BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8010

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609876.1|  PREDICTED: glutaredoxin-C5, chloroplastic-li...    229   2e-71   Nicotiana tomentosiformis
ref|XP_009796776.1|  PREDICTED: monothiol glutaredoxin-S10-like i...    227   9e-71   Nicotiana sylvestris
ref|XP_006352722.1|  PREDICTED: glutaredoxin-C5, chloroplastic-like     227   1e-70   Solanum tuberosum [potatoes]
ref|XP_002267052.1|  PREDICTED: monothiol glutaredoxin-S10              226   3e-70   Vitis vinifera
ref|XP_010323070.1|  PREDICTED: monothiol glutaredoxin-S10              225   9e-70   Solanum lycopersicum
ref|XP_008235553.1|  PREDICTED: monothiol glutaredoxin-S10              220   7e-68   Prunus mume [ume]
emb|CBI37229.3|  unnamed protein product                                216   2e-67   Vitis vinifera
ref|XP_007201404.1|  hypothetical protein PRUPE_ppa012249mg             218   2e-67   Prunus persica
ref|XP_009370908.1|  PREDICTED: glutaredoxin-C5, chloroplastic          218   3e-67   Pyrus x bretschneideri [bai li]
gb|KJB06393.1|  hypothetical protein B456_001G236100                    216   1e-66   Gossypium raimondii
gb|KDO65783.1|  hypothetical protein CISIN_1g030613mg                   215   3e-66   Citrus sinensis [apfelsine]
ref|XP_008382672.1|  PREDICTED: monothiol glutaredoxin-S10-like i...    215   5e-66   
ref|XP_006443689.1|  hypothetical protein CICLE_v10022530mg             214   1e-65   Citrus clementina [clementine]
ref|XP_010263985.1|  PREDICTED: monothiol glutaredoxin-S10 isofor...    213   2e-65   Nelumbo nucifera [Indian lotus]
ref|XP_007050085.1|  Glutaredoxin family protein isoform 1              213   3e-65   Theobroma cacao [chocolate]
gb|KJB06394.1|  hypothetical protein B456_001G236100                    212   8e-65   Gossypium raimondii
ref|NP_001238538.1|  uncharacterized protein LOC100305906               211   2e-64   Glycine max [soybeans]
gb|KHN48963.1|  Glutaredoxin-C5, chloroplastic                          208   2e-63   Glycine soja [wild soybean]
ref|XP_012085184.1|  PREDICTED: monothiol glutaredoxin-S10-like         207   5e-63   Jatropha curcas
ref|XP_003542446.2|  PREDICTED: glutaredoxin-C5, chloroplastic is...    207   7e-63   Glycine max [soybeans]
pdb|3FZ9|A  Chain A, Crystal Structure Of Poplar Glutaredoxin S12...    204   8e-63   Populus tremula x Populus tremuloides
ref|XP_011083086.1|  PREDICTED: monothiol glutaredoxin-S10-like i...    206   9e-63   Sesamum indicum [beniseed]
ref|XP_004140671.2|  PREDICTED: glutaredoxin-C5, chloroplastic-like     206   3e-62   Cucumis sativus [cucumbers]
ref|XP_010548722.1|  PREDICTED: glutaredoxin-C5, chloroplastic-like     205   5e-62   Tarenaya hassleriana [spider flower]
gb|ACF74281.1|  electron transporter/thiol-disulfide exchange int...    203   2e-61   Arachis hypogaea [goober]
ref|XP_008459988.1|  PREDICTED: glutaredoxin-C5, chloroplastic          202   7e-61   Cucumis melo [Oriental melon]
ref|XP_010091846.1|  Glutaredoxin-C5                                    202   7e-61   Morus notabilis
ref|XP_010069686.1|  PREDICTED: monothiol glutaredoxin-S10              202   8e-61   Eucalyptus grandis [rose gum]
ref|XP_006854323.2|  PREDICTED: monothiol glutaredoxin-S10              199   8e-60   Amborella trichopoda
gb|ACJ60637.1|  glutaredoxin S12                                        197   4e-59   Populus tremula x Populus tremuloides
gb|AFK37707.1|  unknown                                                 197   4e-59   Lotus japonicus
ref|XP_004290010.1|  PREDICTED: glutaredoxin-C5, chloroplastic          196   1e-58   Fragaria vesca subsp. vesca
ref|XP_007144429.1|  hypothetical protein PHAVU_007G155300g             196   4e-58   Phaseolus vulgaris [French bean]
ref|XP_010243630.1|  PREDICTED: monothiol glutaredoxin-S10-like i...    194   5e-58   Nelumbo nucifera [Indian lotus]
ref|XP_006386902.1|  hypothetical protein POPTR_0002s25540g             194   8e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011024523.1|  PREDICTED: monothiol glutaredoxin-S10              194   1e-57   Populus euphratica
ref|XP_004495035.1|  PREDICTED: glutaredoxin-C5, chloroplastic-like     193   2e-57   Cicer arietinum [garbanzo]
ref|XP_006412917.1|  hypothetical protein EUTSA_v10026359mg             193   2e-57   Eutrema salsugineum [saltwater cress]
gb|EYU46373.1|  hypothetical protein MIMGU_mgv1a014667mg                192   4e-57   Erythranthe guttata [common monkey flower]
gb|KJB42409.1|  hypothetical protein B456_007G151300                    191   7e-57   Gossypium raimondii
ref|XP_002869477.1|  hypothetical protein ARALYDRAFT_491884             191   2e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010540941.1|  PREDICTED: monothiol glutaredoxin-S12, chlor...    190   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_006282737.1|  hypothetical protein CARUB_v10005878mg             190   2e-56   Capsella rubella
ref|XP_010433169.1|  PREDICTED: glutaredoxin-C5, chloroplastic-like     190   3e-56   Camelina sativa [gold-of-pleasure]
emb|CDY50922.1|  BnaA03g59000D                                          189   5e-56   Brassica napus [oilseed rape]
pdb|3RHB|A  Chain A, Crystal Structure Of The Apo Form Of Glutare...    187   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008789485.1|  PREDICTED: monothiol glutaredoxin-S10              189   7e-56   Phoenix dactylifera
gb|KJB06395.1|  hypothetical protein B456_001G236100                    188   8e-56   Gossypium raimondii
ref|XP_010438390.1|  PREDICTED: glutaredoxin-C5, chloroplastic          189   8e-56   Camelina sativa [gold-of-pleasure]
gb|EYU17959.1|  hypothetical protein MIMGU_mgv1a014885mg                189   9e-56   Erythranthe guttata [common monkey flower]
gb|KHG15724.1|  Glutaredoxin-C5, chloroplastic -like protein            188   1e-55   Gossypium arboreum [tree cotton]
ref|XP_010447922.1|  PREDICTED: glutaredoxin-C5, chloroplastic          188   2e-55   Camelina sativa [gold-of-pleasure]
gb|AFK36721.1|  unknown                                                 187   4e-55   Medicago truncatula
emb|CDP03824.1|  unnamed protein product                                184   4e-55   Coffea canephora [robusta coffee]
emb|CDX97456.1|  BnaC08g13210D                                          187   5e-55   
ref|XP_010940680.1|  PREDICTED: monothiol glutaredoxin-S10              187   5e-55   Elaeis guineensis
ref|XP_010684815.1|  PREDICTED: glutaredoxin-C5, chloroplastic          187   6e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_194602.2|  glutaredoxin-C5                                       186   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007050087.1|  Glutaredoxin family protein isoform 3              185   2e-54   Theobroma cacao [chocolate]
ref|XP_010243631.1|  PREDICTED: monothiol glutaredoxin-S10-like i...    184   3e-54   Nelumbo nucifera [Indian lotus]
emb|CDY68269.1|  BnaA08g30760D                                          184   4e-54   Brassica napus [oilseed rape]
ref|XP_009109071.1|  PREDICTED: glutaredoxin-C5, chloroplastic-like     184   7e-54   Brassica rapa
emb|CDX92892.1|  BnaC07g41500D                                          184   7e-54   
ref|XP_009405704.1|  PREDICTED: monothiol glutaredoxin-S10              183   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008372416.1|  PREDICTED: monothiol glutaredoxin-S10-like         183   2e-53   
ref|XP_006659715.1|  PREDICTED: LOW QUALITY PROTEIN: monothiol gl...    180   2e-52   Oryza brachyantha
ref|XP_006408941.1|  hypothetical protein EUTSA_v10002105mg             179   4e-52   Eutrema salsugineum [saltwater cress]
ref|XP_002445658.1|  hypothetical protein SORBIDRAFT_07g023540          179   5e-52   Sorghum bicolor [broomcorn]
ref|XP_009137805.1|  PREDICTED: glutaredoxin-C5, chloroplastic-like     178   1e-51   Brassica rapa
ref|XP_004974268.1|  PREDICTED: monothiol glutaredoxin-S10-like         177   2e-51   Setaria italica
dbj|BAK05185.1|  predicted protein                                      177   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011080141.1|  PREDICTED: monothiol glutaredoxin-S10-like         177   2e-51   Sesamum indicum [beniseed]
emb|CDY06875.1|  BnaC01g09740D                                          177   3e-51   
ref|XP_003573227.1|  PREDICTED: monothiol glutaredoxin-S10-like         176   4e-51   Brachypodium distachyon [annual false brome]
ref|NP_001175705.1|  Os08g0565800                                       176   5e-51   
ref|XP_009129320.1|  PREDICTED: glutaredoxin-C5, chloroplastic          176   5e-51   Brassica rapa
ref|NP_001141356.1|  uncharacterized protein LOC100273447               176   6e-51   Zea mays [maize]
gb|EAZ08051.1|  hypothetical protein OsI_30316                          176   7e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_010243632.1|  PREDICTED: monothiol glutaredoxin-S10-like i...    174   2e-50   Nelumbo nucifera [Indian lotus]
gb|ACF82007.1|  unknown                                                 173   6e-50   Zea mays [maize]
ref|NP_001148595.1|  Grx_S12 - glutaredoxin subgroup I                  171   8e-49   
ref|XP_002883935.1|  hypothetical protein ARALYDRAFT_899837             169   3e-48   
gb|ERN15790.1|  hypothetical protein AMTR_s00039p00123020               165   1e-47   Amborella trichopoda
ref|XP_006298612.1|  hypothetical protein CARUB_v10014698mg             167   2e-47   
ref|XP_010495920.1|  PREDICTED: monothiol glutaredoxin-S12, chlor...    166   3e-47   Camelina sativa [gold-of-pleasure]
emb|CDY05731.1|  BnaC07g00720D                                          166   6e-47   
ref|XP_009102049.1|  PREDICTED: monothiol glutaredoxin-S12, chlor...    165   2e-46   Brassica rapa
ref|XP_010489071.1|  PREDICTED: monothiol glutaredoxin-S12, chlor...    165   2e-46   
emb|CDY31980.1|  BnaA07g00150D                                          164   2e-46   Brassica napus [oilseed rape]
ref|XP_006443692.1|  hypothetical protein CICLE_v10022530mg             163   3e-46   
ref|NP_179617.1|  monothiol glutaredoxin-S12                            164   4e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KJB42411.1|  hypothetical protein B456_007G151300                    163   6e-46   Gossypium raimondii
ref|XP_002525351.1|  glutaredoxin, grx, putative                        162   8e-46   Ricinus communis
gb|KDO65787.1|  hypothetical protein CISIN_1g030613mg                   162   9e-46   Citrus sinensis [apfelsine]
ref|XP_010416046.1|  PREDICTED: monothiol glutaredoxin-S12, chlor...    162   1e-45   
gb|AAM64584.1|  putative glutaredoxin                                   162   2e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KJB42410.1|  hypothetical protein B456_007G151300                    159   2e-44   Gossypium raimondii
ref|XP_010263986.1|  PREDICTED: glutaredoxin-C5, chloroplastic is...    155   5e-43   Nelumbo nucifera [Indian lotus]
gb|KFK40389.1|  hypothetical protein AALP_AA3G367200                    155   1e-42   Arabis alpina [alpine rockcress]
emb|CAA22979.1|  putative protein                                       154   3e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KDO65785.1|  hypothetical protein CISIN_1g030613mg                   150   3e-41   Citrus sinensis [apfelsine]
dbj|BAD10332.1|  glutaredoxin protein family-like                       149   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001189560.1|  monothiol glutaredoxin-S12                         148   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521163.1|  glutaredoxin, grx, putative                        146   1e-39   
gb|ABK23374.1|  unknown                                                 147   2e-39   Picea sitchensis
gb|ABK22430.1|  unknown                                                 147   2e-39   Picea sitchensis
ref|XP_011083087.1|  PREDICTED: glutaredoxin-C5, chloroplastic-li...    143   2e-38   
gb|ABR18238.1|  unknown                                                 141   1e-37   Picea sitchensis
ref|XP_002303098.2|  glutaredoxin family protein                        134   1e-34   
ref|XP_001782119.1|  predicted protein                                  115   4e-28   
ref|XP_005539560.1|  glutaredoxin type 1                                115   2e-27   Cyanidioschyzon merolae strain 10D
gb|KDO65788.1|  hypothetical protein CISIN_1g030613mg                   110   2e-26   Citrus sinensis [apfelsine]
ref|XP_009352869.1|  PREDICTED: monothiol glutaredoxin-S12, chlor...    108   6e-25   
ref|XP_007209772.1|  hypothetical protein PRUPE_ppa013483mg             106   8e-25   Prunus persica
ref|XP_009367237.1|  PREDICTED: monothiol glutaredoxin-S12, chlor...    107   8e-25   Pyrus x bretschneideri [bai li]
ref|XP_008245004.1|  PREDICTED: glutaredoxin                            106   9e-25   Prunus mume [ume]
ref|XP_009341624.1|  PREDICTED: monothiol glutaredoxin-S12, chlor...    107   1e-24   
ref|XP_009395004.1|  PREDICTED: glutaredoxin-like                       105   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415793.1|  PREDICTED: glutaredoxin-like                       104   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002947896.1|  hypothetical protein VOLCADRAFT_79918              105   2e-24   Volvox carteri f. nagariensis
ref|XP_006652495.1|  PREDICTED: glutaredoxin-C6-like                    104   3e-24   
ref|XP_009362980.1|  PREDICTED: glutaredoxin                            105   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_008382673.1|  PREDICTED: monothiol glutaredoxin-S12, chlor...    105   3e-24   
ref|XP_011655411.1|  PREDICTED: glutaredoxin-C6                         103   4e-24   Cucumis sativus [cucumbers]
ref|XP_008458784.1|  PREDICTED: glutaredoxin-C6                         103   8e-24   Cucumis melo [Oriental melon]
ref|XP_007140969.1|  hypothetical protein PHAVU_008G156300g             103   8e-24   Phaseolus vulgaris [French bean]
ref|NP_001053270.1|  Os04g0508300                                       103   1e-23   
gb|AAK53442.2|AF374461_1  glutaredoxin                                  102   1e-23   Deschampsia antarctica
ref|XP_002446766.1|  hypothetical protein SORBIDRAFT_06g022060          103   2e-23   Sorghum bicolor [broomcorn]
ref|XP_008393010.1|  PREDICTED: glutaredoxin                            102   2e-23   
emb|CDY16749.1|  BnaA09g06330D                                          102   3e-23   Brassica napus [oilseed rape]
emb|CAA54397.1|  glutaredoxin                                           102   3e-23   Oryza sativa [red rice]
ref|XP_002905608.1|  glutaredoxin                                       101   3e-23   Phytophthora infestans T30-4
gb|AEQ39038.1|  putative glutaredoxin-like protein                      101   3e-23   Wolffia arrhiza
gb|KJB33810.1|  hypothetical protein B456_006G031800                    101   3e-23   Gossypium raimondii
ref|XP_010555955.1|  PREDICTED: glutaredoxin-C2                         101   3e-23   Tarenaya hassleriana [spider flower]
ref|XP_009518274.1|  hypothetical protein PHYSODRAFT_324251             101   4e-23   Phytophthora sojae
ref|XP_009768204.1|  PREDICTED: glutaredoxin                            101   4e-23   Nicotiana sylvestris
gb|AAB92419.1|  glutaredoxin type 1                                     101   4e-23   Fritillaria agrestis
ref|XP_009625431.1|  PREDICTED: glutaredoxin                            101   4e-23   Nicotiana tomentosiformis
ref|NP_001274139.1|  glutaredoxin                                       101   6e-23   Cucumis sativus [cucumbers]
ref|XP_004501914.1|  PREDICTED: glutaredoxin-C1-like                    101   7e-23   Cicer arietinum [garbanzo]
gb|EYU44772.1|  hypothetical protein MIMGU_mgv1a016788mg                100   7e-23   Erythranthe guttata [common monkey flower]
ref|XP_008904979.1|  glutaredoxin                                       100   8e-23   Phytophthora parasitica INRA-310
ref|XP_002511377.1|  glutaredoxin-1, grx1, putative                     100   9e-23   Ricinus communis
ref|XP_002968569.1|  CYPC type glutaredoxin                             100   9e-23   Selaginella moellendorffii
ref|XP_011396655.1|  Glutaredoxin-C6                                    100   1e-22   Auxenochlorella protothecoides
dbj|BAK01747.1|  predicted protein                                      100   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009539442.1|  hypothetical protein PHYSODRAFT_348647             100   1e-22   Phytophthora sojae
ref|XP_011098448.1|  PREDICTED: glutaredoxin isoform X2                 100   1e-22   
gb|ACF86986.1|  unknown                                                 100   1e-22   Zea mays [maize]
ref|XP_004298962.1|  PREDICTED: glutaredoxin isoform X1                 100   1e-22   Fragaria vesca subsp. vesca
gb|AEW90961.1|  glutaredoxin 4H1                                        100   1e-22   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
gb|EMT22737.1|  Glutaredoxin-C6                                         100   1e-22   
ref|XP_012080039.1|  PREDICTED: glutaredoxin                            100   1e-22   Jatropha curcas
ref|XP_006840663.1|  PREDICTED: glutaredoxin                            100   2e-22   Amborella trichopoda
ref|XP_004976172.1|  PREDICTED: glutaredoxin-C6-like                    100   2e-22   Setaria italica
gb|ACF40843.1|  glutaredoxin                                          99.8    2e-22   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001149712.1|  glutaredoxin homolog1                              100   2e-22   Zea mays [maize]
gb|ABP48736.1|  glutaredoxin                                          99.8    2e-22   Ipomoea batatas [batate]
emb|CDX87276.1|  BnaC09g05910D                                          100   2e-22   
ref|XP_009770952.1|  PREDICTED: glutaredoxin                            100   2e-22   Nicotiana sylvestris
ref|XP_006439850.1|  hypothetical protein CICLE_v10022897mg           99.8    3e-22   Citrus clementina [clementine]
ref|NP_001274936.1|  glutaredoxin                                     99.0    3e-22   Solanum tuberosum [potatoes]
emb|CDP02089.1|  unnamed protein product                              99.0    3e-22   Coffea canephora [robusta coffee]
ref|XP_006476805.1|  PREDICTED: glutaredoxin-C1-like                  99.4    3e-22   Citrus sinensis [apfelsine]
gb|ABX60201.1|  glutaredoxin                                          99.0    3e-22   Panax ginseng [Asiatic ginseng]
ref|XP_010029144.1|  PREDICTED: glutaredoxin-like                     99.0    4e-22   Eucalyptus grandis [rose gum]
ref|XP_011098447.1|  PREDICTED: glutaredoxin isoform X1               99.0    4e-22   Sesamum indicum [beniseed]
ref|XP_004304641.1|  PREDICTED: glutaredoxin                          98.6    4e-22   Fragaria vesca subsp. vesca
ref|XP_002868660.1|  hypothetical protein ARALYDRAFT_916213           98.6    5e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_003601243.1|  Glutaredoxin                                     99.0    5e-22   Medicago truncatula
ref|XP_002524673.1|  glutaredoxin-1, grx1, putative                   98.2    5e-22   Ricinus communis
ref|XP_010550681.1|  PREDICTED: glutaredoxin-C1-like                  99.0    5e-22   Tarenaya hassleriana [spider flower]
gb|AEW90962.1|  glutaredoxin 4H6                                      99.0    5e-22   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_009112052.1|  PREDICTED: glutaredoxin-C1                       99.0    5e-22   Brassica rapa
ref|XP_006338581.1|  PREDICTED: glutaredoxin-like                     98.2    6e-22   Solanum tuberosum [potatoes]
gb|AFK43408.1|  unknown                                               98.2    6e-22   Lotus japonicus
ref|XP_002898433.1|  glutaredoxin                                     98.6    7e-22   Phytophthora infestans T30-4
ref|XP_001770884.1|  predicted protein                                97.8    7e-22   
emb|CDS10348.1|  hypothetical protein LRAMOSA03024                    98.2    7e-22   Lichtheimia ramosa
emb|CDP16916.1|  unnamed protein product                              98.2    8e-22   Coffea canephora [robusta coffee]
ref|XP_008438572.1|  PREDICTED: glutaredoxin                          98.6    8e-22   Cucumis melo [Oriental melon]
ref|XP_010029146.1|  PREDICTED: glutaredoxin-like                     97.8    9e-22   Eucalyptus grandis [rose gum]
ref|XP_009112048.1|  PREDICTED: glutaredoxin-C1-like                  97.8    1e-21   Brassica rapa
gb|AEP25125.1|  glutaredoxin                                          98.2    1e-21   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_010102526.1|  hypothetical protein L484_014582                 98.2    1e-21   Morus notabilis
emb|CAA89699.1|  glutaredoxin                                         97.4    1e-21   Ricinus communis
ref|XP_011071887.1|  PREDICTED: glutaredoxin                          97.8    1e-21   
gb|EPS66621.1|  glutaredoxin                                          97.4    1e-21   Genlisea aurea
gb|KHN97290.1|  Thioredoxin-like fold protein                         97.4    1e-21   Metarhizium album ARSEF 1941
ref|XP_008895171.1|  glutaredoxin                                     97.1    1e-21   Phytophthora parasitica INRA-310
ref|XP_003580104.1|  PREDICTED: glutaredoxin-C6                       97.8    2e-21   Brachypodium distachyon [annual false brome]
gb|KHG20347.1|  Glutaredoxin-C2 -like protein                         97.1    2e-21   Gossypium arboreum [tree cotton]
gb|KFK28027.1|  hypothetical protein AALP_AA8G462200                  97.4    2e-21   Arabis alpina [alpine rockcress]
ref|XP_009602632.1|  PREDICTED: glutaredoxin                          97.4    2e-21   Nicotiana tomentosiformis
emb|CDX84377.1|  BnaC03g51230D                                        97.4    2e-21   
ref|XP_009150366.1|  PREDICTED: glutaredoxin-C1-like                  97.4    2e-21   Brassica rapa
ref|XP_002276266.1|  PREDICTED: glutaredoxin                          97.1    2e-21   Vitis vinifera
gb|KEH22257.1|  glutaredoxin C4                                       97.1    2e-21   Medicago truncatula
gb|ABK21230.1|  unknown                                               97.4    2e-21   Picea sitchensis
ref|XP_006405503.1|  hypothetical protein EUTSA_v10027999mg           96.7    2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_006284798.1|  hypothetical protein CARUB_v10006067mg           96.7    2e-21   Capsella rubella
ref|XP_002866529.1|  hypothetical protein ARALYDRAFT_919585           97.1    3e-21   Arabidopsis lyrata subsp. lyrata
gb|KJB53201.1|  hypothetical protein B456_008G296500                  96.7    3e-21   Gossypium raimondii
gb|AAM67134.1|  glutaredoxin-like protein                             96.7    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005782310.1|  hypothetical protein EMIHUDRAFT_60433            95.9    3e-21   Emiliania huxleyi CCMP1516
gb|EPS66469.1|  hypothetical protein M569_08309                       96.7    4e-21   Genlisea aurea
ref|XP_005787407.1|  putative glutaredoxin                            95.9    4e-21   Emiliania huxleyi CCMP1516
emb|CDX87275.1|  BnaC09g05900D                                        96.3    4e-21   
ref|XP_010441172.1|  PREDICTED: glutaredoxin-C2                       95.9    5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010435909.1|  PREDICTED: glutaredoxin-C2-like                  95.9    5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_011028538.1|  PREDICTED: glutaredoxin-C1                       97.8    5e-21   Populus euphratica
ref|NP_001233988.1|  glutaredoxin                                     95.9    5e-21   
ref|XP_002322172.1|  glutaredoxin family protein                      96.3    6e-21   Populus trichocarpa [western balsam poplar]
emb|CDY16750.1|  BnaA09g06320D                                        95.9    6e-21   Brassica napus [oilseed rape]
gb|EEC73608.1|  hypothetical protein OsI_08091                        95.5    7e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_002504226.1|  predicted protein                                95.5    7e-21   Micromonas commoda
gb|AAV73806.1|  glutaredoxin                                          95.9    7e-21   Populus tremula x Populus tremuloides
ref|XP_006260718.1|  PREDICTED: glutaredoxin-2, mitochondrial         96.3    8e-21   
ref|XP_006039251.1|  PREDICTED: glutaredoxin-2, mitochondrial         95.9    8e-21   Alligator sinensis
pdb|2E7P|A  Chain A, Crystal Structure Of The Holo Form Of Glutar...  95.5    8e-21   Populus tremula x Populus tremuloides
gb|ENH85899.1|  glutaredoxin                                          95.1    8e-21   
ref|XP_003601242.1|  Glutaredoxin                                     95.9    9e-21   Medicago truncatula
ref|XP_002960344.1|  CPYC type glutaredoxin                           95.1    9e-21   
gb|KKA26321.1|  hypothetical protein TD95_003515                      94.7    1e-20   Thielaviopsis punctulata
ref|XP_003059849.1|  predicted protein                                94.4    1e-20   Micromonas pusilla CCMP1545
pdb|1Z7P|A  Chain A, Solution Structure Of Reduced Glutaredoxin C...  95.1    1e-20   Populus tremula x Populus tremuloides
ref|XP_009334103.1|  PREDICTED: glutaredoxin                          94.7    1e-20   Pyrus x bretschneideri [bai li]
ref|NP_001275104.1|  glutaredoxin                                     95.1    1e-20   Solanum tuberosum [potatoes]
dbj|BAM15272.1|  glutaredoxin                                         95.1    1e-20   Solanum tuberosum [potatoes]
ref|NP_568962.1|  glutaredoxin-C1                                     95.1    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198853.1|  glutaredoxin-C2                                     94.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB08846.1|  glutaredoxin-like protein                            94.4    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|EPZ36542.1|  Glutaredoxin, eukaryotic/virial domain-containing...  94.0    2e-20   Rozella allomycis CSF55
ref|XP_010940165.1|  PREDICTED: glutaredoxin-like                     94.7    2e-20   Elaeis guineensis
sp|Q6K953.1|GRXC4_ORYSJ  RecName: Full=Glutaredoxin-C4, chloropla...  95.1    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010027488.1|  PREDICTED: glutaredoxin-like                     94.7    2e-20   Eucalyptus grandis [rose gum]
ref|XP_002866528.1|  predicted protein                                94.4    2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_007031532.1|  Glutaredoxin family protein                      94.0    2e-20   Theobroma cacao [chocolate]
ref|XP_010251178.1|  PREDICTED: glutaredoxin-like                     94.0    3e-20   Nelumbo nucifera [Indian lotus]
emb|CDH54497.1|  glutaredoxin                                         94.0    3e-20   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_010444169.1|  PREDICTED: glutaredoxin-C1-like                  94.4    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010444170.1|  PREDICTED: glutaredoxin-C1-like                  94.0    3e-20   
ref|XP_011047332.1|  PREDICTED: glutaredoxin                          93.6    3e-20   Populus euphratica
ref|XP_004491729.1|  PREDICTED: glutaredoxin-C2-like                  93.6    3e-20   
ref|XP_004236221.1|  PREDICTED: glutaredoxin                          94.0    3e-20   Solanum lycopersicum
gb|KID97161.1|  Thioredoxin-like fold protein                         93.6    3e-20   Metarhizium majus ARSEF 297
ref|XP_011001506.1|  PREDICTED: glutaredoxin-C1-like                  94.0    3e-20   Populus euphratica
ref|XP_008812171.1|  PREDICTED: glutaredoxin                          94.0    3e-20   Phoenix dactylifera
ref|XP_011464031.1|  PREDICTED: glutaredoxin isoform X2               94.0    4e-20   Fragaria vesca subsp. vesca
gb|ACZ05049.1|  putative glutaredoxin                                 93.2    4e-20   Polygonatum sibiricum [huang jing]
gb|EPB82485.1|  glutaredoxin                                          93.2    4e-20   Mucor circinelloides f. circinelloides 1006PhL
emb|CDX99634.1|  BnaC04g33910D                                        94.7    4e-20   
gb|KID91697.1|  Thioredoxin-like fold protein                         93.2    4e-20   Metarhizium guizhouense ARSEF 977
gb|AFK36197.1|  unknown                                               93.6    5e-20   Lotus japonicus
emb|CBI15005.3|  unnamed protein product                              93.2    5e-20   Vitis vinifera
dbj|GAN05639.1|  glutaredoxin Grx1                                    93.2    5e-20   Mucor ambiguus
ref|XP_006281325.1|  hypothetical protein CARUB_v10027378mg           93.6    6e-20   Capsella rubella
ref|XP_009796016.1|  PREDICTED: glutaredoxin-C4                       93.6    6e-20   Nicotiana sylvestris
gb|KFK28026.1|  hypothetical protein AALP_AA8G462100                  92.8    7e-20   Arabis alpina [alpine rockcress]
ref|XP_006394326.1|  hypothetical protein EUTSA_v10004952mg           95.1    7e-20   
ref|XP_002282196.1|  PREDICTED: glutaredoxin                          93.2    7e-20   Vitis vinifera
ref|XP_002527695.1|  glutaredoxin-1, grx1, putative                   93.6    7e-20   Ricinus communis
gb|KGQ02843.1|  Glutaredoxin                                          92.4    7e-20   Beauveria bassiana D1-5
ref|XP_010546004.1|  PREDICTED: glutaredoxin-C1-like                  92.8    8e-20   Tarenaya hassleriana [spider flower]
ref|XP_010678795.1|  PREDICTED: glutaredoxin                          92.8    9e-20   
ref|NP_001158948.1|  Grx_C2.1 - glutaredoxin subgroup I               92.8    1e-19   Zea mays [maize]
ref|XP_008781810.1|  PREDICTED: glutaredoxin-C8                       92.8    1e-19   Phoenix dactylifera
ref|XP_012090885.1|  PREDICTED: glutaredoxin-C4-like                  92.4    2e-19   Jatropha curcas
gb|AAP80853.1|  glutaredoxin                                          91.7    2e-19   Triticum aestivum [Canadian hard winter wheat]
emb|CEI88366.1|  Putative Glutaredoxin                                91.7    2e-19   Rhizopus microsporus
ref|XP_007811900.1|  glutaredoxin Grx1, putative                      91.3    2e-19   Metarhizium acridum CQMa 102
ref|XP_002452461.1|  hypothetical protein SORBIDRAFT_04g026180        91.7    2e-19   Sorghum bicolor [broomcorn]
ref|XP_009619991.1|  PREDICTED: glutaredoxin-C4                       92.0    2e-19   Nicotiana tomentosiformis
ref|XP_006975412.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  91.7    2e-19   Peromyscus maniculatus bairdii
ref|XP_008379226.1|  PREDICTED: glutaredoxin                          91.3    2e-19   
emb|CDP03012.1|  unnamed protein product                              92.0    3e-19   Coffea canephora [robusta coffee]
ref|XP_002325236.1|  hypothetical protein POPTR_0018s13330g           91.7    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_007063048.1|  PREDICTED: glutaredoxin-2, mitochondrial         91.7    3e-19   
ref|XP_010037548.1|  PREDICTED: glutaredoxin-C1                       90.9    3e-19   
ref|XP_004953119.1|  PREDICTED: glutaredoxin-C4, chloroplastic-like   91.3    3e-19   
ref|XP_007466261.1|  PREDICTED: glutaredoxin-2, mitochondrial         91.3    3e-19   
ref|XP_005073511.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  91.3    3e-19   
ref|XP_006129207.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  91.3    3e-19   
ref|XP_008540972.1|  PREDICTED: glutaredoxin 2                        91.3    3e-19   
gb|KFH66660.1|  glutaredoxin 3                                        90.9    3e-19   
gb|KID75752.1|  Thioredoxin-like fold protein                         90.9    3e-19   
gb|AAL04507.1|AF406809_1  glutaredoxin                                90.9    3e-19   
ref|XP_007036260.1|  Glutaredoxin                                     91.3    3e-19   
ref|XP_003871369.1|  hypothetical protein CORT_0H01280                90.9    3e-19   
ref|XP_008453541.1|  PREDICTED: glutaredoxin-C4-like                  91.3    3e-19   
ref|XP_003999483.1|  PREDICTED: glutaredoxin 2                        91.3    4e-19   
ref|XP_005608087.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  91.3    4e-19   
ref|XP_007413742.1|  hypothetical protein MELLADRAFT_49690            91.7    4e-19   
ref|XP_005756067.1|  putative glutaredoxin                            91.7    4e-19   
emb|CEI99195.1|  Putative Glutaredoxin                                90.9    4e-19   
gb|AAL90750.1|  glutaredoxin                                          91.3    4e-19   
ref|XP_002318656.2|  glutaredoxin family protein                      90.9    4e-19   
ref|XP_004862824.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.9    4e-19   
ref|XP_011228364.1|  PREDICTED: glutaredoxin 2 isoform X2             90.9    4e-19   
ref|XP_005778251.1|  putative glutaredoxin                            91.7    4e-19   
gb|KDO26290.1|  hypothetical protein SPRG_08365                       91.3    4e-19   
ref|XP_009139994.1|  PREDICTED: glutaredoxin-C2                       90.5    4e-19   
ref|XP_010484022.1|  PREDICTED: glutaredoxin-C1-like                  90.9    4e-19   
ref|XP_004751556.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.9    4e-19   
ref|XP_004146345.1|  PREDICTED: glutaredoxin-C4-like                  90.9    5e-19   
ref|XP_010459711.1|  PREDICTED: glutaredoxin-C1                       90.9    5e-19   
ref|XP_008683869.1|  PREDICTED: glutaredoxin 2                        90.9    5e-19   
ref|XP_006648842.1|  PREDICTED: glutaredoxin-C4, chloroplastic-like   90.9    5e-19   
ref|XP_006186172.1|  PREDICTED: glutaredoxin-2, mitochondrial         90.9    5e-19   
ref|XP_010913704.1|  PREDICTED: glutaredoxin-C8                       90.9    5e-19   
ref|XP_007191222.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.5    5e-19   
ref|XP_005375163.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.5    6e-19   
ref|XP_006203696.1|  PREDICTED: glutaredoxin-2, mitochondrial         91.7    6e-19   
ref|XP_008266947.1|  PREDICTED: glutaredoxin 2 isoform X2             90.5    6e-19   
emb|CDY36849.1|  BnaC04g32420D                                        90.1    6e-19   
ref|XP_004146344.1|  PREDICTED: glutaredoxin-C4-like                  90.9    6e-19   
emb|CCK69159.1|  hypothetical protein KNAG_0C00450                    91.3    6e-19   
ref|XP_006975411.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  91.3    6e-19   
ref|XP_005073510.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  91.3    6e-19   
ref|XP_006061480.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.5    6e-19   
emb|CBQ69365.1|  probable GRX1-glutaredoxin                           89.7    6e-19   
emb|CEG63628.1|  Putative Glutaredoxin                                90.1    6e-19   
gb|EFB28798.1|  hypothetical protein PANDA_012565                     89.7    7e-19   
ref|XP_005306934.1|  PREDICTED: glutaredoxin 2 isoform X2             90.5    7e-19   
ref|XP_006728486.1|  PREDICTED: glutaredoxin-2, mitochondrial         90.1    7e-19   
ref|XP_007191221.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.5    7e-19   
ref|XP_005690511.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.1    8e-19   
ref|XP_003434349.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.1    8e-19   
ref|XP_005375162.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.5    8e-19   
ref|XP_003595130.1|  Glutaredoxin-C4                                  90.5    8e-19   
ref|XP_010160316.1|  PREDICTED: glutaredoxin-2, mitochondrial-like    90.1    8e-19   
ref|XP_011069942.1|  PREDICTED: glutaredoxin-C4                       90.5    9e-19   
ref|XP_003938198.1|  PREDICTED: glutaredoxin 2                        90.1    9e-19   
gb|EHK19476.1|  hypothetical protein TRIVIDRAFT_80922                 89.4    1e-18   
ref|XP_007191220.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.1    1e-18   
ref|XP_010607057.1|  PREDICTED: glutaredoxin 2 isoform X2             89.7    1e-18   
emb|CEG78523.1|  Putative Glutaredoxin                                89.7    1e-18   
ref|XP_010251180.1|  PREDICTED: glutaredoxin-like                     90.1    1e-18   
ref|XP_008266946.1|  PREDICTED: glutaredoxin 2 isoform X1             90.5    1e-18   
ref|XP_004439053.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  89.7    1e-18   
ref|XP_005306933.1|  PREDICTED: glutaredoxin 2 isoform X1             90.5    1e-18   
ref|XP_004251165.1|  PREDICTED: glutaredoxin-C4                       90.5    1e-18   
ref|XP_008609095.1|  thioredoxin reductase (NADPH)                    90.1    1e-18   
ref|XP_002973274.1|  hypothetical protein SELMODRAFT_19369            89.0    1e-18   
ref|XP_009476356.1|  PREDICTED: glutaredoxin 2                        89.7    1e-18   
ref|XP_003595128.1|  Glutaredoxin-C4                                  90.9    1e-18   
emb|CCI46389.1|  unnamed protein product                              89.0    1e-18   
ref|XP_007072896.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  89.7    1e-18   
ref|XP_007608359.1|  PREDICTED: glutaredoxin 2 isoform X2             89.7    1e-18   
ref|XP_007820700.1|  Glutaredoxin active site protein                 89.0    1e-18   
ref|XP_007072897.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  89.7    1e-18   
ref|XP_006474249.1|  PREDICTED: glutaredoxin-C4-like                  90.1    1e-18   
ref|XP_004879878.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  90.5    1e-18   
ref|XP_010666528.1|  PREDICTED: glutaredoxin-C4                       91.7    1e-18   
ref|XP_005776232.1|  putative glutaredoxin                            89.0    1e-18   
ref|XP_005487122.1|  PREDICTED: glutaredoxin-2, mitochondrial         89.4    1e-18   
ref|XP_536114.3|  PREDICTED: glutaredoxin-2, mitochondrial isoformX2  89.7    1e-18   
ref|XP_003595129.1|  Glutaredoxin-C4                                  90.9    1e-18   
ref|XP_012042396.1|  PREDICTED: glutaredoxin 2 isoform X2             89.7    1e-18   
gb|EHA99973.1|  Glutaredoxin-2, mitochondrial                         90.5    2e-18   
ref|XP_010484019.1|  PREDICTED: glutaredoxin-C1-like isoform X1       89.0    2e-18   
ref|XP_010014070.1|  PREDICTED: glutaredoxin 2                        89.4    2e-18   
ref|XP_004088990.1|  PREDICTED: glutaredoxin-2, mitochondrial         89.4    2e-18   
gb|AAM61279.1|  glutaredoxin                                          89.7    2e-18   
sp|O81187.1|GLRX_VERFO  RecName: Full=Glutaredoxin                    88.6    2e-18   
ref|XP_011850481.1|  PREDICTED: glutaredoxin 2                        89.4    2e-18   
ref|XP_009460811.1|  PREDICTED: glutaredoxin 2                        89.0    2e-18   
ref|XP_008156856.1|  PREDICTED: glutaredoxin 2                        89.0    2e-18   
gb|ABK21913.1|  unknown                                               88.2    2e-18   
gb|KEZ46601.1|  hypothetical protein SAPIO_CDS0416                    88.6    2e-18   
ref|XP_010972338.1|  PREDICTED: glutaredoxin 2                        90.1    2e-18   
ref|XP_004751555.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  89.7    2e-18   
ref|XP_005715263.1|  Glutaredoxin, GRX4                               89.7    2e-18   
ref|XP_005142946.1|  PREDICTED: glutaredoxin-2, mitochondrial         89.0    2e-18   
ref|XP_010607055.1|  PREDICTED: glutaredoxin 2 isoform X1             89.4    2e-18   
ref|XP_004488030.1|  PREDICTED: glutaredoxin-C4-like                  89.4    2e-18   
gb|AFK38026.1|  unknown                                               89.0    2e-18   
gb|KJB33809.1|  hypothetical protein B456_006G031800                  88.6    2e-18   
ref|XP_008501531.1|  PREDICTED: glutaredoxin 2                        89.0    2e-18   
ref|XP_721347.1|  potential glutaredoxin                              89.7    2e-18   
ref|XP_001775000.1|  predicted protein                                89.4    3e-18   
ref|XP_004619979.1|  PREDICTED: glutaredoxin-2, mitochondrial         89.7    3e-18   
ref|XP_005640868.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  89.7    3e-18   
gb|KGQ85710.1|  glutaredoxin                                          89.7    3e-18   
ref|XP_011744766.1|  PREDICTED: glutaredoxin 2 isoform X3             88.6    3e-18   
ref|XP_004578860.1|  PREDICTED: glutaredoxin-2, mitochondrial-like    88.6    3e-18   
gb|EEH19869.1|  glutaredoxin                                          88.2    3e-18   
ref|XP_009937630.1|  PREDICTED: glutaredoxin 2                        88.6    3e-18   
ref|XP_008584378.1|  PREDICTED: glutaredoxin 2 isoform X2             88.6    3e-18   
ref|XP_005216826.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  88.6    3e-18   
gb|KFQ56596.1|  hypothetical protein N334_10649                       87.8    3e-18   
ref|XP_010484020.1|  PREDICTED: glutaredoxin-C1-like isoform X2       88.2    3e-18   
gb|KHC56897.1|  glutaredoxin                                          89.4    3e-18   
gb|EYU20892.1|  hypothetical protein MIMGU_mgv1a015927mg              89.0    3e-18   
ref|NP_197550.1|  glutaredoxin-C4                                     89.0    3e-18   
ref|XP_006470286.1|  PREDICTED: glutaredoxin-like                     88.2    3e-18   
ref|XP_009408057.1|  PREDICTED: glutaredoxin-C8-like                  89.0    3e-18   
ref|XP_010108797.1|  hypothetical protein L484_020532                 89.0    3e-18   
gb|KFQ42722.1|  hypothetical protein N333_10067                       87.8    3e-18   
ref|XP_003507106.2|  PREDICTED: glutaredoxin 2 isoform X1             89.4    3e-18   
ref|XP_004275888.1|  PREDICTED: glutaredoxin-2, mitochondrial         89.4    3e-18   
ref|XP_004322987.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  89.4    3e-18   
gb|ELK08901.1|  Glutaredoxin-2, mitochondrial                         88.6    3e-18   
gb|EMS48806.1|  Glutaredoxin-C6                                       88.6    3e-18   
ref|XP_003410876.1|  PREDICTED: glutaredoxin 2                        88.6    3e-18   
ref|XP_006916274.1|  PREDICTED: glutaredoxin-2, mitochondrial         88.6    3e-18   
ref|XP_010027500.1|  PREDICTED: glutaredoxin-like                     88.2    4e-18   
ref|XP_005535696.1|  similar to glutaredoxin                          88.2    4e-18   
ref|NP_001230328.1|  glutaredoxin 2 isoform 3                         88.2    4e-18   
ref|XP_002298529.2|  hypothetical protein POPTR_0001s35090g           87.8    4e-18   
ref|XP_008453540.1|  PREDICTED: glutaredoxin-C4-like                  88.6    4e-18   
ref|XP_001516560.2|  PREDICTED: glutaredoxin 2                        88.6    4e-18   
ref|XP_007481053.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  88.2    4e-18   
ref|XP_001376673.2|  PREDICTED: glutaredoxin-2, mitochondrial iso...  88.2    4e-18   
gb|ETE63340.1|  Glutaredoxin-2, mitochondrial                         88.2    4e-18   
ref|XP_007279307.1|  glutaredoxin                                     87.8    4e-18   
ref|XP_004706708.1|  PREDICTED: glutaredoxin-2, mitochondrial         89.0    4e-18   
gb|KIW25074.1|  glutaredoxin                                          87.4    4e-18   
ref|XP_004685523.1|  PREDICTED: glutaredoxin-2, mitochondrial         88.2    4e-18   
ref|XP_004013633.1|  PREDICTED: glutaredoxin 2 isoform X4             89.0    4e-18   
ref|XP_007950358.1|  PREDICTED: glutaredoxin 2                        89.0    4e-18   
pdb|3H8Q|A  Chain A, Crystal Structure Of Glutaredoxin Domain Of ...  87.8    4e-18   
ref|XP_006061479.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  89.0    4e-18   
ref|XP_007481056.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  88.2    5e-18   
ref|XP_006129206.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  89.4    5e-18   
ref|XP_006340202.1|  PREDICTED: glutaredoxin-C4-like                  88.6    5e-18   
ref|XP_008584377.1|  PREDICTED: glutaredoxin 2 isoform X1             89.0    5e-18   
gb|KFW00262.1|  hypothetical protein N326_03981                       87.0    5e-18   
ref|XP_004953283.1|  PREDICTED: monothiol glutaredoxin-S6-like        88.2    5e-18   
ref|XP_001517210.2|  PREDICTED: glutaredoxin-2, mitochondrial-like    87.4    5e-18   
ref|XP_010048610.1|  PREDICTED: glutaredoxin-C4                       88.2    5e-18   
gb|AAD34128.1|AF151891_1  CGI-133 protein                             88.6    5e-18   
ref|XP_009910256.1|  PREDICTED: glutaredoxin 2                        87.8    5e-18   
ref|XP_010756383.1|  glutaredoxin                                     87.4    5e-18   
pdb|2HT9|A  Chain A, The Structure Of Dimeric Human Glutaredoxin 2    88.6    5e-18   
ref|XP_008972290.1|  PREDICTED: glutaredoxin 2 isoform X2             88.2    5e-18   
ref|XP_010199056.1|  PREDICTED: glutaredoxin 2                        87.8    6e-18   
ref|XP_009988205.1|  PREDICTED: glutaredoxin 2                        87.8    6e-18   
gb|ABL67653.1|  putative glutaredoxin                                 87.4    6e-18   
ref|XP_010260953.1|  PREDICTED: glutaredoxin-C4                       88.2    6e-18   
ref|XP_011017730.1|  PREDICTED: glutaredoxin-C4                       88.2    6e-18   
ref|XP_007014498.1|  Glutaredoxin C4                                  87.8    6e-18   
ref|XP_003767583.1|  PREDICTED: glutaredoxin-2, mitochondrial         87.8    6e-18   
pdb|2FLS|A  Chain A, Crystal Structure Of Human Glutaredoxin 2 Co...  87.8    6e-18   
gb|ERN07415.1|  hypothetical protein AMTR_s00019p00245840             87.4    6e-18   
ref|XP_004484545.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  87.4    6e-18   
ref|XP_010988137.1|  PREDICTED: glutaredoxin 2                        88.6    6e-18   
gb|EUN31078.1|  hypothetical protein COCVIDRAFT_88740                 88.2    6e-18   
ref|XP_006845740.2|  PREDICTED: glutaredoxin-C4                       87.8    6e-18   
emb|CBN79183.1|  Glutaredoxin                                         87.0    6e-18   
ref|XP_002975118.1|  hypothetical protein SELMODRAFT_174566           87.8    7e-18   
ref|XP_003264543.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  88.6    7e-18   
ref|XP_008834435.1|  PREDICTED: glutaredoxin 2                        88.6    7e-18   
ref|XP_005335409.1|  PREDICTED: glutaredoxin-2, mitochondrial         87.4    7e-18   
ref|XP_007421050.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  87.8    7e-18   
ref|XP_008983377.1|  PREDICTED: glutaredoxin 2 isoform X3             87.4    7e-18   
ref|XP_007481052.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  87.8    7e-18   
ref|XP_008058140.1|  PREDICTED: glutaredoxin 2                        87.4    7e-18   
ref|XP_009966675.1|  PREDICTED: glutaredoxin 2                        87.4    7e-18   
ref|XP_004088989.1|  PREDICTED: glutaredoxin-2, mitochondrial         88.2    7e-18   
ref|XP_008983376.1|  PREDICTED: glutaredoxin 2 isoform X2             87.4    7e-18   
ref|XP_005423777.1|  PREDICTED: glutaredoxin-2, mitochondrial         87.4    8e-18   
ref|XP_005837427.1|  hypothetical protein GUITHDRAFT_92918            87.4    8e-18   
ref|XP_012042394.1|  PREDICTED: glutaredoxin 2 isoform X1             88.6    8e-18   
ref|XP_003264542.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  88.6    8e-18   
gb|KFQ95046.1|  hypothetical protein Y956_03499                       86.7    8e-18   
emb|CEI91032.1|  Putative Glutaredoxin                                87.0    8e-18   
ref|XP_009832877.1|  glutaredoxin                                     87.0    8e-18   
pdb|2CQ9|A  Chain A, Solution Structure Of Rsgi Ruh-044, An N-Ter...  87.4    8e-18   
dbj|GAN09598.1|  glutaredoxin                                         87.0    8e-18   
ref|XP_007138058.1|  hypothetical protein PHAVU_009G177000g           87.4    8e-18   
ref|XP_007594431.1|  glutaredoxin                                     87.4    9e-18   
ref|XP_007253371.1|  PREDICTED: thioredoxin reductase 3-like          92.8    9e-18   
ref|XP_004862823.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  88.2    9e-18   
ref|XP_007379262.1|  glutaredoxin                                     86.7    9e-18   
ref|XP_010177704.1|  PREDICTED: glutaredoxin 2                        87.4    9e-18   
ref|XP_006757713.1|  PREDICTED: glutaredoxin-2, mitochondrial         87.4    9e-18   
emb|CEG67705.1|  Putative Glutaredoxin                                86.7    9e-18   
gb|KJB27407.1|  hypothetical protein B456_004G096800                  87.4    9e-18   
ref|XP_007684122.1|  hypothetical protein COCMIDRAFT_84672            87.4    9e-18   
gb|AFK43763.1|  unknown                                               87.4    9e-18   
gb|KFH42494.1|  Glutaredoxin-like protein                             87.0    9e-18   
ref|XP_011598306.1|  PREDICTED: glutaredoxin 2                        87.0    1e-17   
ref|XP_011927088.1|  PREDICTED: glutaredoxin 2 isoform X1             88.2    1e-17   
ref|XP_007711962.1|  hypothetical protein COCCADRAFT_95228            87.4    1e-17   
ref|XP_003893418.1|  PREDICTED: glutaredoxin 2 isoform X5             88.2    1e-17   
ref|XP_009654402.1|  glutaredoxin                                     86.7    1e-17   
ref|XP_005708234.1|  glutaredoxin                                     86.3    1e-17   
ref|NP_075994.2|  glutaredoxin-2, mitochondrial isoform b             87.0    1e-17   
ref|XP_007481051.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  87.8    1e-17   
gb|ABK25518.1|  unknown                                               86.7    1e-17   
ref|XP_004088988.1|  PREDICTED: glutaredoxin-2, mitochondrial         88.2    1e-17   
emb|CCF46309.1|  glutaredoxin                                         86.7    1e-17   
ref|XP_005540332.1|  PREDICTED: glutaredoxin-2, mitochondrial iso...  87.0    1e-17   
ref|XP_004659577.1|  PREDICTED: glutaredoxin-2, mitochondrial         87.8    1e-17   
ref|XP_002063912.1|  GK15655                                          86.7    1e-17   
emb|CEI96395.1|  Putative Glutaredoxin                                86.3    1e-17   
ref|XP_009998235.1|  PREDICTED: glutaredoxin 2                        86.7    1e-17   



