BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8057

Length=1082
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086719.1|  PREDICTED: uncharacterized protein LOC105168359    314   1e-102   Sesamum indicum [beniseed]
emb|CDP13288.1|  unnamed protein product                                306   1e-99    Coffea canephora [robusta coffee]
gb|EPS68757.1|  hypothetical protein M569_06012                         298   2e-96    Genlisea aurea
gb|EYU25950.1|  hypothetical protein MIMGU_mgv1a012571mg                298   3e-96    Erythranthe guttata [common monkey flower]
gb|EYU25951.1|  hypothetical protein MIMGU_mgv1a012571mg                298   3e-96    Erythranthe guttata [common monkey flower]
ref|XP_009606772.1|  PREDICTED: uncharacterized protein LOC104101068    298   4e-96    Nicotiana tomentosiformis
ref|XP_006590262.1|  PREDICTED: uncharacterized protein LOC100306...    297   6e-96    Glycine max [soybeans]
ref|NP_001237795.1|  uncharacterized protein LOC100306628               297   7e-96    Glycine max [soybeans]
gb|KHN44402.1|  hypothetical protein glysoja_014443                     298   1e-95    Glycine soja [wild soybean]
ref|XP_009780030.1|  PREDICTED: uncharacterized protein LOC104229142    296   1e-95    Nicotiana sylvestris
ref|XP_010248828.1|  PREDICTED: uncharacterized protein LOC104591617    291   6e-94    Nelumbo nucifera [Indian lotus]
ref|XP_006341763.1|  PREDICTED: uncharacterized protein LOC102591507    291   1e-93    Solanum tuberosum [potatoes]
emb|CDY28870.1|  BnaC06g26580D                                          291   1e-93    Brassica napus [oilseed rape]
ref|XP_007163718.1|  hypothetical protein PHAVU_001G258300g             290   4e-93    Phaseolus vulgaris [French bean]
ref|XP_008444407.1|  PREDICTED: uncharacterized protein LOC103487745    289   1e-92    Cucumis melo [Oriental melon]
ref|XP_004142951.1|  PREDICTED: protein HHL1, chloroplastic isofo...    288   2e-92    Cucumis sativus [cucumbers]
ref|XP_004142952.1|  PREDICTED: protein HHL1, chloroplastic isofo...    288   3e-92    Cucumis sativus [cucumbers]
emb|CDY07411.1|  BnaA07g24900D                                          287   3e-92    Brassica napus [oilseed rape]
ref|XP_009105106.1|  PREDICTED: uncharacterized protein LOC103831017    288   3e-92    Brassica rapa
ref|XP_010690008.1|  PREDICTED: uncharacterized protein LOC104903638    287   4e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010415348.1|  PREDICTED: uncharacterized protein LOC104701...    287   4e-92    Camelina sativa [gold-of-pleasure]
ref|XP_004239174.1|  PREDICTED: uncharacterized protein LOC101256588    287   5e-92    Solanum lycopersicum
ref|XP_010415350.1|  PREDICTED: uncharacterized protein LOC104701...    287   5e-92    Camelina sativa [gold-of-pleasure]
gb|KJB78038.1|  hypothetical protein B456_012G174200                    287   5e-92    Gossypium raimondii
gb|KJB78040.1|  hypothetical protein B456_012G174200                    287   5e-92    Gossypium raimondii
ref|NP_564903.3|  uncharacterized protein                               286   8e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KDP26738.1|  hypothetical protein JCGZ_17896                         286   8e-92    Jatropha curcas
ref|NP_850972.1|  uncharacterized protein                               286   9e-92    Arabidopsis thaliana [mouse-ear cress]
emb|CDX96071.1|  BnaA07g26600D                                          286   1e-91    
ref|XP_010511722.1|  PREDICTED: uncharacterized protein LOC104787...    286   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_009105311.1|  PREDICTED: uncharacterized protein LOC103831...    286   1e-91    
ref|XP_012085594.1|  PREDICTED: protein HHL1, chloroplastic             286   1e-91    Jatropha curcas
ref|XP_010511723.1|  PREDICTED: uncharacterized protein LOC104787...    286   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_009105310.1|  PREDICTED: uncharacterized protein LOC103831...    286   2e-91    Brassica rapa
ref|XP_006302772.1|  hypothetical protein CARUB_v10020893mg             286   2e-91    Capsella rubella
ref|XP_010470685.1|  PREDICTED: uncharacterized protein LOC104750...    285   3e-91    Camelina sativa [gold-of-pleasure]
ref|XP_011042325.1|  PREDICTED: uncharacterized protein LOC105138036    285   3e-91    Populus euphratica
ref|XP_010470686.1|  PREDICTED: uncharacterized protein LOC104750...    285   3e-91    Camelina sativa [gold-of-pleasure]
ref|XP_002314565.1|  hypothetical protein POPTR_0010s06350g             285   5e-91    Populus trichocarpa [western balsam poplar]
ref|XP_006438139.1|  hypothetical protein CICLE_v10032669mg             284   7e-91    Citrus clementina [clementine]
ref|XP_006438141.1|  hypothetical protein CICLE_v10032669mg             284   7e-91    Citrus clementina [clementine]
gb|KHG12697.1|  Multidrug resistance pgp-1                              284   7e-91    Gossypium arboreum [tree cotton]
ref|XP_008807203.1|  PREDICTED: uncharacterized protein LOC103719642    284   9e-91    Phoenix dactylifera
gb|KDO82054.1|  hypothetical protein CISIN_1g027148mg                   283   2e-90    Citrus sinensis [apfelsine]
ref|XP_006484021.1|  PREDICTED: uncharacterized protein LOC102611015    283   2e-90    Citrus sinensis [apfelsine]
ref|XP_006391234.1|  hypothetical protein EUTSA_v10019020mg             283   4e-90    Eutrema salsugineum [saltwater cress]
ref|XP_011457438.1|  PREDICTED: uncharacterized protein LOC101291014    281   1e-89    Fragaria vesca subsp. vesca
ref|XP_010556180.1|  PREDICTED: uncharacterized protein LOC104825...    280   2e-89    Tarenaya hassleriana [spider flower]
ref|XP_010556182.1|  PREDICTED: uncharacterized protein LOC104825...    280   2e-89    Tarenaya hassleriana [spider flower]
ref|NP_001185346.1|  uncharacterized protein                            280   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002515011.1|  oligopeptidase, putative                           279   7e-89    Ricinus communis
ref|XP_002272215.2|  PREDICTED: uncharacterized protein LOC100256...    277   4e-88    Vitis vinifera
ref|XP_010655080.1|  PREDICTED: uncharacterized protein LOC100256...    276   5e-88    Vitis vinifera
ref|XP_009403641.1|  PREDICTED: uncharacterized protein LOC103987153    276   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007044959.1|  Uncharacterized protein TCM_010707                 275   5e-87    
ref|XP_010930033.1|  PREDICTED: uncharacterized protein LOC105051...    273   2e-86    Elaeis guineensis
ref|XP_010930032.1|  PREDICTED: uncharacterized protein LOC105051...    269   5e-85    Elaeis guineensis
emb|CDY01837.1|  BnaC06g28770D                                          288   5e-85    
ref|XP_003601843.1|  hypothetical protein MTR_3g086040                  268   1e-84    Medicago truncatula
ref|XP_004502335.1|  PREDICTED: uncharacterized protein LOC101493538    266   6e-84    Cicer arietinum [garbanzo]
ref|XP_010025366.1|  PREDICTED: uncharacterized protein LOC104415723    266   8e-84    Eucalyptus grandis [rose gum]
ref|XP_007223900.1|  hypothetical protein PRUPE_ppa010899mg             266   8e-84    
ref|XP_006852149.2|  PREDICTED: uncharacterized protein LOC18441862     265   2e-83    Amborella trichopoda
gb|ERN13616.1|  hypothetical protein AMTR_s00049p00073250               265   4e-83    Amborella trichopoda
ref|XP_008221980.1|  PREDICTED: uncharacterized protein LOC103321904    260   2e-81    Prunus mume [ume]
ref|XP_008389783.1|  PREDICTED: uncharacterized protein LOC103452079    259   4e-81    
ref|XP_010100301.1|  hypothetical protein L484_027609                   258   7e-81    
ref|XP_009359285.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    255   1e-79    Pyrus x bretschneideri [bai li]
gb|AAG28905.1|AC008113_21  F12A21.16                                    262   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001047344.1|  Os02g0600200                                       237   6e-72    
ref|XP_010235641.1|  PREDICTED: uncharacterized protein LOC104583...    236   6e-72    
dbj|BAJ85479.1|  predicted protein                                      236   8e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC73537.1|  hypothetical protein OsI_07935                          236   3e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_004952998.1|  PREDICTED: uncharacterized protein LOC101783...    235   5e-71    
ref|XP_004952999.1|  PREDICTED: uncharacterized protein LOC101783...    233   9e-71    Setaria italica
ref|NP_001141155.1|  uncharacterized protein LOC100273241               233   1e-70    Zea mays [maize]
ref|XP_006665147.1|  PREDICTED: uncharacterized protein LOC102722271    229   4e-70    
gb|EMT22924.1|  hypothetical protein F775_29812                         225   3e-67    
gb|KDO82053.1|  hypothetical protein CISIN_1g027148mg                   222   4e-67    Citrus sinensis [apfelsine]
gb|KDO82056.1|  hypothetical protein CISIN_1g027148mg                   218   9e-66    Citrus sinensis [apfelsine]
gb|KEH35275.1|  plant/F12A21-30 protein, putative                       211   5e-63    Medicago truncatula
ref|XP_002887139.1|  F12A21.16                                          226   1e-62    
emb|CBI27531.3|  unnamed protein product                                205   2e-61    Vitis vinifera
ref|XP_010235643.1|  PREDICTED: uncharacterized protein LOC104583...    206   2e-60    
gb|ABK23133.1|  unknown                                                 203   2e-59    Picea sitchensis
ref|XP_006648812.1|  PREDICTED: uncharacterized protein LOC102699572    191   4e-55    
gb|KDO82058.1|  hypothetical protein CISIN_1g027148mg                   174   2e-49    Citrus sinensis [apfelsine]
ref|XP_001765741.1|  predicted protein                                  172   6e-48    
ref|XP_010930034.1|  PREDICTED: uncharacterized protein LOC105051...    162   3e-44    Elaeis guineensis
gb|EAY86575.1|  hypothetical protein OsI_07955                          154   1e-38    Oryza sativa Indica Group [Indian rice]
gb|AFW72182.1|  hypothetical protein ZEAMMB73_079373                    145   5e-38    
gb|KHN24102.1|  Small heat shock protein, chloroplastic                 142   2e-35    Glycine soja [wild soybean]
ref|XP_002983221.1|  hypothetical protein SELMODRAFT_422572             125   1e-30    
ref|XP_002961342.1|  hypothetical protein SELMODRAFT_403146             122   1e-29    
gb|AFB34514.1|  hypothetical protein CL4511Contig1_02                   110   2e-26    Pinus mugo [mountain pine]
gb|AEW09177.1|  hypothetical protein CL4511Contig1_02                   110   3e-26    Pinus radiata
gb|AFB34513.1|  hypothetical protein CL4511Contig1_02                   107   5e-25    Larix decidua
ref|XP_005648734.1|  hypothetical protein COCSUDRAFT_53257            99.8    5e-21    Coccomyxa subellipsoidea C-169
ref|XP_011397511.1|  Uncharacterized protein YhiN                     90.5    1e-16    Auxenochlorella protothecoides
ref|XP_001415572.1|  predicted protein                                84.3    4e-16    Ostreococcus lucimarinus CCE9901
ref|XP_003074445.1|  Metalloendopeptidase family-saccharolysin & ...  82.8    5e-15    Ostreococcus tauri
ref|XP_005852074.1|  hypothetical protein CHLNCDRAFT_133084           77.8    2e-13    Chlorella variabilis
ref|XP_002507497.1|  hypothetical protein MICPUN_113391               72.0    3e-11    Micromonas commoda
ref|XP_003056036.1|  hypothetical protein MICPUCDRAFT_70697           72.0    3e-11    Micromonas pusilla CCMP1545
ref|XP_001695603.1|  hypothetical protein CHLREDRAFT_205992           70.9    8e-11    Chlamydomonas reinhardtii
ref|XP_005534863.1|  hypothetical protein CYME_CMJ126C                64.7    1e-08    Cyanidioschyzon merolae strain 10D
gb|AFW72181.1|  hypothetical protein ZEAMMB73_079373                  58.2    4e-07    
ref|XP_002184929.1|  predicted protein                                59.7    4e-07    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007509245.1|  predicted protein                                58.2    9e-07    Bathycoccus prasinos
ref|XP_002953545.1|  hypothetical protein VOLCADRAFT_121174           58.2    2e-06    Volvox carteri f. nagariensis
ref|XP_005718910.1|  unnamed protein product                          54.7    3e-05    Chondrus crispus [carageen]
gb|KIZ07565.1|  hypothetical protein MNEG_0380                        52.8    5e-05    Monoraphidium neglectum
gb|ADU15868.1|  CLCuV responsive protein                              50.1    2e-04    Gossypium hirsutum [American cotton]



>ref|XP_011086719.1| PREDICTED: uncharacterized protein LOC105168359 [Sesamum indicum]
Length=243

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV MS N LVRLP  +       S        + T TA    +++R  RL+VVEAKGKK
Sbjct  1    MEVGMSLNPLVRLPLSSNGRTHEDSLIRHSLFSTKTTTAQKPYQQKRQHRLLVVEAKGKK  60

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPPLPKLEDDGNPKFVIFIR+A+V LWYPLNIVTGGTTAKIMV+AKDNF
Sbjct  61   GMAARQYQRAPPPPLPKLEDDGNPKFVIFIRVANVYLWYPLNIVTGGTTAKIMVSAKDNF  120

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDTLARNLAAVIYRDEKE+QK+A KQFRVLR++TDFRYGYKLVENNNLR AL+ 
Sbjct  121  LGKYIYKDTLARNLAAVIYRDEKEIQKMAMKQFRVLRSATDFRYGYKLVENNNLRAALAA  180

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
             ++IELP Q+ELKTVLDKVKDFFG AKESFG
Sbjct  181  NDVIELPTQDELKTVLDKVKDFFGDAKESFG  211



>emb|CDP13288.1| unnamed protein product [Coffea canephora]
Length=235

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 178/215 (83%), Gaps = 12/215 (6%)
 Frame = +3

Query  132  MEVAMSFNSLVRLP---RRNPMEDsgsssslirhsissTRTAVPSR-KRQRVGRLMVVEA  299
            ME  MS N L+RLP    RN +EDS    SL         T  P + +R++  RL++VEA
Sbjct  1    MEATMSLNPLIRLPISSSRN-VEDSLVRHSL-------VSTRRPHKGQREKHLRLLIVEA  52

Query  300  KGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  479
            KGKKGMAARQYQR  PPPLPK+EDDGNP+FVIFIRMA+V LWYP+N+VTGGTTAKIMVAA
Sbjct  53   KGKKGMAARQYQRTPPPPLPKIEDDGNPRFVIFIRMANVYLWYPINLVTGGTTAKIMVAA  112

Query  480  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  659
            KDNFLGKYIYKDTL RNLAAVIYRDEKE+QK+A KQ RVLR+ST+FRYGYKLVENNNLR 
Sbjct  113  KDNFLGKYIYKDTLDRNLAAVIYRDEKEIQKMAMKQHRVLRSSTEFRYGYKLVENNNLRA  172

Query  660  ALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ALS+ ++IELPRQEELKTVLDKVKDFFG AKESFG
Sbjct  173  ALSSNDVIELPRQEELKTVLDKVKDFFGDAKESFG  207



>gb|EPS68757.1| hypothetical protein M569_06012, partial [Genlisea aurea]
Length=223

