BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7986

Length=880
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009803270.1|  PREDICTED: scarecrow-like protein 15               192   4e-53   Nicotiana sylvestris
ref|XP_009590475.1|  PREDICTED: scarecrow-like protein 15               188   2e-51   Nicotiana tomentosiformis
ref|XP_004232383.1|  PREDICTED: scarecrow-like protein 15               182   2e-49   Solanum lycopersicum
ref|XP_006363143.1|  PREDICTED: scarecrow-like protein 15-like          181   9e-49   Solanum tuberosum [potatoes]
gb|ABU45198.1|  unknown                                                 177   2e-47   Petunia integrifolia subsp. inflata
gb|ABU45212.1|  unknown                                                 176   4e-47   Solanum bulbocastanum [ornamental nightshade]
gb|ABU45178.1|  unknown                                                 173   7e-46   Solanum melongena [aubergine]
ref|XP_011097216.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    156   6e-40   
emb|CDP02813.1|  unnamed protein product                                144   1e-35   Coffea canephora [robusta coffee]
gb|EYU28571.1|  hypothetical protein MIMGU_mgv1a003577mg                144   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_011099583.1|  PREDICTED: scarecrow-like protein 15               143   2e-35   Sesamum indicum [beniseed]
ref|XP_002310797.1|  hypothetical protein POPTR_0007s12480g             141   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011025728.1|  PREDICTED: scarecrow-like protein 15               140   3e-34   Populus euphratica
ref|XP_010999954.1|  PREDICTED: scarecrow-like protein 15               135   1e-32   Populus euphratica
ref|XP_006383233.1|  scarecrow transcription factor family protein      135   2e-32   
gb|KDO36173.1|  hypothetical protein CISIN_1g048701mg                   123   2e-28   Citrus sinensis [apfelsine]
ref|XP_012079070.1|  PREDICTED: scarecrow-like protein 15               123   3e-28   Jatropha curcas
ref|XP_006425721.1|  hypothetical protein CICLE_v10025246mg             123   4e-28   Citrus clementina [clementine]
ref|XP_007203757.1|  hypothetical protein PRUPE_ppa003675mg             122   5e-28   Prunus persica
ref|XP_002525108.1|  DELLA protein GAIP-B, putative                     121   1e-27   Ricinus communis
ref|XP_007156910.1|  hypothetical protein PHAVU_002G027500g             121   2e-27   Phaseolus vulgaris [French bean]
gb|EPS63021.1|  hypothetical protein M569_11763                         120   3e-27   Genlisea aurea
ref|XP_003517241.1|  PREDICTED: scarecrow-like protein 15-like          120   4e-27   Glycine max [soybeans]
ref|XP_008241642.1|  PREDICTED: scarecrow-like protein 15               119   7e-27   Prunus mume [ume]
ref|XP_002268445.1|  PREDICTED: scarecrow-like protein 15               118   2e-26   Vitis vinifera
emb|CBI17555.3|  unnamed protein product                                118   2e-26   Vitis vinifera
ref|XP_006297491.1|  hypothetical protein CARUB_v10013509mg             117   4e-26   Capsella rubella
ref|XP_008363118.1|  PREDICTED: scarecrow-like protein 15               117   5e-26   
ref|XP_010467682.1|  PREDICTED: scarecrow-like protein 15               116   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_003538842.1|  PREDICTED: scarecrow-like protein 15-like          116   7e-26   Glycine max [soybeans]
ref|XP_008393455.1|  PREDICTED: LOW QUALITY PROTEIN: scarecrow-li...    116   1e-25   Malus domestica [apple tree]
ref|XP_010531168.1|  PREDICTED: scarecrow-like protein 15               112   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_007046999.1|  GRAS family transcription factor, putative         112   4e-24   
ref|XP_010099836.1|  hypothetical protein L484_009050                   111   6e-24   Morus notabilis
ref|XP_006409136.1|  hypothetical protein EUTSA_v10023133mg             110   8e-24   Eutrema salsugineum [saltwater cress]
gb|KJB17813.1|  hypothetical protein B456_003G016500                    110   1e-23   Gossypium raimondii
ref|XP_008453725.1|  PREDICTED: scarecrow-like protein 15               110   1e-23   Cucumis melo [Oriental melon]
ref|XP_004300613.1|  PREDICTED: scarecrow-like protein 15               108   4e-23   Fragaria vesca subsp. vesca
ref|XP_010489558.1|  PREDICTED: scarecrow-like protein 15               107   6e-23   Camelina sativa [gold-of-pleasure]
gb|KGN53268.1|  GRAS family transcription factor                        107   2e-22   Cucumis sativus [cucumbers]
ref|XP_004509243.1|  PREDICTED: scarecrow-like protein 15-like          107   2e-22   Cicer arietinum [garbanzo]
gb|EPS73060.1|  hypothetical protein M569_01698                         105   3e-22   Genlisea aurea
ref|XP_009114695.1|  PREDICTED: scarecrow-like protein 15               105   4e-22   Brassica rapa
ref|XP_004146541.1|  PREDICTED: scarecrow-like protein 15 isoform X1    105   7e-22   Cucumis sativus [cucumbers]
ref|XP_004146542.2|  PREDICTED: scarecrow-like protein 15 isoform X2    103   1e-21   Cucumis sativus [cucumbers]
emb|CDY43895.1|  BnaA07g01720D                                          103   2e-21   Brassica napus [oilseed rape]
ref|XP_003629479.1|  GRAS family transcription factor                   103   2e-21   Medicago truncatula
emb|CDY13032.1|  BnaC07g03310D                                          101   8e-21   Brassica napus [oilseed rape]
ref|XP_009374236.1|  PREDICTED: scarecrow-like protein 15               101   1e-20   
ref|XP_008453726.1|  PREDICTED: scarecrow-like protein 15               101   1e-20   Cucumis melo [Oriental melon]
ref|XP_010548348.1|  PREDICTED: scarecrow-like protein 15               100   3e-20   Tarenaya hassleriana [spider flower]
gb|EYU44670.1|  hypothetical protein MIMGU_mgv1a026210mg              99.4    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_010667697.1|  PREDICTED: scarecrow-like protein 15             99.0    1e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003519903.1|  PREDICTED: scarecrow-like protein 15-like        96.7    7e-19   Glycine max [soybeans]
ref|XP_009356715.1|  PREDICTED: scarecrow-like protein 15             92.4    1e-18   
gb|KFK40237.1|  hypothetical protein AALP_AA3G348400                  94.4    2e-18   Arabis alpina [alpine rockcress]
ref|XP_009142446.1|  PREDICTED: scarecrow-like protein 15             94.4    3e-18   Brassica rapa
emb|CDX69238.1|  BnaC01g02150D                                        94.4    3e-18   
gb|KJB71048.1|  hypothetical protein B456_011G102400                  93.6    5e-18   Gossypium raimondii
ref|XP_006283643.1|  hypothetical protein CARUB_v10004700mg           91.7    3e-17   Capsella rubella
gb|AAT75161.1|  SCARECROW-like protein                                90.1    7e-17   Brassica napus [oilseed rape]
ref|XP_006411970.1|  hypothetical protein EUTSA_v10025054mg           89.7    1e-16   Eutrema salsugineum [saltwater cress]
dbj|BAP91520.1|  gras family protein                                  89.7    1e-16   Glycine max [soybeans]
ref|XP_003547994.1|  PREDICTED: scarecrow-like protein 15-like        88.6    3e-16   Glycine max [soybeans]
ref|XP_010437312.1|  PREDICTED: scarecrow-like protein 15 isoform X2  88.2    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010437311.1|  PREDICTED: scarecrow-like protein 15 isoform X1  88.2    3e-16   
ref|XP_010432142.1|  PREDICTED: scarecrow-like protein 15             88.2    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010446751.1|  PREDICTED: scarecrow-like protein 15 isoform X3  87.4    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010446749.1|  PREDICTED: scarecrow-like protein 15 isoform X1  87.4    6e-16   
ref|NP_195389.4|  scarecrow-like protein 15                           85.9    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869027.1|  hypothetical protein ARALYDRAFT_490963           85.9    2e-15   
emb|CAB16826.1|  SCARECROW-like protein                               85.9    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30292.1|  hypothetical protein AALP_AA7G242600                  85.9    2e-15   Arabis alpina [alpine rockcress]
ref|XP_007156025.1|  hypothetical protein PHAVU_003G252200g           84.0    1e-14   Phaseolus vulgaris [French bean]
ref|XP_010070042.1|  PREDICTED: scarecrow-like protein 15             83.2    1e-14   Eucalyptus grandis [rose gum]
gb|KDO59927.1|  hypothetical protein CISIN_1g007284mg                 83.6    1e-14   Citrus sinensis [apfelsine]
ref|XP_006428037.1|  hypothetical protein CICLE_v10025197mg           82.0    5e-14   Citrus clementina [clementine]
ref|XP_010255200.1|  PREDICTED: scarecrow-like protein 15             76.6    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009394367.1|  PREDICTED: scarecrow-like protein 15             53.9    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACB31517.1|  SCL6-IV                                               50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009803270.1| PREDICTED: scarecrow-like protein 15 [Nicotiana sylvestris]
Length=543