>ref|XP_009609876.1| PREDICTED: glutaredoxin-C5, chloroplastic-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009609877.1| PREDICTED: glutaredoxin-C5, chloroplastic-like isoform X2 [Nicotiana 
tomentosiformis]
Length=180

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 141/183 (77%), Gaps = 9/183 (5%)
 Frame = +1

Query  166  TSTTNLTRVFaslspapsprpralFHCRSLST-----SSNCTSKLGFFGTESRFPKFSSR  330
             +T+NLT+ F++ S + S  PR   H + LS      S NC+  +  F   SR      R
Sbjct  2    AATSNLTKSFSTFSISHSLHPR--IHTQILSQFQHIPSYNCSVPIHKFA--SRIENKGPR  57

Query  331  KQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIE  510
            K C  QIRA+SGSFG R+EESVK+T+ EN VVVYSKTWCSYS EVK LFK+LGV+PLVIE
Sbjct  58   KMCRVQIRAMSGSFGFRLEESVKKTITENAVVVYSKTWCSYSMEVKALFKKLGVDPLVIE  117

Query  511  LDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARK  690
            LDEMGPQGPQLQKVLERLTGQHTVPNVFIG KHIGGCTDTIKLYRKGELEPLLSEA+A K
Sbjct  118  LDEMGPQGPQLQKVLERLTGQHTVPNVFIGAKHIGGCTDTIKLYRKGELEPLLSEANAGK  177

Query  691  TES  699
            TES
Sbjct  178  TES  180



>ref|XP_009796776.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009796777.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X2 [Nicotiana 
sylvestris]
Length=180

 Score =   227 bits (579),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  304  SRFPKFSSRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKR  483
            SR      RK    QIRA+SGSFGSR+EESVK+T+ ENPVVVYSKTWCSYS EVK LFK+
Sbjct  49   SRIENNGPRKMGRVQIRAMSGSFGSRLEESVKKTITENPVVVYSKTWCSYSMEVKALFKK  108

Query  484  LGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEP  663
            LGV+PLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIG KHIGGCTDTIKLYRKGELEP
Sbjct  109  LGVDPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGAKHIGGCTDTIKLYRKGELEP  168

Query  664  LLSEASARKTES  699
            LLSEA+A KTES
Sbjct  169  LLSEANAGKTES  180



>ref|XP_006352722.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Solanum tuberosum]
Length=183

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 126/149 (85%), Gaps = 5/149 (3%)
 Frame = +1

Query  262  SSNCTS---KLGFFGTESRFPKFSSRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVY  432
            +SNC+    +L  FG  SR      RK    QIRA+SGSFGSR+EESVK+T+ ENPVVVY
Sbjct  37   NSNCSVQSVRLHRFG--SRIENNGPRKIGRVQIRAMSGSFGSRLEESVKKTITENPVVVY  94

Query  433  SKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHI  612
            SK+WCSYS+EVKVLFKRLGV+PLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIG KHI
Sbjct  95   SKSWCSYSTEVKVLFKRLGVDPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGAKHI  154

Query  613  GGCTDTIKLYRKGELEPLLSEASARKTES  699
            GGCTDTIKLYRKGELE LLSEA A KTES
Sbjct  155  GGCTDTIKLYRKGELESLLSEAKAGKTES  183



>ref|XP_002267052.1| PREDICTED: monothiol glutaredoxin-S10 [Vitis vinifera]
Length=178

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  325  SRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLV  504
            +R+  P  +RA++ SFGSR+EE+VK+TV ENPVVVYSKTWCSYSSEVK LFKRLGVEP V
Sbjct  54   NRRYGPVLVRAMASSFGSRLEETVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPFV  113

Query  505  IELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            IELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLSEAS 
Sbjct  114  IELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAST  173

Query  685  RKTES  699
            RKTES
Sbjct  174  RKTES  178



>ref|XP_010323070.1| PREDICTED: monothiol glutaredoxin-S10 [Solanum lycopersicum]
Length=183

 Score =   225 bits (573),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 121/140 (86%), Gaps = 2/140 (1%)
 Frame = +1

Query  280  KLGFFGTESRFPKFSSRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSS  459
            +L  FG  SR      RK    QIRA+SGSFGSR+EESVK+T+ ENPVVVYSK+WCSYS+
Sbjct  46   RLHRFG--SRIENDGPRKIGRVQIRAMSGSFGSRLEESVKKTITENPVVVYSKSWCSYST  103

Query  460  EVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKL  639
            EVKVLFKRLGV+PLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIG KHIGGCTDTIKL
Sbjct  104  EVKVLFKRLGVDPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGAKHIGGCTDTIKL  163

Query  640  YRKGELEPLLSEASARKTES  699
            YRKGELE LLSEA A KTES
Sbjct  164  YRKGELESLLSEAKAGKTES  183



>ref|XP_008235553.1| PREDICTED: monothiol glutaredoxin-S10 [Prunus mume]
Length=178