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 169/214 (79%), Gaps = 10/214 (5%)
 Frame = +3

Query  132  MEVAMSFNSLVRLP---RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAK  302
            MEV MS NS+V LP    R   ED       +      ++ +   +       L+VVEAK
Sbjct  1    MEVGMSLNSVVALPLSSNRRTHEDYSLIRHSLFSGKVGSKKSCQQK-------LVVVEAK  53

Query  303  GKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAK  482
            GKKGM  RQYQRNAPPPLPKLEDDGNPKFVIFIRMA+V LWYPLNIV GGTTAKIMVAAK
Sbjct  54   GKKGMLPRQYQRNAPPPLPKLEDDGNPKFVIFIRMANVYLWYPLNIVNGGTTAKIMVAAK  113

Query  483  DNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  662
            DNFLGKYIYKDTLARNLAAVIY+DEKE++K+A KQFRVLR++TDFRYGYK+VENNNLR A
Sbjct  114  DNFLGKYIYKDTLARNLAAVIYKDEKEIRKMAVKQFRVLRSATDFRYGYKIVENNNLRAA  173

Query  663  LSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            L+  ++IELP Q+ELKTV DKVKDFFG AKESFG
Sbjct  174  LAANDVIELPTQDELKTVFDKVKDFFGDAKESFG  207



>gb|EYU25950.1| hypothetical protein MIMGU_mgv1a012571mg [Erythranthe guttata]
Length=246

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 175/218 (80%), Gaps = 7/218 (3%)
 Frame = +3

Query  132  MEVAMSFNSLVRLP------RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGR-LMV  290
            MEV MS N LVRLP       R   ED       +  + ++T  A  S   Q  G+ ++V
Sbjct  1    MEVGMSLNQLVRLPLSSKNGGRRTHEDYSLIRHSLFSTKTTTSAARKSIFGQNQGKSVLV  60

Query  291  VEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIM  470
            VEAKGKKGMA RQYQR APPPLPKL+DDGNPKFVIFIRMA+V LWYPLNIVTGGTTAKIM
Sbjct  61   VEAKGKKGMAERQYQRKAPPPLPKLDDDGNPKFVIFIRMANVYLWYPLNIVTGGTTAKIM  120

Query  471  VAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  650
            +AAKDNFLGKYIYKDTLARNLA+VIYRDEKE+QK+A K FRVLR++T+FRYGYK+VENNN
Sbjct  121  LAAKDNFLGKYIYKDTLARNLASVIYRDEKEIQKMAVKTFRVLRSATEFRYGYKIVENNN  180

Query  651  LRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +R AL+  ++IELP Q++LKTV+DKVKDFFG AKESFG
Sbjct  181  VRAALAANDVIELPTQDKLKTVVDKVKDFFGDAKESFG  218



>gb|EYU25951.1| hypothetical protein MIMGU_mgv1a012571mg [Erythranthe guttata]
Length=243

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 175/218 (80%), Gaps = 7/218 (3%)
 Frame = +3

Query  132  MEVAMSFNSLVRLP------RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGR-LMV  290
            MEV MS N LVRLP       R   ED       +  + ++T  A  S   Q  G+ ++V
Sbjct  1    MEVGMSLNQLVRLPLSSKNGGRRTHEDYSLIRHSLFSTKTTTSAARKSIFGQNQGKSVLV  60

Query  291  VEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIM  470
            VEAKGKKGMA RQYQR APPPLPKL+DDGNPKFVIFIRMA+V LWYPLNIVTGGTTAKIM
Sbjct  61   VEAKGKKGMAERQYQRKAPPPLPKLDDDGNPKFVIFIRMANVYLWYPLNIVTGGTTAKIM  120

Query  471  VAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  650
            +AAKDNFLGKYIYKDTLARNLA+VIYRDEKE+QK+A K FRVLR++T+FRYGYK+VENNN
Sbjct  121  LAAKDNFLGKYIYKDTLARNLASVIYRDEKEIQKMAVKTFRVLRSATEFRYGYKIVENNN  180

Query  651  LRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +R AL+  ++IELP Q++LKTV+DKVKDFFG AKESFG
Sbjct  181  VRAALAANDVIELPTQDKLKTVVDKVKDFFGDAKESFG  218



>ref|XP_009606772.1| PREDICTED: uncharacterized protein LOC104101068 [Nicotiana tomentosiformis]
Length=231

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 175/215 (81%), Gaps = 9/215 (4%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGR-LMVVEAK  302
            MEVAMS N LVRLP  N    ED       +      +RT    ++RQ  GR L+VVEAK
Sbjct  1    MEVAMSLNPLVRLPLSNSRTHEDFSIVKHSVFS----SRTTTTQKQRQLHGRRLLVVEAK  56

Query  303  GKKG-MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  479
            GKKG MAARQYQR APP +PK+EDDGNPKFVIF+RMA+V LWYPLNIVTGGTTAKIMVAA
Sbjct  57   GKKGGMAARQYQRMAPP-IPKIEDDGNPKFVIFVRMANVYLWYPLNIVTGGTTAKIMVAA  115

Query  480  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  659
            KDNFLGKYIYKDTLARNLAAVIY DEK +QKLA KQ RVL+++T+FRYGYKLVENNNLR 
Sbjct  116  KDNFLGKYIYKDTLARNLAAVIYNDEKNIQKLAMKQHRVLKSATEFRYGYKLVENNNLRA  175

Query  660  ALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ALSTT++IELP  ++LKTV+DKVKDFFG AKESFG
Sbjct  176  ALSTTDVIELPTPDQLKTVVDKVKDFFGDAKESFG  210



>ref|XP_006590262.1| PREDICTED: uncharacterized protein LOC100306628 isoform X1 [Glycine 
max]
Length=236

 Score =   297 bits (761),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 172/219 (79%), Gaps = 13/219 (6%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRN--------PMEDsgsssslirhsissTRTAVPSRKRQRVGRLM  287
            MEV MS N+LVRLP  N        PM    S  S  +         VP R +     + 
Sbjct  1    MEVGMSLNALVRLPLSNSRFHDDAAPMIIRHSLFSSRKQQQQQQSYKVPQRHQ-----VF  55

Query  288  VVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKI  467
            VVEAKGKKGM +RQ+QRNAPPPLPK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKI
Sbjct  56   VVEAKGKKGMMSRQFQRNAPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKI  115

Query  468  MVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENN  647
            MVAAKDNFLGKYIYKDTL RNLAAVIYRDEKE+QK A KQ+RVLR +TDFRYGYKLVEN 
Sbjct  116  MVAAKDNFLGKYIYKDTLDRNLAAVIYRDEKEVQKSAFKQYRVLRTATDFRYGYKLVENG  175

Query  648  NLRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            N+R ALSTT++IELP Q++LKTVLDKVKDFFG AKESFG
Sbjct  176  NIRAALSTTDVIELPTQDKLKTVLDKVKDFFGDAKESFG  214



>ref|NP_001237795.1| uncharacterized protein LOC100306628 [Glycine max]
 gb|ACU14904.1| unknown [Glycine max]
Length=239

 Score =   297 bits (760),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 172/219 (79%), Gaps = 13/219 (6%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRN--------PMEDsgsssslirhsissTRTAVPSRKRQRVGRLM  287
            MEV MS N+LVRLP  N        PM    S  S  +         VP R +     + 
Sbjct  1    MEVGMSLNALVRLPLSNSRFHDDAAPMIIRHSLFSSRKQQQQQQSYKVPQRHQ-----VF  55

Query  288  VVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKI  467
            VVEAKGKKGM +RQ+QRNAPPPLPK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKI
Sbjct  56   VVEAKGKKGMMSRQFQRNAPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKI  115

Query  468  MVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENN  647
            MVAAKDNFLGKYIYKDTL RNLAAVIYRDEKE+QK A KQ+RVLR +TDFRYGYKLVEN 
Sbjct  116  MVAAKDNFLGKYIYKDTLDRNLAAVIYRDEKEVQKSAFKQYRVLRTATDFRYGYKLVENG  175

Query  648  NLRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            N+R ALSTT++IELP Q++LKTVLDKVKDFFG AKESFG
Sbjct  176  NIRAALSTTDVIELPTQDKLKTVLDKVKDFFGDAKESFG  214



>gb|KHN44402.1| hypothetical protein glysoja_014443 [Glycine soja]
Length=279

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP-MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGK  308
            MEV MS N+LVRLP  N    D  +   +     SS +    S K  +  ++ VVEAKGK
Sbjct  1    MEVGMSLNALVRLPLSNSRFHDDAAPMIIRHSLFSSRKQQQQSYKVPQRHQVFVVEAKGK  60

Query  309  KGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  488
            KGM +RQ+QRNAPPPLPK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMVAAKDN
Sbjct  61   KGMMSRQFQRNAPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMVAAKDN  120

Query  489  FLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALS  668
            FLGKYIYKDTL RNLAAVIYRDEKE+QK A KQ+RVLR +TDFRYGYKLVEN N+R ALS
Sbjct  121  FLGKYIYKDTLDRNLAAVIYRDEKEVQKSAFKQYRVLRTATDFRYGYKLVENGNIRAALS  180

Query  669  TTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            TT++IELP Q++LKTVLDKVKDFFG AKESFG
Sbjct  181  TTDVIELPTQDKLKTVLDKVKDFFGDAKESFG  212



>ref|XP_009780030.1| PREDICTED: uncharacterized protein LOC104229142 [Nicotiana sylvestris]
Length=228

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 176/213 (83%), Gaps = 8/213 (4%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQ-RVGRLMVVEAKGK  308
            MEVAMS N LVRLP  N       +     HS+ STR     ++RQ   GRL+VVEAKGK
Sbjct  1    MEVAMSLNPLVRLPLSN-----SRTHEDFSHSVFSTRRTTQKKQRQLHGGRLLVVEAKGK  55

Query  309  KG-MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  485
            KG MAARQYQR APP +PK+EDDGNPKFVIF+RMA+V LWYPLNIVTGGTTAKIMVAAKD
Sbjct  56   KGGMAARQYQRMAPP-IPKIEDDGNPKFVIFVRMANVYLWYPLNIVTGGTTAKIMVAAKD  114

Query  486  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  665
            NFLGKYIYKDTLARNLAAVIY DEK +QKLA KQ RVL+++T+FRYGYKLVENNNLR AL
Sbjct  115  NFLGKYIYKDTLARNLAAVIYNDEKNIQKLAMKQHRVLKSATEFRYGYKLVENNNLRAAL  174

Query  666  STTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            STT++IELP  ++LKTV+DKVKDFFG AKESFG
Sbjct  175  STTDVIELPTPDQLKTVVDKVKDFFGDAKESFG  207



>ref|XP_010248828.1| PREDICTED: uncharacterized protein LOC104591617 [Nelumbo nucifera]
Length=223

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 171/209 (82%), Gaps = 10/209 (5%)
 Frame = +3

Query  144  MSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGM  317
            MS N+LVRLP  N    ED     SL              RK+Q   R++VV+AKGKKGM
Sbjct  1    MSLNALVRLPLSNSRSHEDLLVKHSLFSTGT--------GRKQQHRQRVLVVQAKGKKGM  52

Query  318  AARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLG  497
             ARQ+QR  PP LPK+EDDGNPKFVIFIRMA+V LWYPL+++TGGTTAKIMVAAKDNFLG
Sbjct  53   LARQFQRPPPPSLPKIEDDGNPKFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKDNFLG  112

Query  498  KYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTN  677
            KYIYKDT+ARNLAAVIYRDEKE+QK A +Q+RVLR++TDFRYGYKLVEN+N+R A+STT+
Sbjct  113  KYIYKDTIARNLAAVIYRDEKEIQKTAFRQYRVLRSTTDFRYGYKLVENSNVRAAISTTD  172

Query  678  IIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +IELPR+EELKTVLDKVKDFFG AKESFG
Sbjct  173  VIELPRKEELKTVLDKVKDFFGDAKESFG  201



>ref|XP_006341763.1| PREDICTED: uncharacterized protein LOC102591507 [Solanum tuberosum]
Length=230

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 174/212 (82%), Gaps = 9/212 (4%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEVAMS N LVRLP  N       S        ++ RT   ++KR    +L+VVEAKG+K
Sbjct  1    MEVAMSLNPLVRLPLSNSRNHEDFSLLKHSVVSTTRRT---TQKR----KLLVVEAKGRK  53

Query  312  G-MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  488
            G MAARQYQR APP +PK+EDDGNPKFVIFIRMA+V LWYPLNIVTGGTTAKIMVAAKDN
Sbjct  54   GGMAARQYQRMAPP-MPKIEDDGNPKFVIFIRMANVYLWYPLNIVTGGTTAKIMVAAKDN  112

Query  489  FLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALS  668
            FLGKYIYKDTLARNLAAVIY DEKE+QKLA KQ RVL+++T+FRYGYKLVENNNLR ALS
Sbjct  113  FLGKYIYKDTLARNLAAVIYNDEKEIQKLAMKQHRVLKSATEFRYGYKLVENNNLRAALS  172

Query  669  TTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            T+++IELP  ++LKTV+DKVKDFFG AKESFG
Sbjct  173  TSDVIELPTPDKLKTVVDKVKDFFGDAKESFG  204



>emb|CDY28870.1| BnaC06g26580D [Brassica napus]
Length=227

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 175/211 (83%), Gaps = 5/211 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ ++RT  P R+  + G + VVEAKGKK
Sbjct  1    MEVSMSLNALARLPLKN--TGRLEEVGLARHSLFTSRT--PCRESAKRGMVFVVEAKGKK  56

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  57   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  115

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  175

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTVLDKVKDFFG AKESFG
Sbjct  176  SDVIELPTQDQLKTVLDKVKDFFGDAKESFG  206



>ref|XP_007163718.1| hypothetical protein PHAVU_001G258300g [Phaseolus vulgaris]
 gb|ESW35712.1| hypothetical protein PHAVU_001G258300g [Phaseolus vulgaris]
Length=234

 Score =   290 bits (742),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 173/217 (80%), Gaps = 14/217 (6%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVG------RLMVV  293
            MEV MS N+L+RLP  N        S  + +     R ++ S +RQ          + VV
Sbjct  1    MEVGMSLNALLRLPPTN--------SRFLHNDDVPVRHSLVSNRRQHRSLKAPPRHVFVV  52

Query  294  EAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMV  473
            EAKGKKGM +RQ+QR+APPPLPK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMV
Sbjct  53   EAKGKKGMMSRQFQRSAPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMV  112

Query  474  AAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNL  653
            AAKDNFLGKYIYKDTL RNLAAVIY+DEKE+QK A KQ+RVLR +TDFRYGYKLVEN N+
Sbjct  113  AAKDNFLGKYIYKDTLDRNLAAVIYKDEKEVQKSAFKQYRVLRTATDFRYGYKLVENTNI  172

Query  654  RTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            R ALST+++IELP Q++LKTVLDKVKDFFG AKESFG
Sbjct  173  RAALSTSDVIELPTQDKLKTVLDKVKDFFGDAKESFG  209



>ref|XP_008444407.1| PREDICTED: uncharacterized protein LOC103487745 [Cucumis melo]
Length=231

 Score =   289 bits (739),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 171/211 (81%), Gaps = 5/211 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            M+VAMS N+LVRLP  N          L+RHS+ S RT        R  R  VVEAKGKK
Sbjct  1    MDVAMSLNALVRLPLSN---SKLHEDGLVRHSLFSARTMHKPEHTYR--RAFVVEAKGKK  55

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GM +R  QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+++ GGTTAKIMVAAKDNF
Sbjct  56   GMQSRLSQRPGPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSLINGGTTAKIMVAAKDNF  115

