKEAL  145



>ref|XP_012085781.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic isoform X1 [Jatropha curcas]
Length=316

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTPPEPEV-SSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVD  537
            KV+VDG SNAA   P    V S    D K S+E S   LA+EESI+EF++QV++LVKLVD
Sbjct  98   KVAVDGPSNAAASPPTRSGVPSQEKKDAKPSNEPSAPALATEESISEFITQVASLVKLVD  157

Query  538  SRDIAELKLKQLDCELIIRKKEAL  609
            SRDI EL+LKQLDCE+IIRKKEAL
Sbjct  158  SRDIVELQLKQLDCEVIIRKKEAL  181



>gb|AEI16463.1| chloroplast acetyl-CoA carboxylase biotin-containing subunit 
[Brassica napus]
Length=281

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 65/91 (71%), Gaps = 5/91 (5%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNA-APGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVS  516
            V KAQ NKV    SSNA AP    EPE S    D   SS T    LA+EE I+EFL+QV+
Sbjct  59   VVKAQSNKVGSGASSNASAPTKTDEPE-SDEGKDRNSSSSTD---LATEEPISEFLTQVT  114

Query  517  TLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            TLVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  115  TLVKLVDSRDIVELQLKQLDCELVIRKKEAL  145



>gb|AFK33449.1| unknown [Lotus japonicus]
Length=279

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 68/88 (77%), Gaps = 3/88 (3%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            KAQLN+V+ DGSSNAAP    + +V   +   K S E S +V A++ESI++FL+QV++LV
Sbjct  65   KAQLNEVAHDGSSNAAPTNKSDSDVEPPN---KPSPEPSSSVFATQESISDFLTQVASLV  121

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI EL LKQLDCE+ IRK+EA+
Sbjct  122  KLVDSRDIVELTLKQLDCEVTIRKREAM  149



>ref|XP_007204704.1| hypothetical protein PRUPE_ppa009574mg [Prunus persica]
 gb|EMJ05903.1| hypothetical protein PRUPE_ppa009574mg [Prunus persica]
Length=286

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  370  VDGSSNAAPGTPPEPEV-SSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRD  546
            VDGSSN A   P E E+ +  S D K S+E+ PAVL +EESI+EF++QV++LVKLVDSRD
Sbjct  101  VDGSSNVAATPPRELELPAQESKDRKTSNESCPAVLDTEESISEFIAQVASLVKLVDSRD  160

Query  547  IAELKLKQLDCELIIRKKEAL  609
            I EL+LKQLD E+IIRKKEAL
Sbjct  161  IVELQLKQLDFEVIIRKKEAL  181



>gb|KJB66288.1| hypothetical protein B456_010G135200 [Gossypium raimondii]
Length=201

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  421  SSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKK  600
            ++ + D K SS+ SP  +A+EESIAEFL+QVS+LVKLVDSRDI EL+LKQLDCEL+IRKK
Sbjct  7    TAEAKDAKTSSDVSPPAMATEESIAEFLNQVSSLVKLVDSRDIVELQLKQLDCELVIRKK  66

Query  601  EAL  609
            EAL
Sbjct  67   EAL  69



>gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypogaea]
Length=279

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNA-APGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTL  522
            KAQLN+VS+DGSSNA AP T      S A    K SS TS  VLAS+ESI++F++QV++L
Sbjct  64   KAQLNEVSLDGSSNAVAPTT----ANSEAEATAKPSSGTSSGVLASQESISQFITQVASL  119

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKE  603
            VKLVDSRDI EL+LKQ DCE++IRK+E
Sbjct  120  VKLVDSRDIVELQLKQHDCEVMIRKRE  146



>ref|XP_008240457.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic isoform X2 [Prunus mume]
Length=288

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  370  VDGSSNAAPGTPPEPEV-SSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRD  546
            VDGSSN A   P E E+ +  S D K S+E+ PAVL +EESI+EF++QV++LVKLVDS+D
Sbjct  101  VDGSSNVAATPPRELEIPAQESKDRKTSNESCPAVLDTEESISEFIAQVASLVKLVDSKD  160

Query  547  IAELKLKQLDCELIIRKKEAL  609
            I EL+LKQLD E+IIRKKEAL
Sbjct  161  IVELQLKQLDFEVIIRKKEAL  181



>ref|XP_008240456.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X1 [Prunus mume]
Length=310

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +1

Query  370  VDGSSNAAPGTPPEPEV-SSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRD  546
            VDGSSN A   P E E+ +  S D K S+E+ PAVL +EESI+EF++QV++LVKLVDS+D
Sbjct  101  VDGSSNVAATPPRELEIPAQESKDRKTSNESCPAVLDTEESISEFIAQVASLVKLVDSKD  160

Query  547  IAELKLKQLDCELIIRKKEAL  609
            I EL+LKQLD E+IIRKKEAL
Sbjct  161  IVELQLKQLDFEVIIRKKEAL  181



>gb|AEI16461.1| chloroplast acetyl-CoA carboxylase biotin-containing subunit 
[Brassica napus]
Length=275

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 5/90 (6%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKV    SSNA+      PE +   ++      +S   LA+EESI+EFL+QV+T
Sbjct  59   VVKAQSNKVGSGASSNAS-----APERTEGKDENSSKDPSSSTDLATEESISEFLTQVTT  113

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  114  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  143



>ref|XP_010492538.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Camelina sativa]
Length=281

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKV+   S+NAA    P  E +  ++    SS +S   LA+EESI+EFL+QV+T
Sbjct  60   VVKAQSNKVTTGASTNAAKIDGPSAEANEKNSLQDSSSSSSSPELATEESISEFLTQVTT  119

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCELIIRKKEAL
Sbjct  120  LVKLVDSRDIVELQLKQLDCELIIRKKEAL  149



>ref|XP_009131537.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Brassica rapa]
 emb|CDX78688.1| BnaA03g06000D [Brassica napus]
Length=275

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 5/90 (6%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKV    SSNA+      PE +   ++      +S   LA+EESI+EFL+QV+T
Sbjct  59   VVKAQSNKVGSGASSNAS-----APEKTEGKDENSSKDPSSSTDLATEESISEFLTQVTT  113

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  114  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  143



>gb|AEI16460.1| chloroplast acetyl-CoA carboxylase biotin-containing subunit 
[Brassica rapa]
Length=271

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 5/90 (6%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKV    SSNA+      PE +   ++      +S   LA+EESI+EFL+QV+T
Sbjct  59   VVKAQSNKVGSGASSNAS-----APEKTEGKDENSSKDPSSSTDLATEESISEFLTQVTT  113

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  114  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  143



>gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa]
Length=257

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNA-APGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTL  522
            KAQL++VS+DGSSNA AP T      S A    K SS TS  VLAS+ESI++F++QV++L
Sbjct  42   KAQLDEVSLDGSSNAVAPTT----ANSEAEATAKPSSGTSSGVLASQESISQFITQVASL  97

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKE  603
            VKLVDSRDI EL+LKQ DCE++IRK+E
Sbjct  98   VKLVDSRDIVELQLKQHDCEVMIRKRE  124



>gb|AEI16462.1| chloroplast acetyl-CoA carboxylase biotin-containing subunit 
[Brassica napus]
Length=274

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 4/90 (4%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ N+V  + SS A+       ++  +S + K S+ +S A LA+EESI+EFL+QV+T
Sbjct  61   VVKAQSNQVGGNASSKASAPV----KIDESSAEEKDSNTSSSAELATEESISEFLTQVTT  116

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  117  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  146



>gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypogaea]
Length=279

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 5/87 (6%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNA-APGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTL  522
            KAQL++VS+DGSSNA AP T      S A    K SS TS  VLAS+ESI++F++QV++L
Sbjct  64   KAQLDEVSLDGSSNAVAPTT----ANSEAEATAKPSSGTSSGVLASQESISQFITQVASL  119

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKE  603
            VKLVDSRDI EL+LKQ DCE++IRK+E
Sbjct  120  VKLVDSRDIVELQLKQHDCEVMIRKRE  146



>ref|XP_009126109.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic [Brassica rapa]
 emb|CDY66618.1| BnaAnng22560D [Brassica napus]
Length=276

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 4/90 (4%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ N+V  + SS A+       ++  +S + K S+ +S A LA+EESI+EFL+QV+T
Sbjct  61   VVKAQSNQVGGNASSKASAPV----KIDESSAEEKDSNTSSSAELATEESISEFLTQVTT  116

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  117  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  146



>gb|KJB81167.1| hypothetical protein B456_013G132300 [Gossypium raimondii]
Length=243

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 63/90 (70%), Gaps = 13/90 (14%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTP-------PEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            KV+VDGSSN +   P       PEP+      D K SS   P  LA+EESI+EFL+QVS+
Sbjct  26   KVAVDGSSNDSTIPPVNSGSSTPEPQ------DAKPSSNVFPPALATEESISEFLNQVSS  79

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCELIIRK  AL
Sbjct  80   LVKLVDSRDIVELQLKQLDCELIIRKNVAL  109



>gb|AEI16459.1| chloroplast acetyl-CoA carboxylase biotin-containing subunit 
[Brassica rapa]
Length=276

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 4/90 (4%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ N+V  + SS A+       ++  +S + K S+ +S A LA+EESI+EFL+QV+T
Sbjct  61   VVKAQSNQVGGNASSKASAPV----KIDESSAEEKDSNSSSSAELATEESISEFLAQVTT  116

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  117  LVKLVDSRDIVELQLKQLDCELVIRKKEAL  146



>ref|XP_010456549.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Camelina sativa]
Length=233

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKVS   S+NAA    P  E    ++    SS +S   LA+EESI+EFL+QV+T
Sbjct  12   VVKAQSNKVSTGASTNAAKIDGPSAEAKEKNSLKNSSSSSSSPELATEESISEFLAQVTT  71

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL IRKKEAL
Sbjct  72   LVKLVDSRDIVELQLKQLDCELTIRKKEAL  101



>emb|CAN80851.1| hypothetical protein VITISV_040144 [Vitis vinifera]
Length=383

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = +1

Query  400  TPPEPEVSSA-SNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLD  576
            TPP+ +  +  + DVK S++ SPA LASEESI+EF++QV++LVKLVDSRDI EL++KQLD
Sbjct  153  TPPKSDAPAVEAKDVKSSNKPSPAALASEESISEFITQVASLVKLVDSRDIVELQMKQLD  212

Query  577  CELIIRKKEAL  609
            CELIIRKKEAL
Sbjct  213  CELIIRKKEAL  223



>ref|XP_010420330.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like isoform X1 [Camelina sativa]
Length=281

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKVS   S+NAA    P  E    ++    SS +S   LA+EESI+EFL+QV+T
Sbjct  60   VVKAQSNKVSTGASTNAAKIDGPSAEAKEKNSLKNSSSSSSSPELATEESISEFLAQVTT  119

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL IRKKEAL
Sbjct  120  LVKLVDSRDIVELQLKQLDCELTIRKKEAL  149



>ref|XP_010453799.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic [Camelina sativa]
Length=280

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKVS   S+NAA    P  E    ++    SS +S   LA+EESI+EFL+QV+T
Sbjct  59   VVKAQSNKVSTGASTNAAKIDGPSAEAKEKNSLKNSSSSSSSPELATEESISEFLAQVTT  118

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL IRKKEAL
Sbjct  119  LVKLVDSRDIVELQLKQLDCELTIRKKEAL  148



>ref|XP_008456473.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X2 [Cucumis melo]
Length=280