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 157/252 (62%), Gaps = 56/252 (22%)
 Frame = +1

Query  274  MKVPVASNENWNS------------------AAGNG---WYEPKSVLELRRSPSPVLDQK  390
            MKVP +SN+N +S                  AA NG    YEPKSVLELRRSPSP+++++
Sbjct  1    MKVPFSSNDNVSSKPLINNNNNNNLRNATFPAAANGPNLCYEPKSVLELRRSPSPIVEKQ  60

Query  391  AAPAGNFDV---SDDPLELADNLLTNFEDWDSFMKELGLQDDRNI--KPDHNLLFTPSSE  555
                 +F      DDPL+L D++L+NFEDWDS M+ELGLQDD     K +H  L    SE
Sbjct  61   VITNPDFSALCGGDDPLQLGDHVLSNFEDWDSLMRELGLQDDSASLSKSNHPQLSLTQSE  120

Query  556  SQTHQFEFTHSLPEF------VPSSDFNFS-----QFQ----GN-INSFD-------ENW  666
            S T QF   H+L EF       P+SDF+FS     QFQ    GN IN+ D        NW
Sbjct  121  SLT-QF---HNLSEFSADSTQFPTSDFSFSENFPQQFQSVNQGNYINALDLSGDIHQNNW  176

Query  667  SFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLT  846
            + GFDY+DELI+FAECF++NA QLA VIL +LNQ+L SAAG PL+RAAF  +EALQ+ L 
Sbjct  177  NVGFDYVDELIRFAECFETNAFQLAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQLA  236

Query  847  GS---TRPASSS  873
            GS   TRPASSS
Sbjct  237  GSTRQTRPASSS  248



>ref|XP_009590475.1| PREDICTED: scarecrow-like protein 15 [Nicotiana tomentosiformis]
Length=541

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 151/249 (61%), Gaps = 52/249 (21%)
 Frame = +1

Query  274  MKVPVASNENWNS-----------------AAGNG---WYEPKSVLELRRSPSPVLDQKA  393
            MKVP +SN+N +S                 AA NG    YEPKSVLELRRSPSP+++++ 
Sbjct  1    MKVPFSSNDNVSSKPLISNNNNNLQNATFPAATNGPNLCYEPKSVLELRRSPSPIVEKQV  60

Query  394  APAGNFDV---SDDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQT  564
                +F      DDPL+L D++L+NFEDWDS M+ELGLQDD       N   + +     
Sbjct  61   ITNPDFSALCGGDDPLQLGDHVLSNFEDWDSLMRELGLQDDSASLSKSNPQLSLTQSESL  120

Query  565  HQFEFTHSLPEF------VPSSDFNFS-----QFQ----GN-INSFD-------ENWSFG  675
             QF   H+L EF       P+SDF+FS     QFQ    GN IN+ D        NW+ G
Sbjct  121  TQF---HNLSEFSADSTQFPTSDFSFSENFPQQFQSVNQGNYINALDLSGDIHQNNWNVG  177

Query  676  FDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGS-  852
            FDY+DELI+F ECF++NA QLA VIL +LNQ+L SAAG PL+RAAF  +EALQ+ L GS 
Sbjct  178  FDYVDELIRFTECFETNAFQLAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQLAGST  237

Query  853  --TRPASSS  873
              TRPASSS
Sbjct  238  RQTRPASSS  246



>ref|XP_004232383.1| PREDICTED: scarecrow-like protein 15 [Solanum lycopersicum]
 gb|AAG01129.1|AF273333_14 BAC19.14 [Solanum lycopersicum]
Length=536

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 147/239 (62%), Gaps = 41/239 (17%)
 Frame = +1

Query  274  MKVPVASNENWNS-------------AAGNG---WYEPKSVLELRRSPSPVLDQKAAPAG  405
            MKVP ++N+N +S             AA NG    YEPKSVLELRRSPSP++D++     
Sbjct  1    MKVPFSTNDNVSSKPLVNSNNSFTFPAATNGSNLCYEPKSVLELRRSPSPIVDKQIITT-  59

Query  406  NFDVS-----DDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQ  570
            N D+S     +DPL+L D++L+NFEDWDS M+ELGL DD       N L    S +Q H 
Sbjct  60   NPDLSALCGGEDPLQLGDHVLSNFEDWDSLMRELGLHDDSASLSKTNPLTHSESLTQFHN  119

Query  571  F-EFTHSLPEFVPSSDFNFS------QF-----QGNINSFD------ENWSFGFDYIDEL  696
              EF+    +F PS DF+FS      QF        IN+ D      +NWS GFDY+DEL
Sbjct  120  LSEFSAESNQF-PSPDFSFSDTNFPQQFPTVNQASFINALDLSGDIHQNWSVGFDYVDEL  178