 Score =   220 bits (560),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +1

Query  304  SRFPKFSSRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKR  483
            S F    SR+     ++A+S SFGSR+E+SVK+TV ENPVVVYSKTWCSYSSEVK LFKR
Sbjct  47   SLFSINGSRRWRSFSVKAMSSSFGSRLEDSVKKTVDENPVVVYSKTWCSYSSEVKSLFKR  106

Query  484  LGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEP  663
            LGVEP+VIELDE+GPQGPQLQKVLERLTGQHTVPNVFI GKHIGGCTDT+KLYRKGELEP
Sbjct  107  LGVEPMVIELDELGPQGPQLQKVLERLTGQHTVPNVFIAGKHIGGCTDTVKLYRKGELEP  166

Query  664  LLSEASARKTES  699
            LLSEA A+K +S
Sbjct  167  LLSEAKAKKAQS  178



>emb|CBI37229.3| unnamed protein product [Vitis vinifera]
Length=114

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  358  VSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGP  537
            ++ SFGSR+EE+VK+TV ENPVVVYSKTWCSYSSEVK LFKRLGVEP VIELDEMGPQGP
Sbjct  1    MASSFGSRLEETVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPFVIELDEMGPQGP  60

Query  538  QLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            QLQKVLERLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLSEAS RKTES
Sbjct  61   QLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEASTRKTES  114



>ref|XP_007201404.1| hypothetical protein PRUPE_ppa012249mg [Prunus persica]
 gb|EMJ02603.1| hypothetical protein PRUPE_ppa012249mg [Prunus persica]
Length=178

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  304  SRFPKFSSRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKR  483
            S F    SR+     ++A++ SFGSR+EESVK+TV ENPVVVYSKTWCSYSSEVK LFKR
Sbjct  47   SLFSINGSRRWRSFSVKAMASSFGSRLEESVKKTVDENPVVVYSKTWCSYSSEVKSLFKR  106

Query  484  LGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEP  663
            LGVEP+VIELDE+GPQGPQLQKVLERLTGQHTVPNVFI GKHIGGCTDT+KLYRKGELEP
Sbjct  107  LGVEPMVIELDELGPQGPQLQKVLERLTGQHTVPNVFIAGKHIGGCTDTVKLYRKGELEP  166

Query  664  LLSEASARKTES  699
            LLSEA A+  +S
Sbjct  167  LLSEAKAKNAQS  178



>ref|XP_009370908.1| PREDICTED: glutaredoxin-C5, chloroplastic [Pyrus x bretschneideri]
Length=180

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 115/127 (91%), Gaps = 1/127 (1%)
 Frame = +1

Query  322  SSRKQCPTQIRAV-SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEP  498
            SSR+  P  ++A+ S SFGSR+EESVK+TV ENPV VYSKTWCSYSSEVK LFKRLGVEP
Sbjct  54   SSRRWRPMSVQAMASSSFGSRLEESVKKTVDENPVAVYSKTWCSYSSEVKTLFKRLGVEP  113

Query  499  LVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEA  678
            +VIELDE+GPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDT+KLYR GELE LLSEA
Sbjct  114  IVIELDELGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRTGELETLLSEA  173

Query  679  SARKTES  699
            SA+ T+S
Sbjct  174  SAKNTQS  180



>gb|KJB06393.1| hypothetical protein B456_001G236100 [Gossypium raimondii]
Length=175

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +1

Query  325  SRKQC-PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPL  501
            SRKQC P  +R++  SFGSR+EESVK+TV  NPVVVYSK+WCSYSSEVK LFK+LGVEPL
Sbjct  50   SRKQCKPMLVRSMGSSFGSRLEESVKKTVASNPVVVYSKSWCSYSSEVKSLFKKLGVEPL  109

Query  502  VIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEAS  681
            VIELDEMG QGPQ+QK+LERLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLSEA+
Sbjct  110  VIELDEMGAQGPQVQKLLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAT  169

Query  682  ARKTES  699
            A+  E+
Sbjct  170  AKSKEN  175



>gb|KDO65783.1| hypothetical protein CISIN_1g030613mg [Citrus sinensis]
 gb|KDO65784.1| hypothetical protein CISIN_1g030613mg [Citrus sinensis]
Length=174

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +1

Query  328  RKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVI  507
            R+     ++A++ S+GSR+EESVK+TV ENPVVVYSKTWCSYSSEVK+LFKRLGVEPLVI
Sbjct  53   RRYGAVSVQAMASSYGSRLEESVKKTVSENPVVVYSKTWCSYSSEVKLLFKRLGVEPLVI  112

Query  508  ELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            ELDEMGPQGPQLQK+LERLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLSEA +
Sbjct  113  ELDEMGPQGPQLQKLLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAKS  171



>ref|XP_008382672.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X1 [Malus 
domestica]
Length=180

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  325  SRKQCPTQIRAV-SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPL  501
            SR+  P  ++A+ S SFGSR+EESVK TV ENPVVVYSKTWCSYSSEVK LFKRLGVEP+
Sbjct  55   SRRWRPMSVQAMASSSFGSRLEESVKXTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPI  114

Query  502  VIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEAS  681
            VIELDE+GPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELE LLSEA 
Sbjct  115  VIELDELGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELETLLSEAX  174

Query  682  ARKTES  699
            A+ T+S
Sbjct  175  AKNTQS  180



>ref|XP_006443689.1| hypothetical protein CICLE_v10022530mg [Citrus clementina]
 ref|XP_006443690.1| hypothetical protein CICLE_v10022530mg [Citrus clementina]
 ref|XP_006443691.1| hypothetical protein CICLE_v10022530mg [Citrus clementina]
 ref|XP_006480159.1| PREDICTED: glutaredoxin-C5, chloroplastic-like isoform X1 [Citrus 
sinensis]
 gb|ESR56929.1| hypothetical protein CICLE_v10022530mg [Citrus clementina]
 gb|ESR56930.1| hypothetical protein CICLE_v10022530mg [Citrus clementina]
 gb|ESR56931.1| hypothetical protein CICLE_v10022530mg [Citrus clementina]
Length=174

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +1

Query  328  RKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVI  507
            R+     ++A++ SFGSR+EESVK+TV ENPVVVYSKTWCSYSSEVK+LFKRLGVEPLVI
Sbjct  53   RRYGALSVQAMASSFGSRLEESVKKTVSENPVVVYSKTWCSYSSEVKLLFKRLGVEPLVI  112

Query  508  ELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            ELDEMGPQGPQLQK+LERLTGQHTVPNVFIGGKHIGGCT+T+KLYRKGELEPLLSEA +
Sbjct  113  ELDEMGPQGPQLQKLLERLTGQHTVPNVFIGGKHIGGCTETVKLYRKGELEPLLSEAKS  171



>ref|XP_010263985.1| PREDICTED: monothiol glutaredoxin-S10 isoform X1 [Nelumbo nucifera]
Length=177

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 116/136 (85%), Gaps = 1/136 (1%)
 Frame = +1

Query  295  GTESR-FPKFSSRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKV  471
            G  SR F     R      +R+++ SFGSR+EES+K+TV ENPVVVYSKTWCSYSSEVK 
Sbjct  42   GNRSRGFSIHGRRNGGAAVVRSMAASFGSRLEESIKKTVSENPVVVYSKTWCSYSSEVKA  101

Query  472  LFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKG  651
            LFKRLGVEPLVIELDEMGPQGPQLQK+LERLTGQ+TVPNVFIGGKHIGGCTDT+KLYRKG
Sbjct  102  LFKRLGVEPLVIELDEMGPQGPQLQKMLERLTGQYTVPNVFIGGKHIGGCTDTVKLYRKG  161

Query  652  ELEPLLSEASARKTES  699
            ELE LLSEA+A  T+S
Sbjct  162  ELEALLSEANAISTQS  177



>ref|XP_007050085.1| Glutaredoxin family protein isoform 1 [Theobroma cacao]
 ref|XP_007050086.1| Glutaredoxin family protein isoform 1 [Theobroma cacao]
 gb|EOX94242.1| Glutaredoxin family protein isoform 1 [Theobroma cacao]
 gb|EOX94243.1| Glutaredoxin family protein isoform 1 [Theobroma cacao]
Length=175

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  325  SRKQC-PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPL  501
            SRKQ  P  +R ++ SFGSR+EE+VK+TV +NPVVVYSKTWCSYS+EVK LFKRLGV PL
Sbjct  50   SRKQSKPLSVRGMASSFGSRLEENVKKTVADNPVVVYSKTWCSYSAEVKSLFKRLGVNPL  109

Query  502  VIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEAS  681
            VIELDE+GPQGPQ+QKVLERLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELE LLSEA+
Sbjct  110  VIELDELGPQGPQVQKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELETLLSEAN  169

Query  682  ARKTES  699
             + TE+
Sbjct  170  VKNTET  175



>gb|KJB06394.1| hypothetical protein B456_001G236100 [Gossypium raimondii]
Length=176

 Score =   212 bits (539),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 2/127 (2%)
 Frame = +1

Query  325  SRKQC-PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPL  501
            SRKQC P  +R++  SFGSR+EESVK+TV  NPVVVYSK+WCSYSSEVK LFK+LGVEPL
Sbjct  50   SRKQCKPMLVRSMGSSFGSRLEESVKKTVASNPVVVYSKSWCSYSSEVKSLFKKLGVEPL  109

Query  502  VIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCT-DTIKLYRKGELEPLLSEA  678
            VIELDEMG QGPQ+QK+LERLTGQHTVPNVFIGGKHIGGCT DT+KLYRKGELEPLLSEA
Sbjct  110  VIELDEMGAQGPQVQKLLERLTGQHTVPNVFIGGKHIGGCTADTVKLYRKGELEPLLSEA  169

Query  679  SARKTES  699
            +A+  E+
Sbjct  170  TAKSKEN  176



>ref|NP_001238538.1| uncharacterized protein LOC100305906 [Glycine max]
 gb|ACU13815.1| unknown [Glycine max]
 gb|KHN05900.1| Glutaredoxin-C5, chloroplastic [Glycine soja]
Length=166

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSR+E+++K+TV ENPVVVYSKTWC+YSSEVK+LFK+LGV+PLV ELDEMGPQGPQLQK
Sbjct  57   FGSRLEDTIKKTVAENPVVVYSKTWCTYSSEVKILFKKLGVDPLVFELDEMGPQGPQLQK  116

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            VLER+TGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLSEA+A+KTES
Sbjct  117  VLERITGQHTVPNVFIGGKHIGGCTDTLKLYRKGELEPLLSEANAKKTES  166



>gb|KHN48963.1| Glutaredoxin-C5, chloroplastic [Glycine soja]
Length=166

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 111/117 (95%), Gaps = 1/117 (1%)
 Frame = +1

Query  349  IRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGP  528
            +RA S SFGSR+E+++K+TV ENPVV+YSKTWCSYSSEVK+LFK+LGV+PLV ELDEMGP
Sbjct  51   VRATS-SFGSRLEDTIKKTVAENPVVLYSKTWCSYSSEVKILFKKLGVDPLVFELDEMGP  109

Query  529  QGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            QGPQL KVLER+TGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLSEA+A+KT S
Sbjct  110  QGPQLHKVLERITGQHTVPNVFIGGKHIGGCTDTLKLYRKGELEPLLSEANAKKTGS  166



>ref|XP_012085184.1| PREDICTED: monothiol glutaredoxin-S10-like [Jatropha curcas]
 gb|KDP26438.1| hypothetical protein JCGZ_17596 [Jatropha curcas]
Length=173

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = +1

Query  355  AVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQG  534
            +V  SFGSR+EESVK+TV ENPVVVYSKTWCSYSSEVK LFK+LGV+PLVIELDE+GPQG
Sbjct  59   SVRASFGSRLEESVKKTVDENPVVVYSKTWCSYSSEVKALFKKLGVDPLVIELDELGPQG  118

Query  535  PQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTE  696
            PQ+QK+LERLTGQHTVPNVFIGG+HIGGCTDT+KLYRKGELE LLSEA+A+ T+
Sbjct  119  PQIQKLLERLTGQHTVPNVFIGGQHIGGCTDTLKLYRKGELETLLSEATAKSTQ  172



>ref|XP_003542446.2| PREDICTED: glutaredoxin-C5, chloroplastic isoform X1 [Glycine 
max]
Length=177

 Score =   207 bits (526),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 111/117 (95%), Gaps = 1/117 (1%)
 Frame = +1

Query  349  IRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGP  528
            +RA S SFGSR+E+++K+TV ENPVV+YSKTWCSYSSEVK+LFK+LGV+PLV ELDEMGP
Sbjct  62   VRATS-SFGSRLEDTIKKTVAENPVVLYSKTWCSYSSEVKILFKKLGVDPLVFELDEMGP  120

Query  529  QGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            QGPQL KVLER+TGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLS+A+A+KT S
Sbjct  121  QGPQLHKVLERITGQHTVPNVFIGGKHIGGCTDTLKLYRKGELEPLLSKANAKKTGS  177



>pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex 
With Glutathione
 pdb|3FZA|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex 
With Glutathione And Beta-Mercaptoethanol
Length=112

 Score =   204 bits (520),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  364  GSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQL  543
             SFGSR+E++VK+TV ENPVVVYSKTWCSYSSEVK LFKRL V+PLV+ELDE+G QGPQ+
Sbjct  1    ASFGSRLEDAVKKTVAENPVVVYSKTWCSYSSEVKSLFKRLNVDPLVVELDELGAQGPQI  60

Query  544  QKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTE  696
            QKVLERLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLSEA+A+K++
Sbjct  61   QKVLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEANAKKSQ  111



>ref|XP_011083086.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X1 [Sesamum 
indicum]
Length=176

 Score =   206 bits (525),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  361  SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQ  540
            S SFGSR+EE+VK+TVGENPVVVYSKTWCSYSSEVK LFKRLGVEP+VIELD++GPQGPQ
Sbjct  64   SPSFGSRLEETVKKTVGENPVVVYSKTWCSYSSEVKSLFKRLGVEPIVIELDQLGPQGPQ  123

Query  541  LQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            LQK LER+TGQHTVPNVFIGGKHIGGCTDTIKL+RKGELEPLLSEA A K+ S
Sbjct  124  LQKTLERITGQHTVPNVFIGGKHIGGCTDTIKLHRKGELEPLLSEAGAMKSTS  176



>ref|XP_004140671.2| PREDICTED: glutaredoxin-C5, chloroplastic-like [Cucumis sativus]
 gb|KGN46358.1| hypothetical protein Csa_6G087860 [Cucumis sativus]
Length=194

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSR+EESVK T+ +NPVVVYSKTWCSYS EVK LFKRLGV+PLVIELDE+GPQGPQLQK
Sbjct  85   FGSRLEESVKTTITQNPVVVYSKTWCSYSFEVKALFKRLGVQPLVIELDELGPQGPQLQK  144

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            VLERLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEP+LSEA+A+ +E+
Sbjct  145  VLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPMLSEANAKNSET  194



>ref|XP_010548722.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Tarenaya hassleriana]
Length=184

 Score =   205 bits (521),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSR+EESVK TVGENPVVVYSKTWCSYSSEVK LFKRLGV+PLVIELDE+GPQGPQLQK
Sbjct  75   FGSRLEESVKTTVGENPVVVYSKTWCSYSSEVKSLFKRLGVQPLVIELDELGPQGPQLQK  134

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            VLERLTGQ+TVPNVF+GGKHIGGCTDT+KLYRKGELEP+L+EA+A+  +S
Sbjct  135  VLERLTGQYTVPNVFVGGKHIGGCTDTLKLYRKGELEPMLAEANAQSPQS  184



>gb|ACF74281.1| electron transporter/thiol-disulfide exchange intermediate protein 
[Arachis hypogaea]
Length=187

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSR+EE++K+TV  NPVVVYSKTWCSYSSEVK LFK+LGVEPLV ELDEMGPQGPQLQK
Sbjct  79   FGSRLEETIKKTVSGNPVVVYSKTWCSYSSEVKALFKKLGVEPLVFELDEMGPQGPQLQK  138

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            VLERLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLSEA+A+
Sbjct  139  VLERLTGQHTVPNVFIGGKHIGGCTDTLKLYRKGELEPLLSEATAK  184



>ref|XP_008459988.1| PREDICTED: glutaredoxin-C5, chloroplastic [Cucumis melo]
Length=194

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            R+EESVK T+ +NPVVVYSKTWCSYSSEVK LFKRLGV+PLVIELDE+GPQGPQLQKVLE
Sbjct  88   RLEESVKTTITQNPVVVYSKTWCSYSSEVKALFKRLGVQPLVIELDELGPQGPQLQKVLE  147

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            RLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEP+LSEA+A+ +E+
Sbjct  148  RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPMLSEANAKHSEA  194



>ref|XP_010091846.1| Glutaredoxin-C5 [Morus notabilis]
 gb|EXB46054.1| Glutaredoxin-C5 [Morus notabilis]
Length=176

 Score =   202 bits (513),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 120/148 (81%), Gaps = 11/148 (7%)
 Frame = +1

Query  238  FHCRSLSTSSNCTSKLGFFGTESRFPKFSSRKQCPTQIRAVSGSFGSRMEESVKRTVGEN  417
            F  R++S+S+       FFG         SR+  P  ++A+S SFGSR+EE+VK+TV EN
Sbjct  35   FSPRNISSSAT-----SFFGVHG------SRRCRPISVQAMSSSFGSRLEETVKKTVTEN  83

Query  418  PVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFI  597
            PVVVYSKTWCSYSSEVK LFK+LGVEPLVIELDEMG QGPQ+QK+LERLTGQHTVPNVF+
Sbjct  84   PVVVYSKTWCSYSSEVKSLFKKLGVEPLVIELDEMGAQGPQVQKLLERLTGQHTVPNVFV  143

Query  598  GGKHIGGCTDTIKLYRKGELEPLLSEAS  681
            GG HIGGC++T+KL+ KGELEPLL+EA+
Sbjct  144  GGNHIGGCSETVKLHHKGELEPLLAEAT  171



>ref|XP_010069686.1| PREDICTED: monothiol glutaredoxin-S10 [Eucalyptus grandis]
 gb|KCW58107.1| hypothetical protein EUGRSUZ_H00830 [Eucalyptus grandis]
Length=182

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSR+EE+V++TV ENPVVVYSK+WCSYSSEVK LFKRLGV+PLVIELDE+GPQGPQLQK
Sbjct  76   FGSRLEEAVRKTVAENPVVVYSKSWCSYSSEVKSLFKRLGVDPLVIELDELGPQGPQLQK  135

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARK  690
            VLERLTGQHTVPNVFIGG+HIGGCTDT+KL+R GELEPLLSEA+A+ 
Sbjct  136  VLERLTGQHTVPNVFIGGQHIGGCTDTVKLHRNGELEPLLSEANAKN  182



>ref|XP_006854323.2| PREDICTED: monothiol glutaredoxin-S10 [Amborella trichopoda]
Length=186

 Score =   199 bits (507),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  328  RKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVI  507
            R  C     A++ SFGSR+EESVKRTV ENP+V+YSKTWCSYS EVK LFKRLGVEPLVI
Sbjct  58   RDSCRVVPMAMAASFGSRLEESVKRTVVENPIVIYSKTWCSYSMEVKSLFKRLGVEPLVI  117

Query  508  ELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            ELDE+G QGPQLQKVLERLTGQ TVPNVFIGGKHIGGCTDT++LYRKGEL  LLSEA  +
Sbjct  118  ELDELGSQGPQLQKVLERLTGQFTVPNVFIGGKHIGGCTDTVRLYRKGELATLLSEAGVK  177

Query  688  KTES  699
              +S
Sbjct  178  NIQS  181



>gb|ACJ60637.1| glutaredoxin S12 [Populus tremula x Populus tremuloides]
Length=185

 Score =   197 bits (502),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            R+E++VK+TV ENPVVVYSKTWCSYSSEVK LFKRL V+PLV+ELDE+G QGPQ+QKVLE
Sbjct  79   RLEDAVKKTVAENPVVVYSKTWCSYSSEVKSLFKRLNVDPLVVELDELGAQGPQIQKVLE  138

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTE  696
            RLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLSEA+A+K++
Sbjct  139  RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEANAKKSQ  184



>gb|AFK37707.1| unknown [Lotus japonicus]
Length=182

 Score =   197 bits (502),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 109/131 (83%), Gaps = 3/131 (2%)
 Frame = +1

Query  307  RFPKFSSRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRL  486
            R P F+ R  C     + S SFGSR+E+++K+TV +NPVVVYSKTWCSYSSEVK LFK+L
Sbjct  55   RIPTFT-RAMC--TSSSSSSSFGSRLEDTIKKTVADNPVVVYSKTWCSYSSEVKSLFKKL  111

Query  487  GVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPL  666
            G  PLV ELDEMGPQGPQLQK+LERLTGQHTVPNVFIGGKHIGGCTDT+KL+  GELEPL
Sbjct  112  GANPLVFELDEMGPQGPQLQKMLERLTGQHTVPNVFIGGKHIGGCTDTLKLHHNGELEPL  171

Query  667  LSEASARKTES  699
            LSEA A+ T S
Sbjct  172  LSEAKAKNTGS  182



>ref|XP_004290010.1| PREDICTED: glutaredoxin-C5, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=171

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            R+EESVK+TV +NPVVVYSKTWCSYSSEVK LFKRLGVEP VIELDE+G QGPQLQKVLE
Sbjct  65   RLEESVKKTVDDNPVVVYSKTWCSYSSEVKSLFKRLGVEPTVIELDELGAQGPQLQKVLE  124

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            RLTGQHTVPNVFIGGKHIGGCTDT+KL+RKGELEPLL+EA ++ T++
Sbjct  125  RLTGQHTVPNVFIGGKHIGGCTDTVKLHRKGELEPLLAEAKSKNTQT  171



>ref|XP_007144429.1| hypothetical protein PHAVU_007G155300g [Phaseolus vulgaris]
 gb|ESW16423.1| hypothetical protein PHAVU_007G155300g [Phaseolus vulgaris]
Length=226

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSR+E+++ +TV ENPVVVYSKTWCSYSSEVK LFK+LGV PLV ELDEMGPQGPQLQK
Sbjct  117  FGSRLEDTINKTVAENPVVVYSKTWCSYSSEVKSLFKKLGVNPLVFELDEMGPQGPQLQK  176

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
             LER+TGQHTVPNVFIGGKHIGGC+DT+KLYRKGELEPLLSEA  +  E+
Sbjct  177  GLERITGQHTVPNVFIGGKHIGGCSDTMKLYRKGELEPLLSEAKTKNPEN  226



>ref|XP_010243630.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X1 [Nelumbo 
nucifera]
Length=177

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  349  IRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGP  528
            +R ++ SFGSR+E S+K+TV EN VV+YSKTWCSY+SEVK LFKRLGV+PLVIELDE+G 
Sbjct  61   VRFMASSFGSRLEGSIKKTVSENLVVIYSKTWCSYASEVKSLFKRLGVQPLVIELDELGA  120

Query  529  QGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            QGPQLQK+L RLTGQHTVPNVF+GG+HIGGCTDT+KLYRKGEL  LLSEASA+ T++
Sbjct  121  QGPQLQKMLGRLTGQHTVPNVFVGGRHIGGCTDTLKLYRKGELAALLSEASAKNTQN  177



>ref|XP_006386902.1| hypothetical protein POPTR_0002s25540g [Populus trichocarpa]
 gb|ABK93540.1| unknown [Populus trichocarpa]
 gb|ERP64699.1| hypothetical protein POPTR_0002s25540g [Populus trichocarpa]
Length=185

 Score =   194 bits (493),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            R+E++VK+TV ENPVVVYSKTWCSYS EVK LFKRL V+PLV+ELDE+G QGPQ+QKVLE
Sbjct  79   RLEDAVKKTVAENPVVVYSKTWCSYSFEVKSLFKRLNVDPLVVELDELGAQGPQIQKVLE  138

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTE  696
            RLTGQHTVPNVFIGGKHIGGCTDT+KLYRKGELEPLLSEA+A+K++
Sbjct  139  RLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEANAKKSQ  184



>ref|XP_011024523.1| PREDICTED: monothiol glutaredoxin-S10 [Populus euphratica]
Length=185

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            R+E++VK+TV ENPVVVYSKTWCSYSSEVK LFKRL V+PLV+ELD +G QGPQ+QKVLE
Sbjct  79   RLEDAVKKTVAENPVVVYSKTWCSYSSEVKSLFKRLNVDPLVVELDALGAQGPQIQKVLE  138

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTE  696
            RLTGQHTVPNVFIGG HIGGCTDT+KLYRKGELEPLLSEA+A+K++
Sbjct  139  RLTGQHTVPNVFIGGNHIGGCTDTVKLYRKGELEPLLSEANAKKSQ  184



>ref|XP_004495035.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Cicer arietinum]
Length=183

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSR+EE++K TV +NPVVVYSK+WCSYSSEVK LFK+LG +PLV+ELDEMGPQGPQLQK
Sbjct  74   FGSRLEETIKNTVAQNPVVVYSKSWCSYSSEVKSLFKKLGYQPLVLELDEMGPQGPQLQK  133

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            +LERLTGQ+TVPNVFIGGKHIGGCTDT+KLYRKGELE LLSEA+A+
Sbjct  134  LLERLTGQYTVPNVFIGGKHIGGCTDTLKLYRKGELETLLSEATAK  179



>ref|XP_006412917.1| hypothetical protein EUTSA_v10026359mg [Eutrema salsugineum]
 gb|ESQ54370.1| hypothetical protein EUTSA_v10026359mg [Eutrema salsugineum]
Length=180

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRMEESVK+TV +N VVVYSKTWCSY SEVK LFKRLGV+PLVIELDE+GPQGPQLQK
Sbjct  71   FGSRMEESVKKTVTDNTVVVYSKTWCSYCSEVKTLFKRLGVQPLVIELDELGPQGPQLQK  130

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            VLERLTGQHTVPN+F+GGKHIGGCTDT+KL RKGELE +L+EA+ +
Sbjct  131  VLERLTGQHTVPNIFVGGKHIGGCTDTVKLNRKGELELMLAEANGK  176



>gb|EYU46373.1| hypothetical protein MIMGU_mgv1a014667mg [Erythranthe guttata]
Length=182

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 115/154 (75%), Gaps = 12/154 (8%)
 Frame = +1

Query  274  TSKLGFFGTESRFPKFSSRKQ---CPT--------QIRAV-SGSFGSRMEESVKRTVGEN  417
            T  L F    +RF  + +R     C T        QIRA+ S S GS +E++VK+T+ +N
Sbjct  29   TQILSFSRVHNRFSTYFTRTNSSGCRTTSKNAGLRQIRAMGSDSSGSGLEDTVKKTIVDN  88

Query  418  PVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFI  597
            PVVVYSKTWCSYSSEVK LFKRLG E LVIELD++G QG QLQK LE LTGQHTVPNVFI
Sbjct  89   PVVVYSKTWCSYSSEVKSLFKRLGAETLVIELDQLGSQGAQLQKTLESLTGQHTVPNVFI  148

Query  598  GGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            GGKHIGGCTDT+KLY+KGELE LLS+A A KTES
Sbjct  149  GGKHIGGCTDTVKLYQKGELESLLSQAGATKTES  182



>gb|KJB42409.1| hypothetical protein B456_007G151300 [Gossypium raimondii]
Length=175

 Score =   191 bits (486),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  340  PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDE  519
            P  IR ++ SFGSR ++SV +TV +NPVVVYSK+WC +SSEVK LFK+LGVEPLVIELDE
Sbjct  56   PMSIRGMASSFGSRQDDSVTKTVADNPVVVYSKSWCPFSSEVKSLFKKLGVEPLVIELDE  115

Query  520  MGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            +GPQGPQLQ VLE LTGQ TVPNVFIGGKHIGGCTDT++LY  GELE LLS+A+A++ E+
Sbjct  116  LGPQGPQLQNVLEGLTGQRTVPNVFIGGKHIGGCTDTVELYHNGELESLLSDANAKRKEN  175



>ref|XP_002869477.1| hypothetical protein ARALYDRAFT_491884 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45736.1| hypothetical protein ARALYDRAFT_491884 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRMEESV++TV EN VVVYSKTWCSY +EVK LFKRLGV+PLVIELD++GPQGPQLQK
Sbjct  68   FGSRMEESVRKTVTENTVVVYSKTWCSYCTEVKTLFKRLGVQPLVIELDQLGPQGPQLQK  127

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            VLERLTGQHTVPNVF+GGKHIGGCTDT+KL RKG+LE +L+EA+ +  +S
Sbjct  128  VLERLTGQHTVPNVFVGGKHIGGCTDTVKLNRKGDLEVMLAEANGKTGQS  177