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLS  507
             HS   +AQLN+  VD  + A   +  E +V ++    K SS+ S  +LA+EESI+EF++
Sbjct  58   KHSTFIQAQLNEDPVDVPTVAKITS--ESDVLASDGSAKPSSDQSSKILATEESISEFIT  115

Query  508  QVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            QVS+LVKLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  116  QVSSLVKLVDSRDIVELQLKQLDCEVVIRKKEAL  149



>ref|XP_010321292.1| PREDICTED: biotin carboxylase carrier protein isoform X1 [Solanum 
lycopersicum]
Length=316

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 72/127 (57%), Gaps = 37/127 (29%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLN-------------------------------KVSVDGSSNAAPGT  402
             SNWNHSVV +AQ N                               KV++ GSSN A  T
Sbjct  61   QSNWNHSVVTRAQSNEVRFFQMVFIGGILSNIVTFVKTFLGPSVAFKVALGGSSNNA-AT  119

Query  403  PPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCE  582
            P      + S +VK  SETS A   SEE+I+ F+SQVS+LVKLVDSRD+ EL+LKQ DCE
Sbjct  120  P-----ITQSEEVKSPSETSSATSVSEEAISNFISQVSSLVKLVDSRDVVELQLKQFDCE  174

Query  583  LIIRKKE  603
            ++IRKKE
Sbjct  175  ILIRKKE  181



>ref|XP_006286538.1| hypothetical protein CARUB_v10001679mg [Capsella rubella]
 gb|EOA19436.1| hypothetical protein CARUB_v10001679mg [Capsella rubella]
Length=276

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 65/90 (72%), Gaps = 4/90 (4%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            V KAQ NKVS   SSNAA    P    S+   +   SS +S   LA+EESI+EFL+QV+T
Sbjct  59   VVKAQSNKVSTGASSNAAKIDAP----SAEGKEKNSSSSSSSPELATEESISEFLTQVTT  114

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVDSRDI EL+LKQLDCEL IRKKEAL
Sbjct  115  LVKLVDSRDIVELQLKQLDCELTIRKKEAL  144



>ref|XP_006345776.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like isoform X1 [Solanum tuberosum]
Length=316

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 74/129 (57%), Gaps = 37/129 (29%)
 Frame = +1

Query  316  HSNWNHSVVAKAQLN-------------------------------KVSVDGSSNAAPGT  402
             S+WNHS V +AQ N                               KV++ GSSN +  T
Sbjct  63   QSSWNHSAVTRAQSNEVRFFQMVFIGGILSNIVTFVKTFLGRSVAFKVALGGSSNNS-AT  121

Query  403  PPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCE  582
            P      + S +VK  SETS A   SEE+I+ F+SQVS+LVKLVDSRDI EL+LKQLDCE
Sbjct  122  P-----ITQSEEVKSPSETSSATSVSEEAISNFISQVSSLVKLVDSRDIVELQLKQLDCE  176

Query  583  LIIRKKEAL  609
            ++IRKKEAL
Sbjct  177  ILIRKKEAL  185



>ref|XP_002873773.1| BCCP/BCCP-1/BCCP1/CAC1-A/CAC1A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50032.1| BCCP/BCCP-1/BCCP1/CAC1-A/CAC1A [Arabidopsis lyrata subsp. lyrata]
Length=282

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPP---EPEVSSASNDVKLSSETSPAVLASEESIAEFLSQ  510
            V KAQ NKVS   SSNAA    P   E +  ++S D   SS +SP  LA+EESI+EFL+Q
Sbjct  58   VVKAQSNKVSTGASSNAAKIDGPSAAEGKEKTSSKDSSSSSSSSPE-LATEESISEFLTQ  116

Query  511  VSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            V+TLVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  117  VTTLVKLVDSRDIVELQLKQLDCELVIRKKEAL  149



>ref|XP_011013396.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic isoform X3 [Populus euphratica]
Length=262

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  415  EVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIR  594
            +++  S D K S+E SP  LA+EESI+EF+SQVS+LVKLVDSRDI EL+LKQLDCEL+IR
Sbjct  62   QLNEESKDAKPSNEPSPPSLATEESISEFISQVSSLVKLVDSRDIVELQLKQLDCELLIR  121

Query  595  KKEAL  609
            KKEAL
Sbjct  122  KKEAL  126



>ref|XP_011013397.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic isoform X4 [Populus euphratica]
Length=262

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  415  EVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIR  594
            +++  S D K S+E SP  LA+EESI+EF+SQVS+LVKLVDSRDI EL+LKQLDCEL+IR
Sbjct  62   QLNEESKDAKPSNEPSPPSLATEESISEFISQVSSLVKLVDSRDIVELQLKQLDCELLIR  121

Query  595  KKEAL  609
            KKEAL
Sbjct  122  KKEAL  126



>ref|XP_006400177.1| hypothetical protein EUTSA_v10014313mg [Eutrema salsugineum]
 gb|ESQ41630.1| hypothetical protein EUTSA_v10014313mg [Eutrema salsugineum]
Length=283

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 6/94 (6%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAV----LASEESIAEFLS  507
            V KAQ NKV    SSNA+   P + +  SA    K S + + +     LA+EESI+EFL+
Sbjct  60   VVKAQSNKVGTGASSNAS--APAKIDGPSAEGKDKKSLKDASSSSSPDLATEESISEFLT  117

Query  508  QVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            QV+TLVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  118  QVTTLVKLVDSRDIVELQLKQLDCELVIRKKEAL  151



>ref|XP_003624197.1| Acetyl-CoA carboxylase biotin carboxyl carrier protein [Medicago 
truncatula]
 gb|AES80415.1| biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula]
Length=276

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 66/92 (72%), Gaps = 12/92 (13%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKL----SSETSPAVLASEESIAEFLSQV  513
            KAQLN+V++DGSSN  P          A +DV+     S E S +VLA +ESI+E   Q+
Sbjct  66   KAQLNEVALDGSSNDVP--------PKAKSDVEPPTAPSVEPSSSVLADQESISELFDQI  117

Query  514  STLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++LVKLVDSRDI ELKLKQL+CE++IRKKEA+
Sbjct  118  ASLVKLVDSRDIVELKLKQLNCEVLIRKKEAM  149



>ref|XP_010558581.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic [Tarenaya hassleriana]
Length=284

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNA-APGTPPEPEVSSASNDVKLSSETSPAVLASEESIAE  498
            + N   V KAQ NKV  DG SNA A  T  E   +   +       +SP+ LA+EESI+E
Sbjct  54   SLNSFSVVKAQSNKVGGDGPSNASAASTKLEVLAAEGKDSDSSKESSSPSSLATEESISE  113

Query  499  FLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            FL+QV+ LVKLVDSRD+ EL+LKQLDCEL+IRKKEAL
Sbjct  114  FLTQVTDLVKLVDSRDVVELQLKQLDCELVIRKKEAL  150



>ref|XP_010420331.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like isoform X2 [Camelina sativa]
Length=279

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 66/93 (71%), Gaps = 8/93 (9%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAV---LASEESIAEFLSQ  510
            V KAQ NKVS   S+NAA    P     SA    K+SS+ S      LA+EESI+EFL+Q
Sbjct  60   VVKAQSNKVSTGASTNAAKIDGP-----SAEAKEKISSKDSSLSSPELATEESISEFLTQ  114

Query  511  VSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            V+TLVKLVDSRDI EL+LKQLDCEL IRKKEAL
Sbjct  115  VTTLVKLVDSRDIVELQLKQLDCELTIRKKEAL  147



>ref|XP_008456465.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X1 [Cucumis melo]
Length=286

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 70/101 (69%), Gaps = 10/101 (10%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPP-------EPEVSSASNDVKLSSETSPAVLASEE  486
             HS   +AQLN++SV   S   P   P       E +V ++    K SS+ S  +LA+EE
Sbjct  58   KHSTFIQAQLNELSV---SLKDPVDVPTVAKITSESDVLASDGSAKPSSDQSSKILATEE  114

Query  487  SIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            SI+EF++QVS+LVKLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  115  SISEFITQVSSLVKLVDSRDIVELQLKQLDCEVVIRKKEAL  155



>ref|XP_004139256.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X2 [Cucumis sativus]
Length=276

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%), Gaps = 14/98 (14%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDV------KLSSETSPAVLASEES  489
             HS + +AQLN+  VD  + A        +++S S+D+      K SS+ S  +LA+EES
Sbjct  54   KHSTLIRAQLNEDPVDVPTVA--------KITSESDDLASDGSAKPSSDQSSKILATEES  105

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            I+EF++QVS+L+KLVDSRDI EL+LKQLDCE++IRKKE
Sbjct  106  ISEFITQVSSLIKLVDSRDIVELQLKQLDCEVVIRKKE  143



>gb|KHN29258.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic 
[Glycine soja]
Length=250

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            KAQL++V++D SSNA   TPP    S      K S+E S +VLA++ES+++F++QV++LV
Sbjct  46   KAQLDEVALDSSSNA---TPPIKAKSKEEPPAKPSAEPSSSVLATQESVSQFITQVASLV  102

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI ELKLKQ D E+ IRKKEA+
Sbjct  103  KLVDSRDIVELKLKQHDVEVTIRKKEAM  130



>emb|CDY38117.1| BnaC02g06560D [Brassica napus]
Length=280

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSN-AAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVS  516
            V KAQ N+V    SSN +AP    EP     +     S++     LA+EESI+EFL+QV+
Sbjct  61   VVKAQSNQVGGGASSNVSAPAKLDEPSAKEKNASSSSSAD-----LATEESISEFLTQVT  115

Query  517  TLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            TLVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  116  TLVKLVDSRDIVELQLKQLDCELVIRKKEAL  146



>ref|XP_011648731.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X1 [Cucumis sativus]
 gb|KGN60765.1| hypothetical protein Csa_2G009520 [Cucumis sativus]
Length=282

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 71/98 (72%), Gaps = 8/98 (8%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDV------KLSSETSPAVLASEES  489
             HS + +AQLN++SV  S       P   +++S S+D+      K SS+ S  +LA+EES
Sbjct  54   KHSTLIRAQLNELSV--SLKDPVDVPTVAKITSESDDLASDGSAKPSSDQSSKILATEES  111

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            I+EF++QVS+L+KLVDSRDI EL+LKQLDCE++IRKKE
Sbjct  112  ISEFITQVSSLIKLVDSRDIVELQLKQLDCEVVIRKKE  149



>ref|XP_004493036.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like [Cicer arietinum]
Length=260

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            KAQLN+V++DG SN     PP    S   +    S E S +V  ++ESI++F +QV++LV
Sbjct  52   KAQLNEVALDGPSN---DVPPVKAKSGVESPTTPSIEPSSSVSVNQESISQFFTQVASLV  108

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI ELKLKQL+CE+ IRKKEAL
Sbjct  109  KLVDSRDIVELKLKQLNCEVTIRKKEAL  136



>gb|KHN40485.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic 
[Glycine soja]
Length=177

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            KAQLN+V++D SSNA   +PP    S      K  +E S +VLA++ES+++F++QV++LV
Sbjct  46   KAQLNEVALDSSSNAT--SPPMKAKSKEEPPAKPLAEPSSSVLATQESVSQFITQVASLV  103

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI ELKLKQ D E+ IRKKEA+
Sbjct  104  KLVDSRDIVELKLKQHDVEVTIRKKEAM  131