Query  697  IQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTRPASSS  873
            I+FAECF++NA QLA VIL +LNQ+L SAAG PL+RAAF  +EALQ+ L GS R   SS
Sbjct  179  IRFAECFETNAFQLAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQLAGSARQTRSS  237



>ref|XP_006363143.1| PREDICTED: scarecrow-like protein 15-like [Solanum tuberosum]
Length=545

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 121/253 (48%), Positives = 153/253 (60%), Gaps = 57/253 (23%)
 Frame = +1

Query  274  MKVPVASNENWNS------------------AAGNG---WYEPKSVLELRRSPSPVLDQK  390
            MKVP ++N+N +S                  AA NG    YEPKSVLELRRSPSP++D++
Sbjct  1    MKVPFSTNDNVSSKPLISSNNNNLRNNVTFPAATNGSNLCYEPKSVLELRRSPSPIVDKQ  60

Query  391  AAPAGNFDVS------DDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSS  552
                 N D+S      +DPL+L D++LTNFEDWDS M+ELGL DD       N    P S
Sbjct  61   IITT-NPDLSALCGGGEDPLQLGDHVLTNFEDWDSLMRELGLHDDSASLSKTN---PPLS  116

Query  553  ESQTHQFEFTHSLPEFVPSS------DFNFS------QF----QGN-INSFD------EN  663
             +Q+      H+L EF   S      DF+FS      QF    QG+ IN+ D      +N
Sbjct  117  LTQSESLTQFHNLSEFSADSTQFANPDFSFSESTFPQQFPAVNQGSFINALDLSGDIHQN  176

Query  664  WSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLL  843
            W+ GFDY+DELI+FAECF++NA QLA VIL +LNQ+L SAAG PL+RAAF  +EALQ+ L
Sbjct  177  WNVGFDYVDELIRFAECFETNAFQLAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQL  236

Query  844  TGS---TRPASSS  873
             GS   TRP+SSS
Sbjct  237  AGSARQTRPSSSS  249



>gb|ABU45198.1| unknown [Petunia integrifolia subsp. inflata]
Length=548

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 150/251 (60%), Gaps = 55/251 (22%)
 Frame = +1

Query  274  MKVPVASNENWNS-----------------AAGNG---WYEPKSVLELRRSPSPVLDQKA  393
            MKVP +SN+N +S                 AA N     YEPKSVLELRRSPSP+LD K 
Sbjct  1    MKVPFSSNDNVSSKPLNNSNNNNLRNSSFPAATNSPNLCYEPKSVLELRRSPSPILDNKQ  60

Query  394  APAGNFDVS------DDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSE  555
                N D S      +DPL+L D++L+NFEDWDS M+ELGLQ+D       N   T +  
Sbjct  61   VIT-NPDYSTLCGGGEDPLQLGDHVLSNFEDWDSLMRELGLQEDSASLAKSNPQLTLTQT  119

Query  556  SQTHQFEFTHSLPEF------VPSSDFNFS-----QF----QGN-INSFD------ENWS  669
                QF   H+L E+        SS+F+FS     QF    QGN IN+ D       NW+
Sbjct  120  ESLTQF---HTLSEYSADSAQFGSSEFSFSENYPHQFPAVNQGNYINALDLATGDNNNWN  176

Query  670  FGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTG  849
             GFDY+DELI+FAECF++NA QLA VIL +LNQ+L SA+G PL+RAAF  +EALQ+ L G
Sbjct  177  LGFDYVDELIRFAECFETNAFQLAHVILARLNQRLRSASGKPLQRAAFYFKEALQAQLAG  236

Query  850  S---TRPASSS  873
            S   TRP+SSS
Sbjct  237  STRQTRPSSSS  247



>gb|ABU45212.1| unknown [Solanum bulbocastanum]
Length=545

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 145/234 (62%), Gaps = 41/234 (18%)
 Frame = +1

Query  265  LREMKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVS-----DDP  429
            LR +  P A+N +      N  YEPKSVLELRRSPSP++D++     N D+S     +DP
Sbjct  26   LRNVTFPAATNSS------NLCYEPKSVLELRRSPSPIVDKQIITT-NPDLSALCGGEDP  78

Query  430  LELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPS  609
            L+L D++L+NFEDWDS M+ELGL DD       N   + +      QF   H+L EF   
Sbjct  79   LQLGDHVLSNFEDWDSLMRELGLHDDSASLSKTNPQLSLTQSESLTQF---HNLSEFSAD  135

Query  610  S------DFNFS------QF----QGN-INSFD------ENWSFGFDYIDELIQFAECFD  720
            S      DF+FS      QF    QG+ IN+ D      +NW+ GFDY+DELI FAECF+
Sbjct  136  STQFANPDFSFSESTFPQQFPAVNQGSFINALDLSGDIHQNWNVGFDYVDELICFAECFE  195

Query  721  SNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGS---TRPASSS  873
            +NA QLA VIL +LNQ+L SAAG PL+RAAF  +EALQ+ L GS   TRP+SSS
Sbjct  196  TNAFQLAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQLAGSARQTRPSSSS  249



>gb|ABU45178.1| unknown [Solanum melongena]
Length=547

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 145/234 (62%), Gaps = 40/234 (17%)
 Frame = +1

Query  265  LREMKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVS-----DDP  429
            LR +  PVA     N       YEPKSVL+LRRSPSP+++++     N D+S     +DP
Sbjct  28   LRNVTFPVAVTNGPNLC-----YEPKSVLDLRRSPSPIVEKQIVTT-NPDLSALCGGEDP  81

Query  430  LELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPS  609
            L+L D++L+NFEDWDS M+ELGL DD       N    P S +QT      H+L +F   
Sbjct  82   LQLGDHVLSNFEDWDSLMRELGLHDDSASLSKTN---PPLSLAQTESLTQFHNLSDFSGD  138

Query  610  S------DFNFS------QF----QGN-INSFD------ENWSFGFDYIDELIQFAECFD  720
            S      DF+FS      QF    QG+ IN+ D      +NW+ GFDY+DELI+FAECF+
Sbjct  139  STQFANPDFSFSDSTFPQQFPAVNQGSFINALDLSGDIHQNWNVGFDYVDELIRFAECFE  198

Query  721  SNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGS---TRPASSS  873
            +NA Q+A VIL +LNQ+L SAAG PL+RAAF  +EALQ+ L GS   TRP+SSS
Sbjct  199  TNAFQVAHVILARLNQRLRSAAGKPLQRAAFYFKEALQAQLAGSTRQTRPSSSS  252



>ref|XP_011097216.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 15 [Sesamum 
indicum]
Length=516

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 130/219 (59%), Gaps = 41/219 (19%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAP----AGNFDVSDDPLELA--DNLLTNFEDWDSFMKEL  492
            YEPKSVLELR SPSPV D K A     A +  ++DDPL+L    ++L N ++WDS+M+EL
Sbjct  43   YEPKSVLELRSSPSPVSDHKPASNNTCAADILLADDPLQLDQDHHMLINPQEWDSWMREL  102