>ref|XP_010540941.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic [Tarenaya 
hassleriana]
Length=174

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            R+EE+VK T  ENPVVVYSKTWCSYSSEVK LFKRLGV+PLVIELDE+GPQGPQLQ+VLE
Sbjct  68   RLEETVKTTAAENPVVVYSKTWCSYSSEVKSLFKRLGVQPLVIELDELGPQGPQLQRVLE  127

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            RLTGQHTVPNVFIGGKHIGGCTDT+KLYR GELE +L+EA+++  +S
Sbjct  128  RLTGQHTVPNVFIGGKHIGGCTDTLKLYRNGELESMLAEANSKSPQS  174



>ref|XP_006282737.1| hypothetical protein CARUB_v10005878mg [Capsella rubella]
 gb|EOA15635.1| hypothetical protein CARUB_v10005878mg [Capsella rubella]
Length=173

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 113/138 (82%), Gaps = 6/138 (4%)
 Frame = +1

Query  304  SRFPKFSSRKQCPTQIRAVSGS------FGSRMEESVKRTVGENPVVVYSKTWCSYSSEV  465
            S   + S ++ C   IRA+S S      FGSRMEE++K+TV EN VVVYSK+WCSY +EV
Sbjct  36   SPLKRTSLKQTCSVSIRAMSSSSSSAASFGSRMEENIKKTVTENTVVVYSKSWCSYCTEV  95

Query  466  KVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYR  645
            K+LFKRLGV+PLVIELDE+G QGPQLQKVLERLTGQHTVPNVF+GGKH+GGCTDT+KL R
Sbjct  96   KILFKRLGVQPLVIELDELGAQGPQLQKVLERLTGQHTVPNVFVGGKHVGGCTDTVKLNR  155

Query  646  KGELEPLLSEASARKTES  699
            KG+LE +L+EA+ +  ++
Sbjct  156  KGDLELMLAEANGKNGQT  173



>ref|XP_010433169.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Camelina sativa]
Length=180

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRMEE++K+TV EN VVVYSKTWCSY SEVK LFKRLGV+PLVIELD++GPQGPQLQK
Sbjct  73   FGSRMEENIKKTVTENTVVVYSKTWCSYCSEVKTLFKRLGVQPLVIELDQLGPQGPQLQK  132

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKT  693
            VLERLTGQHTVPNVF+GGKH+GGCTDT+KLYRKG+LE +L+E    +T
Sbjct  133  VLERLTGQHTVPNVFVGGKHVGGCTDTVKLYRKGDLELMLAEGKNGQT  180



>emb|CDY50922.1| BnaA03g59000D [Brassica napus]
Length=180

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRMEESV++TV EN VVVYSKTWCSY +EVK LFKRLGV+PLVIELDE+GPQGPQLQK
Sbjct  71   FGSRMEESVRKTVTENIVVVYSKTWCSYCTEVKTLFKRLGVQPLVIELDELGPQGPQLQK  130

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            VLERLTGQHTVPNVF+GGKHIGGCTDT+KL RKG+LE +L+EA+    ++
Sbjct  131  VLERLTGQHTVPNVFVGGKHIGGCTDTVKLNRKGDLELMLAEANGNTNQT  180



>pdb|3RHB|A Chain A, Crystal Structure Of The Apo Form Of Glutaredoxin C5 
From Arabidopsis Thaliana
 pdb|3RHC|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C5 
From Arabidopsis Thaliana
 pdb|3RHC|B Chain B, Crystal Structure Of The Holo Form Of Glutaredoxin C5 
From Arabidopsis Thaliana
Length=113

 Score =   187 bits (474),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  364  GSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQL  543
             SFGSRMEES+++TV EN VV+YSKTWCSY +EVK LFKRLGV+PLV+ELD++GPQGPQL
Sbjct  2    ASFGSRMEESIRKTVTENTVVIYSKTWCSYCTEVKTLFKRLGVQPLVVELDQLGPQGPQL  61

Query  544  QKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            QKVLERLTGQHTVPNVF+ GKHIGGCTDT+KL RKG+LE +L+EA+ +  +S
Sbjct  62   QKVLERLTGQHTVPNVFVCGKHIGGCTDTVKLNRKGDLELMLAEANGKNGQS  113



>ref|XP_008789485.1| PREDICTED: monothiol glutaredoxin-S10 [Phoenix dactylifera]
Length=181

 Score =   189 bits (480),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  361  SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQ  540
            S SFGSR+EESVK+T+ ENPVV+YSKTWCSYS EVK LFKR+GVEPLVIELD++GPQGPQ
Sbjct  66   SSSFGSRLEESVKKTISENPVVIYSKTWCSYSMEVKSLFKRIGVEPLVIELDQLGPQGPQ  125

Query  541  LQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            LQKVLERLTGQ+TVPNVFIGGKHIGGCTDT+KL+ KGEL  LLS+
Sbjct  126  LQKVLERLTGQYTVPNVFIGGKHIGGCTDTVKLHHKGELTTLLSD  170



>gb|KJB06395.1| hypothetical protein B456_001G236100 [Gossypium raimondii]
Length=166

 Score =   188 bits (478),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 106/126 (84%), Gaps = 10/126 (8%)
 Frame = +1

Query  325  SRKQC-PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPL  501
            SRKQC P  +R++  SFGSR+EESVK+TV  NPVVVYSK+WCSYSSEVK LFK+LGVEPL
Sbjct  50   SRKQCKPMLVRSMGSSFGSRLEESVKKTVASNPVVVYSKSWCSYSSEVKSLFKKLGVEPL  109

Query  502  VIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEAS  681
            VIELDEMG QGPQ+QK+LERLTGQHTVPNVFI         DT+KLYRKGELEPLLSEA+
Sbjct  110  VIELDEMGAQGPQVQKLLERLTGQHTVPNVFI---------DTVKLYRKGELEPLLSEAT  160

Query  682  ARKTES  699
            A+  E+
Sbjct  161  AKSKEN  166



>ref|XP_010438390.1| PREDICTED: glutaredoxin-C5, chloroplastic [Camelina sativa]
Length=183

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRMEE++K+TV EN VVVYSKTWCSY SEVK LFKRLGV+PLVIELD++GPQGPQLQK
Sbjct  76   FGSRMEENIKKTVTENTVVVYSKTWCSYCSEVKTLFKRLGVQPLVIELDQLGPQGPQLQK  135

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKT  693
            VLERLTGQHTVPNVF+GGKH+GGCTDT+KLYRKG+LE +L+E    +T
Sbjct  136  VLERLTGQHTVPNVFVGGKHVGGCTDTVKLYRKGDLELMLAEGKNGQT  183



>gb|EYU17959.1| hypothetical protein MIMGU_mgv1a014885mg [Erythranthe guttata]
Length=174

 Score =   189 bits (479),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = +1

Query  316  KFSSRKQCPTQIRAVS-GSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGV  492
            +  SR +   +IRA    +FG+R+ ESV  TVG NPVVVYSKTWCSYS  VK LF+RLGV
Sbjct  49   RIGSRNEGLVEIRATCPATFGARLRESVMNTVGGNPVVVYSKTWCSYSLLVKSLFERLGV  108

Query  493  EPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLS  672
            EPLVIELD++G QGPQLQ+ L+RLTGQHTVPNVF+GGKHIGGCTDT+KL+RKGELEPLLS
Sbjct  109  EPLVIELDQLGAQGPQLQRTLKRLTGQHTVPNVFVGGKHIGGCTDTVKLHRKGELEPLLS  168

Query  673  EASARK  690
            EA A K
Sbjct  169  EAVANK  174



>gb|KHG15724.1| Glutaredoxin-C5, chloroplastic -like protein [Gossypium arboreum]
Length=175

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  340  PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDE  519
            P  IR ++ SFGS  ++SV +TV +NPVVVYSK+WC +SSEVK LFK+LGVEPLVIELDE
Sbjct  56   PMSIRGMASSFGSLQDDSVTKTVADNPVVVYSKSWCPFSSEVKSLFKKLGVEPLVIELDE  115

Query  520  MGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            +GPQGPQLQ VLE LTGQ TVPNVFIGGKHIGGCTDT++LY  GELE LLS+A+A++ E+
Sbjct  116  LGPQGPQLQNVLEGLTGQRTVPNVFIGGKHIGGCTDTVELYHNGELESLLSDANAKRKEN  175



>ref|XP_010447922.1| PREDICTED: glutaredoxin-C5, chloroplastic [Camelina sativa]
Length=177

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRMEE++K+TV EN VVVYSKTWCSY SEVK LFKRLGV+PLVIELD++GPQGPQLQK
Sbjct  68   FGSRMEENIKKTVTENTVVVYSKTWCSYCSEVKTLFKRLGVQPLVIELDQLGPQGPQLQK  127

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            VLERLTGQHTVPNVF+GGKH+GGCT+T+KL RKG+LE +L+EA+ +  ++
Sbjct  128  VLERLTGQHTVPNVFVGGKHVGGCTETVKLNRKGDLELMLAEANGKNGQT  177



>gb|AFK36721.1| unknown [Medicago truncatula]
 gb|KEH42430.1| glutaredoxin C4 [Medicago truncatula]
Length=187

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSR+EE++K TV +NPVVVYSK+WCSY SEVK LFK+LG +PLVIELDE+GPQGPQLQK
Sbjct  78   FGSRLEETIKNTVSQNPVVVYSKSWCSYCSEVKSLFKKLGTQPLVIELDELGPQGPQLQK  137

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARK  690
            +LER+TGQ+TVPNVFIGG+HIGGCTDT+KLYRKG+LE LLS+A A+ 
Sbjct  138  LLERITGQYTVPNVFIGGQHIGGCTDTLKLYRKGDLETLLSDAVAKN  184



>emb|CDP03824.1| unnamed protein product [Coffea canephora]
Length=109

 Score =   184 bits (468),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +1

Query  391  SVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTG  570
            +VK T+ ENPVVVYSKTWCSYSSEVK L K+LG EPLVIELD++GPQGPQLQKVLERLTG
Sbjct  7    TVKTTITENPVVVYSKTWCSYSSEVKTLLKKLGCEPLVIELDQLGPQGPQLQKVLERLTG  66

Query  571  QHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTE  696
            QHTVPN+FIGGKHIGGCTDT+KL+R+GELE LLSEASA+KTE
Sbjct  67   QHTVPNLFIGGKHIGGCTDTVKLHRRGELESLLSEASAKKTE  108



>emb|CDX97456.1| BnaC08g13210D [Brassica napus]
Length=181

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  367  SFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQ  546
            +FGSRMEESVK+TV EN VVVYSKTWCSY  EVK LFKRLGV+PLVIELDE+GPQGPQLQ
Sbjct  68   TFGSRMEESVKKTVTENVVVVYSKTWCSYCIEVKTLFKRLGVQPLVIELDELGPQGPQLQ  127

Query  547  KVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            KVLERLTGQ TVPNVF+GGKHIGGCTDT+KL RKG+L  +L+EA+ +  ++
Sbjct  128  KVLERLTGQRTVPNVFVGGKHIGGCTDTVKLKRKGDLALMLAEANGKTDQT  178



>ref|XP_010940680.1| PREDICTED: monothiol glutaredoxin-S10 [Elaeis guineensis]
Length=180

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  361  SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQ  540
            S SFGSR+EESVK+T+ ENPVV+YSKTWCSYS EVK LFKR+GVEPLVIELD++GP GPQ
Sbjct  65   SASFGSRLEESVKKTISENPVVIYSKTWCSYSMEVKSLFKRIGVEPLVIELDQLGPHGPQ  124

Query  541  LQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            LQKVLERLTGQ+TVPNVFIGGKHIGGCTDT+KL+ KGEL  LLS+
Sbjct  125  LQKVLERLTGQYTVPNVFIGGKHIGGCTDTVKLHHKGELTTLLSD  169



>ref|XP_010684815.1| PREDICTED: glutaredoxin-C5, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=191

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSR+E+S+K+T+ +NPVVVYSKTWCSYSSEVK LFK+LGV+P VIELDE+G QGPQ+QK
Sbjct  84   FGSRLEDSIKKTITDNPVVVYSKTWCSYSSEVKSLFKKLGVKPFVIELDELGAQGPQVQK  143

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARK  690
            VLERLTGQHTVPNVFIG KHIGGC++T+KL+ KGELEPLLSEA+ + 
Sbjct  144  VLERLTGQHTVPNVFIGAKHIGGCSETVKLHHKGELEPLLSEANGKN  190



>ref|NP_194602.2| glutaredoxin-C5 [Arabidopsis thaliana]
 sp|Q8GWS0.1|GRXC5_ARATH RecName: Full=Glutaredoxin-C5, chloroplastic; Short=AtGrxC5; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAC43267.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39931.1| At4g28730 [Arabidopsis thaliana]
 gb|AEE85535.1| glutaredoxin-C5 [Arabidopsis thaliana]
Length=174

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRMEES+++TV EN VV+YSKTWCSY +EVK LFKRLGV+PLV+ELD++GPQGPQLQK
Sbjct  65   FGSRMEESIRKTVTENTVVIYSKTWCSYCTEVKTLFKRLGVQPLVVELDQLGPQGPQLQK  124

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            VLERLTGQHTVPNVF+ GKHIGGCTDT+KL RKG+LE +L+EA+ +  +S
Sbjct  125  VLERLTGQHTVPNVFVCGKHIGGCTDTVKLNRKGDLELMLAEANGKNGQS  174



>ref|XP_007050087.1| Glutaredoxin family protein isoform 3 [Theobroma cacao]
 gb|EOX94244.1| Glutaredoxin family protein isoform 3 [Theobroma cacao]
Length=166

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 10/126 (8%)
 Frame = +1

Query  325  SRKQC-PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPL  501
            SRKQ  P  +R ++ SFGSR+EE+VK+TV +NPVVVYSKTWCSYS+EVK LFKRLGV PL
Sbjct  50   SRKQSKPLSVRGMASSFGSRLEENVKKTVADNPVVVYSKTWCSYSAEVKSLFKRLGVNPL  109

Query  502  VIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEAS  681
            VIELDE+GPQGPQ+QKVLERLTGQHTVPNVFI         DT+KLYRKGELE LLSEA+
Sbjct  110  VIELDELGPQGPQVQKVLERLTGQHTVPNVFI---------DTVKLYRKGELETLLSEAN  160

Query  682  ARKTES  699
             + TE+
Sbjct  161  VKNTET  166



>ref|XP_010243631.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X2 [Nelumbo 
nucifera]
Length=170

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  349  IRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGP  528
            +R ++ SFGSR+E S+K+TV EN VV+YSKTWCSY+SEVK LFKRLGV+PLVIELDE+G 
Sbjct  61   VRFMASSFGSRLEGSIKKTVSENLVVIYSKTWCSYASEVKSLFKRLGVQPLVIELDELGA  120

Query  529  QGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            QGPQLQK+L RLTGQHTVPNVF+GG+HIGGCTDT+KLYRKGEL  LLSE
Sbjct  121  QGPQLQKMLGRLTGQHTVPNVFVGGRHIGGCTDTLKLYRKGELAALLSE  169



>emb|CDY68269.1| BnaA08g30760D [Brassica napus]
Length=179

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRMEESVK+TV EN VVVYSKTWCSY  EVK LFKRLGV+PLVIEL+E+GPQGPQLQK
Sbjct  67   FGSRMEESVKKTVTENVVVVYSKTWCSYCIEVKTLFKRLGVQPLVIELNELGPQGPQLQK  126

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            VLERLTGQ TVPNVF+GGKHIGGCTDT+KL RKG+L  +L+EA+ +  ++
Sbjct  127  VLERLTGQRTVPNVFVGGKHIGGCTDTVKLKRKGDLALMLAEANGKTDQT  176



>ref|XP_009109071.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Brassica rapa]
Length=179

 Score =   184 bits (467),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRMEESVK+TV EN VVVYSKTWCSY  EVK LFKRLGV+PLVIEL+E+GPQGPQLQK
Sbjct  67   FGSRMEESVKKTVTENVVVVYSKTWCSYCIEVKTLFKRLGVQPLVIELNELGPQGPQLQK  126

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            VLERLTGQ TVPNVF+GGKHIGGCTDT+KL RKG+L  +L+EA+ +
Sbjct  127  VLERLTGQRTVPNVFVGGKHIGGCTDTVKLKRKGDLALMLAEANGK  172



>emb|CDX92892.1| BnaC07g41500D [Brassica napus]
Length=178

 Score =   184 bits (466),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            RMEESV++TV EN VVVYSKTWCSY +EVK LFKRLGV+PLVIELDE+GPQGPQLQKVLE
Sbjct  72   RMEESVRKTVTENIVVVYSKTWCSYCTEVKTLFKRLGVQPLVIELDELGPQGPQLQKVLE  131

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            RLTGQHTVPNVF+GGKHIGGCTDT+KL RKG+LE +L+EA+    ++
Sbjct  132  RLTGQHTVPNVFVGGKHIGGCTDTVKLNRKGDLELMLAEANGNTNQT  178



>ref|XP_009405704.1| PREDICTED: monothiol glutaredoxin-S10 [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSR+EESVK+T+ ++P+V+YSKTWCSYS EVK LFKR+GV+PLVIELDE+GPQGPQ+QK
Sbjct  80   FGSRLEESVKKTIADHPIVIYSKTWCSYSMEVKSLFKRIGVQPLVIELDELGPQGPQVQK  139

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
             LERLTGQHTVPNVFIGGKHIGGCTDT+KL++KGEL  LLS+
Sbjct  140  ALERLTGQHTVPNVFIGGKHIGGCTDTVKLHQKGELTTLLSK  181



>ref|XP_008372416.1| PREDICTED: monothiol glutaredoxin-S10-like [Malus domestica]
Length=195

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 99/117 (85%), Gaps = 1/117 (1%)
 Frame = +1

Query  322  SSRKQCPTQIRAV-SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEP  498
            SSR+  P  ++A+ S SFGSR+EESVK+TV ENPVVVYSKTWCSYSSEVK LFKRLGVEP
Sbjct  54   SSRRWRPMSVQAMASSSFGSRLEESVKKTVDENPVVVYSKTWCSYSSEVKTLFKRLGVEP  113

Query  499  LVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLL  669
            +VIELDE+GPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCT  I L+       L+
Sbjct  114  IVIELDELGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTGIIFLHEWSSFMALV  170



>ref|XP_006659715.1| PREDICTED: LOW QUALITY PROTEIN: monothiol glutaredoxin-S10-like 
[Oryza brachyantha]
Length=172

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  367  SFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQ  546
            SFGSRME+SVK+T+ +NP+V+YSK+WCSYS EVK LFKR+GV+P VIELD +G QGPQLQ
Sbjct  62   SFGSRMEDSVKKTLADNPIVIYSKSWCSYSMEVKALFKRIGVQPHVIELDHLGAQGPQLQ  121

Query  547  KVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            KVLERLTGQ TVPNVFIGGKHIGGCTDT+KL+RKGEL  +LSE
Sbjct  122  KVLERLTGQSTVPNVFIGGKHIGGCTDTVKLHRKGELATMLSE  164



>ref|XP_006408941.1| hypothetical protein EUTSA_v10002105mg [Eutrema salsugineum]
 gb|ESQ50394.1| hypothetical protein EUTSA_v10002105mg [Eutrema salsugineum]
Length=178

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGS +EESVK TV ENPVVVYSK+WCSYSSEVK LFK L V+PLV+ELDE+GP+G QLQ 
Sbjct  69   FGSTLEESVKSTVAENPVVVYSKSWCSYSSEVKNLFKSLQVKPLVVELDELGPEGSQLQN  128

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            VLERLTGQ+TVPNVFIGGKHIGGC+DT++LY +GELEP+++EAS +
Sbjct  129  VLERLTGQYTVPNVFIGGKHIGGCSDTLQLYNRGELEPMIAEASGK  174



>ref|XP_002445658.1| hypothetical protein SORBIDRAFT_07g023540 [Sorghum bicolor]
 gb|EES15153.1| hypothetical protein SORBIDRAFT_07g023540 [Sorghum bicolor]
Length=170

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRME+SVK+TV +NPVV+YSK+WCSYS EVK LFKR+GV+P VIELD +G QGPQLQK
Sbjct  61   FGSRMEDSVKKTVADNPVVIYSKSWCSYSMEVKALFKRIGVQPHVIELDHLGAQGPQLQK  120

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            VLERLTGQ TVPNVFIGGKH+GGCTDT+KLYRKGEL  +LS+
Sbjct  121  VLERLTGQTTVPNVFIGGKHVGGCTDTVKLYRKGELASMLSD  162



>ref|XP_009137805.1| PREDICTED: glutaredoxin-C5, chloroplastic-like [Brassica rapa]
Length=177

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  385  EESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERL  564
            EESV++TV EN VVVYSKTWCSY +EVK LFKRLGV+PLVIELDE+GPQGPQLQKVLERL
Sbjct  73   EESVRKTVTENIVVVYSKTWCSYCTEVKTLFKRLGVQPLVIELDELGPQGPQLQKVLERL  132

Query  565  TGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TGQHTVPNVF+GGKHIGGCTDT+KL RKG+LE +L+EA+    ++
Sbjct  133  TGQHTVPNVFVGGKHIGGCTDTVKLNRKGDLELMLAEANGNTNQT  177



>ref|XP_004974268.1| PREDICTED: monothiol glutaredoxin-S10-like [Setaria italica]
Length=170

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FG+RME+SVK+TV +NPVV+YSK+WCSYS EVK LFKR+GV+P VIELD +G QGPQLQK
Sbjct  61   FGARMEDSVKKTVADNPVVIYSKSWCSYSMEVKALFKRIGVQPHVIELDHLGAQGPQLQK  120

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            VLERLTGQ TVPNVFIGGKH+GGCTDT+KL+RKGEL  +LSE
Sbjct  121  VLERLTGQSTVPNVFIGGKHVGGCTDTVKLHRKGELASMLSE  162



>dbj|BAK05185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=165

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRME+SVK+T+ +NPVV+YSK+WCSYS EVK LFKR+GV+P VIELD +G QGPQLQK
Sbjct  55   FGSRMEDSVKKTLADNPVVIYSKSWCSYSMEVKGLFKRIGVDPHVIELDHLGAQGPQLQK  114

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            VLERLTGQ TVPNVFIGGKHIGGCTDT+KLYRKGEL  +L+E   +   S
Sbjct  115  VLERLTGQSTVPNVFIGGKHIGGCTDTVKLYRKGELATMLTELDIKVNNS  164



>ref|XP_011080141.1| PREDICTED: monothiol glutaredoxin-S10-like [Sesamum indicum]
Length=174

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 102/119 (86%), Gaps = 1/119 (1%)
 Frame = +1

Query  346  QIRAV-SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEM  522
            +IRA+ S S GS +EE VK+T+GENPVVVYSKTWCSYSSEVK LFKRLGV P V+ELD++
Sbjct  56   RIRAMCSDSSGSGLEEDVKKTIGENPVVVYSKTWCSYSSEVKSLFKRLGVNPHVVELDQL  115

Query  523  GPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            G QG +LQK LE LTGQ TVPNVFIG KHIGGC+DT+KL+++G+LE LLSEA A K+ES
Sbjct  116  GSQGSELQKTLESLTGQRTVPNVFIGSKHIGGCSDTVKLHQQGKLESLLSEAGAVKSES  174



>emb|CDY06875.1| BnaC01g09740D [Brassica napus]
Length=175

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGS MEESVK+TV +N VVVYSKTWC Y SEVK LFKRLGV+PLV+ELDE+GPQG QLQ 
Sbjct  66   FGSGMEESVKKTVADNTVVVYSKTWCPYCSEVKTLFKRLGVQPLVVELDELGPQGTQLQS  125

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            VLE LTGQ TVPNVF+GGKHIGGCTDT+ L RKGELE +L+EA+A+  ++
Sbjct  126  VLETLTGQRTVPNVFVGGKHIGGCTDTVNLNRKGELELMLAEANAKTDQT  175



>ref|XP_003573227.1| PREDICTED: monothiol glutaredoxin-S10-like [Brachypodium distachyon]
Length=168

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRME+SVK+T+ +NPVV+YSK+WCSYS EVK LFKR+GV+P VIELD +G QGPQLQK
Sbjct  59   FGSRMEDSVKKTLADNPVVIYSKSWCSYSMEVKGLFKRIGVQPHVIELDHLGAQGPQLQK  118

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            VLERLTGQ TVPNVFIGGKHIGGCTDT+KLYRKGEL  +LSE
Sbjct  119  VLERLTGQSTVPNVFIGGKHIGGCTDTVKLYRKGELATMLSE  160



>ref|NP_001175705.1| Os08g0565800 [Oryza sativa Japonica Group]
 sp|Q0J3L4.2|GRS10_ORYSJ RecName: Full=Monothiol glutaredoxin-S10 [Oryza sativa Japonica 
Group]
 dbj|BAC56010.1| glutaredoxin protein family-like [Oryza sativa Japonica Group]
 dbj|BAD10333.1| glutaredoxin protein family-like [Oryza sativa Japonica Group]
 gb|EAZ43692.1| hypothetical protein OsJ_28319 [Oryza sativa Japonica Group]
 dbj|BAG88313.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94433.1| Os08g0565800 [Oryza sativa Japonica Group]
Length=164

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            RME+SVKRT+ +NPVV+YSK+WCSYS EVK LFKR+GV+P VIELD++G QGPQLQKVLE
Sbjct  58   RMEDSVKRTLADNPVVIYSKSWCSYSMEVKALFKRIGVQPHVIELDQLGAQGPQLQKVLE  117

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            RLTGQ TVPNVFIGGKHIGGCTDT+KL+RKGEL  +LSE
Sbjct  118  RLTGQSTVPNVFIGGKHIGGCTDTVKLHRKGELATMLSE  156



>ref|XP_009129320.1| PREDICTED: glutaredoxin-C5, chloroplastic [Brassica rapa]
 emb|CDY35215.1| BnaA01g08160D [Brassica napus]
Length=173

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 104/127 (82%), Gaps = 4/127 (3%)
 Frame = +1

Query  331  KQCPTQ---IRAVSGS-FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEP  498
            K+C  Q   +RA+S S F S MEESVK+TV +N VVVYSKTWC Y SEVK LFKRLGV+P
Sbjct  47   KKCLKQTCSVRAMSSSSFESGMEESVKKTVNDNTVVVYSKTWCPYCSEVKTLFKRLGVQP  106

Query  499  LVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEA  678
            LV+ELDE+GPQG QLQKVLE LTGQ TVP+VF+GGKHIGGCTDT+ L RKGELE +L+EA
Sbjct  107  LVVELDELGPQGTQLQKVLETLTGQRTVPSVFVGGKHIGGCTDTVNLNRKGELELMLAEA  166

Query  679  SARKTES  699
            + +  ++
Sbjct  167  NGKTDQT  173



>ref|NP_001141356.1| uncharacterized protein LOC100273447 [Zea mays]
 gb|ACF84677.1| unknown [Zea mays]
 gb|ACF86156.1| unknown [Zea mays]
 gb|ACG26668.1| Grx_S12 - glutaredoxin subgroup I [Zea mays]
 gb|AFW61641.1| grx_S12-glutaredoxin subgroup I [Zea mays]
Length=178

 Score =   176 bits (447),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQK  549
            FGSRMEESVK+TV +NPVV+YSK+WCSY  EVK LFKR+GV+P VIELD +G QGPQ+QK
Sbjct  69   FGSRMEESVKKTVADNPVVIYSKSWCSYCMEVKALFKRIGVQPHVIELDHLGAQGPQIQK  128

Query  550  VLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLS  672
            VLERLTGQ TVPNVFIGGKH+GGCTDT+KLYRKGEL  +LS
Sbjct  129  VLERLTGQSTVPNVFIGGKHVGGCTDTVKLYRKGELASMLS  169



>gb|EAZ08051.1| hypothetical protein OsI_30316 [Oryza sativa Indica Group]
Length=164

 Score =   176 bits (445),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            RME+SVKRT+ +NPVV+YSK+WCSYS EVK LFKR+GV+P VIELD++G QGPQLQKVLE
Sbjct  58   RMEDSVKRTLADNPVVIYSKSWCSYSMEVKALFKRIGVQPHVIELDQLGAQGPQLQKVLE  117

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            RLTGQ TVPNVFIGGKHIGGCTDT+KL+RKGEL  +LSE
Sbjct  118  RLTGQSTVPNVFIGGKHIGGCTDTVKLHRKGELATMLSE  156