>gb|AFK47404.1| unknown [Medicago truncatula]
Length=276

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (71%), Gaps = 12/92 (13%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKL----SSETSPAVLASEESIAEFLSQV  513
            KAQLN+V++DGSSN  P          A +DV+     S E S +VLA +ESI+E   Q+
Sbjct  66   KAQLNEVALDGSSNDVP--------PKAKSDVEPPTAPSVEPSSSVLADQESISELFDQI  117

Query  514  STLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++LVKLVDSRD  ELKLKQL+CE++IRKKEA+
Sbjct  118  ASLVKLVDSRDTVELKLKQLNCEVLIRKKEAM  149



>gb|KFK25879.1| hypothetical protein AALP_AA8G174100 [Arabis alpina]
Length=282

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%), Gaps = 6/94 (6%)
 Frame = +1

Query  340  VAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETS----PAVLASEESIAEFLS  507
            V KAQ NKV    +SNA+   P + +  SA +   L   ++     A LA+EESI+EFL+
Sbjct  60   VVKAQSNKVGSGAASNAS--APVKTDGPSAEDKKSLKESSASSSSTADLATEESISEFLT  117

Query  508  QVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            QV+TLVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  118  QVTTLVKLVDSRDIVELQLKQLDCELVIRKKEAL  151



>ref|XP_007139713.1| hypothetical protein PHAVU_008G053000g [Phaseolus vulgaris]
 gb|ESW11707.1| hypothetical protein PHAVU_008G053000g [Phaseolus vulgaris]
Length=262

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 69/91 (76%), Gaps = 11/91 (12%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASND---VKLSSETSPAVLASEESIAEFLSQVS  516
            KAQLN+V++D SSNA P       + + S++    K S+E S +VLA++ES+++F++QV+
Sbjct  48   KAQLNEVALDSSSNATP-------IKAKSDEEQPSKPSAEPS-SVLATQESVSQFITQVA  99

Query  517  TLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +LVKLVDSRDI ELK+KQ D EL IRKKEA+
Sbjct  100  SLVKLVDSRDIVELKMKQYDIELTIRKKEAM  130



>ref|NP_001238375.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic 
[Glycine max]
 sp|Q42783.1|BCCP_SOYBN RecName: Full=Biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic; Short=BCCP; Flags: Precursor [Glycine 
max]
 gb|AAF80463.1|AF162283_1 acetyl-CoA carboxylase [Glycine max]
 gb|AAB67836.1| biotin carboxyl carrier protein precursor [Glycine max]
Length=262

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            KAQLN+V++D SSNA   +PP    S      K  +E S +VLA++ES+++F++QV++LV
Sbjct  46   KAQLNEVALDSSSNAT--SPPMKAKSKEEPPAKPLAEPSSSVLATQESVSQFITQVASLV  103

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI ELKLKQ D E+ IRKKEA+
Sbjct  104  KLVDSRDIVELKLKQHDVEVTIRKKEAM  131



>ref|XP_003534503.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like [Glycine max]
Length=261

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            KAQL++V++D SSNA   TPP    S      K  +E S +VLA++ES+++F++QV++LV
Sbjct  46   KAQLDEVALDSSSNA---TPPIKAKSKEEPPAKPLAEPSSSVLATQESVSQFITQVASLV  102

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI ELKLKQ D E+ IRKKEA+
Sbjct  103  KLVDSRDIVELKLKQHDVEVTIRKKEAM  130



>emb|CAA62261.1| biotin carboxyl carrier protein [Brassica napus]
 prf||2210244A Ac-CoA carboxylase:ISOTYPE=bp1
Length=192

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +1

Query  472  LASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LA+EESI+EFL+QV+TLVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  18   LATEESISEFLTQVTTLVKLVDSRDIVELQLKQLDCELVIRKKEAL  63



>gb|ERM99905.1| hypothetical protein AMTR_s00110p00065160 [Amborella trichopoda]
Length=278

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 10/95 (11%)
 Frame = +1

Query  334  SVVAKAQLNKVSVDGSSNAAPGTP-----PEPEVSSASNDVKLSSETSPAVLASEESIAE  498
            S V +AQLN+V+V+ +SNA P T      P P+      D+K + ETSP    SE SI  
Sbjct  57   STVWRAQLNEVAVE-ASNAVPTTSKKSDSPLPK----DEDIKPAEETSPKKTVSEASINA  111

Query  499  FLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            F+++V+ LVKLVDSRDI EL++KQLDCEL IRKKE
Sbjct  112  FMAEVANLVKLVDSRDIMELQMKQLDCELTIRKKE  146



>gb|AEI16458.1| chloroplast acetyl-CoA carboxylase biotin-containing subunit 
[Brassica oleracea]
Length=281

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +1

Query  472  LASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LA+EESI+EFL+QV+TLVKLVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  101  LATEESISEFLTQVTTLVKLVDSRDIVELQLKQLDCELVIRKKEAL  146



>ref|XP_011621080.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic [Amborella trichopoda]
 ref|XP_011621081.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic [Amborella trichopoda]
Length=284

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 10/95 (11%)
 Frame = +1

Query  334  SVVAKAQLNKVSVDGSSNAAPGTP-----PEPEVSSASNDVKLSSETSPAVLASEESIAE  498
            S V +AQLN+V+V+ +SNA P T      P P+      D+K + ETSP    SE SI  
Sbjct  57   STVWRAQLNEVAVE-ASNAVPTTSKKSDSPLPK----DEDIKPAEETSPKKTVSEASINA  111

Query  499  FLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            F+++V+ LVKLVDSRDI EL++KQLDCEL IRKKE
Sbjct  112  FMAEVANLVKLVDSRDIMELQMKQLDCELTIRKKE  146



>ref|XP_009412715.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic [Musa acuminata subsp. malaccensis]
Length=282

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 62/92 (67%), Gaps = 0/92 (0%)
 Frame = +1

Query  328  NHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLS  507
            + S +AKAQLN+V+   +++AA        +     D +    + P+   SEE+I+EF++
Sbjct  62   DRSAIAKAQLNEVAGGPANDAATSKTKAEALGPKGQDAEAGKPSLPSAPLSEEAISEFMT  121

Query  508  QVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            QV+ +VKLVDSRDI EL+LKQ DCELIIRKKE
Sbjct  122  QVANIVKLVDSRDIVELQLKQNDCELIIRKKE  153



>dbj|BAM75182.1| biotin carboxyl carrier protein [Ricinus communis]
Length=205

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 4/88 (5%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            KAQLN+V V GSSN+ P      + +S     ++  E     +    +I EF++QVS LV
Sbjct  51   KAQLNEVIVKGSSNSVPML----DTNSKLAPSEVKDEAVVKNVPDASAITEFMTQVSDLV  106

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI EL+LKQLDCE+IIRKKEAL
Sbjct  107  KLVDSRDITELQLKQLDCEIIIRKKEAL  134



>ref|XP_007032701.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, 
putative [Theobroma cacao]
 gb|EOY03627.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, 
putative [Theobroma cacao]
Length=288

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 6/99 (6%)
 Frame = +1

Query  319  SNWNHSVVAK--AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESI  492
            SN   +   K  AQLN+V+ + SSN+ P    +P+V     + K S  T P V A    I
Sbjct  60   SNGKQTTAFKGHAQLNEVAAEKSSNSIPVVDAKPKVELPKENDKSSENTIPDVAA----I  115

Query  493  AEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            + F++QVS LVKLVDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  116  SAFMTQVSDLVKLVDSRDITELQLKQSDCELVIRKKEAL  154



>ref|XP_002526099.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP2) 
[Ricinus communis]
 gb|EEF36293.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP2) 
[Ricinus communis]
Length=260

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 4/88 (5%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            KAQLN+V V GSSN+ P      + +S     ++  E     +    +I EF++QVS LV
Sbjct  51   KAQLNEVIVKGSSNSVPML----DTNSKLAPSEVKDEAVVKNVPDASAITEFMTQVSDLV  106

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI EL+LKQLDCE+IIRKKEAL
Sbjct  107  KLVDSRDITELQLKQLDCEIIIRKKEAL  134



>ref|XP_010525094.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Tarenaya hassleriana]
Length=284

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  472  LASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LA+EESI+EFL+QV+ LVKLVDSRD+ EL+LKQLDCEL+IRKKEAL
Sbjct  105  LATEESISEFLTQVTNLVKLVDSRDVVELQLKQLDCELVIRKKEAL  150



>ref|XP_007151304.1| hypothetical protein PHAVU_004G035000g [Phaseolus vulgaris]
 gb|ESW23298.1| hypothetical protein PHAVU_004G035000g [Phaseolus vulgaris]
Length=279

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  373  DGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIA  552
            + +SN+AP T  EP V+S+     L  + S   +A E S+  F+SQV  LVK+VDSRD+ 
Sbjct  71   NSNSNSAPVTVKEPNVASSKEKEVLDGKQSGGTIADEASVTAFISQVVDLVKVVDSRDVV  130

Query  553  ELKLKQLDCELIIRKKEAL  609
            EL+LKQLDCE++IRKKEAL
Sbjct  131  ELQLKQLDCEIVIRKKEAL  149



>ref|XP_007151303.1| hypothetical protein PHAVU_004G035000g [Phaseolus vulgaris]
 gb|ESW23297.1| hypothetical protein PHAVU_004G035000g [Phaseolus vulgaris]
Length=267

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  382  SNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELK  561
            SN+AP T  EP V+S+     L  + S   +A E S+  F+SQV  LVK+VDSRD+ EL+
Sbjct  62   SNSAPVTVKEPNVASSKEKEVLDGKQSGGTIADEASVTAFISQVVDLVKVVDSRDVVELQ  121

Query  562  LKQLDCELIIRKKEAL  609
            LKQLDCE++IRKKEAL
Sbjct  122  LKQLDCEIVIRKKEAL  137



>gb|KJB33436.1| hypothetical protein B456_006G011100 [Gossypium raimondii]
Length=226

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 4/89 (4%)
 Frame = +1

Query  343  AKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTL  522
            A+A+LN+V+ + SSN+ P    + + +    D K +  T P V A    I+ F++QVS L
Sbjct  5    ARAKLNEVAAEKSSNSVPVVDMKSKAALPKEDDKSTGNTIPDVAA----ISAFMTQVSDL  60

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            VKLVDSRDI EL+LKQ DCELIIRKKEAL
Sbjct  61   VKLVDSRDITELQLKQSDCELIIRKKEAL  89



>gb|KJB33440.1| hypothetical protein B456_006G011100 [Gossypium raimondii]
Length=284

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 4/89 (4%)
 Frame = +1

Query  343  AKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTL  522
            A+A+LN+V+ + SSN+ P    + + +    D K +  T P V A    I+ F++QVS L
Sbjct  63   ARAKLNEVAAEKSSNSVPVVDMKSKAALPKEDDKSTGNTIPDVAA----ISAFMTQVSDL  118

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            VKLVDSRDI EL+LKQ DCELIIRKKEAL
Sbjct  119  VKLVDSRDITELQLKQSDCELIIRKKEAL  147



>gb|KJB75635.1| hypothetical protein B456_012G049400 [Gossypium raimondii]
Length=224

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  352  QLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKL  531
            QLN+V+ + SSN+      +P+V+    D K S+E +   +    +I+EF++QVS LVKL
Sbjct  74   QLNEVAAEKSSNSVAVVDMKPKVALPEEDDKRSAEKA---IPDAAAISEFMAQVSDLVKL  130

Query  532  VDSRDIAELKLKQLDCELIIRKKEAL  609
            VDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  131  VDSRDITELQLKQSDCELVIRKKEAL  156



>gb|KJB75636.1| hypothetical protein B456_012G049400 [Gossypium raimondii]
Length=294