Query  493  GLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVP---SSDFNFSQF----------  633
            GL DD        L    S   Q+HQ  +++ L EF P   S D N  QF          
Sbjct  103  GLHDDSTTPVSKQL---TSHSDQSHQNHYSNDLLEFPPAISSLDSNHDQFVPVDFGLLPD  159

Query  634  ------QGNINSFD--------ENWSF-GFDYIDELIQFAECFDSNAVQLAQVILPQLNQ  768
                    ++NSFD         NW+  GFDY+DELI+ AECF++N++QL QVIL +LNQ
Sbjct  160  IPINHNSNSLNSFDALSVDLNSSNWNVVGFDYVDELIRLAECFETNSLQLGQVILARLNQ  219

Query  769  KLSSAAGNPLRRAAFLLQEALQSLLTGSTR----PASSS  873
            +L S  G PL+RAAF  +EALQSLLTGS R    PA+SS
Sbjct  220  RLRSPIGKPLQRAAFYFKEALQSLLTGSARLAHQPANSS  258



>emb|CDP02813.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 128/225 (57%), Gaps = 52/225 (23%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAPAGNFDVS----DDPLELADNLLTNFE-DWDSFMKELG  495
            YEPKSVLELR+SPSPV +    P+ N D+S    D  L+L D++L +FE DWDS M+ELG
Sbjct  45   YEPKSVLELRQSPSPVTE---IPSSNTDISTVWDDTGLQLEDHVLNHFEVDWDSLMRELG  101

Query  496  LQDDRNIKPDH------NLLFTPSSESQTHQFEFTHSLPEFVPS-----------SDFNF  624
            L +D N  P        +  FTPS      Q +F  +LPEF P+           SD   
Sbjct  102  LHEDSNPTPTSRPTTFSHSQFTPSGS----QVQF-QNLPEFPPTHNSFDSTLFVPSDITL  156

Query  625  SQFQGNINSFDEN-------------------WSFGFDYIDELIQFAECFDSNAVQLAQV  747
                   +SF+++                   W+ GFDY+DELI+ AECF++N++ L  V
Sbjct  157  PDISTYPSSFNDSSINSLGLSHDAHHHNTNLTWNPGFDYVDELIRLAECFETNSLHLTHV  216

Query  748  ILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTR---PASSS  873
            IL +LNQ+L    G PL+RAAF  +EALQ+LLTGSTR   P++SS
Sbjct  217  ILGRLNQRLRGPTGKPLQRAAFYFKEALQTLLTGSTRLTQPSTSS  261



>gb|EYU28571.1| hypothetical protein MIMGU_mgv1a003577mg [Erythranthe guttata]
Length=576

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/230 (42%), Positives = 123/230 (53%), Gaps = 61/230 (27%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAPAGNFDVS-------DDPLELADNLLTN-----FEDWD  474
            YEPKSVLELR SPSPV      P  +F +        D  +EL D++L N      EDWD
Sbjct  49   YEPKSVLELRGSPSPV---SGKPNSDFLIGGGGGGGGDRLIELEDHVLNNIEHPQLEDWD  105

Query  475  SFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHS--------------LPEFVPSS  612
            S M++LGL DD N  P      + S    THQ   TH+              L EF P +
Sbjct  106  SLMRDLGLHDDFN--PVSKPFSSSSQSDLTHQI--THNINNNNNNNNIHYSELAEFPPVT  161

Query  613  DFNFSQF--------------------------QGNINSFDENWSFGFDYIDELIQFAEC  714
             F  +QF                           G+ N  + NW+ GFDY+DELI+ AEC
Sbjct  162  SFESTQFAAADFGLLPDIPIYSSAAPPTSFEGLSGDAN--NNNWNVGFDYVDELIRLAEC  219

Query  715  FDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTRPA  864
            F++N++QL QVIL +LNQ+L S AG P++RAAF  +EALQSLLTGSTRP+
Sbjct  220  FETNSLQLGQVILARLNQRLRSPAGKPIQRAAFYFKEALQSLLTGSTRPS  269



>ref|XP_011099583.1| PREDICTED: scarecrow-like protein 15 [Sesamum indicum]
Length=524

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 119/209 (57%), Gaps = 33/209 (16%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTN--FEDWDSFMKELGLQD  504
            YEPKSVL+LRRSPSPV D K    G   V    LE AD+ L N   E WDS M+ELGL D
Sbjct  29   YEPKSVLDLRRSPSPVAD-KPVSTGPLPV----LEEADHELINQHLEGWDSLMRELGLHD  83

Query  505  DR-------NIKPDHNLLFTPSSESQTHQFE------FTHSLPEFVPSSDFN-----FSQ  630
            D        NI         P + S  +QF       F+   P +  ++  N      S 
Sbjct  84   DSPPDSKPVNIPCTTLPELPPVTSSFDNQFVSADFGLFSDIPPAYTTTTPLNHNSDAISS  143

Query  631  FQGNINSFDE----NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPL  798
            F+G    F+     NW+ GFDY+DELI+ AECF++N++QL  VIL +LNQ+LSS  G PL
Sbjct  144  FEGLSGDFNGGGAGNWNVGFDYVDELIRLAECFETNSLQLGHVILARLNQRLSSPTGKPL  203

Query  799  RRAAFLLQEALQSLLTGST----RPASSS  873
            +RAAF  +EALQSLL GST    RP SSS
Sbjct  204  QRAAFYFKEALQSLLAGSTLPDHRPVSSS  232



>ref|XP_002310797.1| hypothetical protein POPTR_0007s12480g [Populus trichocarpa]
 gb|EEE91247.1| hypothetical protein POPTR_0007s12480g [Populus trichocarpa]
Length=546

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 116/207 (56%), Gaps = 36/207 (17%)
 Frame = +1

Query  322  NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  501
            N  YEP SVL+LRRSPSP    K APA      +DP+E  D++L    DWDS M++L   
Sbjct  43   NLCYEPTSVLDLRRSPSPARAGKPAPA------NDPIEWDDHVLQTL-DWDSIMRDLDFH  95

Query  502  DDRNIKPDHNL-LFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQF--------------Q  636
            DD       N   F P SESQ      +H+LPEF  S   + +QF               
Sbjct  96   DDSAPALIKNFPQFGPCSESQIQ----SHNLPEFTASHQMDATQFLHSDFNDMYINSIPT  151

Query  637  GNINSFD---------ENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  789
             N+ S D          NW+ GFD+I ELI+ A+CFD+N +QLAQ IL +LN +L S  G
Sbjct  152  HNLTSLDLSHSFHNNIGNWNAGFDFIQELIKAADCFDTNELQLAQAILERLNHRLQSPIG  211

Query  790  NPLRRAAFLLQEALQSLL-TGSTRPAS  867
             PL+RAAF  ++ALQSLL TGSTRP +
Sbjct  212  KPLQRAAFFFKDALQSLLATGSTRPQT  238



>ref|XP_011025728.1| PREDICTED: scarecrow-like protein 15 [Populus euphratica]
Length=546

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 116/207 (56%), Gaps = 36/207 (17%)
 Frame = +1