>ref|XP_010243632.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X3 [Nelumbo 
nucifera]
Length=168

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 97/109 (89%), Gaps = 2/109 (2%)
 Frame = +1

Query  349  IRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGP  528
            +R ++ SFGSR+E S+K+TV EN VV+YSKTW  Y+SEVK LFKRLGV+PLVIELDE+G 
Sbjct  61   VRFMASSFGSRLEGSIKKTVSENLVVIYSKTW--YASEVKSLFKRLGVQPLVIELDELGA  118

Query  529  QGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            QGPQLQK+L RLTGQHTVPNVF+GG+HIGGCTDT+KLYRKGEL  LLSE
Sbjct  119  QGPQLQKMLGRLTGQHTVPNVFVGGRHIGGCTDTLKLYRKGELAALLSE  167



>gb|ACF82007.1| unknown [Zea mays]
 gb|ACF86281.1| unknown [Zea mays]
 tpg|DAA48527.1| TPA: grx_S12-glutaredoxin subgroup I [Zea mays]
Length=167

 Score =   173 bits (439),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            RME+SVK+TV +NPVV+YSK+WCSYS EVK LFKR+GV+P VIELD +G QGPQLQKVLE
Sbjct  61   RMEDSVKKTVADNPVVIYSKSWCSYSMEVKSLFKRIGVQPHVIELDNLGAQGPQLQKVLE  120

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            RLTGQ TVPNVFIGGKH+GGCTDT+KLYRKGEL  +LS+
Sbjct  121  RLTGQSTVPNVFIGGKHVGGCTDTVKLYRKGELASMLSD  159



>ref|NP_001148595.1| Grx_S12 - glutaredoxin subgroup I [Zea mays]
 gb|ACG32167.1| Grx_S12 - glutaredoxin subgroup I [Zea mays]
Length=167

 Score =   171 bits (432),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            RME+SVK+TV +NPVV+YSK+WCSYS EVK LFKR+GV+P VIELD +G QGPQLQKVLE
Sbjct  61   RMEDSVKKTVADNPVVIYSKSWCSYSMEVKSLFKRIGVQPHVIELDNLGAQGPQLQKVLE  120

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            RLTGQ TVPNVFIGGKH+G CTDT+KLYRKGEL  +LS+
Sbjct  121  RLTGQSTVPNVFIGGKHVGRCTDTVKLYRKGELASMLSD  159



>ref|XP_002883935.1| hypothetical protein ARALYDRAFT_899837 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60194.1| hypothetical protein ARALYDRAFT_899837 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 102/127 (80%), Gaps = 13/127 (10%)
 Frame = +1

Query  343  TQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEM  522
            + +RA+S SFGS +EE+VK TV ENPVVVYSKT+CSYSSEVK LFK L VEPLV+ELDE+
Sbjct  58   SSVRAMS-SFGSTLEETVKTTVAENPVVVYSKTYCSYSSEVKSLFKSLQVEPLVVELDEL  116

Query  523  G------------PQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPL  666
            G             +GPQLQ VLE++TGQ+TVPNVFIGGKHIGGC+DT++LY KGELE +
Sbjct  117  GMLTSLQEMFVTSSEGPQLQNVLEKITGQYTVPNVFIGGKHIGGCSDTLQLYNKGELEAM  176

Query  667  LSEASAR  687
            L+EA+ +
Sbjct  177  LAEANGK  183



>gb|ERN15790.1| hypothetical protein AMTR_s00039p00123020, partial [Amborella 
trichopoda]
Length=91

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +1

Query  355  AVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQG  534
            A++ SFGSR+EESVKRTV ENP+V+YSKTWCSYS EVK LFKRLGVEPLVIELDE+G QG
Sbjct  2    AMAASFGSRLEESVKRTVVENPIVIYSKTWCSYSMEVKSLFKRLGVEPLVIELDELGSQG  61

Query  535  PQLQKVLERLTGQHTVPNVFIGGKHIGGCT  624
            PQLQKVLERLTGQ TVPNVFIGGKHIGGCT
Sbjct  62   PQLQKVLERLTGQFTVPNVFIGGKHIGGCT  91



>ref|XP_006298612.1| hypothetical protein CARUB_v10014698mg, partial [Capsella rubella]
 gb|EOA31510.1| hypothetical protein CARUB_v10014698mg, partial [Capsella rubella]
Length=195

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            +EE+VK TV ENPVVVYSK+WCSYSSEVK LFK L VEPLV+ELDE+G +G QLQ VLE+
Sbjct  90   LEETVKTTVAENPVVVYSKSWCSYSSEVKSLFKSLQVEPLVVELDELGSEGSQLQNVLEK  149

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            LTGQ+TVPNVFIGGKHIGGC+DT++LY KGELE +L+EA+ +  +S
Sbjct  150  LTGQYTVPNVFIGGKHIGGCSDTLQLYNKGELEAILAEANGKTGQS  195



>ref|XP_010495920.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Camelina 
sativa]
Length=178

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            +EE+VK+TV ENPVVVYSK+WCSYSSEVK LFK L VEPLV+ELDE+G +G QLQ VLE+
Sbjct  73   LEETVKKTVAENPVVVYSKSWCSYSSEVKSLFKSLQVEPLVVELDELGSEGSQLQNVLEK  132

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            +TGQ+TVPNVFIGGKHIGGC+DT++LY KGELE +L+EA+ +
Sbjct  133  ITGQYTVPNVFIGGKHIGGCSDTLQLYNKGELEGILAEANGK  174



>emb|CDY05731.1| BnaC07g00720D [Brassica napus]
Length=174

 Score =   166 bits (419),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            +EE+VK TV ENPVVVYSK+WCSYSSEVK LF  L V+PLVIELDE+G +G QLQ VLE+
Sbjct  69   LEETVKTTVAENPVVVYSKSWCSYSSEVKSLFNGLQVKPLVIELDELGAEGSQLQNVLEK  128

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            LTGQ TVPNVFIGGKHIGGC+DT++LY KGELEP+L+ A+A+
Sbjct  129  LTGQFTVPNVFIGGKHIGGCSDTLQLYNKGELEPMLAAANAK  170



>ref|XP_009102049.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic [Brassica 
rapa]
Length=176

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            +EE+VK TV ENPVVVYSK+WCSYSSEVK LF  L V+PLV+ELD++G +G QLQ VLE+
Sbjct  71   LEETVKTTVAENPVVVYSKSWCSYSSEVKSLFNGLQVKPLVVELDQLGAEGSQLQTVLEK  130

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            LTGQ TVPNVFIGGKHIGGC+DT++LY KG+LEP+L+EA+A+
Sbjct  131  LTGQFTVPNVFIGGKHIGGCSDTLQLYNKGQLEPMLAEANAK  172



>ref|XP_010489071.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic [Camelina 
sativa]
Length=194

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            +EE+VK+TV ENPVVVYSK+WCSYSSEVK LFK L VEPLV+ELDE+G +G QLQ VLE+
Sbjct  89   LEETVKKTVAENPVVVYSKSWCSYSSEVKSLFKSLQVEPLVVELDELGSEGSQLQNVLEK  148

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            +TGQ+TVPNVFIGGKHIGGC+DT++LY KGELE +++EA+ +
Sbjct  149  ITGQYTVPNVFIGGKHIGGCSDTLQLYNKGELEGIIAEANGK  190



>emb|CDY31980.1| BnaA07g00150D [Brassica napus]
Length=173

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            +EE+VK TV ENPVVVYSK+WCSYSSEVK LF  L V+PLV+ELD++G +G QLQ VLE+
Sbjct  68   LEETVKTTVAENPVVVYSKSWCSYSSEVKSLFNGLQVKPLVVELDQLGAEGSQLQTVLEK  127

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            LTGQ TVPNVFIGGKHIGGC+DT++LY KG+LEP+L+EA+A+
Sbjct  128  LTGQFTVPNVFIGGKHIGGCSDTLQLYNKGQLEPMLAEANAK  169



>ref|XP_006443692.1| hypothetical protein CICLE_v10022530mg [Citrus clementina]
 gb|ESR56932.1| hypothetical protein CICLE_v10022530mg [Citrus clementina]
Length=144

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  328  RKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVI  507
            R+     ++A++ SFGSR+EESVK+TV ENPVVVYSKTWCSYSSEVK+LFKRLGVEPLVI
Sbjct  53   RRYGALSVQAMASSFGSRLEESVKKTVSENPVVVYSKTWCSYSSEVKLLFKRLGVEPLVI  112

Query  508  ELDEMGPQGPQLQKVLERLTGQHTVPNVFIG  600
            ELDEMGPQGPQLQK+LERLTGQHTVPNVFIG
Sbjct  113  ELDEMGPQGPQLQKLLERLTGQHTVPNVFIG  143



>ref|NP_179617.1| monothiol glutaredoxin-S12 [Arabidopsis thaliana]
 sp|Q8LBS4.2|GRS12_ARATH RecName: Full=Monothiol glutaredoxin-S12, chloroplastic; Short=AtGrxS12; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD21761.1| putative glutaredoxin [Arabidopsis thaliana]
 gb|AAM19817.1| At2g20270/F11A3.18 [Arabidopsis thaliana]
 gb|AAM67430.1| At2g20270/F11A3.18 [Arabidopsis thaliana]
 gb|AEC06987.1| monothiol glutaredoxin-S12 [Arabidopsis thaliana]
Length=179

 Score =   164 bits (414),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            +EE+VK TV ENPVVVYSKTWCSYSS+VK LFK L VEPLV+ELD++G +G QLQ VLE+
Sbjct  74   LEETVKTTVAENPVVVYSKTWCSYSSQVKSLFKSLQVEPLVVELDQLGSEGSQLQNVLEK  133

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            +TGQ+TVPNVFIGGKHIGGC+DT++L+ KGELE +L+EA+ +  ++
Sbjct  134  ITGQYTVPNVFIGGKHIGGCSDTLQLHNKGELEAILAEANGKNGQT  179



>gb|KJB42411.1| hypothetical protein B456_007G151300 [Gossypium raimondii]
Length=166

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 95/120 (79%), Gaps = 9/120 (8%)
 Frame = +1

Query  340  PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDE  519
            P  IR ++ SFGSR ++SV +TV +NPVVVYSK+WC +SSEVK LFK+LGVEPLVIELDE
Sbjct  56   PMSIRGMASSFGSRQDDSVTKTVADNPVVVYSKSWCPFSSEVKSLFKKLGVEPLVIELDE  115

Query  520  MGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            +GPQGPQLQ VLE LTGQ TVPNVFI         DT++LY  GELE LLS+A+A++ E+
Sbjct  116  LGPQGPQLQNVLEGLTGQRTVPNVFI---------DTVELYHNGELESLLSDANAKRKEN  166



>ref|XP_002525351.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF36989.1| glutaredoxin, grx, putative [Ricinus communis]
Length=165

 Score =   162 bits (411),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  325  SRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLV  504
            SRK  P  +RA++ SFGSR+EESVK+TV ENPVVVYSKTWCSYSSEVK LFK+LGVEPLV
Sbjct  52   SRKHGPVSVRAMTSSFGSRLEESVKKTVDENPVVVYSKTWCSYSSEVKALFKKLGVEPLV  111

Query  505  IELDEMGPQGPQLQKVLERLTGQHTVPNVFIG  600
            IELDE+G QGPQ+QKVLERLTGQHTVPNVFIG
Sbjct  112  IELDELGAQGPQIQKVLERLTGQHTVPNVFIG  143



>gb|KDO65787.1| hypothetical protein CISIN_1g030613mg [Citrus sinensis]
Length=144

 Score =   162 bits (409),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  328  RKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVI  507
            R+     ++A++ S+GSR+EESVK+TV ENPVVVYSKTWCSYSSEVK+LFKRLGVEPLVI
Sbjct  53   RRYGAVSVQAMASSYGSRLEESVKKTVSENPVVVYSKTWCSYSSEVKLLFKRLGVEPLVI  112

Query  508  ELDEMGPQGPQLQKVLERLTGQHTVPNVFIG  600
            ELDEMGPQGPQLQK+LERLTGQHTVPNVFIG
Sbjct  113  ELDEMGPQGPQLQKLLERLTGQHTVPNVFIG  143



>ref|XP_010416046.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Camelina 
sativa]
Length=171

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            +EE+VK TV +NPVVVYSK+WCSYSSEVK LFK L VEPLV+ELDE+G +G QLQ VLE+
Sbjct  66   LEETVKTTVAQNPVVVYSKSWCSYSSEVKSLFKSLQVEPLVVELDELGSEGSQLQNVLEK  125

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            +TGQ+TVPNVFIGGKHIGGC+DT+++Y KGELE +++EAS +
Sbjct  126  ITGQYTVPNVFIGGKHIGGCSDTLQMYNKGELEGIIAEASGK  167



>gb|AAM64584.1| putative glutaredoxin [Arabidopsis thaliana]
Length=179

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            +EE+VK TV ENPVVVYSKTWCSYSS+VK  FK L VEPLV+ELD++G +G QLQ VLE+
Sbjct  74   LEETVKTTVAENPVVVYSKTWCSYSSQVKSFFKSLQVEPLVVELDQLGSEGSQLQNVLEK  133

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            +TGQ+TVPNVFIGGKHIGGC+DT++L+ KGELE +L+EA+ +  ++
Sbjct  134  ITGQYTVPNVFIGGKHIGGCSDTLQLHNKGELEAILAEANGKNGQT  179



>gb|KJB42410.1| hypothetical protein B456_007G151300 [Gossypium raimondii]
Length=163

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  340  PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDE  519
            P  IR ++ SFGSR ++SV +TV +NPVVVYSK+WC +SSEVK LFK+LGVEPLVIELDE
Sbjct  56   PMSIRGMASSFGSRQDDSVTKTVADNPVVVYSKSWCPFSSEVKSLFKKLGVEPLVIELDE  115

Query  520  MGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCT  624
            +GPQGPQLQ VLE LTGQ TVPNVFIGGKHIGGCT
Sbjct  116  LGPQGPQLQNVLEGLTGQRTVPNVFIGGKHIGGCT  150



>ref|XP_010263986.1| PREDICTED: glutaredoxin-C5, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=154

 Score =   155 bits (391),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +1

Query  349  IRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGP  528
            +R+++ SFGSR+EES+K+TV ENPVVVYSKTWCSYSSEVK LFKRLGVEPLVIELDEMGP
Sbjct  61   VRSMAASFGSRLEESIKKTVSENPVVVYSKTWCSYSSEVKALFKRLGVEPLVIELDEMGP  120

Query  529  QGPQLQKVLERLTGQHTVPNVFI  597
            QGPQLQK+LERLTGQ+TVPNVFI
Sbjct  121  QGPQLQKMLERLTGQYTVPNVFI  143



>gb|KFK40389.1| hypothetical protein AALP_AA3G367200 [Arabis alpina]
Length=181

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            MEE+VK TV ENPVVVYSKT+CSYS +VK LFKRL VEPLVIELDE+G +G QLQ VL +
Sbjct  76   MEETVKTTVTENPVVVYSKTYCSYSFQVKSLFKRLEVEPLVIELDELGSEGSQLQNVLLK  135

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            LTGQ TVPNVFIGGKHIGGC+D ++L  KGELE L++EA+ +
Sbjct  136  LTGQSTVPNVFIGGKHIGGCSDALELDNKGELESLIAEANGK  177



>emb|CAA22979.1| putative protein [Arabidopsis thaliana]
 emb|CAB81461.1| putative protein [Arabidopsis thaliana]
Length=176

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 93/113 (82%), Gaps = 4/113 (4%)
 Frame = +1

Query  370  FGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLG---VEPLVIELDEMGPQGPQ  540
            FGSRMEES+++TV EN VV+YSKTW  + S   +L  R+G   + PLV+ELD++GPQGPQ
Sbjct  65   FGSRMEESIRKTVTENTVVIYSKTWICFISFF-LLNWRMGLSNILPLVVELDQLGPQGPQ  123

Query  541  LQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            LQKVLERLTGQHTVPNVF+ GKHIGGCTDT+KL RKG+LE +L+EA+ +  +S
Sbjct  124  LQKVLERLTGQHTVPNVFVCGKHIGGCTDTVKLNRKGDLELMLAEANGKNGQS  176



>gb|KDO65785.1| hypothetical protein CISIN_1g030613mg [Citrus sinensis]
 gb|KDO65786.1| hypothetical protein CISIN_1g030613mg [Citrus sinensis]
Length=149

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 85/117 (73%), Gaps = 25/117 (21%)
 Frame = +1

Query  328  RKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVI  507
            R+     ++A++ S+GSR+EESVK+TV ENPVVVYSKTWCSYSSEVK+LFKRLGVEPLVI
Sbjct  53   RRYGAVSVQAMASSYGSRLEESVKKTVSENPVVVYSKTWCSYSSEVKLLFKRLGVEPLVI  112

Query  508  ELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEA  678
            ELDEM                         GGKHIGGCTDT+KLYRKGELEPLLSEA
Sbjct  113  ELDEM-------------------------GGKHIGGCTDTVKLYRKGELEPLLSEA  144



>dbj|BAD10332.1| glutaredoxin protein family-like [Oryza sativa Japonica Group]
 dbj|BAD12949.1| glutaredoxin protein family-like [Oryza sativa Japonica Group]
Length=152

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 81/99 (82%), Gaps = 12/99 (12%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            RME+SVKRT+ +NPVV+YSK+WCS            GV+P VIELD++G QGPQLQKVLE
Sbjct  58   RMEDSVKRTLADNPVVIYSKSWCS------------GVQPHVIELDQLGAQGPQLQKVLE  105

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            RLTGQ TVPNVFIGGKHIGGCTDT+KL+RKGEL  +LSE
Sbjct  106  RLTGQSTVPNVFIGGKHIGGCTDTVKLHRKGELATMLSE  144



>ref|NP_001189560.1| monothiol glutaredoxin-S12 [Arabidopsis thaliana]
 gb|AEC06988.1| monothiol glutaredoxin-S12 [Arabidopsis thaliana]
Length=206

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 93/133 (70%), Gaps = 27/133 (20%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEM-------------  522
            +EE+VK TV ENPVVVYSKTWCSYSS+VK LFK L VEPLV+ELD++             
Sbjct  74   LEETVKTTVAENPVVVYSKTWCSYSSQVKSLFKSLQVEPLVVELDQLVSLGKTSLPHDIG  133

Query  523  --------------GPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELE  660
                          G +G QLQ VLE++TGQ+TVPNVFIGGKHIGGC+DT++L+ KGELE
Sbjct  134  LKHLQKFWWFLAFPGSEGSQLQNVLEKITGQYTVPNVFIGGKHIGGCSDTLQLHNKGELE  193

Query  661  PLLSEASARKTES  699
             +L+EA+ +  ++
Sbjct  194  AILAEANGKNGQT  206



>ref|XP_002521163.1| glutaredoxin, grx, putative [Ricinus communis]
 gb|EEF41314.1| glutaredoxin, grx, putative [Ricinus communis]
Length=158

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = +1

Query  325  SRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLV  504
            SRK  P  +RA++ SFGSR+EE VKRTV E+PVVVYSKTWCSYSSEVK LF++LGV PLV
Sbjct  61   SRKHRPVSVRAMA-SFGSRLEEGVKRTVSESPVVVYSKTWCSYSSEVKALFRKLGVNPLV  119

Query  505  IELDEMGPQGPQLQKVLERLTGQHTVPN  588
            IELDE+G QGPQ+QKVLERLTGQHTVPN
Sbjct  120  IELDELGAQGPQIQKVLERLTGQHTVPN  147



>gb|ABK23374.1| unknown [Picea sitchensis]
Length=181

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  349  IRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGP  528
            IRA +GS GS+++ES++  + ENPVVVYSKTWC Y  + K LF+ LGV+P V+ELDE+G 
Sbjct  67   IRATAGSSGSQIKESIETEINENPVVVYSKTWCPYCQQAKGLFEDLGVKPYVVELDELGA  126

Query  529  QGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
                +Q  LE LTGQ TVPNVFIGGKHIGGC+DT++L++ GEL PLLS A  +
Sbjct  127  AERHVQNALEGLTGQSTVPNVFIGGKHIGGCSDTMELHQNGELIPLLSAAGVK  179



>gb|ABK22430.1| unknown [Picea sitchensis]
Length=181

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  349  IRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGP  528
            IRA +GS GS+++ES++  + ENPVVVYSKTWC Y  + K LF+ LGV+P V+ELDE+G 
Sbjct  67   IRATAGSSGSQIKESIETEINENPVVVYSKTWCPYCQQAKGLFEDLGVKPYVVELDELGA  126

Query  529  QGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
                +Q  LE LTGQ TVPNVFIGGKHIGGC+DT++L++ GEL PLLS A  +
Sbjct  127  AERHVQNALEGLTGQSTVPNVFIGGKHIGGCSDTMELHQNGELIPLLSAAGVK  179



>ref|XP_011083087.1| PREDICTED: glutaredoxin-C5, chloroplastic-like isoform X2 [Sesamum 
indicum]
Length=151

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 83/113 (73%), Gaps = 25/113 (22%)
 Frame = +1

Query  361  SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQ  540
            S SFGSR+EE+VK+TVGENPVVVYSKTWCSYSSEVK LFKRLGVEP+VIELD++      
Sbjct  64   SPSFGSRLEETVKKTVGENPVVVYSKTWCSYSSEVKSLFKRLGVEPIVIELDQL------  117

Query  541  LQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
                               GGKHIGGCTDTIKL+RKGELEPLLSEA A K+ S
Sbjct  118  -------------------GGKHIGGCTDTIKLHRKGELEPLLSEAGAMKSTS  151



>gb|ABR18238.1| unknown [Picea sitchensis]
Length=147

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  349  IRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGP  528
            I ++  S GS++E S+K  + ENP+++YSKT C Y   VK LF RLGV+P+V+ELDE+GP
Sbjct  33   IISMCASVGSQIEFSIKDKISENPLIIYSKTRCPYCRAVKTLFNRLGVKPVVVELDELGP  92

Query  529  QGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
               QL+  L+RLTGQ TVPN+FIGGKHIGGC++T+ L++KGEL PLLS +  +
Sbjct  93   AQYQLKNALKRLTGQSTVPNIFIGGKHIGGCSETMALHKKGELIPLLSASGLK  145



>ref|XP_002303098.2| glutaredoxin family protein [Populus trichocarpa]
 gb|EEE82371.2| glutaredoxin family protein [Populus trichocarpa]
Length=183

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            R+E++VK+TV ENPVVVYSKTWCSYS EVK LFKRL V+PLV+ELDE+G QGPQ+QKVLE
Sbjct  79   RLEDAVKKTVAENPVVVYSKTWCSYSFEVKSLFKRLNVDPLVVELDELGAQGPQIQKVLE  138

Query  559  RLTGQHTVPNVFIG  600
            RLTGQHTVPNVFI 
Sbjct  139  RLTGQHTVPNVFIA  152



>ref|XP_001782119.1| predicted protein [Physcomitrella patens]
 gb|EDQ53063.1| predicted protein [Physcomitrella patens]
Length=113

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 74/110 (67%), Gaps = 5/110 (5%)
 Frame = +1

Query  373  GSRMEESVKRTVGENPVVVYSKTWC---SYSSEVKVLFKRLGVEPLVIELDEMGPQGPQL  543
            GS +E  +K+     PVVVYSKT+C    Y   VK LF  LG +  VIELD  G  G  L
Sbjct  6    GSDLELWIKKKNSSEPVVVYSKTYCPYYRYCMRVKKLFSTLGYDFEVIELDAGGQLG--L  63

Query  544  QKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKT  693
            Q  LER++GQ+TVPNVFIGGKHIGGC DT+ L+ KG+LEPLL  A A ++
Sbjct  64   QDALERVSGQYTVPNVFIGGKHIGGCDDTVALHSKGQLEPLLQAAGANRS  113



>ref|XP_005539560.1| glutaredoxin type 1 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM83524.1| glutaredoxin type 1 [Cyanidioschyzon merolae strain 10D]
Length=189

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = +1

Query  346  QIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMG  525
            +++ V+ S  S +E+ ++  V   PVVV+SK+WC + ++VK L + L     +IELDE+G
Sbjct  72   RVQRVTMSSSSGLEQQLRELVASQPVVVFSKSWCGFCAQVKSLMQELQAPAQIIELDELG  131

Query  526  PQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTE  696
              G ++Q +L   TGQ TVPNVFIGGKHIGGC++T++ Y +GEL  L+ EA  RK+E
Sbjct  132  NDGIEIQNLLYGWTGQRTVPNVFIGGKHIGGCSETMEAYERGELVTLIKEAK-RKSE  187



>gb|KDO65788.1| hypothetical protein CISIN_1g030613mg [Citrus sinensis]
Length=126

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  328  RKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVI  507
            R+     ++A++ S+GSR+EESVK+TV ENPVVVYSKTWCSYSSEVK+LFKRLGVEPLVI
Sbjct  53   RRYGAVSVQAMASSYGSRLEESVKKTVSENPVVVYSKTWCSYSSEVKLLFKRLGVEPLVI  112

Query  508  ELDEMG  525
            ELDEMG
Sbjct  113  ELDEMG  118



>ref|XP_009352869.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009359195.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009372578.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009374093.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009333941.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009339894.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
Length=167

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +1

Query  325  SRKQCPTQIRAV-SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPL  501
            SR+  P  ++A+ S SFGSR+EESVK+TV ENPVVVYSKTWCSYSSEVK LFKRLGVEP+
Sbjct  44   SRRWRPMSVQAMASSSFGSRLEESVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPI  103

Query  502  VIELDEMG  525
            VIELDE+G
Sbjct  104  VIELDELG  111



>ref|XP_007209772.1| hypothetical protein PRUPE_ppa013483mg [Prunus persica]
 gb|EMJ10971.1| hypothetical protein PRUPE_ppa013483mg [Prunus persica]
Length=120

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
            VK  V  NPVVV+SKT+C Y   VK L  +LG    VIELDE G  G + Q  L   TGQ
Sbjct  21   VKTIVNSNPVVVFSKTYCGYCKRVKQLLTQLGATYKVIELDE-GTDGDETQAALAEWTGQ  79

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFIGGKHIGGC   ++ ++ G L PLLSEA A
Sbjct  80   RTVPNVFIGGKHIGGCDSVLEKHQAGHLLPLLSEAGA  116



>ref|XP_009367237.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009379483.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
Length=137

 Score =   107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +1

Query  325  SRKQCPTQIRAV-SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPL  501
            SR+  P  ++A+ S SFGSR+EESVK+TV ENPVVVYSKTWCSYSSEVK LFKRLGVEP+
Sbjct  55   SRRWRPMSVQAMASSSFGSRLEESVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPI  114

Query  502  VIELDEMG  525
            VIELDE+G
Sbjct  115  VIELDELG  122



>ref|XP_008245004.1| PREDICTED: glutaredoxin [Prunus mume]
Length=120

 Score =   106 bits (264),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
            VK  V  NPVVV+SKT+C Y   VK L  +LG    VIELDE G  G + Q  L   TGQ
Sbjct  21   VKTIVNSNPVVVFSKTYCGYCKRVKQLLTQLGATYKVIELDE-GTDGDETQAALAEWTGQ  79

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFIGGKHIGGC   ++ ++ G L PLLSEA A
Sbjct  80   RTVPNVFIGGKHIGGCDSVLEKHQAGHLLPLLSEAGA  116



>ref|XP_009341624.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009356411.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009366104.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009370463.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009377492.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009338423.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009340365.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009340375.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like [Pyrus 
x bretschneideri]
Length=178

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +1

Query  325  SRKQCPTQIRAV-SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPL  501
            SR+  P  ++A+ S SFGSR+EESVK+TV ENPVVVYSKTWCSYSSEVK LFKRLGVEP+
Sbjct  55   SRRWRPMSVQAMASSSFGSRLEESVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPI  114

Query  502  VIELDEMG  525
            VIELDE+G
Sbjct  115  VIELDELG  122



>ref|XP_009395004.1| PREDICTED: glutaredoxin-like [Musa acuminata subsp. malaccensis]
Length=110

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K+ V  NPVVV+SK++C Y + VK L  +LG +   IELD +   GPQ+Q+ L   TGQ 
Sbjct  7    KQIVSSNPVVVFSKSYCPYCTRVKQLLTQLGAKYKAIELD-VESDGPQIQEALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVF+GGKHIGGC +T+  + KGEL PLL +A A
Sbjct  66   TVPNVFVGGKHIGGCDNTMASHGKGELVPLLVDAGA  101