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDTLARNLAAVIYRDEKE+QK A KQFRVLR +T+FRYGYKLVEN NLR+ALST
Sbjct  116  LGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLRTATEFRYGYKLVENGNLRSALST  175

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            T++IELP Q++LKTVLDKVKDFFG AKESFG
Sbjct  176  TDVIELPTQDQLKTVLDKVKDFFGDAKESFG  206



>ref|XP_004142951.1| PREDICTED: protein HHL1, chloroplastic isoform X1 [Cucumis sativus]
 gb|KGN62348.1| hypothetical protein Csa_2G350310 [Cucumis sativus]
Length=231

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 170/213 (80%), Gaps = 9/213 (4%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  305
            MEVAMS N+LVRLP  N   +ED     SL        RT        R  R ++VEAKG
Sbjct  1    MEVAMSLNALVRLPLSNSKLLEDGVVRHSLFS-----ARTMHKPHHTYR--RPLLVEAKG  53

Query  306  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  485
            KKGM +R  QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+++ GGTTAKIMVAAKD
Sbjct  54   KKGMQSRLSQRPGPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSLINGGTTAKIMVAAKD  113

Query  486  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  665
            NF+GKYIYKDTLARNLAAVIYRDEKE+QK A KQFRVLR +T+FRYGYKLVEN NLR+AL
Sbjct  114  NFVGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLRTATEFRYGYKLVENGNLRSAL  173

Query  666  STTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            STT++IELP Q++LKTVLDKVKDFFG AK+SFG
Sbjct  174  STTDVIELPTQDQLKTVLDKVKDFFGDAKDSFG  206



>ref|XP_004142952.1| PREDICTED: protein HHL1, chloroplastic isoform X2 [Cucumis sativus]
Length=228

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 170/213 (80%), Gaps = 9/213 (4%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  305
            MEVAMS N+LVRLP  N   +ED     SL        RT        R  R ++VEAKG
Sbjct  1    MEVAMSLNALVRLPLSNSKLLEDGVVRHSLFS-----ARTMHKPHHTYR--RPLLVEAKG  53

Query  306  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  485
            KKGM +R  QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+++ GGTTAKIMVAAKD
Sbjct  54   KKGMQSRLSQRPGPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSLINGGTTAKIMVAAKD  113

Query  486  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  665
            NF+GKYIYKDTLARNLAAVIYRDEKE+QK A KQFRVLR +T+FRYGYKLVEN NLR+AL
Sbjct  114  NFVGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLRTATEFRYGYKLVENGNLRSAL  173

Query  666  STTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            STT++IELP Q++LKTVLDKVKDFFG AK+SFG
Sbjct  174  STTDVIELPTQDQLKTVLDKVKDFFGDAKDSFG  206



>emb|CDY07411.1| BnaA07g24900D [Brassica napus]
Length=227

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 174/211 (82%), Gaps = 5/211 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ ++RT  P R+  +   + VVEAKGKK
Sbjct  1    MEVSMSLNALARLPLKN--TGRLEEVGLARHSLFTSRT--PCRESTKRRMVFVVEAKGKK  56

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  57   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  115

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  175

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTVLDKVKDFFG AKESFG
Sbjct  176  SDVIELPTQDQLKTVLDKVKDFFGDAKESFG  206



>ref|XP_009105106.1| PREDICTED: uncharacterized protein LOC103831017 [Brassica rapa]
Length=249

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 175/213 (82%), Gaps = 5/213 (2%)
 Frame = +3

Query  126  QKMEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  305
            + MEV+MS N+L RLP +N          L RHS+ ++RT  P R+  +   + VVEAKG
Sbjct  21   RSMEVSMSLNALARLPLKN--TGRLEEVGLARHSLFTSRT--PCRESTKRRMVFVVEAKG  76

Query  306  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  485
            KKGMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKD
Sbjct  77   KKGMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKD  135

Query  486  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  665
            N LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R AL
Sbjct  136  NLLGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAAL  195

Query  666  STTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ST+++IELP Q++LKTVLDKVKDFFG AKESFG
Sbjct  196  STSDVIELPTQDQLKTVLDKVKDFFGDAKESFG  228



>ref|XP_010690008.1| PREDICTED: uncharacterized protein LOC104903638 [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 174/211 (82%), Gaps = 2/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS NSL+RLP ++        +S+IRHS+ STR   P    Q++    VVEAKGKK
Sbjct  1    MEVSMSLNSLIRLPMKSKSRTVDEYTSIIRHSLHSTRPKFPKNLHQKLQ--FVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GM  RQ+QR  PPPLPK+EDDGNP+FVIFIRMA+V LWYPLN+VTGGTTAKIMVAAKDN 
Sbjct  59   GMMTRQFQRPGPPPLPKIEDDGNPRFVIFIRMANVYLWYPLNLVTGGTTAKIMVAAKDNI  118

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARNLAAV+Y+DEK L K+A+KQFR LR +TDFRYGYKLVEN ++RTAL+ 
Sbjct  119  LGKYIYKDTIARNLAAVVYQDEKGLIKIAQKQFRTLRTATDFRYGYKLVENADVRTALTP  178

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
             ++IELP Q++LKTV+DKVKDFFG AKESFG
Sbjct  179  KDVIELPTQDQLKTVVDKVKDFFGDAKESFG  209



>ref|XP_010415348.1| PREDICTED: uncharacterized protein LOC104701376 isoform X1 [Camelina 
sativa]
Length=231

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 172/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N            RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGSARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  178  SDVIELPTQDQLKTVFDKVKDYFGDAKESFG  208



>ref|XP_004239174.1| PREDICTED: uncharacterized protein LOC101256588 [Solanum lycopersicum]
Length=226

 Score =   287 bits (734),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 174/214 (81%), Gaps = 13/214 (6%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGR--LMVVEAKG  305
            MEVAMS N LVRLP  N         S      S  + +V S   +R+ +  L+VVEAKG
Sbjct  1    MEVAMSLNPLVRLPLSN---------SRTHEEFSVLKHSVVSTTNRRIQKRKLLVVEAKG  51

Query  306  KKG-MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAK  482
            +KG MAARQYQR APP +PK+EDDGNPKFVIFIRMA+V LWYPLNI+TGGTTAKIMVAAK
Sbjct  52   RKGGMAARQYQRMAPP-MPKIEDDGNPKFVIFIRMANVYLWYPLNIITGGTTAKIMVAAK  110

Query  483  DNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  662
            DNFLGKYIYKDTLARNLAAVIY DEKE++KLA KQ RVL+++T+FRYGYKLVENNNLR A
Sbjct  111  DNFLGKYIYKDTLARNLAAVIYNDEKEIKKLAMKQHRVLKSATEFRYGYKLVENNNLRAA  170

Query  663  LSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            LST+++IELP  ++LKTV+DKVKDFFG AKESFG
Sbjct  171  LSTSDVIELPTPDKLKTVVDKVKDFFGDAKESFG  204



>ref|XP_010415350.1| PREDICTED: uncharacterized protein LOC104701376 isoform X2 [Camelina 
sativa]
Length=230

 Score =   287 bits (734),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 172/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N            RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGSARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  178  SDVIELPTQDQLKTVFDKVKDYFGDAKESFG  208



>gb|KJB78038.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
 gb|KJB78039.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
Length=237

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 178/217 (82%), Gaps = 6/217 (3%)
 Frame = +3

Query  132  MEVAMSFNSLVRLP----RRNPMEDsgsssslirhsissTRTAVP--SRKRQRVGRLMVV  293
            MEV MS N+LVRLP     R   E           S  +T   +P  +R+RQ  G ++VV
Sbjct  1    MEVGMSLNALVRLPLSSTSRAHHEPVDGLVKHSLLSSRTTPLRLPQQTRRRQHGGGMLVV  60

Query  294  EAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMV  473
            EAKGKKGMAARQ+QR  PPPLPK+EDDGNP+FVIFIRMA+V+LWYPL+++TGGTTAKIMV
Sbjct  61   EAKGKKGMAARQFQRPPPPPLPKIEDDGNPRFVIFIRMANVNLWYPLSLITGGTTAKIMV  120

Query  474  AAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNL  653
            AAKDNFLGKYIYKDT+ARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN N+
Sbjct  121  AAKDNFLGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNV  180

Query  654  RTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ++ALST ++IELP Q++LKTV+DKVKDFFG AKESFG
Sbjct  181  KSALSTNDVIELPTQDQLKTVVDKVKDFFGDAKESFG  217



>gb|KJB78040.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
 gb|KJB78041.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
Length=241

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 178/217 (82%), Gaps = 6/217 (3%)
 Frame = +3

Query  132  MEVAMSFNSLVRLP----RRNPMEDsgsssslirhsissTRTAVP--SRKRQRVGRLMVV  293
            MEV MS N+LVRLP     R   E           S  +T   +P  +R+RQ  G ++VV
Sbjct  1    MEVGMSLNALVRLPLSSTSRAHHEPVDGLVKHSLLSSRTTPLRLPQQTRRRQHGGGMLVV  60

Query  294  EAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMV  473
            EAKGKKGMAARQ+QR  PPPLPK+EDDGNP+FVIFIRMA+V+LWYPL+++TGGTTAKIMV
Sbjct  61   EAKGKKGMAARQFQRPPPPPLPKIEDDGNPRFVIFIRMANVNLWYPLSLITGGTTAKIMV  120

Query  474  AAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNL  653
            AAKDNFLGKYIYKDT+ARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN N+
Sbjct  121  AAKDNFLGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNV  180

Query  654  RTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ++ALST ++IELP Q++LKTV+DKVKDFFG AKESFG
Sbjct  181  KSALSTNDVIELPTQDQLKTVVDKVKDFFGDAKESFG  217



>ref|NP_564903.3| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8LDL0.1|HHL1_ARATH RecName: Full=Protein HHL1, chloroplastic; AltName: Full=Hypersensitive 
to high light 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM63154.1| unknown [Arabidopsis thaliana]
 dbj|BAH19661.1| AT1G67700 [Arabidopsis thaliana]
 gb|AEE34684.1| uncharacterized protein AT1G67700 [Arabidopsis thaliana]
Length=231

 Score =   286 bits (733),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 172/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGLARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  177

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  178  SDVIELPTQDQLKTVFDKVKDYFGDAKESFG  208



>gb|KDP26738.1| hypothetical protein JCGZ_17896 [Jatropha curcas]
Length=226

 Score =   286 bits (732),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 174/211 (82%), Gaps = 5/211 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV +S N+LVRLP  N          L++HS+ ++RT   S+ R+    L+VV AKGK+
Sbjct  1    MEVGLSLNALVRLPLSN--SSRTHEDVLVKHSLFTSRTGQKSQHRKT---LLVVNAKGKR  55

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GM ARQ+QR   P LPK+EDDGNPKF+IFIRMA+V LWYPL++VTGGTTAKI VAAKDNF
Sbjct  56   GMQARQFQRPPAPSLPKIEDDGNPKFLIFIRMANVYLWYPLSLVTGGTTAKITVAAKDNF  115

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATEFRYGYKLVENGNMRAALST  175

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP +++LKTV DKVKDFFGGAKESFG
Sbjct  176  SDVIELPTEDQLKTVFDKVKDFFGGAKESFG  206



>ref|NP_850972.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK91348.1| At1g67700/F12A21_30 [Arabidopsis thaliana]
 gb|AAM51570.1| At1g67700/F12A21_30 [Arabidopsis thaliana]
 gb|AEE34683.1| uncharacterized protein AT1G67700 [Arabidopsis thaliana]
Length=230

 Score =   286 bits (732),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 172/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGLARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  177

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  178  SDVIELPTQDQLKTVFDKVKDYFGDAKESFG  208



>emb|CDX96071.1| BnaA07g26600D [Brassica napus]
Length=228

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 174/211 (82%), Gaps = 5/211 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ ++RT    R ++R  + +VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKN--TGRLEEFGLARHSLFTSRTPCLERAQRR--KALVVEAKGKK  56

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  57   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  115

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  175

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKDFFG AKESFG
Sbjct  176  SDVIELPTQDQLKTVFDKVKDFFGDAKESFG  206



>ref|XP_010511722.1| PREDICTED: uncharacterized protein LOC104787786 isoform X1 [Camelina 
sativa]
Length=231

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 173/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEGGLARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  178  SDVIELPTQDQLKTVFDKVKDYFGDAKESFG  208



>ref|XP_009105311.1| PREDICTED: uncharacterized protein LOC103831192 isoform X2 [Brassica 
rapa]
Length=228

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 174/211 (82%), Gaps = 5/211 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ ++RT    R ++R  + +VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKN--TGRLEEFGLARHSLFTSRTPCLERAQRR--KALVVEAKGKK  56

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  57   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  115

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  175

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKDFFG AKESFG
Sbjct  176  SDVIELPTQDQLKTVFDKVKDFFGDAKESFG  206



>ref|XP_012085594.1| PREDICTED: protein HHL1, chloroplastic [Jatropha curcas]
Length=229

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 174/211 (82%), Gaps = 5/211 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV +S N+LVRLP  N          L++HS+ ++RT   S+ R+    L+VV AKGK+
Sbjct  1    MEVGLSLNALVRLPLSN--SSRTHEDVLVKHSLFTSRTGQKSQHRKT---LLVVNAKGKR  55

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GM ARQ+QR   P LPK+EDDGNPKF+IFIRMA+V LWYPL++VTGGTTAKI VAAKDNF
Sbjct  56   GMQARQFQRPPAPSLPKIEDDGNPKFLIFIRMANVYLWYPLSLVTGGTTAKITVAAKDNF  115

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATEFRYGYKLVENGNMRAALST  175

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP +++LKTV DKVKDFFGGAKESFG
Sbjct  176  SDVIELPTEDQLKTVFDKVKDFFGGAKESFG  206



>ref|XP_010511723.1| PREDICTED: uncharacterized protein LOC104787786 isoform X2 [Camelina 
sativa]
Length=230

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 173/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEGGLARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  178  SDVIELPTQDQLKTVFDKVKDYFGDAKESFG  208



>ref|XP_009105310.1| PREDICTED: uncharacterized protein LOC103831192 isoform X1 [Brassica 
rapa]
Length=231

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 174/211 (82%), Gaps = 5/211 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ ++RT    R ++R  + +VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKN--TGRLEEFGLARHSLFTSRTPCLERAQRR--KALVVEAKGKK  56

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  57   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  115

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  175

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKDFFG AKESFG
Sbjct  176  SDVIELPTQDQLKTVFDKVKDFFGDAKESFG  206



>ref|XP_006302772.1| hypothetical protein CARUB_v10020893mg [Capsella rubella]
 gb|EOA35670.1| hypothetical protein CARUB_v10020893mg [Capsella rubella]
Length=231

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 172/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+     VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGLARHSLFSSRTACRETAVQQRRMAFVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  178  SDVIELPTQDQLKTVFDKVKDYFGDAKESFG  208



>ref|XP_010470685.1| PREDICTED: uncharacterized protein LOC104750573 isoform X1 [Camelina 
sativa]
Length=231

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 172/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q    + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKN--TGRFEEVGLARHSLFSSRTACRETAVQPRRMVFVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  178  SDVIELPTQDQLKTVFDKVKDYFGNAKESFG  208



>ref|XP_011042325.1| PREDICTED: uncharacterized protein LOC105138036 [Populus euphratica]
Length=237

 Score =   285 bits (730),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 175/215 (81%), Gaps = 4/215 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTR--TAVPSRKRQRVGR-LMVVEAK  302
            MEV MS N+LVRLP    M        L++HS+ STR  TA  S K+Q  G  L+VV+AK
Sbjct  1    MEVGMSLNALVRLPSSRTMSPHEDGGGLVKHSLFSTRKSTAQTSPKKQGQGHMLLVVKAK  60