Query  322  NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  501
            N  YEP SVL+LRRSPSP      A AG    ++DP+E  D++L    DWDS M++L   
Sbjct  43   NLCYEPTSVLDLRRSPSP------ARAGKPASANDPIEWDDHVLQTL-DWDSIMRDLDFH  95

Query  502  DDRNIKPDHNL-LFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQF--------------Q  636
            DD       N   F P SESQ      +H+LPEF  S   + +QF               
Sbjct  96   DDSAPALIKNFPQFGPCSESQIQ----SHNLPEFTASHQMDATQFLHSDFNDMYINSIPT  151

Query  637  GNINSFD---------ENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  789
             N+ S D          NW+ GFD+I ELI+ A+CFD+N +QLAQ IL +LN +L S  G
Sbjct  152  HNLTSLDLSHSFHNNIGNWNAGFDFIQELIKAADCFDTNELQLAQAILERLNHRLQSPIG  211

Query  790  NPLRRAAFLLQEALQSLL-TGSTRPAS  867
             PL+RAAF  +EALQSLL TGSTRP +
Sbjct  212  KPLQRAAFFFKEALQSLLATGSTRPQT  238



>ref|XP_010999954.1| PREDICTED: scarecrow-like protein 15 [Populus euphratica]
Length=554

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 113/207 (55%), Gaps = 36/207 (17%)
 Frame = +1

Query  322  NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  501
            N  YEP SVL+LRRSPSP      A AG      DP+   D++L    DWDS M+EL   
Sbjct  44   NSCYEPTSVLDLRRSPSP------ARAGKPASVTDPIGWEDHVLQTL-DWDSIMRELDFH  96

Query  502  DDRNIKPDHNL-LFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQF--------------Q  636
            DD      +N   F P SE Q H    +H+LPEF  S   + +QF               
Sbjct  97   DDSAPALINNFPQFGPCSEPQIH----SHNLPEFTASQQIDATQFLNSEFNDMYINSITT  152

Query  637  GNINSFD---------ENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  789
             N+ S D          NW+ G D+I ELI+ A+CFDSN +QLAQVIL +L+ +L S  G
Sbjct  153  HNLTSLDLSHSFHNNIGNWNAGSDFIRELIKAADCFDSNELQLAQVILERLSHRLQSPNG  212

Query  790  NPLRRAAFLLQEALQSLLT-GSTRPAS  867
             PL+RAAF  +EALQ LLT GSTRP +
Sbjct  213  KPLQRAAFFFKEALQCLLTSGSTRPQT  239



>ref|XP_006383233.1| scarecrow transcription factor family protein [Populus trichocarpa]
 gb|ERP61030.1| scarecrow transcription factor family protein [Populus trichocarpa]
Length=548

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 117/214 (55%), Gaps = 36/214 (17%)
 Frame = +1

Query  301  NWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSF  480
            ++N +  N  YEP SVL+LRRSPSP      A AG    + DP+E  D++L    DWDS 
Sbjct  37   SFNPSNRNLCYEPTSVLDLRRSPSP------ARAGKPASATDPIEWEDHVLQTL-DWDSI  89

Query  481  MKELGLQDDRNIKPDHNL-LFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQF--------  633
            M+EL   DD       N   F P SE Q      +H+LPEF  S   + +QF        
Sbjct  90   MRELDFHDDSAPALIKNFPQFGPCSEPQIQ----SHNLPEFTASQQIDATQFLNSEFNDM  145

Query  634  ------QGNINSFD---------ENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQ  768
                    N+ S D          NW+ G D+I ELI+ A+CFDSN +Q+AQVIL +LN 
Sbjct  146  YINSIPTHNLTSLDLSHSFHNNIGNWNAGSDFIQELIKAADCFDSNELQVAQVILERLNH  205

Query  769  KLSSAAGNPLRRAAFLLQEALQSLL-TGSTRPAS  867
            +  S  G PL+RAAF  +EALQSLL TGSTRP +
Sbjct  206  RHQSPNGKPLQRAAFFFKEALQSLLTTGSTRPQT  239



>gb|KDO36173.1| hypothetical protein CISIN_1g048701mg, partial [Citrus sinensis]
Length=520

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 119/231 (52%), Gaps = 46/231 (20%)
 Frame = +1

Query  316  AGNGWYEPKSVLELRRSPSPVLDQK--------AAPAGNFDVSDDP-LELADNLLTNFED  468
            + N  YEP SVLELRRSPSPV + +         A   + ++S DP +E  +++L    D
Sbjct  43   SSNKCYEPTSVLELRRSPSPVAENEKPATVASACATEISANISSDPSIEWEEHVLRTM-D  101

Query  469  WDSFMKELGLQD--------------DRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVP  606
            W+S MK+LGL D              D +++   NL  T S       + F  ++P+  P
Sbjct  102  WESAMKDLGLDDYYSSVPSNPTTSDPDPHLQIRQNLTLTDSVHLLDQSY-FNFNIPDICP  160

Query  607  SSD---------FNFSQFQGNINSFDENWS------------FGFDYIDELIQFAECFDS  723
            SS           NFS    + NS   N S            F FD+I EL++ A+CFDS
Sbjct  161  SSSQHDQGFIVGNNFSAVDVSSNSLVINASSSATGTNIVNVGFEFDFIQELLRAADCFDS  220

Query  724  NAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTRPASSSF  876
            N ++LAQ+IL +LNQ+L S AG PL RAAF  +EAL SLL G TRP   S 
Sbjct  221  NELRLAQIILARLNQRLRSPAGKPLERAAFFFKEALNSLLNGLTRPTCLSL  271



>ref|XP_012079070.1| PREDICTED: scarecrow-like protein 15 [Jatropha curcas]
 gb|KDP31796.1| hypothetical protein JCGZ_12257 [Jatropha curcas]
Length=523

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 93/229 (41%), Positives = 118/229 (52%), Gaps = 40/229 (17%)
 Frame = +1

Query  274  MKVPVASNEN-------------WNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFD  414
            MKVPV+S +N              ++   N  YEP SVL+LRRSPSP      A      
Sbjct  1    MKVPVSSPQNPKHTNIARNIAFHTDNTTPNLTYEPTSVLDLRRSPSP------ASGKPVS  54

Query  415  VSDDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLL-FTPSSESQTHQF---EFT  582
             +D  LE  +++L NF DWDS MKEL   +D    P         S ES  H     EFT
Sbjct  55   ATDHSLEWEEHVLQNF-DWDSIMKELDFHEDS--APTFKTFPQVGSCESIVHNQNLQEFT  111

Query  583  ---HSLPEFVPSSDFNFSQFQG----------NINSFDENWS-FGFDYIDELIQFAECFD  720
               H+ P     SDFN   F            +++    NW+ FG+D I E I+ A+C D
Sbjct  112  LPSHADPAQFLHSDFNDISFNVLPTQNLSTTLDLSHSTGNWNNFGYDLIQEFIRAADCID  171

Query  721  SNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTRPAS  867
            SN +QLA VIL +LN +L +  G PL+RAAF  +EALQSLLTGSTR  +
Sbjct  172  SNELQLAHVILDRLNHRLQAPVGKPLKRAAFFFKEALQSLLTGSTRSVT  220