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  352  QLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKL  531
            QLN+V+ + SSN+      +P+V+    D K S+E +   +    +I+EF++QVS LVKL
Sbjct  74   QLNEVAAEKSSNSVAVVDMKPKVALPEEDDKRSAEKA---IPDAAAISEFMAQVSDLVKL  130

Query  532  VDSRDIAELKLKQLDCELIIRKKEAL  609
            VDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  131  VDSRDITELQLKQSDCELVIRKKEAL  156



>gb|KJB75633.1| hypothetical protein B456_012G049400 [Gossypium raimondii]
Length=290

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  352  QLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKL  531
            QLN+V+ + SSN+      +P+V+    D K S+E +   +    +I+EF++QVS LVKL
Sbjct  74   QLNEVAAEKSSNSVAVVDMKPKVALPEEDDKRSAEKA---IPDAAAISEFMAQVSDLVKL  130

Query  532  VDSRDIAELKLKQLDCELIIRKKEAL  609
            VDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  131  VDSRDITELQLKQSDCELVIRKKEAL  156



>gb|KHG02691.1| Biotin carboxyl carrier of acetyl-CoA carboxylase 2, chloroplastic 
-like protein [Gossypium arboreum]
Length=290

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  352  QLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKL  531
            QLN+V+ + SSN+      +P+V+    D K S+E +   +    +I+EF++QVS LVKL
Sbjct  74   QLNEVAAEKSSNSVAVVDMKPKVALPEEDDKKSAEKA---IPDAAAISEFMAQVSDLVKL  130

Query  532  VDSRDIAELKLKQLDCELIIRKKEAL  609
            VDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  131  VDSRDITELQLKQSDCELVIRKKEAL  156



>ref|XP_011072842.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like isoform X2 [Sesamum indicum]
Length=270

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 10/87 (11%)
 Frame = +1

Query  349  AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVK  528
            AQLN+V+V+  SNA P          A   V ++   +   +  E SI  F++QV  LVK
Sbjct  63   AQLNQVAVEKISNATP----------ALETVPMNKSENQHEIPDESSILTFMTQVKDLVK  112

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDS+DIAEL+LKQ+DCELIIRKKEAL
Sbjct  113  LVDSKDIAELELKQMDCELIIRKKEAL  139



>ref|XP_011072841.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like isoform X1 [Sesamum indicum]
Length=271

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 10/87 (11%)
 Frame = +1

Query  349  AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVK  528
            AQLN+V+V+  SNA P          A   V ++   +   +  E SI  F++QV  LVK
Sbjct  64   AQLNQVAVEKISNATP----------ALETVPMNKSENQHEIPDESSILTFMTQVKDLVK  113

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDS+DIAEL+LKQ+DCELIIRKKEAL
Sbjct  114  LVDSKDIAELELKQMDCELIIRKKEAL  140



>gb|ACT33948.1| biotin carboxyl carrier protein subunit [Jatropha curcas]
Length=270

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 64/106 (60%), Gaps = 22/106 (21%)
 Frame = +1

Query  322  NWNHSVVAK--AQLNKVSVDGSSNAAP--------GTPPEPEVSSASNDVKLSSETSPAV  471
            NW  S V K  A+LN+V ++ SSN+ P         TP E + S+ SN +  S       
Sbjct  46   NWKQSRVTKMQAKLNEVLLEKSSNSVPVLETNSNVPTPDEKDESTESNILDASQ------  99

Query  472  LASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
                  I+ F++QVS LVKLVDSRDI EL+LKQL C+LIIRKKEAL
Sbjct  100  ------ISAFMTQVSDLVKLVDSRDITELQLKQLGCQLIIRKKEAL  139



>ref|XP_011000101.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like [Populus euphratica]
Length=284

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 4/91 (4%)
 Frame = +1

Query  337  VVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVS  516
            V  +AQLN+     SSN+A     EP+V+S+  + + +    P V     SI+ F++QVS
Sbjct  65   VKVQAQLNEAIAKKSSNSALVVDTEPKVASSEGEDEPTESKIPDV----SSISAFMTQVS  120

Query  517  TLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
             LVKLVDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  121  ELVKLVDSRDITELQLKQSDCELVIRKKEAL  151



>ref|XP_010032526.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Eucalyptus grandis]
 gb|KCW51916.1| hypothetical protein EUGRSUZ_J01371 [Eucalyptus grandis]
Length=275

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 61/90 (68%), Gaps = 5/90 (6%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDV--KLSSETSPAVLASEESIAEFLSQVST  519
            KA+LN+V+ + SSN+   T     +S  SN    KL  E    ++    SI+ F+SQVS 
Sbjct  54   KAKLNEVTAEKSSNSGLDTKSGATISQESNGTAAKLDREK---IVPDASSISAFMSQVSD  110

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVKLVD++DI EL+LKQ+DCE+IIRKKEA+
Sbjct  111  LVKLVDTKDIMELQLKQMDCEIIIRKKEAI  140



>ref|XP_002323896.2| hypothetical protein POPTR_0017s12810g [Populus trichocarpa]
 gb|EEF04029.2| hypothetical protein POPTR_0017s12810g [Populus trichocarpa]
Length=284

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 4/91 (4%)
 Frame = +1

Query  337  VVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVS  516
            V  +AQLN+     SSN+A     EP+V+S+  + + +    P V     SI+ F++QVS
Sbjct  65   VKVQAQLNEAIAKKSSNSALMVDNEPKVASSEGEDEPTGSKIPDV----SSISAFMTQVS  120

Query  517  TLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
             LVKLVDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  121  ELVKLVDSRDITELQLKQSDCELVIRKKEAL  151



>ref|XP_009360536.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like [Pyrus x bretschneideri]
Length=284

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 64/97 (66%), Gaps = 7/97 (7%)
 Frame = +1

Query  319  SNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAE  498
            S+W      +AQLN+V+ + SSN+ P    + E  S     + SS+T+   +    SI+ 
Sbjct  61   SSWK----VQAQLNEVTAEKSSNSVPTKNKKSEDGSQEGKDESSSQTN---IPDAASISA  113

Query  499  FLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            F++QVS LVKLVDSRDI EL++KQLD EL+IRKKEAL
Sbjct  114  FMAQVSDLVKLVDSRDIVELEMKQLDLELVIRKKEAL  150



>ref|XP_007151296.1| hypothetical protein PHAVU_004G034300g [Phaseolus vulgaris]
 gb|ESW23290.1| hypothetical protein PHAVU_004G034300g [Phaseolus vulgaris]
Length=276

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  382  SNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELK  561
            SN+AP T   P V+S+     L+ + S +  A + S+  FLSQVS L+KLVDS+DI EL+
Sbjct  73   SNSAPATVKGPNVASSKEKEVLNGKHSGSTTADQASVTAFLSQVSNLIKLVDSKDIVELQ  132

Query  562  LKQLDCELIIRKKEAL  609
            L+Q DCEL+IRKKEAL
Sbjct  133  LEQSDCELLIRKKEAL  148



>gb|KHN48816.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, 
chloroplastic [Glycine soja]
Length=290

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  382  SNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELK  561
            SN+AP T   P V+S+  +   + + S   +  E SI  F+SQVS LVKLVDSRDI EL+
Sbjct  74   SNSAPVTVNGPTVASSKENQVHNGKLSDTTIPDEASIIAFMSQVSDLVKLVDSRDIVELQ  133

Query  562  LKQLDCELIIRKKEAL  609
            LKQ DCEL+IRKKEAL
Sbjct  134  LKQSDCELMIRKKEAL  149



>ref|NP_001241523.1| uncharacterized protein LOC100777962 [Glycine max]
 gb|ACU23332.1| unknown [Glycine max]
Length=280

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  382  SNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELK  561
            SN+AP T   P V+S+  +   + + S   +  E SI  F+SQVS LVKLVDSRDI EL+
Sbjct  74   SNSAPVTVNGPTVASSKENQVHNGKLSDTTIPDEASIIAFMSQVSDLVKLVDSRDIVELQ  133

Query  562  LKQLDCELIIRKKEAL  609
            LKQ DCEL+IRKKEAL
Sbjct  134  LKQSDCELMIRKKEAL  149



>ref|XP_010661139.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic isoform X2 [Vitis vinifera]
Length=270

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 10/92 (11%)
 Frame = +1

Query  349  AQLNKVSVDGSSNAAPGT-----PPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQV  513
            AQLN+V  + SSN+ P +     P E +  SA    K+SS+ +   +    SI+ F+SQV
Sbjct  51   AQLNEVEAEKSSNSVPLSTKLIVPSEGKYESAR---KISSQKN--TIPDASSISAFMSQV  105

Query  514  STLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            S LVKLVDSRDI EL+LKQL CEL+IRKKEAL
Sbjct  106  SDLVKLVDSRDIMELELKQLGCELLIRKKEAL  137



>ref|XP_002284374.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic isoform X1 [Vitis vinifera]
 emb|CBI22297.3| unnamed protein product [Vitis vinifera]
Length=270

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 10/92 (11%)
 Frame = +1

Query  349  AQLNKVSVDGSSNAAPGT-----PPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQV  513
            AQLN+V  + SSN+ P +     P E +  SA    K+SS+ +   +    SI+ F+SQV
Sbjct  51   AQLNEVEAEKSSNSVPLSTKLIVPSEGKYESAR---KISSQKN--TIPDASSISAFMSQV  105

Query  514  STLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            S LVKLVDSRDI EL+LKQL CEL+IRKKEAL
Sbjct  106  SDLVKLVDSRDIMELELKQLGCELLIRKKEAL  137



>gb|EYU31591.1| hypothetical protein MIMGU_mgv1a011799mg [Erythranthe guttata]
Length=270

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 59/88 (67%), Gaps = 11/88 (13%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            ++QLN+V+V+ +SNA P     P + S   +V  ++           SI+ F++ V+ LV
Sbjct  62   RSQLNEVAVEKASNAKPALEKVPTLESERYEVPDAA-----------SISTFMAHVTDLV  110

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI EL+LKQ+DCEL+IRKKEAL
Sbjct  111  KLVDSRDIVELELKQMDCELLIRKKEAL  138



>ref|XP_010259375.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like [Nelumbo nucifera]
Length=293

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +1

Query  328  NHSVVAK--AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEF  501
            + S+V K  AQLN+V V+ SSN+ P      E+ S++   +  +    +      SI+ F
Sbjct  64   DRSIVWKVQAQLNEVIVEKSSNSTPLPEAILEIPSSAEQQESVNSALQSTAPDPSSISAF  123

Query  502  LSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++QV+ LVKLVDS+DI EL+LKQLDCELIIRKKEAL
Sbjct  124  MNQVADLVKLVDSQDIMELQLKQLDCELIIRKKEAL  159



>gb|KJB33439.1| hypothetical protein B456_006G011100 [Gossypium raimondii]
Length=233

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 4/83 (5%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDS  540
            KV+ + SSN+ P    + + +    D K +  T P V A    I+ F++QVS LVKLVDS
Sbjct  18   KVAAEKSSNSVPVVDMKSKAALPKEDDKSTGNTIPDVAA----ISAFMTQVSDLVKLVDS  73

Query  541  RDIAELKLKQLDCELIIRKKEAL  609
            RDI EL+LKQ DCELIIRKKEAL
Sbjct  74   RDITELQLKQSDCELIIRKKEAL  96



>gb|AFP99173.1| biotin carboxyl carrier protein [Vernicia fordii]
Length=270

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = +1

Query  319  SNWNHSVVAK--AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESI  492
            SN   S V K  AQLN+V  + SSN+ P      +V S+    + +    P   A    I
Sbjct  45   SNRKQSPVTKVQAQLNEVLAEKSSNSVPVLDNNSKVPSSEQKDEPAENNIPDASA----I  100