Query  303  GKKGMAARQYQRNAP-PPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  479
            GKKG+  RQ+QR  P P LPK+EDDGNPKF+IFIR A+V LWYPL+++TGGTTAKIMVAA
Sbjct  61   GKKGIQTRQFQRPPPTPSLPKIEDDGNPKFLIFIRAANVYLWYPLSLITGGTTAKIMVAA  120

Query  480  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  659
            KDNFLGKYIYKDTLARNLAAVIY+DEKE+QK A KQ RVLR++T+FRYGYKLVEN NLR 
Sbjct  121  KDNFLGKYIYKDTLARNLAAVIYKDEKEIQKTAFKQHRVLRSATEFRYGYKLVENGNLRA  180

Query  660  ALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ALS T++IELP Q++LKTVLDKVKDFFG AKESFG
Sbjct  181  ALSITDVIELPTQDKLKTVLDKVKDFFGDAKESFG  215



>ref|XP_010470686.1| PREDICTED: uncharacterized protein LOC104750573 isoform X2 [Camelina 
sativa]
Length=230

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 172/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q    + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKN--TGRFEEVGLARHSLFSSRTACRETAVQPRRMVFVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  178  SDVIELPTQDQLKTVFDKVKDYFGNAKESFG  208



>ref|XP_002314565.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
 ref|XP_006378275.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
 gb|ABK95743.1| unknown [Populus trichocarpa]
 gb|EEF00736.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
 gb|ERP56072.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
Length=237

 Score =   285 bits (728),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 177/217 (82%), Gaps = 8/217 (4%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTR--TAVPSRKRQRVGR-LMVVEAK  302
            MEV MS N+LVRLP    M        L++H++ STR  TA  S K+Q  G  L+VV+AK
Sbjct  1    MEVGMSLNALVRLPSSRTMLLHEDGGGLLKHTLFSTRKSTAQTSPKKQGQGHMLLVVKAK  60

Query  303  GKKGMAARQYQRNAPPP---LPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMV  473
            GKKGM  RQ+QR  PPP   LPK+EDDGNPKF+IFIR+A+V LWYPL+++TGGTTAKIMV
Sbjct  61   GKKGMQTRQFQR--PPPTLSLPKIEDDGNPKFLIFIRVANVYLWYPLSLITGGTTAKIMV  118

Query  474  AAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNL  653
            AAKDNFLGKYIYKDTLARNLAAVIY+DEKE+QK A KQ RVLR++T+FRYGYKLVEN NL
Sbjct  119  AAKDNFLGKYIYKDTLARNLAAVIYKDEKEIQKTAFKQHRVLRSATEFRYGYKLVENGNL  178

Query  654  RTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            R ALS T++IELP Q++LKTVLDKVKDFFG AKESFG
Sbjct  179  RAALSITDVIELPTQDKLKTVLDKVKDFFGDAKESFG  215



>ref|XP_006438139.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 ref|XP_006438140.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 gb|ESR51379.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 gb|ESR51380.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
Length=226

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 172/207 (83%), Gaps = 3/207 (1%)
 Frame = +3

Query  144  MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  323
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+GM A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGMQA  57

Query  324  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  503
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  504  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNII  683
            IYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++I
Sbjct  118  IYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVI  177

Query  684  ELPRQEELKTVLDKVKDFFGGAKESFG  764
            ELP  ++LKTVLDKVKDFFG AKESFG
Sbjct  178  ELPTPDKLKTVLDKVKDFFGDAKESFG  204



>ref|XP_006438141.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 gb|ESR51381.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
Length=227

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 172/207 (83%), Gaps = 3/207 (1%)
 Frame = +3

Query  144  MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  323
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+GM A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGMQA  57

Query  324  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  503
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  504  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNII  683
            IYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++I
Sbjct  118  IYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVI  177

Query  684  ELPRQEELKTVLDKVKDFFGGAKESFG  764
            ELP  ++LKTVLDKVKDFFG AKESFG
Sbjct  178  ELPTPDKLKTVLDKVKDFFGDAKESFG  204



>gb|KHG12697.1| Multidrug resistance pgp-1 [Gossypium arboreum]
Length=237

 Score =   284 bits (727),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 178/218 (82%), Gaps = 8/218 (4%)
 Frame = +3

Query  132  MEVAMSFNSLVRLP-------RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMV  290
            MEV MS N+LVRLP          P+ D     SL     ++ R    +R+++  G ++V
Sbjct  1    MEVGMSLNALVRLPLSSTSRAHHEPV-DGLVKHSLFSSRTTTLRLPQQTRRQKHGGGMLV  59

Query  291  VEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIM  470
            VEAKGKKGMAARQ+QR  PPPLPK+EDDGNP+FVIFIRMA+V+LWYPL+++TGGTTAKIM
Sbjct  60   VEAKGKKGMAARQFQRPPPPPLPKIEDDGNPRFVIFIRMANVNLWYPLSLITGGTTAKIM  119

Query  471  VAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  650
            VAAKDNFLGKYIYKDT+ARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN N
Sbjct  120  VAAKDNFLGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGN  179

Query  651  LRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ++ ALST ++IELP Q++LKTV+DKVKDFFG AKESFG
Sbjct  180  VKAALSTNDVIELPTQDQLKTVVDKVKDFFGDAKESFG  217



>ref|XP_008807203.1| PREDICTED: uncharacterized protein LOC103719642 [Phoenix dactylifera]
Length=235

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 168/215 (78%), Gaps = 5/215 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEVAMS   L RLP  N  +     + +   S    R     R+ ++  +LMVVEAKGKK
Sbjct  1    MEVAMSVRGLARLPLSNS-KVIAHENGVFLGSPLPLRNPTSRRQSEKKRQLMVVEAKGKK  59

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GM  RQ+QR  PP LPK+EDDGNP+FVIFIR  +V LWYPL+++TGGTTAKIMVAAKDNF
Sbjct  60   GMMGRQFQRPPPPALPKIEDDGNPRFVIFIRTTNVYLWYPLSLITGGTTAKIMVAAKDNF  119

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARNLAAVIYRDEKE+QK A KQ+RVLR++T FRYGYKLVENNNLR ALST
Sbjct  120  LGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQYRVLRSATAFRYGYKLVENNNLRAALST  179

Query  672  TNIIELPRQEELKTVLDKVKDFFG----GAKESFG  764
             ++IELP QEELKTVLDKVKDFFG    GAKESFG
Sbjct  180  NDVIELPTQEELKTVLDKVKDFFGDAASGAKESFG  214



>gb|KDO82054.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
 gb|KDO82055.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=226

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 172/207 (83%), Gaps = 3/207 (1%)
 Frame = +3

Query  144  MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  323
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+G+ A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGLQA  57

Query  324  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  503
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  504  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNII  683
            IYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++I
Sbjct  118  IYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVI  177

Query  684  ELPRQEELKTVLDKVKDFFGGAKESFG  764
            ELP  ++LKTVLDKVKDFFG AKESFG
Sbjct  178  ELPTPDKLKTVLDKVKDFFGDAKESFG  204



>ref|XP_006484021.1| PREDICTED: uncharacterized protein LOC102611015 [Citrus sinensis]
 gb|KDO82052.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=227

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 172/207 (83%), Gaps = 3/207 (1%)
 Frame = +3

Query  144  MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  323
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+G+ A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGLQA  57

Query  324  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  503
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  504  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNII  683
            IYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++I
Sbjct  118  IYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVI  177

Query  684  ELPRQEELKTVLDKVKDFFGGAKESFG  764
            ELP  ++LKTVLDKVKDFFG AKESFG
Sbjct  178  ELPTPDKLKTVLDKVKDFFGDAKESFG  204



>ref|XP_006391234.1| hypothetical protein EUTSA_v10019020mg [Eutrema salsugineum]
 gb|ESQ28520.1| hypothetical protein EUTSA_v10019020mg [Eutrema salsugineum]
Length=259

 Score =   283 bits (724),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 174/214 (81%), Gaps = 9/214 (4%)
 Frame = +3

Query  129  KMEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAK  302
            KMEV+MS N+L RLP +N   +E++G +   +  S ++ R +V  R       + VVEAK
Sbjct  28   KMEVSMSLNALARLPLKNTGRLEEAGLARHSLFTSRTACRESVQRRM------VFVVEAK  81

Query  303  GKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAK  482
            GKKGMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAK
Sbjct  82   GKKGMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAK  140

Query  483  DNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  662
            DN LGKYIYKDT+ARN+AAVIY+DEKE+QK A KQ RVLR + +FRYGYKLVEN N+R A
Sbjct  141  DNLLGKYIYKDTIARNIAAVIYKDEKEIQKTAIKQHRVLRTAKEFRYGYKLVENGNMRAA  200

Query  663  LSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            LST+++IELP  ++LKTVLDKVKDFFG AKESFG
Sbjct  201  LSTSDVIELPTPDQLKTVLDKVKDFFGDAKESFG  234



>ref|XP_011457438.1| PREDICTED: uncharacterized protein LOC101291014 [Fragaria vesca 
subsp. vesca]
Length=230

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 168/212 (79%), Gaps = 6/212 (3%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAV-PSRKRQRVGRLMVVEAKGK  308
            MEV MS N++VRLP  +              +  +T+ A  PS      G+ +VVEAKGK
Sbjct  1    MEVGMSLNAVVRLPLSSSRTHEDGLVRHSLVTSKTTQKACKPSH-----GQTLVVEAKGK  55

Query  309  KGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  488
            KGM  RQ+QR  PPP+PK+EDDGNP+FV+FIRMA+V LWYPL++++GGTTAKIM+AAKDN
Sbjct  56   KGMQDRQFQRRQPPPMPKIEDDGNPRFVVFIRMANVYLWYPLSVISGGTTAKIMLAAKDN  115

Query  489  FLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALS  668
            FLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++T+FRYGYK+VEN N+R AL+
Sbjct  116  FLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATEFRYGYKIVENGNMRAALA  175

Query  669  TTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            T+++IELP  ++L+T  DKVKDFFG AKESFG
Sbjct  176  TSDVIELPTPDQLRTTFDKVKDFFGDAKESFG  207



>ref|XP_010556180.1| PREDICTED: uncharacterized protein LOC104825532 isoform X1 [Tarenaya 
hassleriana]
Length=234

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 175/216 (81%), Gaps = 10/216 (5%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissT---RTAVPSRKRQRVGRLMVVE  296
            MEV MS N+LV+LP RN   +ED G        +   T    +A P R+R      +VVE
Sbjct  1    MEVGMSLNALVQLPLRNSGRLEDGGGFVKHHCLAGWRTGFRDSAAPRRRRG-----LVVE  55

Query  297  AKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVA  476
            AKGKKGMAARQYQR  PPPLPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVA
Sbjct  56   AKGKKGMAARQYQRPPPPPLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVA  115

Query  477  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLR  656
            AKDN LGKYIYKDT+ARNLAAVIY+DEKE+QK A KQFRVLR +T+FRYGYKLVEN N+R
Sbjct  116  AKDNLLGKYIYKDTIARNLAAVIYKDEKEIQKTAFKQFRVLRNATEFRYGYKLVENGNVR  175

Query  657  TALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
             AL+TT++IELP Q++LKTV+DKVKDFFG AKESFG
Sbjct  176  AALTTTDVIELPTQDKLKTVVDKVKDFFGDAKESFG  211



>ref|XP_010556182.1| PREDICTED: uncharacterized protein LOC104825532 isoform X2 [Tarenaya 
hassleriana]
Length=233

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 175/216 (81%), Gaps = 10/216 (5%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissT---RTAVPSRKRQRVGRLMVVE  296
            MEV MS N+LV+LP RN   +ED G        +   T    +A P R+R      +VVE
Sbjct  1    MEVGMSLNALVQLPLRNSGRLEDGGGFVKHHCLAGWRTGFRDSAAPRRRRG-----LVVE  55

Query  297  AKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVA  476
            AKGKKGMAARQYQR  PPPLPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVA
Sbjct  56   AKGKKGMAARQYQRPPPPPLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVA  115

Query  477  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLR  656
            AKDN LGKYIYKDT+ARNLAAVIY+DEKE+QK A KQFRVLR +T+FRYGYKLVEN N+R
Sbjct  116  AKDNLLGKYIYKDTIARNLAAVIYKDEKEIQKTAFKQFRVLRNATEFRYGYKLVENGNVR  175

Query  657  TALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
             AL+TT++IELP Q++LKTV+DKVKDFFG AKESFG
Sbjct  176  AALTTTDVIELPTQDKLKTVVDKVKDFFGDAKESFG  211



>ref|NP_001185346.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE34685.1| uncharacterized protein AT1G67700 [Arabidopsis thaliana]
Length=229

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 171/211 (81%), Gaps = 4/211 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGLARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKL EN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKL-ENGNMRAALST  176

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  177  SDVIELPTQDQLKTVFDKVKDYFGDAKESFG  207



>ref|XP_002515011.1| oligopeptidase, putative [Ricinus communis]
 gb|EEF47565.1| oligopeptidase, putative [Ricinus communis]
Length=233

 Score =   279 bits (714),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 173/211 (82%), Gaps = 2/211 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV +S N+LVRLP  N          + +H++ STRT V  +K  +   L+VV+AKGK+
Sbjct  1    MEVGLSLNALVRLPLSNSSR-IHHEDGVAKHTLFSTRT-VTLQKSLKKQTLLVVKAKGKR  58

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GM +RQ+QR   P LPK+EDDGNPKF+IFIRMA+V LWYPL++VTGGTTAKIMVAAKDNF
Sbjct  59   GMQSRQFQRPPAPSLPKIEDDGNPKFLIFIRMANVYLWYPLSLVTGGTTAKIMVAAKDNF  118

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGKYIYK+TL RNLAAVIYRDEKE+QK A KQFRVLR++T+FRYGYKLVEN N+R ALST
Sbjct  119  LGKYIYKNTLDRNLAAVIYRDEKEIQKTAFKQFRVLRSATEFRYGYKLVENGNVRAALST  178

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            T++IELP  ++LKTV+DKVKDFFG AKESFG
Sbjct  179  TDVIELPTPDQLKTVVDKVKDFFGDAKESFG  209



>ref|XP_002272215.2| PREDICTED: uncharacterized protein LOC100256260 isoform X1 [Vitis 
vinifera]
Length=229

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 174/210 (83%), Gaps = 9/210 (4%)
 Frame = +3

Query  138  VAMSFNS-LVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKG  314
            V +S N+ LVR P  N      S    I+HSI STRT   S+K+    R +VVEAKGK+G
Sbjct  4    VGLSLNAALVRTPLSN---SRASEDGFIKHSIFSTRTVPKSQKK----RALVVEAKGKRG  56

Query  315  MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFL  494
            M  RQ+QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+++TGGTTAKIMVAAKDNFL
Sbjct  57   MQGRQFQRQ-PPPLPKIEDDGNPKFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKDNFL  115

Query  495  GKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTT  674
            GKYIY+DT+ARNLAAVIY+DEKE+QK A +Q+RVLR++ +FRYGYKLVENNN+R+ALSTT
Sbjct  116  GKYIYRDTIARNLAAVIYKDEKEIQKTAFRQYRVLRSAKEFRYGYKLVENNNVRSALSTT  175

Query  675  NIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ++IELP Q ELKTVLDKV+DFFG AKESFG
Sbjct  176  DVIELPTQGELKTVLDKVRDFFGDAKESFG  205



>ref|XP_010655080.1| PREDICTED: uncharacterized protein LOC100256260 isoform X2 [Vitis 
vinifera]
Length=226

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 174/210 (83%), Gaps = 9/210 (4%)
 Frame = +3

Query  138  VAMSFNS-LVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKG  314
            V +S N+ LVR P  N      S    I+HSI STRT   S+K+    R +VVEAKGK+G
Sbjct  4    VGLSLNAALVRTPLSN---SRASEDGFIKHSIFSTRTVPKSQKK----RALVVEAKGKRG  56