>ref|XP_006425721.1| hypothetical protein CICLE_v10025246mg [Citrus clementina]
 ref|XP_006466756.1| PREDICTED: scarecrow-like protein 15-like [Citrus sinensis]
 gb|ESR38961.1| hypothetical protein CICLE_v10025246mg [Citrus clementina]
Length=578

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 119/231 (52%), Gaps = 46/231 (20%)
 Frame = +1

Query  316  AGNGWYEPKSVLELRRSPSPVLDQK--------AAPAGNFDVSDDP-LELADNLLTNFED  468
            + N  YEP SVLELRRSPSPV + +         A   + ++S DP +E  +++L    D
Sbjct  43   SSNKCYEPTSVLELRRSPSPVAENEKPATVASACATEISANISSDPSIEWEEHVLRTM-D  101

Query  469  WDSFMKELGLQD--------------DRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVP  606
            W+S MK+LGL D              D +++   NL  T S       + F  ++P+  P
Sbjct  102  WESAMKDLGLDDYYSSVPSNPTTSDPDPHLQIRQNLTLTDSVHLLDQSY-FNFNIPDICP  160

Query  607  SSDF---------NFSQFQGNINSFDENWS------------FGFDYIDELIQFAECFDS  723
            SS           NFS    + NS   N S            F FD+I EL++ A+CFDS
Sbjct  161  SSSQHDQGFIVGNNFSAVDVSSNSLVINASSSATGTNIVNVGFEFDFIQELLRAADCFDS  220

Query  724  NAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTRPASSSF  876
            N ++LAQ+IL +LNQ+L S AG PL RAAF  +EAL SLL G TRP   S 
Sbjct  221  NELRLAQIILARLNQRLRSPAGKPLERAAFFFKEALNSLLNGLTRPTCLSL  271



>ref|XP_007203757.1| hypothetical protein PRUPE_ppa003675mg [Prunus persica]
 gb|EMJ04956.1| hypothetical protein PRUPE_ppa003675mg [Prunus persica]
Length=557

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 121/207 (58%), Gaps = 34/207 (16%)
 Frame = +1

Query  322  NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSD--------DPLELADNLLTNFEDWDS  477
            N  YEP SVL+LR SPSPV +QK  PA    VSD        DPLE  +  L N  DWDS
Sbjct  43   NLCYEPTSVLDLRHSPSPVAEQK--PAKISAVSDVLSHSNHHDPLEWDEQALHNL-DWDS  99

Query  478  FMKELGLQDDRNIKPDHNLLFTPSSESQ-THQFEFTHSLPEFVPS----SDFNFS-----  627
             M++LGL DD       ++    S++SQ +H  ++ H  P F P+    SDFN +     
Sbjct  100  IMRDLGLHDDSVPNLKTSIPQLNSTDSQISHLSDYPHPQP-FDPTQLVHSDFNINLSEVY  158

Query  628  ---QFQGNINSFDE----NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  786
                F    ++F +    NW+ GFD+I+ELI+ A+CFDS+ +QLAQ IL +LNQ+L S++
Sbjct  159  STQNFTNTTHNFYDHQPGNWNVGFDFIEELIRAADCFDSDELQLAQGILDRLNQRLRSSS  218

Query  787  -----GNPLRRAAFLLQEALQSLLTGS  852
                 G PL+RAA   ++A+QS+L GS
Sbjct  219  PSKPVGKPLQRAAVYFRDAIQSILIGS  245



>ref|XP_002525108.1| DELLA protein GAIP-B, putative [Ricinus communis]
 gb|EEF37235.1| DELLA protein GAIP-B, putative [Ricinus communis]
Length=539

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 96/235 (41%), Positives = 123/235 (52%), Gaps = 46/235 (20%)
 Frame = +1

Query  274  MKVPVASNENWN-----------------------SAAGNGWYEPKSVLELRRSPSPVLD  384
            MKVPV+S++N N                       S+A N  YEP SVL+LRRSPSPV  
Sbjct  1    MKVPVSSSQNNNHRQSQSANLKNSTNSRNIGFHNSSSAPNLCYEPTSVLDLRRSPSPVSG  60

Query  385  QKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQT  564
            + A+   +       LE  +++L NF DWD  MKEL   +D +     N+    S ES  
Sbjct  61   KPASGPEH----HHSLEWDEHVLQNF-DWDFIMKELDFHED-STPTLKNIPQVNSCESII  114

Query  565  HQF----EFT----HSLPEFVPSSDFN---FSQFQGNINSFD-----ENWS-FGFDYIDE  693
            H      EFT    +  P  +   DFN   F+     +NS D      NWS FGFD I E
Sbjct  115  HSHNNLQEFTAPSNNDPPHLLHHPDFNDICFNIPTQKLNSLDLSHNIGNWSNFGFDLIQE  174

Query  694  LIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTR  858
            LI+ A+C DS+ +QLA VIL +LN +L S  G PL+RAAF  +EALQ+LL GS R
Sbjct  175  LIRAADCIDSSEIQLANVILDRLNHRLQSPVGKPLQRAAFFFKEALQNLLAGSPR  229



>ref|XP_007156910.1| hypothetical protein PHAVU_002G027500g [Phaseolus vulgaris]
 gb|ESW28904.1| hypothetical protein PHAVU_002G027500g [Phaseolus vulgaris]
Length=517

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 118/225 (52%), Gaps = 38/225 (17%)
 Frame = +1

Query  274  MKVPVASNENWNSAAGNG---------------WYEPKSVLELRRSPSPVLDQKAAPAGN  408
            M+VPV S+   N    N                 YEP SVL+L RSPSP  ++       
Sbjct  1    MRVPVPSSPQTNPKPTNNVVRTIALPNLNTTGLCYEPTSVLDLCRSPSPGSEKPTDHTVV  60

Query  409  FDVSDDPLELADNLLTNFEDWDSFMKELGLQDDRNIK-------PDHNLLFTPSSESQTH  567
               S D L+L D+ L N  DWDS MK+LGL DD           PD+N    P  +    
Sbjct  61   VTDSQDCLDLDDHALHNL-DWDSIMKDLGLHDDSGAHLLKTIPHPDNN--NNPCDDFTIA  117

Query  568  QFEFTHSLPEFVPSSD--------FNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDS  723
             FE  H+L EF   SD        F+F+    + ++   N   GFD+I+ELI+ A+CFD+
Sbjct  118  PFE--HAL-EFSTLSDIYSNQNLAFDFNHLVHDFSNHHHN--NGFDFIEELIRAADCFDT  172

Query  724  NAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTR  858
              + +AQVIL +LNQ+L S  G PL+RAAF  +EALQSLL+GS R
Sbjct  173  KQLHVAQVILERLNQRLRSPVGKPLQRAAFYFKEALQSLLSGSNR  217