>ref|XP_009415793.1| PREDICTED: glutaredoxin-like [Musa acuminata subsp. malaccensis]
Length=106

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            E  K TV  NPVVV+SKT+C +   VK L  +LG     IELD +   G  +Q  L   T
Sbjct  4    EKAKETVSSNPVVVFSKTFCPFCVRVKKLLDQLGARYKAIELD-VESDGSDIQAALAEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGGKHIGGC DT+  +++G+L+PLL EA A
Sbjct  63   GQRTVPNVFIGGKHIGGCDDTLAKHQQGKLKPLLIEAGA  101



>ref|XP_002947896.1| hypothetical protein VOLCADRAFT_79918 [Volvox carteri f. nagariensis]
 gb|EFJ50884.1| hypothetical protein VOLCADRAFT_79918 [Volvox carteri f. nagariensis]
Length=138

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 79/128 (62%), Gaps = 7/128 (5%)
 Frame = +1

Query  292  FGTESRFPKFSSRKQCPTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKV  471
            F   SR P  +  +      + V  +  S+  +++K+TV +N VVVYSKT+C Y + VK 
Sbjct  13   FSAASRLPARAVTR------KVVVRTLASK-ADTIKQTVADNKVVVYSKTYCPYCTRVKG  65

Query  472  LFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKG  651
            LF  L V   V+ELD MG +G ++Q  L+ +TG+ TVP VF+GGK IGGC DT+  +  G
Sbjct  66   LFTELKVPYKVLELDNMGSEGAEIQDALQPITGRRTVPQVFVGGKFIGGCDDTMAAHAAG  125

Query  652  ELEPLLSE  675
            +L+ +L E
Sbjct  126  KLKSVLGE  133



>ref|XP_006652495.1| PREDICTED: glutaredoxin-C6-like [Oryza brachyantha]
Length=113

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C +   VK LF++LG     IELD +   GP+LQ  L   TGQ 
Sbjct  7    KEIVASTPVVVFSKTYCPFCVRVKKLFEQLGATFKAIELD-VESDGPELQSALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DT+ L   G+L PLL+EA A
Sbjct  66   TVPNVFINGKHIGGCDDTMALNSAGKLVPLLTEAGA  101



>ref|XP_009362980.1| PREDICTED: glutaredoxin [Pyrus x bretschneideri]
Length=120

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
            VK  V  NPVVV+SKT+C Y   VK L  +LG    VIELDE G  G ++Q  L + TGQ
Sbjct  21   VKTIVDSNPVVVFSKTYCGYCKRVKQLLTQLGATFKVIELDE-GIDGGEMQAALAQWTGQ  79

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFIGGKH+GGC   ++ +  G+L PLL+EA A
Sbjct  80   TTVPNVFIGGKHVGGCDSVMEKHNAGQLVPLLTEAGA  116



>ref|XP_008382673.1| PREDICTED: monothiol glutaredoxin-S12, chloroplastic-like isoform 
X2 [Malus domestica]
Length=144

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 1/68 (1%)
 Frame = +1

Query  325  SRKQCPTQIRAV-SGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPL  501
            SR+  P  ++A+ S SFGSR+EESVK TV ENPVVVYSKTWCSYSSEVK LFKRLGVEP+
Sbjct  55   SRRWRPMSVQAMASSSFGSRLEESVKXTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPI  114

Query  502  VIELDEMG  525
            VIELDE+G
Sbjct  115  VIELDELG  122



>ref|XP_011655411.1| PREDICTED: glutaredoxin-C6 [Cucumis sativus]
 gb|KGN51374.1| Glutaredoxin [Cucumis sativus]
Length=107

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 63/99 (64%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            E  K  V  NPV V+SK++C +  +VK L  +LGV    IELD     G ++Q  L + T
Sbjct  4    EKAKEIVASNPVAVFSKSYCPFCVQVKRLLTKLGVSFKAIELDTES-DGREIQAALAQFT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGGKHIGGC DT+ L   G L PLL+EA A
Sbjct  63   GQRTVPNVFIGGKHIGGCDDTMALNSSGRLVPLLAEAGA  101



>ref|XP_008458784.1| PREDICTED: glutaredoxin-C6 [Cucumis melo]
Length=107

 Score =   103 bits (256),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 63/99 (64%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            E  K  V  NPV V+SK++C +  +VK L  +LGV    IELD     G ++Q  L + T
Sbjct  4    EKAKEIVASNPVTVFSKSYCPFCVQVKRLLTKLGVSFKAIELDTES-DGREVQAALAQFT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGGKHIGGC DT+ L   G L PLL+EA A
Sbjct  63   GQRTVPNVFIGGKHIGGCDDTMALNSSGRLVPLLAEAGA  101



>ref|XP_007140969.1| hypothetical protein PHAVU_008G156300g [Phaseolus vulgaris]
 gb|ESW12963.1| hypothetical protein PHAVU_008G156300g [Phaseolus vulgaris]
Length=107

 Score =   103 bits (256),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SKT+C +  +VK LF  LGV   +IE+D + P G  +Q  L   TGQ 
Sbjct  7    KEIVSSNPVVVFSKTYCPFCVQVKQLFASLGVTFKLIEMD-VEPDGADIQAALLEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC +T  L  +G+L PLL+ A A
Sbjct  66   TVPNVFIGGKHIGGCDNTTDLQNQGKLVPLLTSAGA  101



>ref|NP_001053270.1| Os04g0508300 [Oryza sativa Japonica Group]
 sp|P55142.2|GRXC6_ORYSJ RecName: Full=Glutaredoxin-C6; AltName: Full=Glutaredoxin-C2 
homolog 1 [Oryza sativa Japonica Group]
 dbj|BAA20071.1| glutaredoxin [Oryza sativa Japonica Group]
 emb|CAE04729.1| OSJNBa0043L24.17 [Oryza sativa Japonica Group]
 dbj|BAF15184.1| Os04g0508300 [Oryza sativa Japonica Group]
 emb|CAH67564.1| OSIGBa0101P20.7 [Oryza sativa Indica Group]
 gb|EAY94797.1| hypothetical protein OsI_16580 [Oryza sativa Indica Group]
 gb|EAZ31298.1| hypothetical protein OsJ_15409 [Oryza sativa Japonica Group]
Length=112

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K TV   PVVVYSK++C +   VK LF++LG     IELD     G +LQ  L   TGQ 
Sbjct  7    KETVASAPVVVYSKSYCPFCVRVKKLFEQLGATFKAIELDGES-DGSELQSALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DT+ L  +G+L PLL+EA A
Sbjct  66   TVPNVFINGKHIGGCDDTLALNNEGKLVPLLTEAGA  101



>gb|AAK53442.2|AF374461_1 glutaredoxin [Deschampsia antarctica]
Length=113

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
             K     +PVVV+SK++C Y + VK LF +LG     IELD  G  G  +Q  L + TGQ
Sbjct  6    AKEIAASSPVVVFSKSYCPYCTRVKQLFTKLGASFKAIELDVEG-DGADMQSALAQWTGQ  64

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFI GKHIGGC DT+ L + G+L PLL EA A
Sbjct  65   KTVPNVFINGKHIGGCDDTLALEKSGKLVPLLREAGA  101



>ref|XP_002446766.1| hypothetical protein SORBIDRAFT_06g022060 [Sorghum bicolor]
 gb|EES11094.1| hypothetical protein SORBIDRAFT_06g022060 [Sorghum bicolor]
Length=128

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   P+VV+SKT C +   VK LF++LG     IELD +   GP+LQ  L+  TGQ 
Sbjct  22   KEIVASAPLVVFSKTSCPFCVRVKQLFEKLGASYKAIELD-VESDGPELQNALKEWTGQR  80

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DT+ L   G+L PLL+EA A
Sbjct  81   TVPNVFINGKHIGGCDDTMALNNDGKLVPLLTEAGA  116



>ref|XP_008393010.1| PREDICTED: glutaredoxin [Malus domestica]
Length=120

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
            VK  V  NPVVV+SKT+C Y   VK L  +LG    VIELDE G  G ++Q  L + TGQ
Sbjct  21   VKNIVNSNPVVVFSKTYCGYCKRVKQLLTQLGAXFKVIELDE-GIDGGEMQAALAQWTGQ  79

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVP VFIGGKH+GGC   ++ +  G+L PLL+EA A
Sbjct  80   TTVPXVFIGGKHVGGCDSVLEKHNAGQLVPLLTEAGA  116



>emb|CDY16749.1| BnaA09g06330D [Brassica napus]
Length=125

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V E PVVV+SKT+C Y   VK L  +LG    V+ELDEM   G ++Q  L   TGQ 
Sbjct  23   KEIVSEYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEM-SDGGEIQSALSEWTGQS  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFI GKHIGGC   ++ Y++G+L PLL+EA A    S
Sbjct  82   TVPNVFIKGKHIGGCDRVMESYKQGKLVPLLTEAGAIANNS  122



>emb|CAA54397.1| glutaredoxin [Oryza sativa]
Length=112

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K TV   PVVVYSK++C +   VK LF +LG     IELD     G +LQ  L   TGQ 
Sbjct  7    KETVASAPVVVYSKSYCPFCVRVKKLFGQLGATFKAIELDGE-SDGSELQSALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DT+ L  +G+L PLL+EA A
Sbjct  66   TVPNVFINGKHIGGCDDTLALNNEGKLVPLLTEAGA  101



>ref|XP_002905608.1| glutaredoxin [Phytophthora infestans T30-4]
 gb|EEY68449.1| glutaredoxin [Phytophthora infestans T30-4]
Length=104

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +1

Query  385  EESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERL  564
            +E+V+  +   PVVVYSK++C Y ++ K L  +LG +  V+ELD++   G + Q  LE++
Sbjct  5    KETVEAKISSTPVVVYSKSYCPYCTKTKTLLTQLGAKYDVVELDQVAG-GSEQQDALEQI  63

Query  565  TGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TGQ TVPNVF+GGK IGG +D  KL++ G LEPLL + SA
Sbjct  64   TGQSTVPNVFVGGKSIGGNSDVQKLHKAGNLEPLLEQNSA  103



>gb|AEQ39038.1| putative glutaredoxin-like protein [Wolffia arrhiza]
Length=108

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = +1

Query  385  EESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERL  564
            ++  +  +  +PVVV+SKT+C Y + VK L   LG    VIELD     G Q+Q  L  L
Sbjct  3    QQKAQEIIASDPVVVFSKTYCPYCTRVKKLLTELGARFNVIELDREN-DGSQVQAALAGL  61

Query  565  TGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TGQ TVPNVFIGGKHIGGC    +++R G+L PLL+EA A
Sbjct  62   TGQRTVPNVFIGGKHIGGCDTLTEIHRGGKLVPLLTEAGA  101



>gb|KJB33810.1| hypothetical protein B456_006G031800 [Gossypium raimondii]
 gb|KJB33811.1| hypothetical protein B456_006G031800 [Gossypium raimondii]
Length=107

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 66/99 (67%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V  NPVVV+SK++C +  +VK L ++LG     IELD+    G  +Q  L   T
Sbjct  4    QKAKDIVSTNPVVVFSKSYCPFCVDVKQLLQQLGASFKAIELDKES-DGSDIQAALAEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGGKHIGGC  T+ L+++G+L PLL+EA A
Sbjct  63   GQRTVPNVFIGGKHIGGCDSTMALHKEGKLVPLLTEAGA  101



>ref|XP_010555955.1| PREDICTED: glutaredoxin-C2 [Tarenaya hassleriana]
Length=108

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 65/99 (66%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V  NPVVV+SKT+C +  +VK L + +GV+   +ELD  G  G  +Q  L   T
Sbjct  4    QKAKEIVANNPVVVFSKTYCPFCVDVKKLLQEVGVKFKAVELDTEG-DGSGIQSALAEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGG HIGGC  T  L++KG+L PLL+EA A
Sbjct  63   GQRTVPNVFIGGNHIGGCDTTKGLHKKGKLVPLLTEAGA  101



>ref|XP_009518274.1| hypothetical protein PHYSODRAFT_324251 [Phytophthora sojae]
 ref|XP_009518277.1| hypothetical protein PHYSODRAFT_485550 [Phytophthora sojae]
 gb|EGZ22986.1| hypothetical protein PHYSODRAFT_324251 [Phytophthora sojae]
 gb|EGZ22989.1| hypothetical protein PHYSODRAFT_485550 [Phytophthora sojae]
Length=104

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +1

Query  385  EESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERL  564
            +E+V+  +  +PVVVYSKT+C + ++ K L   LG +  V+ELDE+   G + Q  LE L
Sbjct  5    KETVQAQIAASPVVVYSKTYCRFCTKTKALLTELGAKFDVVELDEV-EGGGEHQDALEDL  63

Query  565  TGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TGQ TVPNVF+GGK IGG +D  KL++ G+LEPLL ++ A
Sbjct  64   TGQSTVPNVFVGGKSIGGNSDVRKLHKAGDLEPLLKQSGA  103



>ref|XP_009768204.1| PREDICTED: glutaredoxin [Nicotiana sylvestris]
Length=108

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SKT+C +   VK L  +LG     +ELD     G ++Q  L   TGQ 
Sbjct  7    KEIVSANPVVVFSKTYCPFCVSVKDLLSKLGASFKAVELDTE-KDGSEIQAALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC  T  L+R+G+L PLL+EA A
Sbjct  66   TVPNVFIGGKHIGGCDATTALHREGKLVPLLTEAGA  101



>gb|AAB92419.1| glutaredoxin type 1 [Fritillaria agrestis]
 gb|AAB92654.1| glutaredoxin type II [Fritillaria agrestis]
 gb|AAB92655.1| glutaredoxin type I [Fritillaria agrestis]
 gb|AAB92656.1| glutaredoxin type I [Fritillaria agrestis]
 gb|AAB92657.1| glutaredoxin type I [Fritillaria agrestis]
 gb|AAB92658.1| glutaredoxin type I [Fritillaria agrestis]
Length=104

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SK++C Y   VK L  +L     VIELD +   G  +Q  L   TGQ 
Sbjct  7    KDLVASNPVVVFSKSYCPYCIRVKELLVKLKATYKVIELD-LESDGSAIQAALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC  T++LY  G+L+PLL EA A
Sbjct  66   TVPNVFIGGKHIGGCDKTMELYNSGKLQPLLVEAGA  101



>ref|XP_009625431.1| PREDICTED: glutaredoxin [Nicotiana tomentosiformis]
 gb|AII99816.1| gluaredoxin [Nicotiana tabacum]
Length=108

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SKT+C +   VK L  +LG     +ELD     G ++Q  L   TGQ 
Sbjct  7    KEIVSANPVVVFSKTYCPFCVSVKDLLSKLGASFNAVELDTE-KDGSEIQAALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC  T  L+R+G+L PLL+EA A
Sbjct  66   TVPNVFIGGKHIGGCDATTALHREGKLVPLLTEAGA  101



>ref|NP_001274139.1| glutaredoxin [Cucumis sativus]
 gb|AGX01494.1| glutaredoxin [Cucumis sativus]
 gb|KGN64321.1| hypothetical protein Csa_1G046180 [Cucumis sativus]
Length=125

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
            VK+ V  +PVVV+SKT+C + S VK L  +LG    VIELD+    G ++Q  L   TGQ
Sbjct  22   VKKIVSTDPVVVFSKTYCGFCSSVKKLLTQLGARYKVIELDQK-SDGDKIQSALAEWTGQ  80

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFIGGKHIGGC    + + +G+L PLL+EA A
Sbjct  81   TTVPNVFIGGKHIGGCDAVTEKHHRGQLVPLLTEAGA  117



>ref|XP_004501914.1| PREDICTED: glutaredoxin-C1-like [Cicer arietinum]
Length=125

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
             K     +PV V+SKT+C Y   VK LFK+LG    VIELD     G ++Q  L   TGQ
Sbjct  22   AKNLAASSPVFVFSKTYCGYCKRVKDLFKQLGASYKVIELDTE-SDGGEIQAALAEWTGQ  80

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
             TVPNVFIGGKHIGGC   ++ +R G+L PLL++A A    S
Sbjct  81   RTVPNVFIGGKHIGGCDSVLEKHRAGQLVPLLNDAGAIANNS  122



>gb|EYU44772.1| hypothetical protein MIMGU_mgv1a016788mg [Erythranthe guttata]
Length=107

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  N VVV+SKT+C +   VK L   LG     IELD  G  G +LQ  L +LTGQ 
Sbjct  7    KEIVSTNSVVVFSKTYCPFCVSVKKLLTELGASFKAIELDTEG-DGAELQSALAQLTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC  T  L+++G+L PLL+EA A
Sbjct  66   TVPNVFISGKHIGGCDATTALHKQGKLVPLLTEAGA  101



>ref|XP_008904979.1| glutaredoxin [Phytophthora parasitica INRA-310]
 gb|ETI47582.1| glutaredoxin [Phytophthora parasitica P1569]
 gb|ETK87519.1| glutaredoxin [Phytophthora parasitica]
 gb|ETL40948.1| glutaredoxin [Phytophthora parasitica]
 gb|ETL94093.1| glutaredoxin [Phytophthora parasitica]
 gb|ETM47335.1| glutaredoxin [Phytophthora parasitica]
 gb|ETN09833.1| glutaredoxin [Phytophthora parasitica INRA-310]
 gb|ETO76298.1| glutaredoxin [Phytophthora parasitica P1976]
 gb|ETP17380.1| glutaredoxin [Phytophthora parasitica CJ01A1]
 gb|ETP45435.1| glutaredoxin [Phytophthora parasitica P10297]
Length=104

 Score =   100 bits (249),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +1

Query  385  EESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERL  564
            +E+V+  +  +PVVVYSK++C Y ++ K L   LG +  V+ELD++   G + Q  LE L
Sbjct  5    KETVQAQITASPVVVYSKSYCPYCTKTKALLTELGAKFEVVELDQI-DGGSEQQDALEDL  63

Query  565  TGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TGQ TVPNVF+GGK IGG +D  KL++ G LEPLL E+ A
Sbjct  64   TGQSTVPNVFVGGKSIGGNSDVRKLHKAGNLEPLLKESGA  103



>ref|XP_002511377.1| glutaredoxin-1, grx1, putative [Ricinus communis]
 gb|EEF51979.1| glutaredoxin-1, grx1, putative [Ricinus communis]
Length=125

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +1

Query  418  PVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFI  597
            PVVV+SKT+C Y + VK L  +LG    +IEL+E    G  +Q  L + TG  TVPNVFI
Sbjct  30   PVVVFSKTYCGYCNRVKQLLTQLGANFKIIELNEE-ADGDDIQAALAQWTGLRTVPNVFI  88

Query  598  GGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            GGKHIGGC  T+  Y+KGEL PLL++A A    S
Sbjct  89   GGKHIGGCDSTLDKYQKGELLPLLNDAGAIANNS  122



>ref|XP_002968569.1| CYPC type glutaredoxin [Selaginella moellendorffii]
 gb|EFJ30823.1| CYPC type glutaredoxin [Selaginella moellendorffii]
Length=103

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NP+VV+SKT+C +  +VK LF  +G +P V+ELD     G  LQ  L   TGQ 
Sbjct  7    KDIVAHNPLVVFSKTYCPFCVKVKELFSSIGAQPKVVELDSEA-DGADLQAALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARK  690
            +VP+VF+GGKH+GGC DT K +  G+L P+L +A   K
Sbjct  66   SVPSVFVGGKHVGGCDDTTKKHNSGQLVPMLKDAGLLK  103



>ref|XP_011396655.1| Glutaredoxin-C6 [Auxenochlorella protothecoides]
 gb|KFM23777.1| Glutaredoxin-C6 [Auxenochlorella protothecoides]
Length=107

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +1

Query  358  VSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGP  537
            +SG   + ++E  K+    NPVVVYSKT+C Y +EVK LF++L V+  VIELD +   G 
Sbjct  1    MSGDLVATLKEKNKK----NPVVVYSKTYCPYCAEVKSLFQKLKVDAKVIELDSLA-DGN  55

Query  538  QLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEA  678
             +Q+ L  + G+ TVP VF+GG+HIGGC DT+     G+L+ +L EA
Sbjct  56   DVQQALFEVVGKKTVPQVFVGGQHIGGCDDTMAANDSGKLKEMLKEA  102



>dbj|BAK01747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=130

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
             K  V   PVVV+SK++C +  +VK LF +LG     IELD     GP++Q  L   TGQ
Sbjct  23   AKEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTES-DGPEMQSALAEWTGQ  81

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFI GKHIGGC DT+ L + G+L  LL+EA A
Sbjct  82   RTVPNVFINGKHIGGCDDTLALNKGGKLVALLTEAGA  118



>ref|XP_009539442.1| hypothetical protein PHYSODRAFT_348647 [Phytophthora sojae]
 gb|EGZ05070.1| hypothetical protein PHYSODRAFT_348647 [Phytophthora sojae]
Length=104

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +1

Query  385  EESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERL  564
            +E+V+  +  +PVVVYSK++C Y ++ K L  +LG +  V+ELD++   G + Q  LE++
Sbjct  5    KETVEAKIAASPVVVYSKSYCPYCTKTKTLLTQLGAKFDVVELDQIAG-GSEQQDALEQI  63

Query  565  TGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TGQ TVPNVF+GGK IGG +D  KL++ G LEPLL +  A
Sbjct  64   TGQSTVPNVFVGGKSIGGNSDVQKLHKAGNLEPLLEQNHA  103



>ref|XP_011098448.1| PREDICTED: glutaredoxin isoform X2 [Sesamum indicum]
Length=107

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SKT+C +   VK L  +LG     IELD+ G  G ++Q  L   TGQ 
Sbjct  7    KELVSTNPVVVFSKTYCPFCVTVKELLTKLGASFKAIELDKEG-DGTEIQSALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC  T  L+ +G+L PLL++A A
Sbjct  66   TVPNVFIGGKHIGGCDATTALHNQGKLVPLLTQAGA  101



>gb|ACF86986.1| unknown [Zea mays]
 gb|ACG33210.1| Grx_C2.2 - glutaredoxin subgroup I [Zea mays]
 gb|ACG48330.1| Grx_C2.2 - glutaredoxin subgroup I [Zea mays]
Length=113

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   P+VV+SKT C +   VK LF++LG     IELD+    G +LQ  L+  TGQ 
Sbjct  7    KEIVASAPLVVFSKTSCPFCVRVKQLFEKLGASYKAIELDKES-DGAELQNALKEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DT+ L   G+L PLL+EA A
Sbjct  66   TVPNVFINGKHIGGCDDTMALNNDGKLVPLLTEAGA  101



>ref|XP_004298962.1| PREDICTED: glutaredoxin isoform X1 [Fragaria vesca subsp. vesca]
Length=124

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            + VK TV   PVVV+SKT+C Y   VK L  ++G    VIELDE    G ++Q  L   T
Sbjct  19   DKVKTTVNSTPVVVFSKTYCGYCKRVKQLLTQVGATYKVIELDE-DVDGGEIQAALAEWT  77

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGGKHIGGC   ++ ++ G+L PLL EA A
Sbjct  78   GQTTVPNVFIGGKHIGGCDSVLEKHQAGQLLPLLREAGA  116



>gb|AEW90961.1| glutaredoxin 4H1 [Secale cereale x Triticum turgidum subsp. durum]
Length=131

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SK++C +  +VK L  RLG     IELD     GP++Q  L   TGQ 
Sbjct  25   KEIVASAPVVVFSKSYCPFCVQVKKLLTRLGASFKAIELDTES-DGPEIQSALAEWTGQR  83

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DTI L + G+L  LL+EA A
Sbjct  84   TVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGA  119



>gb|EMT22737.1| Glutaredoxin-C6 [Aegilops tauschii]
Length=113

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SK++C +  +VK LF +LG     IELD     GP++Q  L   TGQ 
Sbjct  7    KEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTE-SDGPEIQSALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DT+ L + G+L  LL+EA A
Sbjct  66   TVPNVFINGKHIGGCDDTVALNKGGKLIALLTEAGA  101



>ref|XP_012080039.1| PREDICTED: glutaredoxin [Jatropha curcas]
Length=128

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  418  PVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFI  597
            PVVV+SKT+C Y + VK L  +LG    VIELDE    G ++Q  L + TGQ TVPNVFI
Sbjct  30   PVVVFSKTYCGYCNRVKQLLTQLGASYKVIELDEE-IDGAEIQAALTQWTGQRTVPNVFI  88

Query  598  GGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
             GK IGGC DT++ Y+KGEL  LL++A A    S
Sbjct  89   NGKRIGGCDDTLEKYQKGELLSLLNDAGAIANNS  122



>ref|XP_006840663.1| PREDICTED: glutaredoxin [Amborella trichopoda]
 gb|ERN02338.1| hypothetical protein AMTR_s00096p00023730 [Amborella trichopoda]
Length=121

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SKT+C Y  +VK L   LG    V+ELD +   G  +Q  LE  TGQ 
Sbjct  24   KEIVSSNPVVVFSKTYCPYCVQVKQLLSNLGANFKVVELD-VESDGSDMQSALEEWTGQW  82

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            T+PNVFIGGKH+GGC   +  ++KGEL P+L++  A
Sbjct  83   TIPNVFIGGKHVGGCDACVATHKKGELVPMLTKVGA  118



>ref|XP_004976172.1| PREDICTED: glutaredoxin-C6-like [Setaria italica]
Length=130

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SK++C +   VK LF++LG     IELD +   G +LQ  L+  TGQ 
Sbjct  22   KEIVASAPVVVFSKSYCPFCVRVKQLFEKLGATFKAIELD-VESDGSELQDALKEWTGQR  80

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DT+ L   G+L PLL+EA A
Sbjct  81   TVPNVFISGKHIGGCDDTMALNNDGKLVPLLTEAGA  116



>gb|ACF40843.1| glutaredoxin [Triticum aestivum]
Length=113

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SK++C +  +VK LF +LG     IELD     GP++Q  L   TGQ 
Sbjct  7    KEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTES-DGPEIQSALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DT+ L + G+L  LL+EA A
Sbjct  66   TVPNVFINGKHIGGCDDTVALNKGGKLIALLTEAGA  101



>ref|NP_001149712.1| glutaredoxin homolog1 [Zea mays]
 gb|ACG36484.1| Grx_C2.2 - glutaredoxin subgroup I [Zea mays]
 tpg|DAA37006.1| TPA: grx_C2.2-glutaredoxin subgroup I [Zea mays]
Length=131

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   P+VV+SKT C +   VK LF++LG     IELD+    G +LQ  L+  TGQ 
Sbjct  25   KEIVASAPLVVFSKTSCPFCVRVKQLFEKLGASYKAIELDKE-SDGAELQNALKEWTGQR  83

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DT+ L   G+L PLL+EA A
Sbjct  84   TVPNVFINGKHIGGCDDTMALNNDGKLVPLLTEAGA  119



>gb|ABP48736.1| glutaredoxin [Ipomoea batatas]
Length=115

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  +P VV+SKT+C Y + VK L  +LG    +IELD+    G  +Q+ L   TGQ 
Sbjct  7    KEIVSSHPAVVFSKTYCGYCTRVKNLLNQLGAAYKLIELDQEND-GDAIQQALLEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFIGGKH+GGC  T++ +++G+L P+L++A A  T+S
Sbjct  66   TVPNVFIGGKHVGGCDKTLEKHQQGQLVPMLTDAGAITTKS  106



>emb|CDX87276.1| BnaC09g05910D [Brassica napus]
Length=125

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V E PVVV+SKT+C Y   VK +  +LG    V+ELDEMG  G ++Q  L   TGQ 
Sbjct  23   KEIVSEYPVVVFSKTYCGYCQRVKQVLTQLGATFKVLELDEMGD-GGEIQSALSEWTGQS  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFI GKHIGGC   ++  ++G+L PLL+EA A    S
Sbjct  82   TVPNVFIKGKHIGGCDRVVESNKQGKLVPLLTEAGAIANNS  122



>ref|XP_009770952.1| PREDICTED: glutaredoxin [Nicotiana sylvestris]
Length=125

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K+ V  NPVVV+SKT+C Y + VK L  +LG    VIELD+    G ++Q+ L   TGQ 
Sbjct  23   KQIVSSNPVVVFSKTYCGYCTRVKQLLSQLGATFKVIELDQES-DGNEVQQALLEWTGQR  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKH+GGC   ++ +++G+L P+L +A+A
Sbjct  82   TVPNVFIGGKHVGGCDSIVEKHQQGKLLPMLKDAAA  117