Query  315  MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFL  494
            M  RQ+QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+++TGGTTAKIMVAAKDNFL
Sbjct  57   MQGRQFQRQ-PPPLPKIEDDGNPKFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKDNFL  115

Query  495  GKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTT  674
            GKYIY+DT+ARNLAAVIY+DEKE+QK A +Q+RVLR++ +FRYGYKLVENNN+R+ALSTT
Sbjct  116  GKYIYRDTIARNLAAVIYKDEKEIQKTAFRQYRVLRSAKEFRYGYKLVENNNVRSALSTT  175

Query  675  NIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ++IELP Q ELKTVLDKV+DFFG AKESFG
Sbjct  176  DVIELPTQGELKTVLDKVRDFFGDAKESFG  205



>ref|XP_009403641.1| PREDICTED: uncharacterized protein LOC103987153 [Musa acuminata 
subsp. malaccensis]
Length=234

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 166/213 (78%), Gaps = 6/213 (3%)
 Frame = +3

Query  144  MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGR-LMVVEAKGKKGM-  317
            MS  SLVRLP  NP        +      S   +     KRQ+  R L+VVEAKGK+GM 
Sbjct  1    MSMGSLVRLPTCNPKGALLQEDARFFLRGSPLASVTTGNKRQQRRRNLLVVEAKGKRGMM  60

Query  318  AARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLG  497
            A RQ QR  PP LPK+EDDGNP+FV+FIR ++V LWYPL+I++GGTTAKIMVAAKDNFLG
Sbjct  61   AGRQSQRPPPPRLPKIEDDGNPRFVVFIRTSNVYLWYPLSIISGGTTAKIMVAAKDNFLG  120

Query  498  KYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTN  677
            KYIYKDT+ARN+AAVIYRDEKE+QK A KQ+RVLR++T FRYGYKLVENNNLR A+ST+N
Sbjct  121  KYIYKDTIARNIAAVIYRDEKEIQKTAVKQYRVLRSATSFRYGYKLVENNNLRAAISTSN  180

Query  678  IIELPRQEELKTVLDKVKDFFGG----AKESFG  764
            +IELP QEELKTVLDKVKDFFG     AKESFG
Sbjct  181  VIELPTQEELKTVLDKVKDFFGNATSDAKESFG  213



>ref|XP_007044959.1| Uncharacterized protein TCM_010707 [Theobroma cacao]
 gb|EOY00791.1| Uncharacterized protein TCM_010707 [Theobroma cacao]
Length=258

 Score =   275 bits (704),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 176/233 (76%), Gaps = 22/233 (9%)
 Frame = +3

Query  132  MEVAMSFNSLVRLP----RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEA  299
            MEV MS N+LVRLP     R   E           S  +T     S++RQ+ G ++VVEA
Sbjct  1    MEVGMSLNALVRLPLSSTSRTHHESLDGLVKHSLFSSRTTTWQQQSQRRQQRGGMLVVEA  60

Query  300  KGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  479
            KGKKGMAARQ+QR  PPP+PK+EDDGNP+FVIFIRMA V+LWYPL+++TGGTTAKIMVAA
Sbjct  61   KGKKGMAARQFQRPPPPPMPKIEDDGNPRFVIFIRMAGVNLWYPLSLITGGTTAKIMVAA  120

Query  480  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV-------  638
            KDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++TDFRYGYKLV       
Sbjct  121  KDNFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATDFRYGYKLVMMEKFAN  180

Query  639  -----------ENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
                       EN N+R+ALST ++IELP Q++LKTVLDKVKDFFG AK+SFG
Sbjct  181  SFSEFCVLNIQENGNVRSALSTNDVIELPTQDQLKTVLDKVKDFFGDAKDSFG  233



>ref|XP_010930033.1| PREDICTED: uncharacterized protein LOC105051352 isoform X2 [Elaeis 
guineensis]
Length=235

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 169/218 (78%), Gaps = 11/218 (5%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP---MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAK  302
            MEVAMS  +L RLP  N      ++G          S T   V  +KRQ    LMVVEAK
Sbjct  1    MEVAMSVRALARLPLSNSKVTAHENGVFLGSPLPLRSQTSRRVSEKKRQ----LMVVEAK  56

Query  303  GKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAK  482
            GK+GM ARQ+QR  PPPLPK+EDDGNP+FVIFIR   V LWYPL++VTGGTTAKIMVAAK
Sbjct  57   GKRGMMARQFQRPPPPPLPKIEDDGNPRFVIFIRTTKVYLWYPLSVVTGGTTAKIMVAAK  116

Query  483  DNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  662
            DNFLGKYIYKDT+ARNLAAVIYRDEKE+QK A KQ+RVLR++T FRYGYKL+ENNNLR A
Sbjct  117  DNFLGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQYRVLRSATAFRYGYKLIENNNLRAA  176

Query  663  LSTTNIIELPRQEELKTVLDKVKDFF----GGAKESFG  764
            +ST ++IELP QEELKTVLDKVKDF     GGAKESFG
Sbjct  177  ISTNDVIELPTQEELKTVLDKVKDFVGNAAGGAKESFG  214



>ref|XP_010930032.1| PREDICTED: uncharacterized protein LOC105051352 isoform X1 [Elaeis 
guineensis]
Length=237

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 169/220 (77%), Gaps = 13/220 (6%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP---MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAK  302
            MEVAMS  +L RLP  N      ++G          S T   V  +KRQ    LMVVEAK
Sbjct  1    MEVAMSVRALARLPLSNSKVTAHENGVFLGSPLPLRSQTSRRVSEKKRQ----LMVVEAK  56

Query  303  GKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVD--LWYPLNIVTGGTTAKIMVA  476
            GK+GM ARQ+QR  PPPLPK+EDDGNP+FVIFIR   V   LWYPL++VTGGTTAKIMVA
Sbjct  57   GKRGMMARQFQRPPPPPLPKIEDDGNPRFVIFIRTTKVSVYLWYPLSVVTGGTTAKIMVA  116

Query  477  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLR  656
            AKDNFLGKYIYKDT+ARNLAAVIYRDEKE+QK A KQ+RVLR++T FRYGYKL+ENNNLR
Sbjct  117  AKDNFLGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQYRVLRSATAFRYGYKLIENNNLR  176

Query  657  TALSTTNIIELPRQEELKTVLDKVKDFF----GGAKESFG  764
             A+ST ++IELP QEELKTVLDKVKDF     GGAKESFG
Sbjct  177  AAISTNDVIELPTQEELKTVLDKVKDFVGNAAGGAKESFG  216



>emb|CDY01837.1| BnaC06g28770D [Brassica napus]
Length=982

 Score =   288 bits (738),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 171/212 (81%), Gaps = 4/212 (2%)
 Frame = +3

Query  129  KMEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGK  308
            +MEV+MS N+L RLP +N         +      S T     +++R++V   +VVEAKGK
Sbjct  753  QMEVSMSLNALTRLPLKNTGRLEEFGLARHSLFTSRTSCLETAQRRRKV---LVVEAKGK  809

Query  309  KGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  488
            KGMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN
Sbjct  810  KGMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDN  868

Query  489  FLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALS  668
             LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALS
Sbjct  869  LLGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALS  928

Query  669  TTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            T+++IELP Q++LKTV DKVKDFFG AKESFG
Sbjct  929  TSDVIELPTQDQLKTVFDKVKDFFGDAKESFG  960



>ref|XP_003601843.1| hypothetical protein MTR_3g086040 [Medicago truncatula]
 gb|AES72094.1| plant/F12A21-30 protein, putative [Medicago truncatula]
 gb|AFK48802.1| unknown [Medicago truncatula]
Length=227

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 165/211 (78%), Gaps = 5/211 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV MS N+L+  P  +      SS        S  R    ++++ +   ++VVEAK KK
Sbjct  1    MEVGMSLNALLHPPLSS-----SSSRFHNDSLFSMPRQFPRTQRQHQHHHVLVVEAKSKK  55

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GM +RQYQR  PPPLPK+EDDGNPKFV+FIRMA+V LWYPL+IV+GGTTAKIMVAAKDNF
Sbjct  56   GMMSRQYQRQPPPPLPKIEDDGNPKFVVFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNF  115

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  671
            LGK+IYKDTL RNLAAVIYRDEKE+QK A KQ RVL+++T+FRYGYKLVEN N++ ALST
Sbjct  116  LGKFIYKDTLDRNLAAVIYRDEKEIQKSAFKQHRVLKSATEFRYGYKLVENGNVKAALST  175

Query  672  TNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +++I+LP  ++LKTV DKVKDFFG  KESFG
Sbjct  176  SDVIQLPTPDKLKTVADKVKDFFGDVKESFG  206



>ref|XP_004502335.1| PREDICTED: uncharacterized protein LOC101493538 [Cicer arietinum]
Length=232

 Score =   266 bits (680),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 170/213 (80%), Gaps = 5/213 (2%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTR-TAVPSRKRQRVGRLMVVEAKGK  308
            MEV MS N+LVR P  +        SS      S  R T+  + +RQ V   +VVEAKGK
Sbjct  1    MEVGMSLNALVRPPLSSSGSRFHDDSSFSHFLFSIPRHTSGKTHQRQHV---LVVEAKGK  57

Query  309  KGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  488
            KGM +RQ+QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMVAAKDN
Sbjct  58   KGMMSRQFQRPPPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMVAAKDN  117

Query  489  FLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVEN-NNLRTAL  665
            FLGKYIYKDTL RNLAAVIY+DEKE+QK A KQ R LR++T+FRYGYKLVEN NN+R AL
Sbjct  118  FLGKYIYKDTLDRNLAAVIYKDEKEIQKSAFKQHRTLRSATEFRYGYKLVENYNNVRAAL  177

Query  666  STTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            STT++IELP  ++LKTVLDKVKDFFG AKESFG
Sbjct  178  STTDVIELPTPDKLKTVLDKVKDFFGDAKESFG  210



>ref|XP_010025366.1| PREDICTED: uncharacterized protein LOC104415723 [Eucalyptus grandis]
 gb|KCW62010.1| hypothetical protein EUGRSUZ_H04690 [Eucalyptus grandis]
Length=240

 Score =   266 bits (681),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 166/213 (78%), Gaps = 2/213 (1%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  305
            MEV MS N+ VRLP        D     +    S S    A  +R  +R    +VVEAKG
Sbjct  1    MEVGMSLNATVRLPLTGSRVAHDDSPGLARHSLSTSRAAAAAAARGPRRGRPPLVVEAKG  60

Query  306  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  485
            K+GM ARQ+QR  PPPLPK+EDDGNP+FVIFIRMA+V LWYPL+++TGGTTAKIMVAAKD
Sbjct  61   KRGMQARQFQRPPPPPLPKIEDDGNPRFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKD  120

Query  486  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  665
            NFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ RVLR +T+FRYGYK+VEN N+R AL
Sbjct  121  NFLGKYIYKDTLARNLAAVIYRDEKEIQKTALKQHRVLRTATEFRYGYKIVENGNVRAAL  180

Query  666  STTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            STT++IELP Q++LKTV DKVKD FG AKESFG
Sbjct  181  STTDVIELPTQDQLKTVFDKVKDLFGDAKESFG  213



>ref|XP_007223900.1| hypothetical protein PRUPE_ppa010899mg [Prunus persica]
 gb|EMJ25099.1| hypothetical protein PRUPE_ppa010899mg [Prunus persica]
Length=231

 Score =   266 bits (679),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 165/213 (77%), Gaps = 6/213 (3%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            ME  MS N++VRLP    +  S +    +      + T    +  QR GR +VVEAK K+
Sbjct  1    MEAGMSLNAVVRLP----LSSSRTHEDGLVRHSLVSTTTTTQKAEQRQGRKLVVEAKSKR  56

Query  312  GMAARQYQRNAPPPLPK--LEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  485
            GM ARQ+Q   PPP     +EDDGNP+FV+F+RMA+V LWYPL++++GGTTAKIMVAAKD
Sbjct  57   GMMARQFQAKKPPPPAMPKIEDDGNPRFVVFMRMANVYLWYPLSVISGGTTAKIMVAAKD  116

Query  486  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  665
            NFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R AL
Sbjct  117  NFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMRAAL  176

Query  666  STTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ST+++IELP +++LKT  DKVKDFFG AKESFG
Sbjct  177  STSDVIELPTKDKLKTTFDKVKDFFGDAKESFG  209



>ref|XP_006852149.2| PREDICTED: uncharacterized protein LOC18441862 [Amborella trichopoda]
Length=241

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 152/174 (87%), Gaps = 5/174 (3%)
 Frame = +3

Query  255  SRKRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPL  434
            SR+ +  G  MVV AKG++G+  R++QR A PPLPKLEDDGNPKFVIFIR A V LWYPL
Sbjct  48   SRREENSG-FMVVTAKGRRGVQDRKFQRPALPPLPKLEDDGNPKFVIFIRTAKVYLWYPL  106

Query  435  NIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTD  614
            ++VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A K++RVLR++++
Sbjct  107  SVVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKEVQKTAFKRYRVLRSASE  166

Query  615  FRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESFG  764
            FRYGYKLVEN NLR AL+T+++IELP QEELKTVLDKVKD+FG    GAKESFG
Sbjct  167  FRYGYKLVENGNLRAALATSDVIELPTQEELKTVLDKVKDYFGNATSGAKESFG  220



>gb|ERN13616.1| hypothetical protein AMTR_s00049p00073250 [Amborella trichopoda]
Length=265

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 152/174 (87%), Gaps = 5/174 (3%)
 Frame = +3

Query  255  SRKRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPL  434
            SR+ +  G  MVV AKG++G+  R++QR A PPLPKLEDDGNPKFVIFIR A V LWYPL
Sbjct  48   SRREENSG-FMVVTAKGRRGVQDRKFQRPALPPLPKLEDDGNPKFVIFIRTAKVYLWYPL  106

Query  435  NIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTD  614
            ++VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A K++RVLR++++
Sbjct  107  SVVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKEVQKTAFKRYRVLRSASE  166

Query  615  FRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESFG  764
            FRYGYKLVEN NLR AL+T+++IELP QEELKTVLDKVKD+FG    GAKESFG
Sbjct  167  FRYGYKLVENGNLRAALATSDVIELPTQEELKTVLDKVKDYFGNATSGAKESFG  220



>ref|XP_008221980.1| PREDICTED: uncharacterized protein LOC103321904 [Prunus mume]
Length=235

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 170/215 (79%), Gaps = 9/215 (4%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  305
            ME  MS N++VRLP  +    ED     SL+  + ++T+ A      QR GR +VV+AK 
Sbjct  1    MEAGMSLNAVVRLPLSSSRTHEDGLVRHSLVSTTTTTTQKA-----EQRQGRKLVVQAKS  55

Query  306  KKGMAARQYQRNAPPPLPK--LEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  479
            K+GM ARQ+Q   PPP     +EDDGNP+FV+F+RMA+V LWYPL++++GGTTAKIMVAA
Sbjct  56   KRGMMARQFQAKKPPPPAMPKIEDDGNPRFVVFMRMANVYLWYPLSVISGGTTAKIMVAA  115

Query  480  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  659
            KDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R 
Sbjct  116  KDNFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMRA  175

Query  660  ALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ALST+++IELP +++LKT  DKVKDFFG AKESFG
Sbjct  176  ALSTSDVIELPTKDKLKTTFDKVKDFFGDAKESFG  210



>ref|XP_008389783.1| PREDICTED: uncharacterized protein LOC103452079 [Malus domestica]
Length=236