>gb|EPS63021.1| hypothetical protein M569_11763 [Genlisea aurea]
Length=527

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 115/200 (58%), Gaps = 23/200 (12%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQ-KAAPAGNFDVSDDPLELADNLLT-NFEDWDSFMKELGL--  498
            YEPKSVLE+R SPSPV ++  +A AG+  V  +  E    L+    EDWD +M ELGL  
Sbjct  30   YEPKSVLEIRGSPSPVTEKPSSAAAGDSSVRPEGTESNHALMNPQVEDWD-WMTELGLND  88

Query  499  ------------QDDRNIKPDHNLLFTPSSESQTHQF---EFTHSLPEFVPSSDFNFSQF  633
                        +++       NL+  P+    + QF   EF   LP+F P+   +    
Sbjct  89   DDDDGSSSPVSRREELPAVQYQNLIDFPAGSFDSGQFPEMEFG-LLPDFPPAYGDSVEGL  147

Query  634  QGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAF  813
             G + +   NW+ GFD++DELI+ AECF++N+ QLA +IL +LN++L S AG PL+R AF
Sbjct  148  SGELAT--GNWNAGFDFVDELIRLAECFETNSAQLAHMILARLNERLRSPAGKPLQRIAF  205

Query  814  LLQEALQSLLTGSTRPASSS  873
              +EALQSLLT +   ++ S
Sbjct  206  YFKEALQSLLTAAPHASAGS  225



>ref|XP_003517241.1| PREDICTED: scarecrow-like protein 15-like [Glycine max]
Length=525

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 119/218 (55%), Gaps = 30/218 (14%)
 Frame = +1

Query  262  ILREMKVPVASNENWNSAAGNG-WYEPKSVLELRRSPSPVLDQKAAPAGNFDV----SDD  426
            ++R + +P   N N ++    G  YEP SVL+L RSPSP  ++   P  +  V    S D
Sbjct  19   VVRTIALP---NLNNSTTPPTGLCYEPTSVLDLCRSPSPGTEK---PTTDHSVLVTNSQD  72

Query  427  PLELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLF-----------TPSSESQTHQF  573
             L+L D+ L N  DWDS MK+LGL DD         L             PS +  T   
Sbjct  73   YLDLEDHALHNL-DWDSIMKDLGLHDDSATPVLKTFLHPDDDDDDDNNNNPSCDDFT---  128

Query  574  EFTHSLPEFVPSSDFNFSQ---FQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQ  744
             F H+L EF   SD   +Q   F  N    D N   GFD+I+ELI+ A+CFD+  + +AQ
Sbjct  129  LFDHAL-EFTTLSDIYSNQNFAFDFNHLPHDFNHLNGFDFIEELIRAADCFDTKQLHVAQ  187

Query  745  VILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTR  858
            +IL +LNQ+L S  G PL RAAF L+EALQSLL+GS R
Sbjct  188  LILERLNQRLRSPVGKPLHRAAFYLKEALQSLLSGSNR  225



>ref|XP_008241642.1| PREDICTED: scarecrow-like protein 15 [Prunus mume]
Length=561

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 120/207 (58%), Gaps = 34/207 (16%)
 Frame = +1

Query  322  NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSD--------DPLELADNLLTNFEDWDS  477
            N  YEP SVL+L  SPSPV +QK  PA    VSD        DPLE  +  L N  DWDS
Sbjct  42   NLCYEPTSVLDLCHSPSPVAEQK--PAKISAVSDVLSHSNHHDPLEWDEQALHNL-DWDS  98

Query  478  FMKELGLQDDRNIKPDHNLLFTPSSESQ-THQFEFTHSLPEFVPS----SDFNFS-----  627
             M++LGL DD       ++    S++SQ +H  ++ H  P F P+    SDFN +     
Sbjct  99   IMRDLGLHDDSVPNLKTSIPQLNSTDSQISHLSDYPHPQP-FDPTQLVHSDFNINLSEVY  157

Query  628  ---QFQGNINSFDE----NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  786
                F    ++F +    NW+ GFD+I+ELI+ A+CFDS+ +QLAQ IL +LNQ+L S++
Sbjct  158  STQNFTNATHNFYDHQPGNWNVGFDFIEELIRAADCFDSDELQLAQGILDRLNQRLRSSS  217

Query  787  -----GNPLRRAAFLLQEALQSLLTGS  852
                 G PL+RAA   ++ALQS+L GS
Sbjct  218  PSKPVGKPLQRAAVYFRDALQSILNGS  244



>ref|XP_002268445.1| PREDICTED: scarecrow-like protein 15 [Vitis vinifera]
Length=538

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 110/208 (53%), Gaps = 31/208 (15%)
 Frame = +1

Query  322  NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELA--------DNLLTNFEDWDS  477
            N  YEP SVL+LRRSPSPV D+ A   G   VSD  L L+        D+ + N +DWD 
Sbjct  38   NVCYEPTSVLDLRRSPSPVADKAATFPGITAVSDVSLPLSEEPGFQWEDHGMHNLDDWDP  97

Query  478  FMKELGLQDDR--------NIKP--------DHNLLFTPSSESQTHQFEFTHSLPEFVPS  609
             + +  L+DD          + P            L        T    F  +L E   +
Sbjct  98   TVWDFVLRDDSAPVFGSVPQLGPCDPQFPHLPLPDLPPSQPIYHTQLLPFDFTLSEISSN  157

Query  610  SDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  789
             + NF     N+NSF  +W+ G ++++ELI+ AECF SN  QLAQ IL +LNQ+L +  G
Sbjct  158  QNHNF-----NLNSF--HWNVGSEFVEELIRAAECFGSNNSQLAQAILARLNQRLRAPVG  210

Query  790  NPLRRAAFLLQEALQSLLTGSTRPASSS  873
             PL+RAAF  +EAL SLLTGS R + SS
Sbjct  211  KPLQRAAFYFKEALHSLLTGSNRKSHSS  238



>emb|CBI17555.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 110/208 (53%), Gaps = 31/208 (15%)
 Frame = +1

Query  322  NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELA--------DNLLTNFEDWDS  477
            N  YEP SVL+LRRSPSPV D+ A   G   VSD  L L+        D+ + N +DWD 
Sbjct  69   NVCYEPTSVLDLRRSPSPVADKAATFPGITAVSDVSLPLSEEPGFQWEDHGMHNLDDWDP  128

Query  478  FMKELGLQDDR--------NIKP--------DHNLLFTPSSESQTHQFEFTHSLPEFVPS  609
             + +  L+DD          + P            L        T    F  +L E   +
Sbjct  129  TVWDFVLRDDSAPVFGSVPQLGPCDPQFPHLPLPDLPPSQPIYHTQLLPFDFTLSEISSN  188

Query  610  SDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  789
             + NF     N+NSF  +W+ G ++++ELI+ AECF SN  QLAQ IL +LNQ+L +  G
Sbjct  189  QNHNF-----NLNSF--HWNVGSEFVEELIRAAECFGSNNSQLAQAILARLNQRLRAPVG  241

Query  790  NPLRRAAFLLQEALQSLLTGSTRPASSS  873
             PL+RAAF  +EAL SLLTGS R + SS
Sbjct  242  KPLQRAAFYFKEALHSLLTGSNRKSHSS  269