Query  493  AEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            + F++QVS LVKLVDSRDI EL+LKQL CELIIRKKEAL
Sbjct  101  SAFMTQVSDLVKLVDSRDITELQLKQLGCELIIRKKEAL  139



>gb|KJB75634.1| hypothetical protein B456_012G049400 [Gossypium raimondii]
Length=291

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 61/87 (70%), Gaps = 4/87 (5%)
 Frame = +1

Query  352  QLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV-K  528
            QLN+V+ + SSN+      +P+V+    D K S+E +   +    +I+EF++QVS LV +
Sbjct  74   QLNEVAAEKSSNSVAVVDMKPKVALPEEDDKRSAEKA---IPDAAAISEFMAQVSDLVNR  130

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  131  LVDSRDITELQLKQSDCELVIRKKEAL  157



>ref|XP_006384298.1| hypothetical protein POPTR_0004s11800g [Populus trichocarpa]
 gb|ABK93654.1| unknown [Populus trichocarpa]
 gb|ERP62095.1| hypothetical protein POPTR_0004s11800g [Populus trichocarpa]
Length=251

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = +1

Query  343  AKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTL  522
            A+AQLN+V V+ SSN+      + E  +AS++ K   E + + +    SI+ F++QVS L
Sbjct  37   AQAQLNEVMVEKSSNSV--LVGDSESKAASSEGK--DEPTESKIPDVSSISAFMTQVSEL  92

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            VKLVDSRDI EL+LKQ  CELIIRKKEAL
Sbjct  93   VKLVDSRDITELQLKQSGCELIIRKKEAL  121



>ref|XP_008451672.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Cucumis melo]
Length=290

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +1

Query  355  LNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSP-AVLASEESIAEFLSQVSTLVKL  531
            L +V V  +SN+AP     P    +   V+ +   S  + L  E SI+ F+SQVS L+KL
Sbjct  74   LKEVVVGKTSNSAPAIASTPGNGPSGGKVESAVTVSDQSYLPDEPSISTFMSQVSDLIKL  133

Query  532  VDSRDIAELKLKQLDCELIIRKKEAL  609
            VDSRDI EL+LKQ DCE++IRKKEA+
Sbjct  134  VDSRDIMELQLKQQDCEIVIRKKEAI  159



>ref|XP_002305399.1| hypothetical protein POPTR_0004s11800g [Populus trichocarpa]
 gb|EEE85910.1| hypothetical protein POPTR_0004s11800g [Populus trichocarpa]
Length=281

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = +1

Query  343  AKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTL  522
            A+AQLN+V V+ SSN+      + E  +AS++ K   E + + +    SI+ F++QVS L
Sbjct  67   AQAQLNEVMVEKSSNSV--LVGDSESKAASSEGK--DEPTESKIPDVSSISAFMTQVSEL  122

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            VKLVDSRDI EL+LKQ  CELIIRKKEAL
Sbjct  123  VKLVDSRDITELQLKQSGCELIIRKKEAL  151



>ref|XP_011013434.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like [Populus euphratica]
Length=281

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = +1

Query  343  AKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTL  522
            A+AQLN+V V+ SSN+      + E  +AS++ K   E + + +    SI+ F++QVS L
Sbjct  67   AQAQLNEVMVEKSSNSV--LVGDSESKAASSEGK--DEPTESKIPDVPSISAFMTQVSEL  122

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            VKLVDSRDI EL+LKQ  CELIIRKKEAL
Sbjct  123  VKLVDSRDITELQLKQSGCELIIRKKEAL  151



>ref|XP_010089617.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2 [Morus 
notabilis]
 gb|EXB38088.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2 [Morus 
notabilis]
Length=306

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = +1

Query  322  NWNHSVVAK--AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAV-LASEESI  492
            N   S V K  AQL+KV+   +SN+ P    + +V S     +   E++P   +    SI
Sbjct  46   NSRFSAVGKVSAQLSKVTA-SNSNSVPIPATKSQVGSPDGKDESPKESTPRNNVPDPSSI  104

Query  493  AEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            + F++QVS L+KLVDSRDI EL+LKQLDCEL +RKKEAL
Sbjct  105  SAFMAQVSDLIKLVDSRDIVELQLKQLDCELTLRKKEAL  143



>ref|XP_012084810.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Jatropha curcas]
 gb|KDP27226.1| hypothetical protein JCGZ_19925 [Jatropha curcas]
Length=270

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 63/106 (59%), Gaps = 22/106 (21%)
 Frame = +1

Query  322  NWNHSVVAK--AQLNKVSVDGSSNAAP--------GTPPEPEVSSASNDVKLSSETSPAV  471
            N   S V K  A+LN+V ++ SSN+ P         TP E + S+ SN +  S       
Sbjct  46   NRKQSRVTKMQAKLNEVLLEKSSNSVPVLETNSNVPTPDEKDESTESNILDASQ------  99

Query  472  LASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
                  I+ F++QVS LVKLVDSRDI EL+LKQL C+LIIRKKEAL
Sbjct  100  ------ISAFMTQVSDLVKLVDSRDITELQLKQLGCQLIIRKKEAL  139



>ref|XP_008792772.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Phoenix dactylifera]
Length=254

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  319  SNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEP-EVSSASNDVKLSSETSPAVLASEESIA  495
            SN +HS ++KAQ+ +V+V+ SS++ P T  +P ++SS   +     E++      +  I+
Sbjct  23   SNRSHSPISKAQVQEVAVESSSSSYPMTSTKPGDLSSKDEEAGCQEESASQATVPDSMIS  82

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
             ++++ S LVKLVDS+DI EL+LKQ D ELIIRKKEA+
Sbjct  83   AYIAEASKLVKLVDSKDITELQLKQKDFELIIRKKEAI  120



>gb|KHN07141.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, 
chloroplastic [Glycine soja]
Length=294

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  382  SNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELK  561
            SN+AP     P V+S+      + + S   +  + SI  F+SQVS LVKLVDSRDI EL+
Sbjct  72   SNSAPVMVNGPNVASSKEKEVHNGKLSGGTIPDDASIIAFMSQVSDLVKLVDSRDIVELQ  131

Query  562  LKQLDCELIIRKKEAL  609
            LKQ DCEL+IRKKEAL
Sbjct  132  LKQSDCELMIRKKEAL  147



>ref|XP_011072843.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like isoform X3 [Sesamum indicum]
Length=264

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 10/83 (12%)
 Frame = +1

Query  361  KVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDS  540
            KV+V+  SNA P          A   V ++   +   +  E SI  F++QV  LVKLVDS
Sbjct  61   KVAVEKISNATP----------ALETVPMNKSENQHEIPDESSILTFMTQVKDLVKLVDS  110

Query  541  RDIAELKLKQLDCELIIRKKEAL  609
            +DIAEL+LKQ+DCELIIRKKEAL
Sbjct  111  KDIAELELKQMDCELIIRKKEAL  133



>gb|EPS63946.1| hypothetical protein M569_10835 [Genlisea aurea]
Length=273

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 10/87 (11%)
 Frame = +1

Query  349  AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVK  528
            AQLN+ + D   +      P P + +A N   L SE   +V  +  S++EF+SQV+ LVK
Sbjct  67   AQLNEGAGDELQD------PTPSLEAALN---LKSENQESVPPTP-SVSEFISQVTDLVK  116

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDS+DI EL+LKQLDCE+IIRKKEAL
Sbjct  117  LVDSKDIVELQLKQLDCEVIIRKKEAL  143



>ref|XP_003543944.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Glycine max]
Length=276

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  382  SNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELK  561
            SN+AP     P V+S+      + + S   +  + SI  F+SQVS LVKLVDSRDI EL+
Sbjct  72   SNSAPVMVNGPNVASSKEKEVHNGKLSGGTIPDDASIIAFMSQVSDLVKLVDSRDIVELQ  131

Query  562  LKQLDCELIIRKKEAL  609
            LKQ DCEL+IRKKEAL
Sbjct  132  LKQSDCELMIRKKEAL  147



>gb|AFK44602.1| unknown [Lotus japonicus]
Length=284

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            + Q N+ +  G+SN+AP       V+S+      +   S   +A   SI+ F++Q S LV
Sbjct  66   QTQRNEAATVGNSNSAPLPV---NVASSKEKEDYNGSVSCGTVADASSISTFMAQASDLV  122

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI EL+LKQ DCEL+IRK+EAL
Sbjct  123  KLVDSRDIVELQLKQSDCELMIRKREAL  150



>ref|XP_008379410.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Malus domestica]
Length=278

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%), Gaps = 7/95 (7%)
 Frame = +1

Query  319  SNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAE  498
            S+W      +AQLN+V+ + S N+ P    + E  S     + SS+T+   +    SI+ 
Sbjct  61   SSWK----VQAQLNEVAAEKSPNSVPINNKKSEDGSPEGKGESSSQTN---IPDAASISA  113

Query  499  FLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            F++QVS L+KLVDSRDI EL++KQLD EL+IRKKE
Sbjct  114  FMAQVSDLIKLVDSRDIVELEMKQLDLELVIRKKE  148



>gb|KJB33437.1| hypothetical protein B456_006G011100 [Gossypium raimondii]
 gb|KJB33438.1| hypothetical protein B456_006G011100 [Gossypium raimondii]
Length=201

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (73%), Gaps = 4/59 (7%)
 Frame = +1

Query  433  NDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
             D K +  T P V A    I+ F++QVS LVKLVDSRDI EL+LKQ DCELIIRKKEAL
Sbjct  10   EDDKSTGNTIPDVAA----ISAFMTQVSDLVKLVDSRDITELQLKQSDCELIIRKKEAL  64



>ref|XP_004137199.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Cucumis sativus]
 gb|KGN53635.1| hypothetical protein Csa_4G092990 [Cucumis sativus]
Length=290

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 7/89 (8%)
 Frame = +1

Query  355  LNKVSVDGSSNAAPG---TPPE-PEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTL  522
              +V V  +SN+AP    TP   P      + V +S ++S   L  E SI+ F+SQVS L
Sbjct  74   FKEVVVGKTSNSAPAIVSTPGNGPSGRKTESAVTVSDQSS---LPDELSISTFMSQVSDL  130

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            VKLVDSRDI EL+LKQ +CE++IRKKEA+
Sbjct  131  VKLVDSRDIMELQLKQQECEILIRKKEAI  159



>ref|XP_009613066.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Nicotiana tomentosiformis]
Length=263

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 10/87 (11%)
 Frame = +1

Query  349  AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVK  528
            AQLN+V++D S+N+ P       VS  S +    +E S   +    SI  F+SQ + LV+
Sbjct  58   AQLNEVAIDKSTNSKP-------VSEKSLEEVPKTEYS---IPDASSIQAFMSQAADLVE  107

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDSRDI EL+LKQ DCE++IRKK AL
Sbjct  108  LVDSRDIVELQLKQKDCEILIRKKAAL  134



>ref|XP_004491870.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Cicer arietinum]
Length=276

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +1

Query  367  SVDGSSNAAPGTPPEPEVSSASN-DVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSR  543
            +++ SSN+AP    EP+V+S    D      + P+      S++ F++QVS LVKLVDSR
Sbjct  63   TIENSSNSAPVLVNEPKVASPKEEDNHNGKPSGPSTSTDASSVSTFMNQVSELVKLVDSR  122