>ref|XP_006439850.1| hypothetical protein CICLE_v10022897mg [Citrus clementina]
 gb|ESR53090.1| hypothetical protein CICLE_v10022897mg [Citrus clementina]
Length=121

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SKT+C Y + VK L K+LG    V+ELD +   G ++Q  L   TGQ 
Sbjct  21   KEIVSSNPVVVFSKTYCGYCTRVKELLKQLGTSFKVVELD-IESDGSKIQAALAEWTGQR  79

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC   ++ ++ G+L PLL +A A
Sbjct  80   TVPNVFIGGKHIGGCDTVVEKHQGGKLVPLLRDAGA  115



>ref|NP_001274936.1| glutaredoxin [Solanum tuberosum]
 gb|ABU96710.1| glutaredoxin [Solanum tuberosum]
Length=108

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPV V+SKT+C +   VK L  +LG     +ELD     G ++Q  L   TGQ 
Sbjct  7    KEIVSGNPVAVFSKTYCPFCVSVKDLLSKLGATFKAVELDSE-KDGSEIQAALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC  T  L+R+G+L PLL+EA A
Sbjct  66   TVPNVFIGGKHIGGCDATTALHREGKLVPLLTEAGA  101



>emb|CDP02089.1| unnamed protein product [Coffea canephora]
Length=107

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SK++C +   VK L  ++G     +ELD +   G ++Q  L  LTGQ 
Sbjct  7    KEIVSANPVVVFSKSYCPFCVNVKKLLGQVGANFKAVELD-VESDGSEIQAALAELTGQK  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFIGGKHIGGC  T  L++ G+L PLL+EA A  + S
Sbjct  66   TVPNVFIGGKHIGGCDATTALHQNGKLVPLLTEAGAVASVS  106



>ref|XP_006476805.1| PREDICTED: glutaredoxin-C1-like [Citrus sinensis]
 gb|KDO69593.1| hypothetical protein CISIN_1g033336mg [Citrus sinensis]
Length=121

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SKT+C Y + VK L K+LG    V+ELD +   G ++Q  L   TGQ 
Sbjct  21   KEIVSSNPVVVFSKTYCGYCTTVKELLKQLGTSFKVVELD-IESDGSKIQAALAEWTGQR  79

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC   ++ ++ G+L PLL +A A
Sbjct  80   TVPNVFIGGKHIGGCDTVVEKHQGGKLVPLLRDAGA  115



>gb|ABX60201.1| glutaredoxin [Panax ginseng]
Length=106

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  N VVV+SKT+CSY   VK L   +G    VIE+D+    G ++Q  L   TGQ 
Sbjct  7    KELVSSNGVVVFSKTYCSYCQTVKKLLTDIGASFKVIEMDKE-SDGSEIQSALVEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFIGGKHIGGC  T  +++ G+L PLL+EA A  ++S
Sbjct  66   TVPNVFIGGKHIGGCDLTTAMHKSGKLVPLLTEAGAVASKS  106



>ref|XP_010029144.1| PREDICTED: glutaredoxin-like [Eucalyptus grandis]
 gb|KCW55988.1| hypothetical protein EUGRSUZ_I01764 [Eucalyptus grandis]
Length=106

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SKT CSY  +VK L  +LGV    IEL++    G ++Q  L   TGQ 
Sbjct  7    KELVSANPVVVFSKTTCSYCVKVKELLSKLGVNFKAIELNQEN-DGSEIQSALAEWTGQK  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGG HIGGC  T  ++ +G+L PLL++A A
Sbjct  66   TVPNVFIGGNHIGGCDATTAMHNEGKLVPLLTQAGA  101



>ref|XP_011098447.1| PREDICTED: glutaredoxin isoform X1 [Sesamum indicum]
Length=107

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SKT+C +   VK L  +LG     IELD+ G  G ++Q  L   TGQ 
Sbjct  7    KELVSTNPVVVFSKTYCPFCVTVKELLTKLGASFKAIELDKEG-DGTEIQSALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEA  678
            TVPNVFIGGKHIGGC  T  L+ +G+L PLL+EA
Sbjct  66   TVPNVFIGGKHIGGCDATTGLHAQGKLVPLLTEA  99



>ref|XP_004304641.1| PREDICTED: glutaredoxin [Fragaria vesca subsp. vesca]
Length=107

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  N VVV+SK++C Y   VK LF +LG +   IELD+    G +LQ  L+  TGQ 
Sbjct  7    KELVSSNTVVVFSKSYCPYCVTVKKLFTQLGADFKAIELDQE-SDGSELQAALKEWTGQK  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGG HIGGC  T  L+ +G+L PLL+EA A
Sbjct  66   TVPNVFIGGNHIGGCDATQALHNQGKLVPLLTEAGA  101



>ref|XP_002868660.1| hypothetical protein ARALYDRAFT_916213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44919.1| hypothetical protein ARALYDRAFT_916213 [Arabidopsis lyrata subsp. 
lyrata]
Length=111

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V  + VVV+SKT+C Y   VK L ++LG +   +ELD     G Q+Q  L   T
Sbjct  4    QKAKDIVNSDSVVVFSKTYCPYCVRVKELLQQLGAKFKAVELDNE-SDGSQIQSALAEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGG HIGGC  T  L++ G+L PLL+EA A
Sbjct  63   GQRTVPNVFIGGNHIGGCDATTNLHKDGKLVPLLTEAGA  101



>ref|XP_003601243.1| Glutaredoxin [Medicago truncatula]
 gb|AES71494.1| glutaredoxin C4 [Medicago truncatula]
Length=121

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
             K     +PV V+SKT+C Y + VK L K+LG    VIELD     G ++Q  L   TGQ
Sbjct  21   AKEIAASSPVFVFSKTYCGYCNRVKDLLKQLGAAHKVIELDTE-SDGGEIQAALAEWTGQ  79

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFIGGKHIGGC   ++ +R G+L PLL++A A
Sbjct  80   RTVPNVFIGGKHIGGCDSVLEKHRTGQLVPLLNDAGA  116



>ref|XP_002524673.1| glutaredoxin-1, grx1, putative [Ricinus communis]
 sp|P55143.1|GLRX_RICCO RecName: Full=Glutaredoxin [Ricinus communis]
 gb|EEF37692.1| glutaredoxin-1, grx1, putative [Ricinus communis]
Length=102

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  N VVV+SKT+C Y + VK L  +LG +  V+ELD     G ++Q  L   TGQ 
Sbjct  7    KELVSSNAVVVFSKTYCPYCTSVKKLLDQLGAKYKVVELD-TESDGSEIQTALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC  T   + +G+L PLL+EA A
Sbjct  66   TVPNVFIGGKHIGGCDSTTAKHSQGQLVPLLTEAGA  101



>ref|XP_010550681.1| PREDICTED: glutaredoxin-C1-like [Tarenaya hassleriana]
Length=125

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
             K  V  +PVVV+SKT+C Y   VK L  +LG +   +ELDEMG  G ++Q  L   TGQ
Sbjct  22   AKEIVASHPVVVFSKTYCGYCQRVKQLLTQLGADFKFLELDEMG-DGSEIQSALLDWTGQ  80

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFI G+HIGGC   ++ +++G+L PLL+EA A
Sbjct  81   RTVPNVFIKGEHIGGCDRVMESHQQGKLLPLLTEAGA  117



>gb|AEW90962.1| glutaredoxin 4H6 [Secale cereale x Triticum turgidum subsp. durum]
Length=131

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SK++C +  +VK L  +LG     IELD     GP++Q  L   TGQ 
Sbjct  25   KEIVASAPVVVFSKSYCPFCVQVKKLLTQLGASFKAIELDTES-DGPEIQSALAEWTGQR  83

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DTI L + G+L  LL+EA A
Sbjct  84   TVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGA  119



>ref|XP_009112052.1| PREDICTED: glutaredoxin-C1 [Brassica rapa]
Length=125

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V E PVVV+SKT+C Y   VK L  +LG    V+ELDEM   G ++Q  L   TGQ 
Sbjct  23   KEIVSEYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEM-SDGGEIQSALSEWTGQS  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFI GKHIGGC   ++  ++G+L PLL+EA A    S
Sbjct  82   TVPNVFIKGKHIGGCDRVMESNKQGKLVPLLTEAGAIANNS  122



>ref|XP_006338581.1| PREDICTED: glutaredoxin-like [Solanum tuberosum]
Length=108

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  +  NPVVV+SKT+C +   VK L   +G     IELD     G ++Q  L   TGQ 
Sbjct  7    KEIITANPVVVFSKTYCPFCVSVKDLLSNVGTSFKAIELDSE-KDGSEIQAALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            T+PNVFIGGKHIGGC  T  L+R+G L PLL+EA A
Sbjct  66   TIPNVFIGGKHIGGCDSTTALHREGNLVPLLTEAGA  101



>gb|AFK43408.1| unknown [Lotus japonicus]
Length=107

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  N VVV+SKT+C +  +VK LF  LGV   VIELD     G  +Q  L   TGQ 
Sbjct  7    KEIVSSNAVVVFSKTYCPFCVDVKKLFANLGVNYKVIELDSEA-DGSDIQAALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            +VPNVFIGG HIGGC  T  L+ +G+L PLL+ A A
Sbjct  66   SVPNVFIGGNHIGGCDSTKALHNQGKLVPLLTSAGA  101



>ref|XP_002898433.1| glutaredoxin [Phytophthora infestans T30-4]
 gb|EEY63256.1| glutaredoxin [Phytophthora infestans T30-4]
Length=120

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +1

Query  385  EESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERL  564
            +E+V+  +  +PVVVYSK++C Y ++ K L   LG +  V+ELD++   G + Q  LE L
Sbjct  5    KENVQTQIAASPVVVYSKSYCRYCTKTKTLLTELGAKYEVVELDQI-EGGSEQQDALEDL  63

Query  565  TGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TGQ TVPNVF+ GK IGG +D  KL++ G LEPLL ++ A
Sbjct  64   TGQGTVPNVFVAGKSIGGNSDVHKLHKTGNLEPLLKDSGA  103



>ref|XP_001770884.1| predicted protein [Physcomitrella patens]
 gb|EDQ64214.1| predicted protein, partial [Physcomitrella patens]
Length=102

 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 1/93 (1%)
 Frame = +1

Query  406  VGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVP  585
            + +N VVV+SK++C +   VK L K +G E  V+ELDE    G  +Q  L +L+GQ TVP
Sbjct  10   ISQNAVVVFSKSYCPFCLRVKSLLKSIGAEMKVVELDEE-SDGSDIQAALAKLSGQRTVP  68

Query  586  NVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            NVFIGG+HIGG  DT  +++KG+L PLL+ A A
Sbjct  69   NVFIGGQHIGGRDDTTAMHKKGQLLPLLNGAGA  101



>emb|CDS10348.1| hypothetical protein LRAMOSA03024 [Absidia idahoensis var. thermophila]
Length=112

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            ++E VK+++ +N V+V+SK++C Y +  K LF+ L V+   +ELD     GP++QK L  
Sbjct  8    IKELVKKSIADNSVMVFSKSYCPYCTGAKDLFEDLDVKYKALELD-THQDGPEIQKALAE  66

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            +TGQ TVPNVFI  KHIGG +D   +YR G+LE L  +A  +
Sbjct  67   MTGQKTVPNVFINSKHIGGYSDLDSVYRSGKLESLFKDAGIK  108



>emb|CDP16916.1| unnamed protein product [Coffea canephora]
Length=111

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
            VK+ V  +PVVV+SKT+C Y + VK L  +LG    V+ELDE    G ++Q  L   TGQ
Sbjct  6    VKQIVSSHPVVVFSKTFCGYCNRVKQLLDQLGATHTVVELDEE-TDGTEMQSALAVWTGQ  64

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFI GKHIGGC      +  GEL PLL+EA A
Sbjct  65   RTVPNVFIAGKHIGGCDTVTGKHEMGELVPLLNEAGA  101



>ref|XP_008438572.1| PREDICTED: glutaredoxin [Cucumis melo]
Length=125

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
            VK+ +  +PVVV+SKT+C + S VK L  +LG    VIEL++    G ++Q  L   TGQ
Sbjct  22   VKKIISTDPVVVFSKTYCGFCSSVKKLLTQLGARYKVIELNQE-SNGDKIQSALAEWTGQ  80

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFIGGKHIGGC    + + +G+L PLL+EA A
Sbjct  81   TTVPNVFIGGKHIGGCDAVTEKHHRGQLVPLLTEAGA  117



>ref|XP_010029146.1| PREDICTED: glutaredoxin-like [Eucalyptus grandis]
 gb|KCW55984.1| hypothetical protein EUGRSUZ_I01760 [Eucalyptus grandis]
Length=106

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SK++C Y   VK L  +LGV    +ELD+    G ++Q  L   TGQ 
Sbjct  7    KELVSANPVVVFSKSYCPYCVSVKKLLSQLGVNFKALELDQEN-DGSEIQSALAEWTGQK  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFIGG HIGGC  T  ++ +G+L PLL++A A    S
Sbjct  66   TVPNVFIGGNHIGGCDATTAMHNQGKLVPLLTQAGALAKAS  106



>ref|XP_009112048.1| PREDICTED: glutaredoxin-C1-like [Brassica rapa]
Length=116

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = +1

Query  379  RMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLE  558
            ++    K  V   PVVV+SKT+C Y  +VK L  +LG +  V+ELDEM   G ++Q  L 
Sbjct  8    KVMNKAKEIVSSYPVVVFSKTYCGYCQKVKKLLTQLGADFEVLELDEMSG-GGEIQSALS  66

Query  559  RLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            + TGQ TVPNVFI GKHIGGC   ++  +KG+L PLL EA A
Sbjct  67   KWTGQRTVPNVFIKGKHIGGCDSVMESNQKGKLVPLLIEAGA  108



>gb|AEP25125.1| glutaredoxin [Secale cereale x Triticum turgidum subsp. durum]
Length=131

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SK++C +  +VK L  +LG     +ELD     GP++Q  L   TGQ 
Sbjct  25   KEIVASAPVVVFSKSYCPFCVQVKKLLTQLGASFKAVELDTES-DGPEIQSALAEWTGQR  83

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DTI L + G+L  LL+EA A
Sbjct  84   TVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGA  119



>ref|XP_010102526.1| hypothetical protein L484_014582 [Morus notabilis]
 gb|EXB93590.1| hypothetical protein L484_014582 [Morus notabilis]
Length=125

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
            VK+ V  +PVVV+SKT+C Y + VK L  +LG    VIELDE    G  +Q  L   TG+
Sbjct  22   VKQIVSSHPVVVFSKTYCGYCTRVKNLLTQLGAAFKVIELDEE-SDGGDMQAALAEWTGR  80

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
             TVPNVFI GK+IGGC   ++L++ G+L PLL+ A A   +S
Sbjct  81   RTVPNVFIAGKNIGGCDSVLELHQSGQLLPLLTNAGAIANDS  122



>emb|CAA89699.1| glutaredoxin [Ricinus communis]
Length=102

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  N VVV+SKT+C Y + VK L  +LG +  V+ELD     G ++Q  L   TGQ 
Sbjct  7    KELVCSNAVVVFSKTYCPYCTSVKKLLDQLGAKYKVVELD-TESDGSEIQTALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC  T   + +G+L PLL+EA A
Sbjct  66   TVPNVFIGGKHIGGCDSTTAKHSQGQLVPLLTEAGA  101



>ref|XP_011071887.1| PREDICTED: glutaredoxin [Sesamum indicum]
 ref|XP_011071888.1| PREDICTED: glutaredoxin [Sesamum indicum]
Length=124

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K+ V  NPVVV+SKT+C Y + VK LF +L V   VIELDE    G ++Q  L   TGQ 
Sbjct  22   KQIVSSNPVVVFSKTYCGYCNRVKQLFSQLKVTYKVIELDEESD-GDEVQTALAEWTGQR  80

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGG    +  +++GEL  LL+EA A
Sbjct  81   TVPNVFINGKHIGGSDAVVAKHQQGELVSLLAEAGA  116



>gb|EPS66621.1| glutaredoxin [Genlisea aurea]
Length=103

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  N VVV+SK++C + S+VK L   LG     +ELD  G  G ++Q  L   TGQ 
Sbjct  7    KEIVDSNAVVVFSKSYCPFCSKVKKLLAELGASFRAVELDVEG-DGSEIQAALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC  T  ++++G+L PLL+EA A
Sbjct  66   TVPNVFIGGKHIGGCDATTGIHKEGKLVPLLTEAGA  101



>gb|KHN97290.1| Thioredoxin-like fold protein [Metarhizium album ARSEF 1941]
Length=108

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
            V++ + ++ +VV+SK++C Y  + K  FK+LG +  V+ELD++ P G +LQ  LE ++GQ
Sbjct  8    VQQIIDKHNIVVFSKSYCPYCKQTKETFKKLGAKIEVLELDQI-PDGAELQDALEDISGQ  66

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEAS  681
             TVPNV+I  KHIGG +D   LY++G+LE L+ EA+
Sbjct  67   RTVPNVYIKQKHIGGNSDVQSLYKEGKLEALVKEAN  102



>ref|XP_008895171.1| glutaredoxin [Phytophthora parasitica INRA-310]
 gb|ETI38659.1| glutaredoxin [Phytophthora parasitica P1569]
 gb|ETK78908.1| glutaredoxin [Phytophthora parasitica]
 gb|ETL32308.1| glutaredoxin [Phytophthora parasitica]
 gb|ETL85551.1| glutaredoxin [Phytophthora parasitica]
 gb|ETM38700.1| glutaredoxin [Phytophthora parasitica]
 gb|ETN19312.1| glutaredoxin [Phytophthora parasitica INRA-310]
 gb|ETO67423.1| glutaredoxin [Phytophthora parasitica P1976]
 gb|ETP08567.1| glutaredoxin [Phytophthora parasitica CJ01A1]
 gb|ETP36607.1| glutaredoxin [Phytophthora parasitica P10297]
Length=104

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +1

Query  385  EESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERL  564
            +E+V+  +   PVVVYSK++C Y ++ K L  +LG +  V+ELD++   G + Q  LE++
Sbjct  5    KETVEAKISSTPVVVYSKSYCPYCAKTKTLLTQLGAKYDVVELDQING-GSEQQDALEQI  63

Query  565  TGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TGQ TVPNVF+GGK IGG +D  KL++ G LE LL +  A
Sbjct  64   TGQSTVPNVFVGGKSIGGNSDVQKLHKAGNLESLLEQNGA  103



>ref|XP_003580104.1| PREDICTED: glutaredoxin-C6 [Brachypodium distachyon]
Length=128

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SK++C +  +VK LF +LG     IELD+    G ++Q  L   TGQ 
Sbjct  22   KEIVASAPVVVFSKSYCPFCVKVKQLFTQLGASFKAIELDKE-SDGAEMQSALAEWTGQR  80

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC DT+ L   G+L  LL+EA A
Sbjct  81   TVPNVFINGKHIGGCDDTVALNNGGKLVALLTEAGA  116



>gb|KHG20347.1| Glutaredoxin-C2 -like protein [Gossypium arboreum]
Length=107

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 63/99 (64%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  +  N VVV+SK++C +  +VK L ++LG    VIELD+    G  +Q  L   T
Sbjct  4    QKAKDIISTNTVVVFSKSYCPFCVDVKQLLQKLGASFKVIELDKE-SDGADIQAALAEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGG HIGGC  T  L+ +G+L PLL+EA A
Sbjct  63   GQRTVPNVFIGGNHIGGCDSTTGLHNQGKLVPLLTEAGA  101



>gb|KFK28027.1| hypothetical protein AALP_AA8G462200 [Arabis alpina]
Length=125

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 63/101 (62%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C Y   VK L  +LG    V+ELDEM   G ++Q  L   TGQ 
Sbjct  23   KEIVSTYPVVVFSKTYCGYCQRVKQLLTQLGASFKVLELDEM-SDGSEIQSALSEWTGQT  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFI GKHIGGC   ++  ++G+L PLL+EA A    S
Sbjct  82   TVPNVFIKGKHIGGCDSVMESNKQGKLVPLLTEAGAIANNS  122



>ref|XP_009602632.1| PREDICTED: glutaredoxin [Nicotiana tomentosiformis]
Length=125

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K+ V  NPVVV+SKT+C Y + VK L  +LG    VIELD+    G ++Q+ L   TGQ 
Sbjct  23   KQIVSSNPVVVFSKTYCGYCTRVKQLLSQLGATFKVIELDQES-DGNEVQQALLEWTGQR  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKH+GGC   ++ +++G+L PLL +A+A
Sbjct  82   TVPNVFIVGKHVGGCDSIVEKHQQGKLLPLLKDAAA  117



>emb|CDX84377.1| BnaC03g51230D [Brassica napus]
Length=120

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  +PVVV+SKT+C Y   VK L  +LG    V+ELDEM   G ++Q  L   TGQ 
Sbjct  23   KEIVSAHPVVVFSKTYCGYCQSVKQLLTQLGATFKVLELDEM-SDGGEIQSALSEWTGQS  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC   ++  ++G+L PLL+EA A
Sbjct  82   TVPNVFIKGKHIGGCDRVMESNKQGKLVPLLTEAGA  117



>ref|XP_009150366.1| PREDICTED: glutaredoxin-C1-like [Brassica rapa]
 emb|CDY00348.1| BnaA06g22490D [Brassica napus]
Length=120

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  +PVVV+SKT+C Y   VK L  +LG    V+ELDEM   G ++Q  L   TGQ 
Sbjct  23   KEIVSAHPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEM-SDGGEIQSALSEWTGQS  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC   ++  ++G+L PLL+EA A
Sbjct  82   TVPNVFIKGKHIGGCDRVMESNKQGKLVPLLTEAGA  117



>ref|XP_002276266.1| PREDICTED: glutaredoxin [Vitis vinifera]
 emb|CAN74292.1| hypothetical protein VITISV_015981 [Vitis vinifera]
 emb|CBI34892.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  +  V  NPVVV+SKT+C +   VK L   LG    V+ELD     G  LQ  L   T
Sbjct  4    QKAQEMVSSNPVVVFSKTYCPFCVSVKKLLSELGATFKVVELDTE-SDGADLQSALAGWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            GQ TVPNVFIGGKHIGGC     L+  G+L PLL+EA A  + S
Sbjct  63   GQRTVPNVFIGGKHIGGCDTATALHSDGKLVPLLTEAGAITSSS  106



>gb|KEH22257.1| glutaredoxin C4 [Medicago truncatula]
Length=107

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SK++C +  +VK LF  LGV    +ELD     G ++Q  L + TGQ 
Sbjct  7    KEIVSSNPVVVFSKSYCPFCVQVKKLFTDLGVTFKAVELDSES-DGSEIQGALAQWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGG HIGGC  T  L  +G+L PLL+ A A
Sbjct  66   TVPNVFIGGNHIGGCDSTTNLQNQGKLVPLLTSAGA  101



>gb|ABK21230.1| unknown [Picea sitchensis]
 gb|ABK23885.1| unknown [Picea sitchensis]
 gb|ACN40488.1| unknown [Picea sitchensis]
Length=130

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = +1

Query  358  VSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGP  537
            +S S  +R E+ VK T+  N + ++SK++C Y +  K +FK L V P V+ELD +   G 
Sbjct  19   MSASAATRQEKFVKTTISNNKIAIFSKSYCPYCARAKNVFKELNVTPYVVELD-LRDDGG  77

Query  538  QLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            ++Q+ L  L G+ TVP VFI GKHIGG  DT++ Y+ G+L  L+ +
Sbjct  78   EIQQALSILVGRRTVPQVFIDGKHIGGSDDTLEAYQSGQLAKLVGQ  123



>ref|XP_006405503.1| hypothetical protein EUTSA_v10027999mg [Eutrema salsugineum]
 gb|ESQ46956.1| hypothetical protein EUTSA_v10027999mg [Eutrema salsugineum]
Length=108

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 65/99 (66%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V  N VVV+SK++C +  +VK L ++LG + + +ELD+    G  +Q  L   T
Sbjct  4    QKAKEIVSSNAVVVFSKSYCPFCVKVKELLQKLGAKFIAVELDKE-SDGGSIQAALGEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGGKHIGGC  T+ ++  G+L PLL+EA A
Sbjct  63   GQRTVPNVFIGGKHIGGCDATMGMHSSGKLVPLLTEAGA  101



>ref|XP_006284798.1| hypothetical protein CARUB_v10006067mg [Capsella rubella]
 gb|EOA17696.1| hypothetical protein CARUB_v10006067mg [Capsella rubella]
Length=111

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V  + VVV+SKT+C Y   VK L ++LG +   +ELD     G Q+Q  L   T
Sbjct  4    QKAKEIVNSDSVVVFSKTFCPYCVRVKELLQQLGAKFKAVELDTE-SDGSQIQSALAEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGG HIGGC  T  L++ G+L PLL+EA A
Sbjct  63   GQRTVPNVFIGGNHIGGCDATSNLHKDGKLVPLLTEAGA  101



>ref|XP_002866529.1| hypothetical protein ARALYDRAFT_919585 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42788.1| hypothetical protein ARALYDRAFT_919585 [Arabidopsis lyrata subsp. 
lyrata]
Length=125

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 62/101 (61%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C Y   VK L  +LG    V ELDEM   G ++Q  L   TGQ 
Sbjct  23   KEIVSAYPVVVFSKTYCGYCQRVKQLLTQLGASFKVFELDEM-SDGGEIQAALSEWTGQS  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFI GKHIGGC   ++  ++G+L PLL+EA A    S
Sbjct  82   TVPNVFIKGKHIGGCDKVMESNKQGKLVPLLTEAGAIANNS  122



>gb|KJB53201.1| hypothetical protein B456_008G296500 [Gossypium raimondii]
Length=124

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            + VK  V   PVVV+SKT+C Y + VK LF +L      IELD+    G ++Q  L   T
Sbjct  20   DKVKHIVSSTPVVVFSKTYCGYCNRVKQLFAQLKASYKAIELDQE-SDGGEMQAALAEWT  78

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTE  696
            GQ TVPNVFI G HIGGC   I  Y+ G+L  LLS+A A   +
Sbjct  79   GQRTVPNVFIAGTHIGGCDSVIAKYQAGQLLNLLSDAGAMTVD  121



>gb|AAM67134.1| glutaredoxin-like protein [Arabidopsis thaliana]
Length=125

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C Y   VK L  +LG    V+ELDEM   G ++Q  L   TGQ 
Sbjct  23   KEIVSAYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEM-SDGGEIQSALSEWTGQT  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC   ++  ++G+L PLL+EA A
Sbjct  82   TVPNVFIKGKHIGGCDRVMETNKQGKLVPLLTEAGA  117



>ref|XP_005782310.1| hypothetical protein EMIHUDRAFT_60433, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD29881.1| hypothetical protein EMIHUDRAFT_60433, partial [Emiliania huxleyi 
CCMP1516]
Length=100

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 60/101 (59%), Gaps = 1/101 (1%)
 Frame = +1

Query  367  SFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQ  546
            S  + + E++K TV  N VVVYSK+WC Y    K     + V P V+ELDE+   G ++Q
Sbjct  1    SANAALAEAIKDTVASNDVVVYSKSWCPYCQRCKAALADMNVTPTVVELDEL-DDGAEIQ  59

Query  547  KVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLL  669
              L  LTGQ TVPNVF+ G H+GG  DT +    G+L  LL
Sbjct  60   AELLSLTGQRTVPNVFVKGAHLGGNDDTQRAISSGKLAQLL  100



>gb|EPS66469.1| hypothetical protein M569_08309, partial [Genlisea aurea]
Length=128

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 1/109 (1%)
 Frame = +1

Query  343  TQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEM  522
            T    V+G    R    VK+T+  +P+V++SK++C Y    K +F+ L  EP VIELDE 
Sbjct  15   TSCSVVAGISPERRVSRVKKTIKSHPIVIFSKSYCPYCKRAKQVFRELKQEPYVIELDEK  74

Query  523  GPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLL  669
               G ++Q+ L  + G+ TVP VFI GKHIGG  DT++ Y  GEL  LL
Sbjct  75   D-DGAEIQQALSEIVGRRTVPQVFINGKHIGGSDDTVEAYESGELAKLL  122



>ref|XP_005787407.1| putative glutaredoxin, partial [Emiliania huxleyi CCMP1516]
 gb|EOD34978.1| putative glutaredoxin, partial [Emiliania huxleyi CCMP1516]
Length=100