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 168/215 (78%), Gaps = 8/215 (4%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  305
            MEV +S N+ VRLP  +    ED     SL+      T T   + +RQ V R +VVE+KG
Sbjct  1    MEVGLSLNAAVRLPLSSSRTHEDGLVRHSLVSTK---TTTQKAAEQRQ-VRRALVVESKG  56

Query  306  KKGMAARQYQRNAPPPLP--KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  479
            K+GM ARQ+Q   PPP    K+EDDGNP+FV+FIRMA+V LWYPL++++GGTTAKIM+AA
Sbjct  57   KRGMMARQFQPKRPPPPAMPKIEDDGNPRFVVFIRMANVYLWYPLSVISGGTTAKIMIAA  116

Query  480  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  659
            KDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R 
Sbjct  117  KDNFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMRA  176

Query  660  ALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            ALST+++IELP +++LKT  DKVKDF   AKESFG
Sbjct  177  ALSTSDVIELPTKDKLKTTFDKVKDFXXDAKESFG  211



>ref|XP_010100301.1| hypothetical protein L484_027609 [Morus notabilis]
 gb|EXB82435.1| hypothetical protein L484_027609 [Morus notabilis]
Length=227

 Score =   258 bits (659),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 170/213 (80%), Gaps = 6/213 (3%)
 Frame = +3

Query  132  MEVAMSFNSLVRLP--RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  305
            MEV MS N++V LP  +   +ED     SL         T    ++++R  + +VVEAKG
Sbjct  1    MEVGMSLNAVVCLPLSKSRTLEDGLVRHSLFSTRS----TQRQKQEQKRQRKTLVVEAKG  56

Query  306  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  485
            KKGM ARQ+QR  PPP+PK+EDDGNP+FVIFIRMA+V  WYPL+I+TGGTTAKIM+AAKD
Sbjct  57   KKGMQARQFQRPPPPPMPKIEDDGNPRFVIFIRMANVGFWYPLSIITGGTTAKIMLAAKD  116

Query  486  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  665
            NFLGKYIYKDTL +NLAAVIYRDEKE+QK A KQF++LR +T+FRYGYK+VEN NL+ A+
Sbjct  117  NFLGKYIYKDTLDKNLAAVIYRDEKEIQKSAFKQFKILRNATEFRYGYKIVENGNLKAAV  176

Query  666  STTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            +T +++ELP Q++L+TVLDKVKDFFG AK+SFG
Sbjct  177  ATNDVVELPTQDKLRTVLDKVKDFFGDAKDSFG  209



>ref|XP_009359285.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103949875 
[Pyrus x bretschneideri]
Length=236

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 167/216 (77%), Gaps = 10/216 (5%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGR-LMVVEAK  302
            MEV +S N+ V+ P  +    ED     SL+      T+T +     Q+ GR  +VVE+K
Sbjct  1    MEVGLSLNAGVQFPFSSSRTHEDGLVRHSLVS-----TKTTIQKAAEQKQGRRTLVVESK  55

Query  303  GKKGMAARQYQRNAPPPLPK--LEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVA  476
             K+GM ARQ+Q   PPP     +EDDGNP+FV+F+RMA+V LWYPL++++GGTTAKIM+A
Sbjct  56   SKRGMMARQFQPKKPPPPAMPKIEDDGNPRFVVFMRMANVYLWYPLSVISGGTTAKIMIA  115

Query  477  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLR  656
            AKDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R
Sbjct  116  AKDNFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMR  175

Query  657  TALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
             ALST+++IELP +++LKT  DKVKDFFG AKESFG
Sbjct  176  AALSTSDVIELPTKDKLKTTFDKVKDFFGDAKESFG  211



>gb|AAG28905.1|AC008113_21 F12A21.16 [Arabidopsis thaliana]
Length=998

 Score =   262 bits (669),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 152/198 (77%), Gaps = 23/198 (12%)
 Frame = +3

Query  237  TRTAVPSRKRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADV  416
            +RTA      Q+   + VVEAKGKKGMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V
Sbjct  718  SRTACRETAVQQRRMVFVVEAKGKKGMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANV  776

Query  417  DLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYR---------------  551
             LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+AAVIYR               
Sbjct  777  YLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIAAVIYRVNYTSFCLFLCDVIS  836

Query  552  -------DEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELK  710
                   DEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP Q++LK
Sbjct  837  NCFYLQQDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELPTQDQLK  896

Query  711  TVLDKVKDFFGGAKESFG  764
            TV DKVKD+FG AKESFG
Sbjct  897  TVFDKVKDYFGDAKESFG  914



>ref|NP_001047344.1| Os02g0600200 [Oryza sativa Japonica Group]
 dbj|BAD22147.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09258.1| Os02g0600200 [Oryza sativa Japonica Group]
 dbj|BAG90207.1| unnamed protein product [Oryza sativa Japonica Group]
Length=266

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 140/163 (86%), Gaps = 5/163 (3%)
 Frame = +3

Query  285  MVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAK  464
            +VVEA+G+ G + R+ Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAK
Sbjct  59   LVVEARGR-GWSDRRSQQQRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAK  117

Query  465  IMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVEN  644
            IM+AAKDNFLGKYIYKDTLARNLAAVIY+DE ++   AK+Q+RVL+   +FRYGYK+VEN
Sbjct  118  IMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDDIIDTAKEQYRVLKTDNEFRYGYKVVEN  177

Query  645  NNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESF  761
             NLR+AL+T+N+IELP++EELKTV+DKVKDFFG    GAKESF
Sbjct  178  GNLRSALTTSNVIELPKKEELKTVVDKVKDFFGDVTSGAKESF  220



>ref|XP_010235641.1| PREDICTED: uncharacterized protein LOC104583798 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235642.1| PREDICTED: uncharacterized protein LOC104583798 isoform X1 [Brachypodium 
distachyon]
Length=249

 Score =   236 bits (602),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 6/175 (3%)
 Frame = +3

Query  252  PSRKRQRVGRLMVVEAKGKKGMAARQYQRNAP-PPLPKLEDDGNPKFVIFIRMADVDLWY  428
            P  +R    RL VVEA+G +G + RQ Q+    P LPK+EDDGNP+FVIFIR A+V  WY
Sbjct  31   PRPRRLHAARL-VVEARGGRGWSDRQSQQQRRMPQLPKIEDDGNPRFVIFIRTANVYFWY  89

Query  429  PLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRAS  608
            PLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA VIY+DE ++   AK+QFRVL++ 
Sbjct  90   PLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLATVIYKDEDDIIDTAKEQFRVLKSE  149

Query  609  TDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESF  761
             +FRYGYK+VE  NLR+AL+T+N+IELP++EELKTV+DKVKDFFG    GAKESF
Sbjct  150  NEFRYGYKVVEKGNLRSALATSNVIELPKKEELKTVVDKVKDFFGEVTSGAKESF  204



>dbj|BAJ85479.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ94426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=256

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 140/164 (85%), Gaps = 5/164 (3%)
 Frame = +3

Query  285  MVVEAKGKKGMAARQYQRNAP-PPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTA  461
            +VVEA+G +G + RQ Q+    P LPK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTA
Sbjct  46   LVVEARGGRGWSDRQSQQQRRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTA  105

Query  462  KIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVE  641
            KIM+AAKDNFLGKYIYKDTLARNLA VIY+DE ++  LAK+QFRVL+  T+FRYGYK+VE
Sbjct  106  KIMLAAKDNFLGKYIYKDTLARNLATVIYKDEDDIIDLAKEQFRVLKGETEFRYGYKIVE  165

Query  642  NNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESF  761
              NLR+AL+T+N++ELP++EELK+V+DKV+DFFG    GAKESF
Sbjct  166  KGNLRSALATSNVLELPKKEELKSVVDKVRDFFGEVTSGAKESF  209



>gb|EEC73537.1| hypothetical protein OsI_07935 [Oryza sativa Indica Group]
 gb|EEE67978.1| hypothetical protein OsJ_25898 [Oryza sativa Japonica Group]
Length=300

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 140/164 (85%), Gaps = 5/164 (3%)
 Frame = +3

Query  285  MVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAK  464
            +VVEA+G+ G + R+ Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAK
Sbjct  59   LVVEARGR-GWSDRRSQQQRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAK  117

Query  465  IMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVEN  644
            IM+AAKDNFLGKYIYKDTLARNLAAVIY+DE ++   AK+Q+RVL+   +FRYGYK+VEN
Sbjct  118  IMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDDIIDTAKEQYRVLKTDNEFRYGYKVVEN  177

Query  645  NNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESFG  764
             NLR+AL+T+N+IELP++EELKTV+DKVKDFFG    GAKESF 
Sbjct  178  GNLRSALTTSNVIELPKKEELKTVVDKVKDFFGDVTSGAKESFA  221



>ref|XP_004952998.1| PREDICTED: uncharacterized protein LOC101783266 isoform X1 [Setaria 
italica]
Length=288

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  261  KRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNI  440
            +RQ   R +VVEA+G+     +  Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLNI
Sbjct  39   RRQPARRALVVEARGRSWSERQMEQQRRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNI  98

Query  441  VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFR  620
            +TGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+DE  +   AK+Q+RVL+   +FR
Sbjct  99   ITGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDVIIDTAKEQYRVLKTENEFR  158

Query  621  YGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESFG  764
            YGYK+VEN N+R+AL+T+N+IELP+++ELKTV+DKVKDFFG    GAKESF 
Sbjct  159  YGYKVVENGNVRSALTTSNVIELPKKDELKTVVDKVKDFFGDVTAGAKESFA  210



>ref|XP_004952999.1| PREDICTED: uncharacterized protein LOC101783266 isoform X2 [Setaria 
italica]
Length=249

 Score =   233 bits (594),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  261  KRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNI  440
            +RQ   R +VVEA+G+     +  Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLNI
Sbjct  39   RRQPARRALVVEARGRSWSERQMEQQRRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNI  98

Query  441  VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFR  620
            +TGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+DE  +   AK+Q+RVL+   +FR
Sbjct  99   ITGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDVIIDTAKEQYRVLKTENEFR  158

Query  621  YGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESFG  764
            YGYK+VEN N+R+AL+T+N+IELP+++ELKTV+DKVKDFFG    GAKESF 
Sbjct  159  YGYKVVENGNVRSALTTSNVIELPKKDELKTVVDKVKDFFGDVTAGAKESFA  210



>ref|NP_001141155.1| uncharacterized protein LOC100273241 [Zea mays]
 gb|ACF79164.1| unknown [Zea mays]
 gb|ACF85560.1| unknown [Zea mays]
 gb|AFW72183.1| hypothetical protein ZEAMMB73_079373 [Zea mays]
Length=249

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = +3

Query  264  RQRVGRLMVVEAKGKKGMAARQYQRNAPPPL-PKLEDDGNPKFVIFIRMADVDLWYPLNI  440
            RQ   R +VVEA+G +G + RQ Q+    PL PK+EDDGNP+FVIFIR A+V  WYPLNI
Sbjct  39   RQPARRALVVEARGGRGWSERQMQQQRRAPLLPKIEDDGNPRFVIFIRTANVYFWYPLNI  98

Query  441  VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFR  620
            +TGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+DE  +   AK+Q+RVL+    FR
Sbjct  99   ITGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDVIIDTAKEQYRVLKTENQFR  158

Query  621  YGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESF  761
            YGYK+VE  N+R+AL+T+N+IELP+++ELKTV+DKVKDFFG    GAKESF
Sbjct  159  YGYKVVEKGNIRSALTTSNVIELPKKDELKTVVDKVKDFFGDVTAGAKESF  209



>ref|XP_006665147.1| PREDICTED: uncharacterized protein LOC102722271, partial [Oryza 
brachyantha]
Length=194

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 129/148 (87%), Gaps = 4/148 (3%)
 Frame = +3

Query  333  QRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYK  512
            Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLN+VTGGTTAKIM+AAKDNFLGKYIYK
Sbjct  1    QQQRMPSLPKIEDDGNPRFVIFIRTANVYFWYPLNVVTGGTTAKIMLAAKDNFLGKYIYK  60

Query  513  DTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELP  692
            DTLARNLAAVIY+DE E+   AK+Q+RVL+   +FRYGYK+VEN NLR+AL+T+N+IELP
Sbjct  61   DTLARNLAAVIYKDEDEIIDTAKEQYRVLKTENEFRYGYKVVENANLRSALTTSNVIELP  120

Query  693  RQEELKTVLDKVKDFFG----GAKESFG  764
            ++EELKTV+DKVKDFFG    GAKESFG
Sbjct  121  KKEELKTVVDKVKDFFGDVTSGAKESFG  148



>gb|EMT22924.1| hypothetical protein F775_29812 [Aegilops tauschii]
Length=276

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 142/184 (77%), Gaps = 25/184 (14%)
 Frame = +3

Query  285  MVVEAKGKKGMAARQYQRNA-PPPLPKLEDDGNPKFVIFIRMADV-------DL------  422
            +VVEA+G +G + RQ Q+    P LPK+EDDGNP+FVIFIR A+V       DL      
Sbjct  46   LVVEARGGRGWSDRQSQQQRRMPQLPKIEDDGNPRFVIFIRTANVYSSSIPSDLIVCMYI  105

Query  423  -------WYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAK  581
                   WYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA VIY+DE ++  LAK
Sbjct  106  NFLLVYFWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLATVIYKDEDDIIDLAK  165

Query  582  KQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GA  749
            +QFRVL+  T+FRYGYK+VE  NLR+AL+T+N++ELP++EELK+V+DKV+DFFG    GA
Sbjct  166  EQFRVLKGETEFRYGYKIVEKGNLRSALATSNVLELPKKEELKSVVDKVRDFFGEVTSGA  225

Query  750  KESF  761
            KESF
Sbjct  226  KESF  229



>gb|KDO82053.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=198

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 145/207 (70%), Gaps = 32/207 (15%)
 Frame = +3

Query  144  MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  323
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+G+ A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGLQA  57

Query  324  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  503
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  504  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNII  683
            IYKDTLARNLAAVIYR                             EN NLR ALST+++I
Sbjct  118  IYKDTLARNLAAVIYR-----------------------------ENGNLRAALSTSDVI  148

Query  684  ELPRQEELKTVLDKVKDFFGGAKESFG  764
            ELP  ++LKTVLDKVKDFFG AKESFG
Sbjct  149  ELPTPDKLKTVLDKVKDFFGDAKESFG  175



>gb|KDO82056.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
 gb|KDO82057.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=197

 Score =   218 bits (556),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 135/165 (82%), Gaps = 3/165 (2%)
 Frame = +3

Query  144  MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  323
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+G+ A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGLQA  57

Query  324  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  503
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  504  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV  638
            IYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLV
Sbjct  118  IYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLV  162



>gb|KEH35275.1| plant/F12A21-30 protein, putative [Medicago truncatula]
Length=194

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  311
            MEV MS N+L+     +P   S SS        S  R    ++++ +   ++VVEAK KK
Sbjct  1    MEVGMSLNALL-----HPPLSSSSSRFHNDSLFSMPRQFPRTQRQHQHHHVLVVEAKSKK  55

Query  312  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  491
            GM +RQYQR  PPPLPK+EDDGNPKFV+FIRMA+V LWYPL+IV+GGTTAKIMVAAKDNF
Sbjct  56   GMMSRQYQRQPPPPLPKIEDDGNPKFVVFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNF  115

Query  492  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV  638
            LGK+IYKDTL RNLAAVIYRDEKE+QK A KQ RVL+++T+FRYGYKLV
Sbjct  116  LGKFIYKDTLDRNLAAVIYRDEKEIQKSAFKQHRVLKSATEFRYGYKLV  164



>ref|XP_002887139.1| F12A21.16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63398.1| F12A21.16 [Arabidopsis lyrata subsp. lyrata]
Length=985

 Score =   226 bits (576),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 157/221 (71%), Gaps = 17/221 (8%)
 Frame = +3