Query  544  DIAELKLKQLDCELIIRKKEAL  609
            DI EL+LKQ D EL IRKKEAL
Sbjct  123  DIVELQLKQADYELTIRKKEAL  144



>ref|XP_004489502.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like [Cicer arietinum]
Length=285

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +1

Query  367  SVDGSSNAAPGTPPEPEVSSASN-DVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSR  543
            +++ SSN+AP    EP+V+S    D      + P+      S++ F++QVS LVKLVDSR
Sbjct  72   TIENSSNSAPVLVNEPKVASPKEEDNHNGKPSGPSTSTDASSVSTFMNQVSELVKLVDSR  131

Query  544  DIAELKLKQLDCELIIRKKEAL  609
            DI EL+LKQ D EL IRKKEAL
Sbjct  132  DIVELQLKQADYELTIRKKEAL  153



>emb|CDX69519.1| BnaA10g18680D [Brassica napus]
Length=255

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +++F+S+VS+L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  85   LSDFMSKVSSLLKLVDSRDIVELELKQLDCEIVIRKKEAL  124



>ref|XP_008230865.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Prunus mume]
Length=285

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 12/93 (13%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKL-----SSETSPAVLASEESIAEFLSQ  510
            +AQL++V+ + SSN+AP       +++ S D  L     S+E   + +    SI+ F++Q
Sbjct  66   QAQLSEVT-EKSSNSAP------IINTKSEDGSLEGKDESTEKRSSNIPDASSISAFMAQ  118

Query  511  VSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            VS LVKLVDSRDI EL++KQLD EL+IRKKEAL
Sbjct  119  VSDLVKLVDSRDIVELQMKQLDLELVIRKKEAL  151



>ref|XP_009121569.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like [Brassica rapa]
Length=257

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +++F+S+VS+L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  87   LSDFMSKVSSLLKLVDSRDIVELELKQLDCEIVIRKKEAL  126



>gb|AFS89700.1| biotin carboxyl carrier protein [Vernicia fordii]
Length=252

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  487  SIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +I+ F++QVS LVKLVDSRDI EL+LKQL CELIIRKKEAL
Sbjct  81   AISAFMTQVSDLVKLVDSRDITELQLKQLGCELIIRKKEAL  121



>gb|AEI16469.1| acetyl-CoA carboxylase biotin-containing subunit [Brassica rapa]
Length=260

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +++F+S+VS+L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  87   LSDFMSKVSSLLKLVDSRDIVELELKQLDCEIVIRKKEAL  126



>gb|KFK25777.1| hypothetical protein AALP_AA8G159100 [Arabis alpina]
Length=254

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++EF+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  82   LSEFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  121



>ref|XP_006400073.1| hypothetical protein EUTSA_v10014486mg [Eutrema salsugineum]
 gb|ESQ41526.1| hypothetical protein EUTSA_v10014486mg [Eutrema salsugineum]
Length=250

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            I++F+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  83   ISDFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  122



>gb|AAS46758.1| biotin carboxyl carrier protein [Brassica napus]
Length=260

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +++F+S+VS+L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  87   LSDFMSKVSSLLKLVDSRDIVELELKQLDCEIVIRKKEAL  126



>ref|XP_009792449.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Nicotiana sylvestris]
Length=260

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 10/87 (11%)
 Frame = +1

Query  349  AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVK  528
            AQLN+V++D S+N+ P        S  S +    +E S   +    SI  F+SQ + LV+
Sbjct  58   AQLNEVAIDKSTNSKPA-------SEKSLEEVPKTEYS---IPDASSIQAFMSQAADLVE  107

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDSRDI EL+LKQ DCE++IRKK AL
Sbjct  108  LVDSRDIVELQLKQKDCEILIRKKAAL  134



>ref|XP_010420218.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Camelina sativa]
Length=250

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++EF+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  82   LSEFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  121



>ref|XP_007215770.1| hypothetical protein PRUPE_ppa009593mg [Prunus persica]
 gb|EMJ16969.1| hypothetical protein PRUPE_ppa009593mg [Prunus persica]
Length=285

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 2/88 (2%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            +AQL++V+ + SSN+AP    + E  S     + S+E   + +    SI+ F++QVS LV
Sbjct  66   QAQLSEVT-EKSSNSAPINNTKSEDGSLEGKDE-STEKRSSNIPDASSISAFMAQVSDLV  123

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI EL++KQLD EL+IRKKEAL
Sbjct  124  KLVDSRDIVELQMKQLDLELVIRKKEAL  151



>gb|AEI16468.1| acetyl-CoA carboxylase biotin-containing subunit [Brassica rapa]
Length=257

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  484  ESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            E +++F+S+VS L+KLVDSRDI EL+LKQLDCE++I+KKEAL
Sbjct  85   EELSDFMSKVSGLLKLVDSRDIVELELKQLDCEIVIQKKEAL  126



>ref|XP_010492396.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like [Camelina sativa]
Length=256

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++EF+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  86   LSEFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  125



>ref|XP_010453692.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like [Camelina sativa]
Length=256

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++EF+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  86   LSEFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  125



>ref|XP_004304236.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Fragaria vesca subsp. vesca]
Length=281

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 56/88 (64%), Gaps = 14/88 (16%)
 Frame = +1

Query  355  LNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAV---LASEESIAEFLSQVSTLV  525
            L+KV+ +  +N+AP            N+ K   E++  V   +    SI+ F++QVS LV
Sbjct  70   LSKVTAEKPANSAP-----------LNNTKAEDESAEKVSNNIPDASSISAFMAQVSDLV  118

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI EL++KQLD EL+IRKKEAL
Sbjct  119  KLVDSRDIVELQMKQLDLELVIRKKEAL  146



>ref|XP_006431276.1| hypothetical protein CICLE_v10012388mg [Citrus clementina]
 gb|ESR44516.1| hypothetical protein CICLE_v10012388mg [Citrus clementina]
Length=243

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  487  SIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +I+ F++QVS LVKLVDSRDI EL++KQ DCELIIRKKEAL
Sbjct  112  AISAFMTQVSDLVKLVDSRDIMELQMKQSDCELIIRKKEAL  152



>gb|AFK45654.1| unknown [Lotus japonicus]
Length=289

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +1

Query  367  SVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRD  546
            +V  SSN+AP    EP+V+S   +      + P+      SI+ F++QVS LVKLVDS+D
Sbjct  79   TVGNSSNSAPVLVKEPKVASL-EEKDNGKPSGPSTSTDASSISAFMNQVSDLVKLVDSKD  137

Query  547  IAELKLKQLDCELIIRKKEAL  609
            I EL+LKQ D EL+IRKKEAL
Sbjct  138  IVELQLKQADYELMIRKKEAL  158



>gb|AFK43158.1| unknown [Lotus japonicus]
Length=289

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +1

Query  367  SVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRD  546
            +V  SSN+AP    EP+V+S   +      + P+      SI+ F++QVS LVKLVDS+D
Sbjct  79   TVGNSSNSAPVLVKEPKVASL-EEKDNGKPSGPSTSTDASSISAFMNQVSDLVKLVDSKD  137

Query  547  IAELKLKQLDCELIIRKKEAL  609
            I EL+LKQ D EL+IRKKEAL
Sbjct  138  IVELQLKQADYELMIRKKEAL  158



>ref|XP_007037521.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, 
putative [Theobroma cacao]
 gb|EOY22022.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, 
putative [Theobroma cacao]
Length=269

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 12/96 (13%)
 Frame = +1

Query  322  NWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEF  501
            N   ++   AQ+N+V+V+ S N+AP      E++S         E     +   +SIA F
Sbjct  40   NQFRTLKVHAQVNEVAVEKSLNSAPII----EITS--------EEKGKQGIPDLQSIAAF  87

Query  502  LSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++QV+ L+KL+DSRDI EL+LKQ  CE+ IRKKEAL
Sbjct  88   MNQVADLIKLIDSRDIVELQLKQPACEVTIRKKEAL  123



>gb|AEI16467.1| acetyl-CoA carboxylase biotin-containing subunit [Brassica napus]
 emb|CDY26426.1| BnaC09g42420D [Brassica napus]
Length=252

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +++F+S+VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  86   LSDFISKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  125



>gb|AAG44776.1|AF271796_1 biotin carboxyl carrier protein subunit [Glycine max]
Length=284

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  TSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            + P+  A   SI+ F++QVS LVKLVDS+DI EL+LKQ +CEL+IRKKEAL
Sbjct  101  SGPSTSADASSISAFMNQVSDLVKLVDSKDIMELQLKQANCELVIRKKEAL  151



>ref|NP_001235174.1| biotin carboxyl carrier protein subunit [Glycine max]
 gb|AAG44765.1|AF271071_1 biotin carboxyl carrier protein subunit precursor [Glycine max]
 gb|KHN13569.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, 
chloroplastic [Glycine soja]
Length=284

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  457  TSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            + P+  A   SI+ F++QVS LVKLVDS+DI EL+LKQ +CEL+IRKKEAL
Sbjct  101  SGPSTSADASSISAFMNQVSDLVKLVDSKDIMELQLKQANCELVIRKKEAL  151



>gb|ERN09068.1| hypothetical protein AMTR_s00163p00066960 [Amborella trichopoda]
Length=248

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  SEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            SEE I++F++QVS+LVKLVDSRDI EL+L+Q DCEL IRKKE
Sbjct  96   SEERISDFMAQVSSLVKLVDSRDIVELQLQQHDCELTIRKKE  137



>emb|CDX78635.1| BnaA03g05470D [Brassica napus]
Length=254

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +++F+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  83   LSDFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  122



>ref|XP_010525117.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like [Tarenaya hassleriana]
Length=260

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  499  FLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            F++QVS LVKLVDSRDI EL+LKQLDCE+IIRKKEAL
Sbjct  94   FMAQVSDLVKLVDSRDIVELELKQLDCEIIIRKKEAL  130



>ref|XP_006288243.1| hypothetical protein CARUB_v10001485mg [Capsella rubella]
 gb|EOA21141.1| hypothetical protein CARUB_v10001485mg [Capsella rubella]
Length=318

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++EF+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  149  LSEFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  188



>ref|XP_009775160.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like [Nicotiana sylvestris]
Length=267

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 56/88 (64%), Gaps = 11/88 (13%)
 Frame = +1

Query  349  AQLNKVSV-DGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLV  525
            AQLN+V + + S+N+ P       VS  + +     E S    A   SI EF+SQ + LV
Sbjct  63   AQLNEVVILEKSTNSKP-------VSEKNEEEVPKPEPS---TADASSIQEFMSQAAHLV  112

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI EL+LKQ DCE++IRKKEA+
Sbjct  113  KLVDSRDIVELQLKQNDCEIVIRKKEAM  140



>ref|XP_009131471.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Brassica rapa]
Length=254

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +++F+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  83   LSDFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  122



>gb|AEI16466.1| acetyl-CoA carboxylase biotin-containing subunit [Brassica napus]
Length=251

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +++F+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  83   LSDFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  122



>ref|XP_010551815.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Tarenaya hassleriana]
Length=264

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++ F+S+VS LVKLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  96   LSGFMSRVSDLVKLVDSRDIVELELKQLDCEIVIRKKEAL  135



>ref|XP_011624494.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic [Amborella trichopoda]
Length=276

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  478  SEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            SEE I++F++QVS+LVKLVDSRDI EL+L+Q DCEL IRKKE
Sbjct  96   SEERISDFMAQVSSLVKLVDSRDIVELQLQQHDCELTIRKKE  137