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 60/101 (59%), Gaps = 1/101 (1%)
 Frame = +1

Query  367  SFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQ  546
            S  + + E++K TV  N VVVYSK+WC Y    K     + V P V+ELDE+   G ++Q
Sbjct  1    SANAALAEAIKDTVASNDVVVYSKSWCPYCQRCKAALADINVTPTVVELDEL-DDGAEIQ  59

Query  547  KVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLL  669
              L  LTGQ TVPNVF+ G H+GG  DT +    G+L  LL
Sbjct  60   AELLSLTGQRTVPNVFVKGAHLGGNDDTQRAISSGKLAQLL  100



>emb|CDX87275.1| BnaC09g05900D [Brassica napus]
Length=116

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C Y  +VK L  +LG +  V+ELDEM   G ++Q  L + TGQ 
Sbjct  14   KEIVTSYPVVVFSKTYCGYCQKVKRLLTQLGADFEVLELDEM-RDGGEIQSALSKWTGQS  72

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVP+VFI GKH+GGC   ++  RKG+L PLL EA A
Sbjct  73   TVPSVFIKGKHMGGCDSVMESNRKGKLVPLLIEADA  108



>ref|XP_010441172.1| PREDICTED: glutaredoxin-C2 [Camelina sativa]
 ref|XP_010450676.1| PREDICTED: glutaredoxin-C2 [Camelina sativa]
Length=111

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V  + VVV+SKT+C Y   VK L ++LG +   +ELD     G Q+Q  L   T
Sbjct  4    QKAKDIVNSDSVVVFSKTFCPYCVRVKELLQQLGAKFKAVELDTE-SDGSQIQSALGEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGG HIGGC  T  L++ G+L PLL+EA A
Sbjct  63   GQRTVPNVFIGGNHIGGCDATSNLHKDGKLVPLLTEAGA  101



>ref|XP_010435909.1| PREDICTED: glutaredoxin-C2-like [Camelina sativa]
Length=111

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V  + VVV+SKT+C Y   VK L ++LG +   +ELD     G Q+Q  L   T
Sbjct  4    QKAKDIVNSDSVVVFSKTFCPYCVRVKELLQQLGAKFKAVELDTEN-DGSQIQSALGEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGG HIGGC  T  L++ G+L PLL+EA A
Sbjct  63   GQRTVPNVFIGGNHIGGCDATSNLHKDGKLVPLLTEAGA  101



>ref|XP_011028538.1| PREDICTED: glutaredoxin-C1 [Populus euphratica]
Length=177

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K      PVVV+SKT+C Y + VK L  ++G    V+ELDE+   G QLQ  L   TG+ 
Sbjct  75   KELASSAPVVVFSKTYCGYCNRVKQLLTQVGATYKVVELDELS-DGSQLQSALAHWTGRG  133

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVF+GGKHIGGC   ++ +++ EL PLL +A+A    S
Sbjct  134  TVPNVFMGGKHIGGCDTVVEKHQRNELLPLLQDAAATAKNS  174



>ref|NP_001233988.1| glutaredoxin [Solanum lycopersicum]
 sp|Q9ZR41.1|GLRX_SOLLC RecName: Full=Glutaredoxin [Solanum lycopersicum]
 emb|CAA77130.1| gluaredoxin [Solanum lycopersicum]
Length=108

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 60/97 (62%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
             K  V  NPV V+SKT+C +   VK L  +LG     +ELD     G ++Q  L   TGQ
Sbjct  6    AKEIVSGNPVAVFSKTYCPFCVSVKDLLSKLGATFKAVELDSE-KDGSEIQAALAEWTGQ  64

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFIG KHIGGC  T  L+R+G+L PLL+EA A
Sbjct  65   RTVPNVFIGRKHIGGCDATTALHREGKLLPLLTEAGA  101



>ref|XP_002322172.1| glutaredoxin family protein [Populus trichocarpa]
 gb|ABK94262.1| unknown [Populus trichocarpa]
 gb|EEF06299.1| glutaredoxin family protein [Populus trichocarpa]
Length=126

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = +1

Query  418  PVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFI  597
            PVVV+SKT+C Y + VK L  ++G    V+ELDE+   G QLQ  L + TG+ TVPNVFI
Sbjct  31   PVVVFSKTYCGYCNRVKQLLTQVGATYKVVELDEI-SDGSQLQSALAQWTGRGTVPNVFI  89

Query  598  GGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            GGK+IGGC   ++ +++ EL PLL +A+A    S
Sbjct  90   GGKNIGGCDTVVEKHQRNELLPLLQDAAATAKNS  123



>emb|CDY16750.1| BnaA09g06320D [Brassica napus]
Length=116

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C Y  +VK L  +LG +  V+ELDEM   G ++Q  L + T Q 
Sbjct  14   KEIVSSYPVVVFSKTYCGYCQKVKKLLTQLGADFEVLELDEM-SDGGEIQSALSKWTEQR  72

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI GKHIGGC   ++  +KG+L PLL EA A
Sbjct  73   TVPNVFIKGKHIGGCDSVMESNQKGKLVPLLIEAGA  108



>gb|EEC73608.1| hypothetical protein OsI_08091 [Oryza sativa Indica Group]
 gb|EEE57384.1| hypothetical protein OsJ_07545 [Oryza sativa Japonica Group]
Length=107

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 63/104 (61%), Gaps = 1/104 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V  +PVVV+SKT+C + + VK L   L      +ELD +   G +LQ  L   T
Sbjct  4    DKAKEIVASSPVVVFSKTYCPFCARVKRLLAELAASYKAVELD-VESDGSELQSALADWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            GQ TVP VFI GKHIGGC DT+ +++ G L PLL+EA A  T S
Sbjct  63   GQRTVPCVFIKGKHIGGCDDTMAMHKGGNLVPLLTEAGAIATPS  106



>ref|XP_002504226.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65484.1| predicted protein [Micromonas sp. RCC299]
Length=109

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = +1

Query  376  SRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVL  555
            +R+   V   +  N VVV++K+WC Y  +VK LF+ + V  L ++LD+   +   L KVL
Sbjct  2    TRLTGLVSGKIESNDVVVWAKSWCPYCDKVKALFQTMEVTHLAVDLDKFNEE-KALVKVL  60

Query  556  ERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
              +TGQ TVPNVFIGG H+GGC DT+ L   GEL+ +L +
Sbjct  61   TEMTGQRTVPNVFIGGAHVGGCDDTMALKESGELQRMLKD  100



>gb|AAV73806.1| glutaredoxin [Populus tremula x Populus tremuloides]
Length=126

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K      PVVV+SKT+C Y + VK L  ++G    V+ELDE+   G QLQ  L   TG+ 
Sbjct  24   KELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDEL-SDGSQLQSALAHWTGRG  82

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGK IGGC   ++ +++ EL PLL +A+A
Sbjct  83   TVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAA  118



>ref|XP_006260718.1| PREDICTED: glutaredoxin-2, mitochondrial [Alligator mississippiensis]
Length=146

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 77/120 (64%), Gaps = 5/120 (4%)
 Frame = +1

Query  340  PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDE  519
            PT +R  + +  ++++E    T+ +N VV++SKT CSY    K LF+ + V    +ELD 
Sbjct  24   PTSMRLSNDATLNQIQE----TISDNCVVIFSKTTCSYCKMAKKLFQDMNVNYTAVELD-  78

Query  520  MGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            M   G QLQ+VL+++TG  TVP VF+ G  IGG TDT +L+++G L PL+ +   R+TE+
Sbjct  79   MQRNGSQLQEVLQQMTGGRTVPRVFVNGSCIGGATDTQRLHQEGRLLPLVHQCQMRRTEN  138



>ref|XP_006039251.1| PREDICTED: glutaredoxin-2, mitochondrial [Alligator sinensis]
Length=128

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 77/120 (64%), Gaps = 5/120 (4%)
 Frame = +1

Query  340  PTQIRAVSGSFGSRMEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDE  519
            PT +R  + +  ++++E    T+ +N VV++SKT CSY    K LF+ + V    +ELD 
Sbjct  6    PTSMRLSNDATLNQIQE----TISDNCVVIFSKTTCSYCKMAKKLFQDMHVNYTAVELD-  60

Query  520  MGPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            M   G QLQ+VL+++TG  TVP VF+ G  IGG TDT +L+++G L PL+ +   R+TE+
Sbjct  61   MQRNGSQLQEVLQQMTGGRTVPRVFVNGSCIGGATDTQRLHQEGRLLPLVHQCQMRRTEN  120



>pdb|2E7P|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C1 
From Populus Tremula X Tremuloides
 pdb|2E7P|B Chain B, Crystal Structure Of The Holo Form Of Glutaredoxin C1 
From Populus Tremula X Tremuloides
 pdb|2E7P|C Chain C, Crystal Structure Of The Holo Form Of Glutaredoxin C1 
From Populus Tremula X Tremuloides
 pdb|2E7P|D Chain D, Crystal Structure Of The Holo Form Of Glutaredoxin C1 
From Populus Tremula X Tremuloides
Length=116

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K      PVVV+SKT+C Y + VK L  ++G    V+ELDE+   G QLQ  L   TG+ 
Sbjct  14   KELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDEL-SDGSQLQSALAHWTGRG  72

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGK IGGC   ++ +++ EL PLL +A+A
Sbjct  73   TVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAA  108



>gb|ENH85899.1| glutaredoxin [Colletotrichum orbiculare MAFF 240422]
Length=106

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +1

Query  385  EESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERL  564
            ++ V+  + EN VVV+SK++C Y  + K   + LG E  V+ELD++ P G ++Q VLE++
Sbjct  5    KQQVQSIIDENSVVVFSKSYCPYCRQTKSTLEELGAEFKVVELDQL-PDGGEIQDVLEQI  63

Query  565  TGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKT  693
            +GQ TVPN +I  KHIGG +D   L + G+LE +L EASA K 
Sbjct  64   SGQRTVPNSYIAQKHIGGNSDLQGLLKGGKLENILKEASAIKA  106



>ref|XP_003601242.1| Glutaredoxin [Medicago truncatula]
 gb|AES71493.1| glutaredoxin C1 [Medicago truncatula]
Length=127

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K+    +PV V+SKT+C Y   VK L K+LG    V+E+D +   G ++   L   TGQ 
Sbjct  25   KQIAASSPVFVFSKTYCGYCKRVKDLLKQLGATYKVLEMD-IESDGDEIHAALTEWTGQR  83

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC   ++ +R G+L PLL++A A
Sbjct  84   TVPNVFIGGKHIGGCDSILEKHRAGQLIPLLTDAGA  119



>ref|XP_002960344.1| CPYC type glutaredoxin [Selaginella moellendorffii]
 ref|XP_002967371.1| CPYC type glutaredoxin [Selaginella moellendorffii]
 gb|EFJ31970.1| CPYC type glutaredoxin [Selaginella moellendorffii]
 gb|EFJ37883.1| CPYC type glutaredoxin [Selaginella moellendorffii]
Length=103

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPV+V+SK++C Y   VK L   LG +   +EL+     G ++Q  L   TGQ 
Sbjct  5    KDLVASNPVMVFSKSYCPYCVSVKKLLASLGAKFTALELNAE-KDGAEIQAALAEWTGQR  63

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            TVP+VFIGGKHIGGC DT   +RKG+L PLL E
Sbjct  64   TVPSVFIGGKHIGGCDDTTATHRKGQLVPLLQE  96



>gb|KKA26321.1| hypothetical protein TD95_003515 [Thielaviopsis punctulata]
Length=105

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +1

Query  418  PVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVFI  597
            P+V+++K+WC Y ++ K +FK+LG +  V +LD+M   G +LQ  LE++TGQ TVPN FI
Sbjct  15   PIVLFTKSWCPYCTDSKNVFKKLGYQFTVYDLDQM-SDGNELQDALEQVTGQRTVPNNFI  73

Query  598  GGKHIGGCTDTIKLYRKGELEPLLSEASARK  690
            GGK +GG +D   LY KG+L  LL  A A K
Sbjct  74   GGKSVGGNSDLQALYAKGKLAGLLEAAGAVK  104



>ref|XP_003059849.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55801.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=89

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +1

Query  415  NPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQHTVPNVF  594
            N V V+SK+WC + ++VK L ++ G   L IELD+   +  ++Q  L   TGQ TVPNVF
Sbjct  2    NAVTVWSKSWCPFCTQVKQLLEKEGASYLAIELDKF-HEAEEIQASLAATTGQRTVPNVF  60

Query  595  IGGKHIGGCTDTIKLYRKGELEPLLSEA  678
            +GGKH+GGC DT+ L+R GEL  ++  A
Sbjct  61   VGGKHVGGCDDTMALHRSGELRKMIEAA  88



>pdb|1Z7P|A Chain A, Solution Structure Of Reduced Glutaredoxin C1 From Populus 
Tremula X Tremuloides
 pdb|1Z7R|A Chain A, Solution Structure Of Reduced Glutaredoxin C1 From Populus 
Tremula X Tremuloides
Length=117

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 63/99 (64%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K      PVVV+SKT+C Y + VK L  ++G    V+ELDE+   G QLQ  L   T
Sbjct  12   KKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELS-DGSQLQSALAHWT  70

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            G+ TVPNVFIGGK IGGC   ++ +++ EL PLL +A+A
Sbjct  71   GRGTVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAA  109



>ref|XP_009334103.1| PREDICTED: glutaredoxin [Pyrus x bretschneideri]
Length=107

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  N VVV+SKT+C +   VK L  +LG      ELD     G Q+Q  L   TGQ 
Sbjct  7    KELVSTNSVVVFSKTYCPFCVNVKQLLTQLGASYKAFELDSE-SDGAQIQSALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVF+GG HIGGC +T  L+++G+L PLL++A A
Sbjct  66   TVPNVFVGGNHIGGCDETTALHKEGKLVPLLTQAGA  101



>ref|NP_001275104.1| glutaredoxin [Solanum tuberosum]
 gb|ABU96709.1| glutaredoxin [Solanum tuberosum]
Length=125

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K+ V  NPVVV+SKT+C Y + VK L  +LG    VIELD+    G ++Q+ L   T Q 
Sbjct  23   KQIVSSNPVVVFSKTYCGYCTRVKQLLSQLGATFKVIELDQES-DGDEVQQALLEWTRQR  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGG+H+GGC   ++ +++G+L P+L +A+A
Sbjct  82   TVPNVFIGGEHVGGCDSVLEKHQQGKLLPMLKDAAA  117



>dbj|BAM15272.1| glutaredoxin, partial [Solanum tuberosum]
Length=125

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K+ V  NPVVV+SKT+C Y + VK L  +LG    VIELD+    G ++Q+ L   T Q 
Sbjct  23   KQIVSSNPVVVFSKTYCGYCTRVKQLLSQLGATFKVIELDQES-DGDEVQQALLEWTRQR  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGG+H+GGC   ++ +++G+L P+L +A+A
Sbjct  82   TVPNVFIGGEHVGGCDSVLEKHQQGKLLPMLKDAAA  117



>ref|NP_568962.1| glutaredoxin-C1 [Arabidopsis thaliana]
 sp|Q8L8T2.2|GRXC1_ARATH RecName: Full=Glutaredoxin-C1; Short=AtGrxC1 [Arabidopsis thaliana]
 gb|AAL91146.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|AAM47884.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|AED97688.1| glutaredoxin-C1 [Arabidopsis thaliana]
Length=125

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C Y   VK L  +LG    V+ELDEM   G ++Q  L   TGQ 
Sbjct  23   KEIVSAYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEM-SDGGEIQSALSEWTGQT  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI G HIGGC   ++  ++G+L PLL+EA A
Sbjct  82   TVPNVFIKGNHIGGCDRVMETNKQGKLVPLLTEAGA  117



>ref|NP_198853.1| glutaredoxin-C2 [Arabidopsis thaliana]
 sp|Q9FNE2.1|GRXC2_ARATH RecName: Full=Glutaredoxin-C2; Short=AtGrxC2 [Arabidopsis thaliana]
 dbj|BAB11592.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|AAL36059.1| AT5g40370/MPO12_80 [Arabidopsis thaliana]
 gb|AAL61914.1| glutaredoxin -like protein [Arabidopsis thaliana]
 gb|AAM19927.1| AT5g40370/MPO12_80 [Arabidopsis thaliana]
 gb|AAM47865.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|AAM64389.1| glutaredoxin-like protein [Arabidopsis thaliana]
 gb|AED94538.1| glutaredoxin-C2 [Arabidopsis thaliana]
Length=111

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 61/99 (62%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V    VVV+SKT+C Y   VK L ++LG +   +ELD     G Q+Q  L   T
Sbjct  4    QKAKEIVNSESVVVFSKTYCPYCVRVKELLQQLGAKFKAVELDTE-SDGSQIQSGLAEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGG HIGGC  T  L++ G+L PLL+EA A
Sbjct  63   GQRTVPNVFIGGNHIGGCDATSNLHKDGKLVPLLTEAGA  101



>dbj|BAB08846.1| glutaredoxin-like protein [Arabidopsis thaliana]
Length=111

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C Y   VK L  +LG    V+ELDEM   G ++Q  L   TGQ 
Sbjct  9    KEIVSAYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEM-SDGGEIQSALSEWTGQT  67

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFI G HIGGC   ++  ++G+L PLL+EA A
Sbjct  68   TVPNVFIKGNHIGGCDRVMETNKQGKLVPLLTEAGA  103



>gb|EPZ36542.1| Glutaredoxin, eukaryotic/virial domain-containing protein [Rozella 
allomycis CSF55]
Length=97

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            M   VK+ + EN V+++SK++C Y  + K LF+ + V    +ELD+    G ++Q  L +
Sbjct  1    MNALVKKLIAENNVMIFSKSYCPYCKKAKKLFENINVSYFALELDQ-ESNGSEIQNELAK  59

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSE  675
            +TGQ TVPN+FI G H+GGC DT + +  G+L+ LL E
Sbjct  60   MTGQTTVPNIFIKGNHLGGCDDTYEAFNSGKLQKLLKE  97



>ref|XP_010940165.1| PREDICTED: glutaredoxin-like [Elaeis guineensis]
Length=125

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 7/114 (6%)
 Frame = +1

Query  361  SGSFGSRMEES------VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEM  522
            S S GS+ E+        K  V  NPV+V+SK++C Y + VK L  +LG    VIELD +
Sbjct  7    SSSVGSKEEQGEMALAKAKELVSSNPVMVFSKSYCPYCTRVKQLLSQLGASYKVIELD-V  65

Query  523  GPQGPQLQKVLERLTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
               G ++Q  L   TG  TVPNVFIGG HIGGC + ++ +  G+L PLL+EA A
Sbjct  66   ESDGSEVQSALAEWTGLRTVPNVFIGGNHIGGCDNVMERHNGGKLVPLLTEAGA  119



>sp|Q6K953.1|GRXC4_ORYSJ RecName: Full=Glutaredoxin-C4, chloroplastic; AltName: Full=Glutaredoxin-C2 
homolog 2; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD21596.1| putative glutaredoxin [Oryza sativa Japonica Group]
 dbj|BAD21454.1| putative glutaredoxin [Oryza sativa Japonica Group]
Length=133

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 63/104 (61%), Gaps = 1/104 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V  +PVVV+SKT+C + + VK L   L      +ELD +   G +LQ  L   T
Sbjct  30   DKAKEIVASSPVVVFSKTYCPFCARVKRLLAELAASYKAVELD-VESDGSELQSALADWT  88

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            GQ TVP VFI GKHIGGC DT+ +++ G L PLL+EA A  T S
Sbjct  89   GQRTVPCVFIKGKHIGGCDDTMAMHKGGNLVPLLTEAGAIATPS  132



>ref|XP_010027488.1| PREDICTED: glutaredoxin-like [Eucalyptus grandis]
 gb|KCW83349.1| hypothetical protein EUGRSUZ_B00283 [Eucalyptus grandis]
Length=122

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 61/102 (60%), Gaps = 1/102 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K      PVVV+SKT+C Y   VK+L  +LGV   V+ELD+ G  G  +Q  L   T
Sbjct  22   DKAKEVASSAPVVVFSKTYCGYCQRVKLLLTQLGVSYKVVELDKEG-DGAVVQSALADWT  80

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKT  693
            G  TVPNVFIGG HIGGC    + ++ G+L PLL  A A KT
Sbjct  81   GLRTVPNVFIGGNHIGGCDSVTEKHQAGQLVPLLRSAGAVKT  122



>ref|XP_002866528.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42787.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C YS  VK L ++LG    V+ELDEM   G ++Q  L   TGQ 
Sbjct  14   KEMVSSYPVVVFSKTYCGYSKRVKQLLQQLGATFQVLELDEMS-DGGEIQSALSEWTGQS  72

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVP+VFI GKHIGG    ++  ++G+L PLL+EA A
Sbjct  73   TVPSVFIKGKHIGGSDKVMETNKQGKLVPLLTEAGA  108



>ref|XP_007031532.1| Glutaredoxin family protein [Theobroma cacao]
 gb|EOY02458.1| Glutaredoxin family protein [Theobroma cacao]
Length=107

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SK++C Y   VK L ++LG     IEL+     G ++Q  L   TG  
Sbjct  7    KEVVSANPVVVFSKSYCPYCVNVKQLLQQLGASFKAIELNNES-DGSEIQAALAEWTGLR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGGKHIGGC  T  L+ +G+L PLL+EA A
Sbjct  66   TVPNVFIGGKHIGGCDVTTTLHEEGKLIPLLTEAGA  101



>ref|XP_010251178.1| PREDICTED: glutaredoxin-like [Nelumbo nucifera]
Length=107

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V ++PVVV+SK++C +   VK L  +LG     IELD +   G ++Q  L   TGQ 
Sbjct  7    KEIVSKHPVVVFSKSYCPFCDRVKNLLSQLGANYNAIELD-VESDGNEIQSALAEWTGQK  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFI G HIGGC  T +++R G+L PLL++A A    S
Sbjct  66   TVPNVFIAGNHIGGCDKTTEMHRGGKLVPLLTQAGAVAVAS  106



>emb|CDH54497.1| glutaredoxin [Lichtheimia corymbifera JMRC:FSU:9682]
Length=112

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (64%), Gaps = 1/102 (1%)
 Frame = +1

Query  382  MEESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLER  561
            ++E VK+++ +N V+V+SKT C Y +  K LF+ L V    +ELD     G ++QK L  
Sbjct  8    IKELVKKSIADNSVMVFSKTTCPYCTGAKDLFEDLDVNYKALELDTR-QDGSEIQKALAE  66

Query  562  LTGQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASAR  687
            +TGQ TVPNVFI  KHIGG +D   +YR G+LE L  +A  +
Sbjct  67   MTGQKTVPNVFINSKHIGGYSDLDSVYRSGKLESLFKDAGIK  108



>ref|XP_010444169.1| PREDICTED: glutaredoxin-C1-like [Camelina sativa]
Length=126

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 64/107 (60%), Gaps = 3/107 (3%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C Y  +VK L  +LG    V ELDEM   G Q+Q  L   TGQ 
Sbjct  23   KEIVSSYPVVVFSKTYCGYCQKVKQLLTKLGASFKVFELDEM-SDGGQIQSALTEWTGQS  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES*LSRAW  717
            TVPNVFI  KHIGGC   ++  ++G+L  LL+EA A    S  S+ W
Sbjct  82   TVPNVFIKEKHIGGCDKVMESNKQGKLVSLLTEAGAIANNS--SQLW  126



>ref|XP_010444170.1| PREDICTED: glutaredoxin-C1-like [Camelina sativa]
 ref|XP_010444171.1| PREDICTED: glutaredoxin-C1-like [Camelina sativa]
 ref|XP_010444172.1| PREDICTED: glutaredoxin-C1-like [Camelina sativa]
 ref|XP_010444173.1| PREDICTED: glutaredoxin-C1-like [Camelina sativa]
 ref|XP_010444174.1| PREDICTED: glutaredoxin-C1-like [Camelina sativa]
 ref|XP_010444175.1| PREDICTED: glutaredoxin-C1-like [Camelina sativa]
Length=116

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V   PVVV+SKT+C Y   VK L  +LG    V+ELDE+G  G ++Q  L   TGQ 
Sbjct  14   KEIVSSYPVVVFSKTYCRYCQRVKQLLTQLGASFKVLELDEIG-DGSKIQSALSEWTGQS  72

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVP+VFI  KHIGG    ++ Y++G+L PLL+EA A
Sbjct  73   TVPSVFIKAKHIGGSDKVMETYKQGKLVPLLTEAGA  108



>ref|XP_011047332.1| PREDICTED: glutaredoxin [Populus euphratica]
Length=109

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  ESVKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLT  567
            +  K  V  N VVV+SKT+C +   VK L  +LG +   +ELD     G ++Q  L   T
Sbjct  4    DKAKELVSTNSVVVFSKTYCPFCVRVKELLNQLGAKYTAVELDTE-KDGSEIQSALHEWT  62

Query  568  GQHTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            GQ TVPNVFIGG HIGGC  T  ++++G+L PLL++A A
Sbjct  63   GQRTVPNVFIGGNHIGGCDKTTGMHQEGKLVPLLADAGA  101



>ref|XP_004491729.1| PREDICTED: glutaredoxin-C2-like [Cicer arietinum]
Length=107

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K  V  NPVVV+SK++C +  +VK LF  LGV    IELD     G ++Q  L   TGQ 
Sbjct  7    KEIVSSNPVVVFSKSYCPFCVQVKKLFTNLGVTFKAIELDSE-SDGSEIQGALAEWTGQR  65

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVP+VFIGG HIGGC  T  L+ +G+L  LL+ A A
Sbjct  66   TVPSVFIGGNHIGGCDATTNLHNQGKLVSLLASAGA  101



>ref|XP_004236221.1| PREDICTED: glutaredoxin [Solanum lycopersicum]
Length=125

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K+ V  NPVVV+SKT+C Y + VK L  +LG    VIELD     G ++Q  L   T Q 
Sbjct  23   KQIVSSNPVVVFSKTYCGYCTRVKKLLSQLGATFKVIELDRES-DGDEVQAALLEWTKQR  81

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
            TVPNVFIGG+H+GGC   ++ +++G+L P+L +A+A
Sbjct  82   TVPNVFIGGEHVGGCDSVLEKHQQGKLLPMLKDAAA  117



>gb|KID97161.1| Thioredoxin-like fold protein, partial [Metarhizium majus ARSEF 
297]
Length=106

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
            V+  + ENPVVV+SK++C Y    K   K+LG E   +ELD++ P G  LQ  LE +TGQ
Sbjct  8    VQTLIDENPVVVFSKSYCPYCRSTKETLKKLGAEFKALELDQI-PDGADLQDALEDITGQ  66

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKT  693
             TVPNV I  KHIGG +D   L   G+LE LL ++ A K 
Sbjct  67   RTVPNVHIRQKHIGGNSDVQSLNHSGKLEGLLKDSGALKA  106



>ref|XP_011001506.1| PREDICTED: glutaredoxin-C1-like [Populus euphratica]
Length=120

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 1/101 (1%)
 Frame = +1

Query  397  KRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQH  576
            K      PVVV+SKT+C Y + VK L  ++G    VIELDE+   G +LQ VL   TGQ 
Sbjct  18   KELASSAPVVVFSKTYCGYCNRVKQLLTQVGATYKVIELDELSG-GYELQSVLGHWTGQS  76

Query  577  TVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASARKTES  699
            TVPNVFI GKHIGGC   ++ ++  +L PLL++A A    S
Sbjct  77   TVPNVFIEGKHIGGCDSVLEKHKNNQLLPLLNDAGAVAINS  117



>ref|XP_008812171.1| PREDICTED: glutaredoxin [Phoenix dactylifera]
Length=125

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +1

Query  394  VKRTVGENPVVVYSKTWCSYSSEVKVLFKRLGVEPLVIELDEMGPQGPQLQKVLERLTGQ  573
             K  V  NPV+V+SK++CS+ + VK L  +LG    VIELD +   G ++Q  L   T Q
Sbjct  24   AKELVSSNPVMVFSKSYCSFCTRVKQLLSQLGANYKVIELD-VESDGSEIQSALAEWTAQ  82

Query  574  HTVPNVFIGGKHIGGCTDTIKLYRKGELEPLLSEASA  684
             TVPNVFIGG HIGGC   +  +  G+L PLL+EA A
Sbjct  83   RTVPNVFIGGNHIGGCDSVMGRHNGGKLVPLLTEAGA  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1641823912876