Query  129  KMEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGK  308
            K +++MS N+L RLP +N          L+R S+ S+RTA      Q+   + VVEAKGK
Sbjct  684  KPKMSMSLNALTRLPLKNT--GRFEEVGLVRQSLFSSRTACRETAVQQRRMVFVVEAKGK  741

Query  309  KGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  488
            KGMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN
Sbjct  742  KGMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDN  800

Query  489  FLGKYIYKDTLARNLAAVIYRDEKE---------LQKLAKKQFRVLRASTDFRYGYKLVE  641
             LGKYIYKDT+ARN+AAVIYR             L  + +K+F+  + S+         E
Sbjct  801  LLGKYIYKDTIARNIAAVIYRVNYTSCFLFGLIPLFNMMRKRFKRQQLSSTVS-----CE  855

Query  642  NNNLRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            N N+R ALST+++IELP Q++LKTV DKVKD+FG AKESFG
Sbjct  856  NGNMRAALSTSDVIELPTQDQLKTVFDKVKDYFGDAKESFG  896



>emb|CBI27531.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +3

Query  405  MADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKK  584
            MA+V LWYPL+++TGGTTAKIMVAAKDNFLGKYIY+DT+ARNLAAVIY+DEKE+QK A +
Sbjct  1    MANVYLWYPLSLITGGTTAKIMVAAKDNFLGKYIYRDTIARNLAAVIYKDEKEIQKTAFR  60

Query  585  QFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
            Q+RVLR++ +FRYGYKLVENNN+R+ALSTT++IELP Q ELKTVLDKV+DFFG AKESFG
Sbjct  61   QYRVLRSAKEFRYGYKLVENNNVRSALSTTDVIELPTQGELKTVLDKVRDFFGDAKESFG  120



>ref|XP_010235643.1| PREDICTED: uncharacterized protein LOC104583798 isoform X2 [Brachypodium 
distachyon]
Length=236

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 130/175 (74%), Gaps = 19/175 (11%)
 Frame = +3

Query  252  PSRKRQRVGRLMVVEAKGKKGMAARQYQRNAP-PPLPKLEDDGNPKFVIFIRMADVDLWY  428
            P  +R    RL VVEA+G +G + RQ Q+    P LPK+EDDGNP+FVIFIR A+V  WY
Sbjct  31   PRPRRLHAARL-VVEARGGRGWSDRQSQQQRRMPQLPKIEDDGNPRFVIFIRTANVYFWY  89

Query  429  PLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRAS  608
            PLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA VIY+DE ++   AK+QFRVL++ 
Sbjct  90   PLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLATVIYKDEDDIIDTAKEQFRVLKSE  149

Query  609  TDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESF  761
             +FRYGYK+VE  NLR+AL+T+N+IE             VKDFFG    GAKESF
Sbjct  150  NEFRYGYKVVEKGNLRSALATSNVIE-------------VKDFFGEVTSGAKESF  191



>gb|ABK23133.1| unknown [Picea sitchensis]
Length=232

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 137/177 (77%), Gaps = 5/177 (3%)
 Frame = +3

Query  246  AVPSRKRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLW  425
            A+ SRK    G +++VEAKG+K M  + YQ+  PP +PK EDD NP+FV+FIR  +V  W
Sbjct  39   ALWSRKNTGRGGVVIVEAKGRKSMQEKMYQQRPPPSVPKAEDD-NPRFVVFIRSKNVPRW  97

Query  426  YPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRA  605
            YPLNI++GGTTAKIMVA KD  +GK++Y+  L RN+AAV+Y+DEKE++K+A KQ+ VL+A
Sbjct  98   YPLNIISGGTTAKIMVAGKDTPVGKFLYEGALTRNIAAVVYKDEKEIRKIALKQYPVLKA  157

Query  606  STDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESFG  764
            +++ +YGYKL++  N  +AL +++II++P QEELK V++KVKDFFG    G KESFG
Sbjct  158  ASELQYGYKLIDPKNPNSALYSSDIIKIPPQEELKPVVEKVKDFFGNAMTGVKESFG  214



>ref|XP_006648812.1| PREDICTED: uncharacterized protein LOC102699572 [Oryza brachyantha]
Length=193

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 107/121 (88%), Gaps = 4/121 (3%)
 Frame = +3

Query  414  VDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFR  593
            V  WYPLN+VTGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+DE E+   AK+Q+R
Sbjct  27   VYFWYPLNVVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDEIIDTAKEQYR  86

Query  594  VLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG----GAKESF  761
            VL+   +FRYGYK+VEN NLR+AL+T+N+IELP++EELKTV+DKVKDFFG    GAKESF
Sbjct  87   VLKTENEFRYGYKVVENANLRSALTTSNVIELPKKEELKTVVDKVKDFFGDVTSGAKESF  146

Query  762  G  764
            G
Sbjct  147  G  147



>gb|KDO82058.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=142

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 111/144 (77%), Gaps = 3/144 (2%)
 Frame = +3

Query  144  MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  323
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+G+ A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGLQA  57

Query  324  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  503
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  504  IYKDTLARNLAAVIYRDEKELQKL  575
            IYKDTLARNLAAVIYR    L +L
Sbjct  118  IYKDTLARNLAAVIYRVSSVLLQL  141



>ref|XP_001765741.1| predicted protein [Physcomitrella patens]
 gb|EDQ69332.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = +3

Query  291  VEAKGKK--GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAK  464
            V AKG++  G+  RQ  R   P +P +EDDGNPKFV+FIR  +V  WYPL++VTGGTTAK
Sbjct  30   VRAKGRRNAGIPGRQPNRQQMPSMPAMEDDGNPKFVLFIRTLNVPRWYPLSVVTGGTTAK  89

Query  465  IMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVEN  644
            +MV A  N  GK +Y+ TL RN+A VIY+DEK++ + A KQ+ VL+++T F+YGYK+++ 
Sbjct  90   MMVGAMKNDWGKKLYEGTLTRNIAGVIYKDEKKIIQTAIKQYPVLKSATGFQYGYKIMDP  149

Query  645  NNLRTALSTTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
               ++A+ +++++ +P QEEL +V+DKVK FF    ESFG
Sbjct  150  EKPQSAMFSSDVVTIPPQEELNSVVDKVKGFFSKVGESFG  189



>ref|XP_010930034.1| PREDICTED: uncharacterized protein LOC105051352 isoform X3 [Elaeis 
guineensis]
Length=189

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 125/218 (57%), Gaps = 57/218 (26%)
 Frame = +3

Query  132  MEVAMSFNSLVRLPRRNP---MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAK  302
            MEVAMS  +L RLP  N      ++G          S T   V  +KRQ    LMVVEAK
Sbjct  1    MEVAMSVRALARLPLSNSKVTAHENGVFLGSPLPLRSQTSRRVSEKKRQ----LMVVEAK  56

Query  303  GKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAK  482
            GK+GM ARQ+QR  PPPLPK+EDDGNP+FVIFIR                          
Sbjct  57   GKRGMMARQFQRPPPPPLPKIEDDGNPRFVIFIRTT------------------------  92

Query  483  DNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  662
                                  +DEKE+QK A KQ+RVLR++T FRYGYKL+ENNNLR A
Sbjct  93   ----------------------KDEKEIQKTAFKQYRVLRSATAFRYGYKLIENNNLRAA  130

Query  663  LSTTNIIELPRQEELKTVLDKVKDFF----GGAKESFG  764
            +ST ++IELP QEELKTVLDKVKDF     GGAKESFG
Sbjct  131  ISTNDVIELPTQEELKTVLDKVKDFVGNAAGGAKESFG  168



>gb|EAY86575.1| hypothetical protein OsI_07955 [Oryza sativa Indica Group]
Length=477

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = +3

Query  285  MVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAK  464
            +VVEA+G+ G + R+ Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAK
Sbjct  59   LVVEARGR-GWSDRRSQQQRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAK  117

Query  465  IMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFR  593
            IM+AAKDNFLGKYIYKDTLARNLAAVIY+DE ++   AK+Q+R
Sbjct  118  IMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDDIIDTAKEQYR  160



>gb|AFW72182.1| hypothetical protein ZEAMMB73_079373 [Zea mays]
Length=165

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +3

Query  264  RQRVGRLMVVEAKGKKGMAARQYQRNA-PPPLPKLEDDGNPKFVIFIRMADVDLWYPLNI  440
            RQ   R +VVEA+G +G + RQ Q+    P LPK+EDDGNP+FVIFIR A+V  WYPLNI
Sbjct  39   RQPARRALVVEARGGRGWSERQMQQQRRAPLLPKIEDDGNPRFVIFIRTANVYFWYPLNI  98

Query  441  VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFR  620
            +TGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+   + Q+L    F  L  S+   
Sbjct  99   ITGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKVIDDQQQL----FFWLHHSSHIL  154

Query  621  YGYKLV  638
             G+ ++
Sbjct  155  NGHPIL  160



>gb|KHN24102.1| Small heat shock protein, chloroplastic, partial [Glycine soja]
Length=320

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 94/153 (61%), Gaps = 37/153 (24%)
 Frame = +3

Query  279  RLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTT  458
            ++ VVEAKGKKGM +RQ+QRN+PPPLPK+EDDGNPKFVIFIRMA+               
Sbjct  38   QVFVVEAKGKKGMMSRQFQRNSPPPLPKIEDDGNPKFVIFIRMAN---------------  82

Query  459  AKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV  638
                            YKDTL RNLAAVIYRDEKE+QK A KQ+RVLR++TDFRYGYKL+
Sbjct  83   ----------------YKDTLDRNLAAVIYRDEKEVQKSACKQYRVLRSATDFRYGYKLL  126

Query  639  ENNNLRTALSTTNIIELPRQEELKTVLDKVKDF  737
                    + T N+   P     K   + + +F
Sbjct  127  ------WEIQTDNLSSFPFAFTFKLSFNHLANF  153



>ref|XP_002983221.1| hypothetical protein SELMODRAFT_422572 [Selaginella moellendorffii]
 gb|EFJ15563.1| hypothetical protein SELMODRAFT_422572 [Selaginella moellendorffii]
Length=184

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 104/173 (60%), Gaps = 8/173 (5%)
 Frame = +3

Query  240  RTAVPSRKRQRVGRLMVVEAKGKKG-----MAARQYQRNAPPPLPKLEDDGNPKFVIFIR  404
            R A+ S +R    +++ +EA  +KG        +Q Q+ + P +P  EDD NP+FVIFIR
Sbjct  3    RAAIASSERSL--QVLTIEASKRKGPMRRMQQQQQMQQRSLPKVPAAEDD-NPRFVIFIR  59

Query  405  MADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKK  584
              +V LWYPLNIV+GG  AK MV    N  GK IY ++L  N+ A +Y+DE+++     K
Sbjct  60   SKNVPLWYPLNIVSGGNAAKFMVGVTKNEWGKKIYGNSLTNNIGAAVYKDEEKIIASVVK  119

Query  585  QFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG  743
             +  L+ + +F++GYKLV+      AL   ++  +P +EELK + +KV DF G
Sbjct  120  TYPTLKTAKEFQFGYKLVDEEKANEALRPVDVTLIPPKEELKPITEKVTDFVG  172



>ref|XP_002961342.1| hypothetical protein SELMODRAFT_403146 [Selaginella moellendorffii]
 gb|EFJ38881.1| hypothetical protein SELMODRAFT_403146 [Selaginella moellendorffii]
Length=179

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 100/164 (61%), Gaps = 6/164 (4%)
 Frame = +3

Query  267  QRVGRLMVVEAKGKKG-----MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYP  431
            +R  +++ +EA  +KG        +Q Q+ + P +P  EDD NP+FVIFIR  +V LWYP
Sbjct  5    ERSLQVLTIEASKRKGPMRRMQQQQQMQQRSLPKVPAAEDD-NPRFVIFIRSKNVPLWYP  63

Query  432  LNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRAST  611
            LNIV+GG  AK MV    N  GK IY ++L  N+ A +Y+DE+++     K +  L+ + 
Sbjct  64   LNIVSGGNAAKFMVGVTKNEWGKKIYGNSLTNNIGAAVYKDEEKIIASVVKTYPTLKTAK  123

Query  612  DFRYGYKLVENNNLRTALSTTNIIELPRQEELKTVLDKVKDFFG  743
            +F++GYKLV+      AL   ++  +P +E+LK + +KV DF G
Sbjct  124  EFQFGYKLVDEEKANEALRPVDVTLIPPKEDLKPITEKVTDFVG  167



>gb|AFB34514.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
 gb|AFB34515.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
 gb|AFB34516.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
 gb|AFB34517.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
Length=85

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +3

Query  282  LMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTA  461
            L++VEAKGKK M  + Y++  PP LPK EDD NP+FV+FIR  +V  WYPLNI++GGTTA
Sbjct  1    LVIVEAKGKKSMQEKLYKQRPPPSLPKAEDD-NPRFVVFIRTKNVPRWYPLNIISGGTTA  59

Query  462  KIMVAAKDNFLGKYIYKDTLARNLAA  539
            KIMVA KD  +GK++Y+  L RN+AA
Sbjct  60   KIMVAGKDTPVGKFLYEGALTRNIAA  85



>gb|AEW09177.1| hypothetical protein CL4511Contig1_02, partial [Pinus radiata]
 gb|AFG53863.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53864.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53865.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53866.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53867.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53868.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53869.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53870.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53871.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53872.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53873.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53874.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53875.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53876.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53877.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53878.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53879.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
Length=85

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +3

Query  282  LMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTA  461
            L++VEAKGKK M  + Y++  PP LPK EDD NP+FV+FIR  +V  WYPLNI++GGTTA
Sbjct  1    LVIVEAKGKKNMQEKLYKQRPPPSLPKAEDD-NPRFVVFIRTKNVPRWYPLNIISGGTTA  59

Query  462  KIMVAAKDNFLGKYIYKDTLARNLAA  539
            KIMVA KD  +GK++Y+  L RN+AA
Sbjct  60   KIMVAGKDTPVGKFLYEGALTRNIAA  85



>gb|AFB34513.1| hypothetical protein CL4511Contig1_02, partial [Larix decidua]
Length=85

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = +3

Query  282  LMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTA  461
            L++VEAKG+K M  + Y++  PP +P  EDD NP+FV+FIR  +V  WYPLNI++GGTTA
Sbjct  1    LVIVEAKGRKSMQEKMYKQRPPPSVPPAEDD-NPRFVVFIRSKNVPRWYPLNIISGGTTA  59

Query  462  KIMVAAKDNFLGKYIYKDTLARNLAA  539
            KIMVA KD  +GK++Y+  L RN+AA
Sbjct  60   KIMVAGKDTPVGKFLYEGALTRNIAA  85



>ref|XP_005648734.1| hypothetical protein COCSUDRAFT_53257 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24190.1| hypothetical protein COCSUDRAFT_53257 [Coccomyxa subellipsoidea 
C-169]
Length=213

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 96/173 (55%), Gaps = 8/173 (5%)
 Frame = +3

Query  243  TAVPSRKRQRVGRLMVVEAKGKKGMAARQYQRNAP------PPLPKLEDDGNPKFVIFIR  404
            TA P+  R   GR + +E    KG   ++  ++A       PP P ++ D N +FV+FIR
Sbjct  34   TAAPATCRPGSGRSLRLEVSAVKGAGKKKLAQSAQAGAAQLPPTPPVDPD-NAEFVLFIR  92

Query  405  MADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKK  584
                  WYPL++V GG+ A I+V A ++  G+ +Y  TL RN+  V+Y+D ++++ + K+
Sbjct  93   AVKFPQWYPLSVVKGGSAANIIVRAMESEFGRLLYGKTLIRNIGTVVYQDRRKIENMVKR  152