>ref|XP_006431277.1| hypothetical protein CICLE_v10012388mg [Citrus clementina]
 gb|ESR44517.1| hypothetical protein CICLE_v10012388mg [Citrus clementina]
Length=286

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  487  SIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +I+ F++QVS LVKLVDSRDI EL++KQ DCELIIRKKEAL
Sbjct  112  AISAFMTQVSDLVKLVDSRDIMELQMKQSDCELIIRKKEAL  152



>gb|KDO72741.1| hypothetical protein CISIN_1g023188mg [Citrus sinensis]
Length=286

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 58/94 (62%), Gaps = 15/94 (16%)
 Frame = +1

Query  331  HSVVAKAQLNKVS-VDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLS  507
            + V+AK  LN  + VD  S          EV+S+   V+ + +  P       +I+ F++
Sbjct  73   NDVIAKKPLNSTAAVDTGS----------EVASSEEKVESAEKKIP----DASAISAFMT  118

Query  508  QVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            QVS LVKLVDSRDI EL++KQ DCELI+RKKEAL
Sbjct  119  QVSDLVKLVDSRDIMELQMKQSDCELIVRKKEAL  152



>ref|XP_006482733.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like isoform X1 [Citrus sinensis]
Length=286

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 58/94 (62%), Gaps = 15/94 (16%)
 Frame = +1

Query  331  HSVVAKAQLNKVS-VDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLS  507
            + V+AK  LN  + VD  S          EV+S+   V+ + +  P       +I+ F++
Sbjct  73   NDVIAKKPLNSTAAVDTGS----------EVASSEEKVESAEKKIP----DASAISAFMT  118

Query  508  QVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            QVS LVKLVDSRDI EL++KQ DCELI+RKKEAL
Sbjct  119  QVSDLVKLVDSRDIMELQMKQSDCELIVRKKEAL  152



>gb|KDO72742.1| hypothetical protein CISIN_1g023188mg [Citrus sinensis]
Length=283

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 15/92 (16%)
 Frame = +1

Query  337  VVAKAQLNKVS-VDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQV  513
            V+AK  LN  + VD  S          EV+S+   V+ + +  P       +I+ F++QV
Sbjct  72   VIAKKPLNSTAAVDTGS----------EVASSEEKVESAEKKIP----DASAISAFMTQV  117

Query  514  STLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            S LVKLVDSRDI EL++KQ DCELI+RKKEAL
Sbjct  118  SDLVKLVDSRDIMELQMKQSDCELIVRKKEAL  149



>ref|XP_006482734.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like isoform X2 [Citrus sinensis]
Length=283

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 57/92 (62%), Gaps = 15/92 (16%)
 Frame = +1

Query  337  VVAKAQLNKVS-VDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQV  513
            V+AK  LN  + VD  S          EV+S+   V+ + +  P       +I+ F++QV
Sbjct  72   VIAKKPLNSTAAVDTGS----------EVASSEEKVESAEKKIP----DASAISAFMTQV  117

Query  514  STLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            S LVKLVDSRDI EL++KQ DCELI+RKKEAL
Sbjct  118  SDLVKLVDSRDIMELQMKQSDCELIVRKKEAL  149



>ref|XP_009365859.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like [Pyrus x bretschneideri]
Length=280

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%), Gaps = 7/95 (7%)
 Frame = +1

Query  319  SNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAE  498
            S+W      +AQLN+V+ + S N+ P    + E  S+    + SS+T+   +    SI+ 
Sbjct  61   SSWK----VQAQLNEVAAEKSPNSVPINKKKSEDGSSEGKGESSSQTN---IPDAASISA  113

Query  499  FLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            F++QVS L+KLVDSRDI EL++KQLD EL+IRKKE
Sbjct  114  FMAQVSDLIKLVDSRDIVELEMKQLDLELVIRKKE  148



>ref|XP_002871669.1| hypothetical protein ARALYDRAFT_909527 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47928.1| hypothetical protein ARALYDRAFT_909527 [Arabidopsis lyrata subsp. 
lyrata]
Length=255

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++EF+++VS L+KLVDS+DI EL+LKQLDCE++IRKKEAL
Sbjct  86   LSEFMTKVSGLLKLVDSKDIVELELKQLDCEIVIRKKEAL  125



>ref|NP_568316.1| biotin carboxyl carrier protein 2 [Arabidopsis thaliana]
 sp|Q9LLC1.1|BCCP2_ARATH RecName: Full=Biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic; Short=AtBCCP2; Short=BCCP-2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF80592.1|AF223948_1 biotin carboxyl carrier protein isoform 2 [Arabidopsis thaliana]
 gb|AAM63527.1| biotin carboxyl carrier protein precursor-like protein [Arabidopsis 
thaliana]
 gb|ABI49449.1| At5g15530 [Arabidopsis thaliana]
 gb|AED92173.1| biotin carboxyl carrier protein 2 [Arabidopsis thaliana]
Length=255

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++EF+++VS L+KLVDS+DI EL+LKQLDCE++IRKKEAL
Sbjct  86   LSEFMAKVSGLLKLVDSKDIVELELKQLDCEIVIRKKEAL  125



>ref|XP_003618716.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase [Medicago 
truncatula]
 gb|AES74934.1| biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula]
Length=278

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 61/90 (68%), Gaps = 10/90 (11%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETS-PAVLASEES-IAEFLSQVST  519
            +AQLN+ +V  + N+AP        + AS++ K +   S PA   S+ES I+ F+SQV+ 
Sbjct  64   QAQLNEAAVVENLNSAP--------TVASSEEKENQNGSVPASTVSDESAISAFMSQVAD  115

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            LV LVDSRDI EL+LKQ D EL+IRKKEAL
Sbjct  116  LVILVDSRDIVELQLKQSDYELVIRKKEAL  145



>gb|AEI16472.1| acetyl-CoA carboxylase biotin-containing subunit [Brassica oleracea]
Length=252

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +++F+S+VS L+KLVDSRD+ EL+LKQLDCE++IRKKEAL
Sbjct  86   LSDFISKVSGLLKLVDSRDMVELELKQLDCEIVIRKKEAL  125



>ref|XP_004241599.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Solanum lycopersicum]
Length=261

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 10/87 (11%)
 Frame = +1

Query  349  AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVK  528
            AQLN+V++D S+N+ P       VS  S +    +E S   +    SI  F+SQ + LV+
Sbjct  59   AQLNEVAIDKSNNSKP-------VSEKSLEEVSKTEYS---IPDASSIQAFMSQAADLVE  108

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDSRDI EL+LKQ +CE++IRKK AL
Sbjct  109  LVDSRDIVELQLKQNNCEILIRKKAAL  135



>emb|CAA62264.1| Biotin carboxyl carrier protein [Brassica napus]
 prf||2210244D Ac-CoA carboxylase:ISOTYPE=bp4
Length=256

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++ F+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  84   LSNFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  123



>ref|XP_006354759.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Solanum tuberosum]
Length=258

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 10/87 (11%)
 Frame = +1

Query  349  AQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVK  528
            AQLN+V++D S+N+ P       VS  S +    +E S   +    SI  F+SQ + LV+
Sbjct  59   AQLNEVAIDKSNNSKP-------VSEKSLEEVSKTEYS---IPDASSIQAFMSQAADLVE  108

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDSRDI EL+LKQ +CE++IRKK AL
Sbjct  109  LVDSRDIVELQLKQNNCEILIRKKAAL  135



>ref|XP_009616596.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic [Nicotiana tomentosiformis]
Length=267

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  475  ASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            A   SI EF+SQ + LVKLVDSRDI EL+LKQ DCE++IRKKEA+
Sbjct  96   ADASSIQEFMSQAAHLVKLVDSRDIVELQLKQNDCEIVIRKKEAM  140



>gb|ACJ84238.1| unknown [Medicago truncatula]
 gb|AFK41038.1| unknown [Medicago truncatula]
Length=239

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 62/93 (67%), Gaps = 10/93 (11%)
 Frame = +1

Query  337  VVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASNDVKLSSETS-PAVLASEES-IAEFLSQ  510
            V  +AQLN+ +V  + N+AP        + AS++ K +   S PA   S+ES I+ F+SQ
Sbjct  61   VKIQAQLNEAAVVENLNSAP--------TVASSEEKENQNGSVPASTVSDESAISAFMSQ  112

Query  511  VSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            V+ LV LVDSRDI EL+LKQ D EL++RKKEAL
Sbjct  113  VADLVILVDSRDIVELQLKQSDYELVMRKKEAL  145



>emb|CDX70616.1| BnaC03g07000D [Brassica napus]
Length=256

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++ F+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  84   LSNFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  123



>ref|XP_008805109.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like isoform X1 [Phoenix dactylifera]
Length=286

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = +1

Query  319  SNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEP-EVSSASNDVKLSSETSPAVLASEESIA  495
            SN  HS++ KAQ+ +V VDGSS+++  T  +   +SS   +     E++    A +  I+
Sbjct  54   SNRCHSLILKAQVQEVGVDGSSSSSARTSTKSGNLSSKDKEADALKESASQTAAPDSMIS  113

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
             ++++ S LVKLVDS+DI EL+LK+ D ELIIRKKEAL
Sbjct  114  AYIAEASKLVKLVDSKDITELQLKRKDFELIIRKKEAL  151



>gb|AEI16473.1| acetyl-CoA carboxylase biotin-containing subunit [Brassica oleracea]
Length=256

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++ F+++VS L+KLVDSRDI EL+LKQLDCE++IRKKEAL
Sbjct  84   LSNFMAKVSGLLKLVDSRDIVELELKQLDCEIVIRKKEAL  123



>gb|ACO53613.1| biotin carboxyl carrier protein 2-3 [Arachis hypogaea]
Length=276

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++ F++QV+ LVKLVDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  102  VSAFMAQVADLVKLVDSRDIVELQLKQSDCELMIRKKEAL  141



>gb|ACO53615.1| biotin carboxyl carrier protein 2-5 [Arachis hypogaea]
Length=276

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++ F++QV+ LVKLVDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  102  VSAFMAQVADLVKLVDSRDIVELQLKQSDCELMIRKKEAL  141



>ref|XP_010030547.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like isoform X2 [Eucalyptus grandis]
Length=274

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = +1

Query  409  EPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELI  588
            E  V+ A  D + + E     L    SI+ F++QV+ LV+LVDSRDI EL+LKQ DCE+I
Sbjct  74   EGSVAGAETDGEATKEEP--RLPDAPSISAFMNQVADLVELVDSRDIVELQLKQADCEVI  131

Query  589  IRKKEAL  609
            IRKK+AL
Sbjct  132  IRKKDAL  138



>gb|ACO53614.1| biotin carboxyl carrier protein 2-4 [Arachis hypogaea]
Length=276

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++ F++QV+ LVKLVDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  102  VSAFMAQVADLVKLVDSRDIVELQLKQSDCELMIRKKEAL  141



>gb|ACO53612.1| biotin carboxyl carrier protein 2-2 [Arachis hypogaea]
Length=276

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++ F++QV+ LVKLVDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  102  VSAFMAQVADLVKLVDSRDIVELQLKQSDCELMIRKKEAL  141



>emb|CAC01752.1| biotin carboxyl carrier protein precursor-like protein [Arabidopsis 
thaliana]
Length=333

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++EF+++VS L+KLVDS+DI EL+LKQLDCE++IRKKEAL
Sbjct  107  LSEFMAKVSGLLKLVDSKDIVELELKQLDCEIVIRKKEAL  146



>ref|XP_010030540.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like isoform X1 [Eucalyptus grandis]
Length=277

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = +1

Query  409  EPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELI  588
            E  V+ A  D + + E     L    SI+ F++QV+ LV+LVDSRDI EL+LKQ DCE+I
Sbjct  77   EGSVAGAETDGEATKEEP--RLPDAPSISAFMNQVADLVELVDSRDIVELQLKQADCEVI  134

Query  589  IRKKEAL  609
            IRKK+AL
Sbjct  135  IRKKDAL  141



>ref|XP_010030553.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
2, chloroplastic-like isoform X3 [Eucalyptus grandis]
Length=273

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = +1

Query  409  EPEVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELI  588
            E  V+ A  D + + E     L    SI+ F++QV+ LV+LVDSRDI EL+LKQ DCE+I
Sbjct  73   EGSVAGAETDGEATKEEP--RLPDAPSISAFMNQVADLVELVDSRDIVELQLKQADCEVI  130

Query  589  IRKKEAL  609
            IRKK+AL
Sbjct  131  IRKKDAL  137



>gb|ACO53611.1| biotin carboxyl carrier protein 2-1 [Arachis hypogaea]
Length=276

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++ F++QV+ LVKLVDSRDI EL+LKQ DCEL+IRKKEAL
Sbjct  102  VSAFMAQVADLVKLVDSRDIVELQLKQSDCELMIRKKEAL  141



>gb|AEI16465.1| acetyl-CoA carboxylase biotin-containing subunit [Brassica napus]
Length=256

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +++F+++VS L+KLVDSRDI EL+LKQLDC ++IRKKEAL
Sbjct  84   LSDFMAKVSGLLKLVDSRDIVELELKQLDCGIVIRKKEAL  123



>ref|XP_004489456.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like isoform X2 [Cicer arietinum]
Length=282

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  487  SIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            S++ F++QV+ LVKLVDSRDI EL+LKQ DCEL+IRK EAL
Sbjct  110  SVSAFMTQVADLVKLVDSRDIVELQLKQSDCELLIRKTEAL  150



>ref|XP_004489455.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like isoform X1 [Cicer arietinum]
Length=311

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  487  SIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            S++ F++QV+ LVKLVDSRDI EL+LKQ DCEL+IRK EAL
Sbjct  139  SVSAFMTQVADLVKLVDSRDIVELQLKQSDCELLIRKTEAL  179



>ref|XP_010939149.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like isoform X1 [Elaeis guineensis]
Length=285

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  319  SNWNHSVVAKAQLNKVSVDGSSNAAPGTPPE-PEVSSASNDVKLSSETSPAVLASEESIA  495
             +W+HS + KAQ+ +V+VD SS ++  T  +   +SS   +     E++    A +  I+
Sbjct  53   GSWSHSHILKAQVQEVAVDVSSRSSAMTSTKSGNLSSKDKEADALKESASQTAAPDSMIS  112

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKK  600
              +++ S LVKLVDS+DI EL+LK+ D ELIIRKK
Sbjct  113  ACIAEASNLVKLVDSKDITELQLKRKDFELIIRKK  147



>gb|AGT55821.1| biotin carboxyl carrier protein [Cocos nucifera]
Length=285

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +1

Query  319  SNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSASN-DVKLSSETSPAVLASEESIA  495
            SN +HS V KAQ+ +V+VDGSS+++  T  +   SS+ + +     E++    A +  I+
Sbjct  54   SNRSHSHVLKAQVQEVAVDGSSSSSTMTSTKSGNSSSKDKEADALKESASQTAAPDSMIS  113

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
             ++++ + LVKLVDS+DI EL+LK+ D ELIIRKK AL
Sbjct  114  AYIAEATNLVKLVDSKDIMELQLKRKDFELIIRKKTAL  151



>emb|CAA62265.1| Biotin carboxyl carrier protein [Brassica napus]
 prf||2210244E Ac-CoA carboxylase:ISOTYPE=bp6
Length=251

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  490  IAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKE  603
            +++F+S+VS L+KLVDSRDI EL+LKQLDCE++IRK++
Sbjct  86   LSDFISKVSGLLKLVDSRDIVELELKQLDCEIVIRKRK  123



>ref|XP_009394324.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=275

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = +1

Query  331  HSVVAKAQLNKVSVDGSSNAAPGTPPEPEVSSAS-NDVKLSSETSPAVLASEESIAEFLS  507
            H  + KA   +V+V+ SSN++P    + E       D  +  E+      ++ +I+ F++
Sbjct  52   HYPILKAHFQEVTVETSSNSSPIAWTKSETLPIKIKDAGVVEESGGPNEVTDSTISTFMA  111

Query  508  QVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +VS+LVKLVDS+DI EL LK+  CEL+I+K EAL
Sbjct  112  EVSSLVKLVDSKDITELHLKKDGCELLIKKHEAL  145



>ref|XP_003621415.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase [Medicago 
truncatula]
 gb|AES77633.1| biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula]
Length=287

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  460  SPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
             P+      S++ F+ QVS LVKLVDSRDI EL+LKQ   EL+IRKKEAL
Sbjct  105  GPSASTDASSVSTFMDQVSELVKLVDSRDIMELELKQAGYELMIRKKEAL  154



>gb|ABK26424.1| unknown [Picea sitchensis]
Length=309

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  487  SIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            +I+ F+S+V+ L+KLVDSRDI EL+LKQ D E++IRKKEAL
Sbjct  133  AISAFMSEVTDLIKLVDSRDIMELQLKQQDYEILIRKKEAL  173



>ref|XP_010936328.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=281

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +1

Query  319  SNWNHSVVAKAQLNKVSVDGSSNAAPGTPPEP-EVSSASNDVKLSSETSPAVLASEESIA  495
            SN +HS++ KAQ+ +V+V+ S++++P    +P ++SS   +     E++      +  I+
Sbjct  50   SNRSHSLILKAQVQEVAVESSASSSPMASIKPGDLSSKDEEAACREESASQAAVQDSMIS  109

Query  496  EFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
             ++++ S LVKLVDS+DI EL+LK+ D ELIIRKKEA+
Sbjct  110  AYIAEASKLVKLVDSKDITELQLKRKDFELIIRKKEAI  147



>ref|XP_008805110.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like isoform X2 [Phoenix dactylifera]
Length=275

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query  346  KAQLNKVSVDGSSNAAPGTPPEP-EVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTL  522
            KAQ+ +V VDGSS+++  T  +   +SS   +     E++    A +  I+ ++++ S L
Sbjct  52   KAQVQEVGVDGSSSSSARTSTKSGNLSSKDKEADALKESASQTAAPDSMISAYIAEASKL  111

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            VKLVDS+DI EL+LK+ D ELIIRKKEAL
Sbjct  112  VKLVDSKDITELQLKRKDFELIIRKKEAL  140



>gb|KJB66287.1| hypothetical protein B456_010G135200 [Gossypium raimondii]
Length=161

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  523  VKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++LVDSRDI EL+LKQLDCEL+IRKKEAL
Sbjct  1    MRLVDSRDIVELQLKQLDCELVIRKKEAL  29



>ref|XP_009411120.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009411121.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=286

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  478  SEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            ++ +I+ F+++VS LVKLVDS+DI EL LK   C+L+IRKKEAL
Sbjct  110  TDTTISAFMAEVSNLVKLVDSKDITELHLKTEACDLLIRKKEAL  153



>ref|XP_008805111.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like isoform X3 [Phoenix dactylifera]
Length=270

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  475  ASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIRKKEAL  609
            A +  I+ ++++ S LVKLVDS+DI EL+LK+ D ELIIRKKEAL
Sbjct  91   APDSMISAYIAEASKLVKLVDSKDITELQLKRKDFELIIRKKEAL  135



>ref|XP_010936329.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic isoform X2 [Elaeis guineensis]
Length=270

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  415  EVSSASNDVKLSSETSPAVLASEESIAEFLSQVSTLVKLVDSRDIAELKLKQLDCELIIR  594
            ++SS   +     E++      +  I+ ++++ S LVKLVDS+DI EL+LK+ D ELIIR
Sbjct  72   DLSSKDEEAACREESASQAAVQDSMISAYIAEASKLVKLVDSKDITELQLKRKDFELIIR  131

Query  595  KKEAL  609
            KKEA+
Sbjct  132  KKEAI  136



>gb|AGG36123.1| biotin carboxyl carrier protein subunit, partial [Jatropha curcas]
Length=105

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDSRDI EL+LKQL C+LIIRKKEAL
Sbjct  1    LVDSRDITELQLKQLGCQLIIRKKEAL  27



>gb|AGG36117.1| biotin carboxyl carrier protein subunit, partial [Jatropha curcas]
 gb|AGG36118.1| biotin carboxyl carrier protein subunit, partial [Jatropha curcas]
 gb|AGG36119.1| biotin carboxyl carrier protein subunit, partial [Jatropha curcas]
 gb|AGG36120.1| biotin carboxyl carrier protein subunit, partial [Jatropha curcas]
 gb|AGG36121.1| biotin carboxyl carrier protein subunit, partial [Jatropha curcas]
 gb|AGG36124.1| biotin carboxyl carrier protein subunit, partial [Jatropha curcas]
 gb|AGG36125.1| biotin carboxyl carrier protein subunit, partial [Jatropha curcas]
 gb|AGG36126.1| biotin carboxyl carrier protein subunit, partial [Jatropha curcas]
 gb|AGG36127.1| biotin carboxyl carrier protein subunit, partial [Jatropha curcas]
Length=105

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDSRDI EL+LKQL C+LIIRKKEAL
Sbjct  1    LVDSRDITELQLKQLGCQLIIRKKEAL  27



>gb|KHG26758.1| Biotin carboxyl carrier of acetyl-CoA carboxylase 2, chloroplastic 
-like protein [Gossypium arboreum]
Length=270

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  526  KLVDSRDIAELKLKQLDCELIIRKKEAL  609
            KLVDSRDI EL+LKQ DCELIIRKKEAL
Sbjct  106  KLVDSRDITELQLKQSDCELIIRKKEAL  133



>gb|AGG36122.1| biotin carboxyl carrier protein subunit, partial [Jatropha platyphylla]
Length=105

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVDSRDI EL+LKQL C+LIIRKKEAL
Sbjct  1    LVDSRDITELQLKQLGCQLIIRKKEAL  27



>gb|KCW51917.1| hypothetical protein EUGRSUZ_J01371 [Eucalyptus grandis]
Length=194

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  529  LVDSRDIAELKLKQLDCELIIRKKEAL  609
            LVD++DI EL+LKQ+DCE+IIRKKEA+
Sbjct  33   LVDTKDIMELQLKQMDCEIIIRKKEAI  59



>ref|XP_010939150.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, 
chloroplastic-like isoform X2 [Elaeis guineensis]
Length=270

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +1

Query  343  AKAQLNKVSVDGSSNAAPGTPPE-PEVSSASNDVKLSSETSPAVLASEESIAEFLSQVST  519
            A+  L KV+VD SS ++  T  +   +SS   +     E++    A +  I+  +++ S 
Sbjct  46   ARFPLLKVAVDVSSRSSAMTSTKSGNLSSKDKEADALKESASQTAAPDSMISACIAEASN  105

Query  520  LVKLVDSRDIAELKLKQLDCELIIRKK  600
            LVKLVDS+DI EL+LK+ D ELIIRKK
Sbjct  106  LVKLVDSKDITELQLKRKDFELIIRKK  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1133412046677