Query  585  QFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEELK-TVLDKVKDFF  740
               +++   DF +G+K+ +           N+  +P + EL+ TV D+V D++
Sbjct  153  SLPMMKNFKDFEFGFKIRDKTRPNDWYFAENVTIIPPESELRGTVADQVGDWW  205



>ref|XP_011397511.1| Uncharacterized protein YhiN [Auxenochlorella protothecoides]
 gb|KFM24623.1| Uncharacterized protein YhiN [Auxenochlorella protothecoides]
Length=457

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 80/133 (60%), Gaps = 2/133 (2%)
 Frame = +3

Query  348  PPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLAR  527
            PP P+  D  N +FV+F+R   +  W PL+I+ GGT A ++V +    LGK +Y +TL R
Sbjct  319  PPTPE-PDPKNEEFVMFVRSKKLMKWVPLSIMKGGTAANMLVKSMQGNLGKKMYTNTLIR  377

Query  528  NLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEEL  707
            N+A  +Y+D  E+++  + Q+   + + +F Y +K+ +           ++I +P +E+L
Sbjct  378  NIAQGLYKDRLEVERQLRNQYPFFKETKEFEYAFKIRDKTKPEEWYLPADLIIIPPEEDL  437

Query  708  K-TVLDKVKDFFG  743
            + TV+DK K+FFG
Sbjct  438  EDTVVDKAKNFFG  450



>ref|XP_001415572.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93864.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=147

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 79/142 (56%), Gaps = 8/142 (6%)
 Frame = +3

Query  348  PPLPKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLA  524
            PP+    D  N +FVI +R    +  WYPLN+VTGG+ A  +V   DN + K + + +L+
Sbjct  10   PPI----DPDNEQFVIHVRSKRGIKAWYPLNVVTGGSAANTLVKGLDNDMSKEMAQKSLS  65

Query  525  RNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTN--IIELPRQ  698
            +N+   IY+D   + K+A+    +L+ + +  YG+ +++  N R+  S  N  +  +P +
Sbjct  66   QNIGKAIYKDMAAIDKVARS-MPMLKQAKEIEYGFSVLDKENPRSMFSPANDKVWLIPSE  124

Query  699  EELKTVLDKVKDFFGGAKESFG  764
            EE +T  DK ++     K+ FG
Sbjct  125  EECETPADKFQEMGDNMKKMFG  146



>ref|XP_003074445.1| Metalloendopeptidase family-saccharolysin & thimet oligopeptidase 
(ISS) [Ostreococcus tauri]
 emb|CAL50296.1| unnamed product [Ostreococcus tauri]
Length=205

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 90/160 (56%), Gaps = 11/160 (7%)
 Frame = +3

Query  294  EAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIM  470
            E  G K M+  Q ++  PP  P      N +FVI++R    +  WYPLN+VTGG+ A  +
Sbjct  52   EGSGAKMMS--QVEQFMPPIDPD-----NEQFVIYVRSKRGLKAWYPLNVVTGGSAANTL  104

Query  471  VAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  650
            V   DN + + + + +L +N+   IY+D + ++K+A+    +L+ + +  YG+ +++  N
Sbjct  105  VKGLDNDMSREMAQKSLQQNIGKAIYKDFEAIEKVART-MPMLKQAKEIEYGFAVLDKKN  163

Query  651  LRTALS--TTNIIELPRQEELKTVLDKVKDFFGGAKESFG  764
             R+  S  + +++ +P +E+ +T  DK ++     K+ FG
Sbjct  164  PRSMFSPASGSVMMIPSEEDCETPADKFQEMGDNLKKMFG  203



>ref|XP_005852074.1| hypothetical protein CHLNCDRAFT_133084 [Chlorella variabilis]
 gb|EFN59972.1| hypothetical protein CHLNCDRAFT_133084 [Chlorella variabilis]
Length=206

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = +3

Query  369  DDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIY  548
            D  N +FVIF+R   +  W PL++V GGT A ++V   D+   K     TL +N+   +Y
Sbjct  70   DPDNEEFVIFVRSKKLPQWVPLSVVKGGTAANMLVKGLDSDWMKDTTAKTLVQNIGKAVY  129

Query  549  RDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPRQEEL-KTVLDK  725
            +D++++    +K +   + + +F + +K+ E  + +       ++++P + EL KT  + 
Sbjct  130  KDKEQIIASLRKAYPPFKETKEFEFAFKIREKADPKAWYVPKGLMDIPPEAELEKTPAEN  189

Query  726  VKDFFGGAKESFG  764
            VKDFF  A   FG
Sbjct  190  VKDFFSTAFSGFG  202



>ref|XP_002507497.1| hypothetical protein MICPUN_113391 [Micromonas sp. RCC299]
 gb|ACO68755.1| hypothetical protein MICPUN_113391 [Micromonas sp. RCC299]
Length=215

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 77/135 (57%), Gaps = 5/135 (4%)
 Frame = +3

Query  354  LPKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARN  530
            +P ++ D N +FVI++R       W+PLN+VTGG+TA  +V   D+ L + + K +L  N
Sbjct  68   MPPVDPD-NEQFVIYVRSKKGFKAWFPLNVVTGGSTANTLVKGLDSNLSRDMAKKSLTNN  126

Query  531  LAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALS--TTNIIELPRQEE  704
            +   IY+D  +LQ++ ++   +L+A+ +  YG+ +++  N  +  +    ++  +P ++E
Sbjct  127  IGQAIYKDADQLQEMCRR-MPMLKAAKELEYGFMILDKKNPSSMFNPPAESVFVIPPEDE  185

Query  705  LKTVLDKVKDFFGGA  749
             +    K+ + +  A
Sbjct  186  TRMPAQKMAEGWQSA  200



>ref|XP_003056036.1| hypothetical protein MICPUCDRAFT_70697 [Micromonas pusilla CCMP1545]
 gb|EEH59412.1| hypothetical protein MICPUCDRAFT_70697 [Micromonas pusilla CCMP1545]
Length=214

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 79/146 (54%), Gaps = 16/146 (11%)
 Frame = +3

Query  354  LPKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARN  530
            LP ++ D N +FVI++R       WYPLN+VTGG+TA  +V   D+ L + +   +L  N
Sbjct  71   LPPIDPD-NEQFVIYVRSKKGFKAWYPLNVVTGGSTANTLVKGLDSDLSRELAVKSLTTN  129

Query  531  LAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTT--NIIELPRQEE  704
            +   IY++ ++L+++ ++   +L+ + +  +G+ +++ +N  +    T   +  +P ++E
Sbjct  130  IGQAIYKETEQLEEMCRR-MPMLKNAKELEFGFMVLDKSNPSSMFKPTADKVFVIPEEDE  188

Query  705  -----------LKTVLDKVKDFFGGA  749
                        +    KVKDF GG+
Sbjct  189  TRLPAQKMAEGFQNAAGKVKDFLGGS  214



>ref|XP_001695603.1| hypothetical protein CHLREDRAFT_205992 [Chlamydomonas reinhardtii]
 gb|EDP01390.1| predicted protein [Chlamydomonas reinhardtii]
Length=223

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 84/180 (47%), Gaps = 26/180 (14%)
 Frame = +3

Query  270  RVGRLMVVEAKGKKGMAARQ---------YQRNAPPPLPKLEDDGNPKFVIFIR------  404
            R    +  + KGK   A RQ          +R AP P     D  N +FVIF R      
Sbjct  34   RTSVQVFAKGKGKGKSALRQGSMPNQMEMVRREAPTPD---VDPENAEFVIFFRCLKYKD  90

Query  405  -----MADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQ  569
                 M    LW PL+IV G   +  +  A  +  G  +Y  TL   +A+ +Y+D+ +L+
Sbjct  91   PQLNAMVGPSLWVPLSIVKGNQVSNFLANAIKSPWGMRLYGRTLIWQMASGLYQDKAKLE  150

Query  570  KLAKKQFRVL--RASTDFRYGYKLVENNNLRTALSTTNIIELPRQEEL-KTVLDKVKDFF  740
            K  +K F      AS+DF+Y +K+ +  N +   +  N+   P  E+L +T LD++K FF
Sbjct  151  KELRKNFPPFANSASSDFQYAFKIRDKANPKDWTAAENLTFFPSPEDLGETGLDQLKKFF  210



>ref|XP_005534863.1| hypothetical protein CYME_CMJ126C [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80256.1| hypothetical protein CYME_CMJ126C [Cyanidioschyzon merolae strain 
10D]
Length=224

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 68/131 (52%), Gaps = 6/131 (5%)
 Frame = +3

Query  273  VGRLMVVEAKGKKGMAARQYQRNAP-PPLPKLE--DDGNPKFVIFIRMADVDLWYPLNIV  443
            V R   +  +G  G+ A++ + NAP  P  +LE  +DG P F I  R     LWYPL  +
Sbjct  51   VHRSTALPHRGVIGLQAKKGKPNAPLAPPSELEVPEDGTPVFAILARSPVSGLWYPLGTM  110

Query  444  TGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDE-KELQKLAKKQFRVLRAST--D  614
             G   AK++V A     G+  Y DTL + +A  ++ ++ + +   A +++  LR  T  D
Sbjct  111  RGDGRAKMLVNAMRTSWGRKFYGDTLNKGVARSVFSEQGRRMIHAALRKYSALRKYTADD  170

Query  615  FRYGYKLVENN  647
              YGY+++  +
Sbjct  171  LEYGYRVIAKD  181



>gb|AFW72181.1| hypothetical protein ZEAMMB73_079373 [Zea mays]
Length=92

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +3

Query  264  RQRVGRLMVVEAKGKKGMAARQYQRNAPPPL-PKLEDDGNPKFVIFIRMADV  416
            RQ   R +VVEA+G +G + RQ Q+    PL PK+EDDGNP+FVIFIR A+V
Sbjct  39   RQPARRALVVEARGGRGWSERQMQQQRRAPLLPKIEDDGNPRFVIFIRTANV  90



>ref|XP_002184929.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43665.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=206

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 71/151 (47%), Gaps = 9/151 (6%)
 Frame = +3

Query  300  KGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGT-TAKIMVA  476
            K K+ MA R+    A  P      DG P F +F+R    ++WYP     G   +A +  +
Sbjct  62   KQKEMMAMREEMIAAQKP----GQDGLPVFNLFVRTKKANMWYPCGSFKGDERSAALAKS  117

Query  477  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRAS-TDFRYGYKLVENNNL  653
              D  L   + K  +   +A  +YRD+ +L++   + +  LR S  DF +GYKL  +   
Sbjct  118  YADGGLLAGVSKRQIDGGIAGSLYRDQGKLKESVARSYPQLRKSREDFEFGYKLSYDGLS  177

Query  654  RTALSTTNIIELPRQEELKTVLDKVKDFFGG  746
                S   +IE P+  E K V D +K+ F G
Sbjct  178  EEQSSEIKVIE-PK--ETKGVFDSIKNAFSG  205



>ref|XP_007509245.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19702.1| predicted protein [Bathycoccus prasinos]
Length=171

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 73/136 (54%), Gaps = 21/136 (15%)
 Frame = +3

Query  354  LPKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGK------YIYK  512
            LP ++ D N +FVI++R    +  W+PLN+VTGG+TA  +V   D+ L K      + Y 
Sbjct  11   LPPIDPD-NEQFVIYVRSKKGLKTWFPLNVVTGGSTANTLVKGLDSNLSKDVCLSLFYYH  69

Query  513  ----------DTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  662
                       +L  N+   +Y+++ +L+++ +K   +L+++ +  YG+ +++  N  + 
Sbjct  70   FSHYFLQMALKSLTNNIGQALYKEQVQLEEMVRK-MPMLKSARELEYGFSVLDKKNPNSM  128

Query  663  L--STTNIIELPRQEE  704
               S  ++  +P +EE
Sbjct  129  FKPSEKDVYVIPPEEE  144



>ref|XP_002953545.1| hypothetical protein VOLCADRAFT_121174 [Volvox carteri f. nagariensis]
 gb|EFJ45518.1| hypothetical protein VOLCADRAFT_121174 [Volvox carteri f. nagariensis]
Length=233

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 74/146 (51%), Gaps = 17/146 (12%)
 Frame = +3

Query  348  PPLPKLEDDGNPKFVIFIRM---------ADV--DLWYPLNIVTGGTTAKIMVAAKDNFL  494
            PP+P++ D  N + V+F+R+          DV   LW P+N++ G      +V A     
Sbjct  66   PPVPEV-DPENAEIVLFVRVLKYKDPTLNMDVGPSLWMPVNLIKGNQVLNFLVEALKTDW  124

Query  495  GKYIYKDTLARNLAAVIYRDEKELQKLAKK---QFRVLRASTDFRYGYKLVENNNLRTAL  665
            G  +Y  TL   +A+ IY+D+ +++K  KK   QF    AS DF Y +K+ + +  +  L
Sbjct  125  GMRLYGRTLIWQIASGIYQDKAKVEKDLKKNVPQF-ANAASKDFEYAFKIRDKSVPKDWL  183

Query  666  STTNIIELPRQEELK-TVLDKVKDFF  740
               N+   P  E+L  T + ++K FF
Sbjct  184  KPENLTICPPPEDLAGTGVAQLKAFF  209



>ref|XP_005718910.1| unnamed protein product [Chondrus crispus]
 emb|CDF39005.1| unnamed protein product [Chondrus crispus]
Length=249

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 76/166 (46%), Gaps = 10/166 (6%)
 Frame = +3

Query  243  TAVPSRKRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDL  422
            T++P+R R     + + + + ++ +  R+ Q         L +DG P F IF+R     L
Sbjct  85   TSLPARARPTYTPIQMKKGRSRQPLQPRRAQDQM-----SLPEDGTPVFAIFVRTPRTKL  139

Query  423  WYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIY--RDEKELQKLAKKQFRV  596
            WYP+  V G   +K +V A      K +Y + L + +A  +Y    +K +Q   +   ++
Sbjct  140  WYPMGAVQGDDRSKNLVNALKGGFAKAMYANALDKGIAQTVYGKGGDKFVQSAVRMYPQL  199

Query  597  LRASTDFRYGYKL--VENNNLRTALSTTNIIELPRQEELKTVLDKV  728
             + +    +GY++  +  +   T L T   + LP  E  K  LD V
Sbjct  200  KKYTKQLEFGYRVTAIGLDEQPTKLVTKE-MALPFVEWAKKQLDNV  244



>gb|KIZ07565.1| hypothetical protein MNEG_0380 [Monoraphidium neglectum]
Length=159

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 21/150 (14%)
 Frame = +3

Query  348  PPLPKLEDDGNPKFVIFIRM--ADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTL  521
            PP+    D  N +FVIFIR        W  +++V GG++A ++V       G+ +Y  TL
Sbjct  6    PPV----DPENEEFVIFIRATSGSYQQWMNMSVVKGGSSANLLVKGMATEWGRKLYARTL  61

Query  522  ARNLAAVIYRDE----KELQKLAKKQFR-----VLR-----ASTDFRYGYKLVENNNLRT  659
              N+A  IY++     K L+   ++Q R     V+       + DF +  K+ +  N + 
Sbjct  62   LSNIAGSIYKERDAILKGLRDSVRQQIRMGGPKVMEPLLNVPAADFEFAMKIRDKANPKD  121

Query  660  ALSTTNIIELPRQEELKTV-LDKVKDFFGG  746
                 N+  LP + E+    LD+ K FF  
Sbjct  122  WSKPDNLTILPPESEITAQPLDRFKAFFSA  151



>gb|ADU15868.1| CLCuV responsive protein [Gossypium hirsutum]
Length=77

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  681  IELPRQEELKTVLDKVKDFFGGAKESFG  764
            IELP Q++LKTV+DKVKDFFG AKESFG
Sbjct  7    IELPTQDQLKTVVDKVKDFFGDAKESFG  34



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2828948199880