>ref|XP_006297491.1| hypothetical protein CARUB_v10013509mg [Capsella rubella]
 gb|EOA30389.1| hypothetical protein CARUB_v10013509mg [Capsella rubella]
Length=501

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 103/180 (57%), Gaps = 18/180 (10%)
 Frame = +1

Query  334  EPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLE--LADNLLTNFEDWDSFMKELGLQDD  507
            EP SVL+LRRSPSP   ++  P GN + +  P+E     + +    DWDS MKEL L DD
Sbjct  22   EPTSVLDLRRSPSPATAEEK-PVGNNNTNQFPIEDDHHHHHVMRSMDWDSIMKELELDDD  80

Query  508  RNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQFQGNINSFDEN---WSFGF  678
                       TP+ +S    F  +  LP F     F+  +F G+ + F +N      GF
Sbjct  81   S----------TPTLKSNFPTFAISPPLPVF--PDQFHPPEFPGHGHGFIDNNNEGGGGF  128

Query  679  DYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTR  858
            D++++LI+   C DS+ +QLAQVIL +LNQ+L S  G PL RAAF  +EAL SL+TG+ R
Sbjct  129  DFVEDLIRVVNCVDSDELQLAQVILSRLNQRLRSPTGRPLERAAFYFKEALGSLITGTNR  188



>ref|XP_008363118.1| PREDICTED: scarecrow-like protein 15 [Malus domestica]
Length=543

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 117/208 (56%), Gaps = 39/208 (19%)
 Frame = +1

Query  325  GWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSD-------DPLELADNLLTNFEDWDSFM  483
            G YEP SVL+LR SPSPV  +K  P+    +SD       DP+E  + +     DWDS M
Sbjct  38   GGYEPTSVLDLRHSPSPVSAEK--PSKILAISDVLSHSNHDPVEWEEQV-----DWDSIM  90

Query  484  KELGLQDDRNIKPDHNLLFTPSSESQTHQF-EFTHSLPEFVPS----SDF--NFSQFQGN  642
            K+LGL DD N+    N +  P   S   Q  E+ H  P F P+    SD+  N S+   +
Sbjct  91   KDLGLHDD-NVPNLKNSI--PQLNSNDPQISEYLHPQP-FDPTQLVHSDYSINLSEVYSS  146

Query  643  INSFDE---------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA---  786
             N +D          NW+ G D+I+ELI+ A+CFDS+ +QLAQVIL +LN ++ S++   
Sbjct  147  QNCYDHAINDFHQSGNWNVGVDFIEELIRAADCFDSDELQLAQVILDRLNNRMRSSSPSK  206

Query  787  --GNPLRRAAFLLQEALQSLLTGSTRPA  864
              G PL+RAA   ++ALQSLL GS   A
Sbjct  207  PVGKPLQRAAVYFKDALQSLLNGSDTAA  234



>ref|XP_010467682.1| PREDICTED: scarecrow-like protein 15 [Camelina sativa]
Length=501

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 112/198 (57%), Gaps = 19/198 (10%)
 Frame = +1

Query  274  MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDD-PLELADNL  450
            M+VP +S+   NS     + EP SVL+LRRSPSP      A      VSD  PL+  D++
Sbjct  1    MRVPASSDTTSNSNL-VCFNEPTSVLDLRRSPSP----STAEEKPLLVSDQFPLDDDDHV  55

Query  451  LTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVP--SSDFNF  624
            + +  DWDS MKEL L DD N+KP+      PSS      F  T   P  +P      + 
Sbjct  56   MRSM-DWDSIMKELDLDDD-NLKPNF-----PSSP----HFAATAVDPPLLPIFPDQLHP  104

Query  625  SQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRR  804
             +F G+   F+     G D++++LI+   C DS+ +QLAQVIL +LNQ+L S  G PL R
Sbjct  105  PEFPGHGYGFNNEGGGGLDFVEDLIRVVNCVDSDELQLAQVILSRLNQRLRSPTGRPLER  164

Query  805  AAFLLQEALQSLLTGSTR  858
            AAF  +EAL SL+TG+ R
Sbjct  165  AAFYFKEALGSLITGTNR  182



>ref|XP_003538842.1| PREDICTED: scarecrow-like protein 15-like [Glycine max]
Length=516

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 107/186 (58%), Gaps = 20/186 (11%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDP-LELADNLLTNFEDWDSFMKELGLQDD  507
            YEP SVL+L RSPSP      +P      +D   L+L D+ L N  DWDS MK+LGL DD
Sbjct  41   YEPTSVLDLCRSPSP------SPGTEKPTNDHAVLDLDDHALHNL-DWDSIMKDLGLHDD  93

Query  508  RNIKPDHNLLF------TPSSESQT---HQFEFTHSLPEFVPSSDFNFSQFQGNINSFDE  660
                     L        PS +  T   H  EFT SL +   + +  F  F    + F+ 
Sbjct  94   SATPVLKTFLHPDDDNNNPSCDDFTPFDHALEFT-SLSDIYSNQNLAF-DFNHLPHDFNH  151

Query  661  NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSL  840
            + + GFD+I+ELI+ A+CFD+  + +AQVIL +LNQ+L S  G PL+RAAF  +EALQSL
Sbjct  152  HLN-GFDFIEELIRAADCFDTKQLHVAQVILERLNQRLRSPVGKPLQRAAFYFKEALQSL  210

Query  841  LTGSTR  858
            L+GS R
Sbjct  211  LSGSNR  216



>ref|XP_008393455.1| PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 15 [Malus 
domestica]
Length=548

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 112/207 (54%), Gaps = 32/207 (15%)
 Frame = +1

Query  325  GWYEPKSVLELRRSPSPVLDQK-----AAPAGNFDVSDDPLELADNLLTNFEDWDSFMKE  489
            G YEP SVL+LR SPSPV  +K     A P      + DPLE  +  + +  DWDS M++
Sbjct  38   GGYEPTSVLDLRHSPSPVSAEKPSKISAIPDVLSHSNHDPLEWEEEQVLHNLDWDSIMRD  97

Query  490  LGLQDDR--NIKPDHNLLFTPSSESQTHQF-EFTHSLP----EFVPSS-DFNFSQFQGNI  645
            LGL D+   N+K        P   +   Q  E+ H  P    + V S  D N S+   + 
Sbjct  98   LGLHDENVPNLKTS-----IPQLNANDPQISEYPHPQPFDATQLVHSDWDINLSEVYSSQ  152

Query  646  NSFDE---------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA----  786
            N +D          NW+ G D+I+ELI+ A+CFD++ +QLAQVIL +LN +L S++    
Sbjct  153  NCYDHVTNDFHQSGNWNVGLDFIEELIRAADCFDTDELQLAQVILDRLNNRLRSSSPSKP  212

Query  787  -GNPLRRAAFLLQEALQSLLTGSTRPA  864
             G PL+R A   +EALQSLL GS   A
Sbjct  213  VGKPLQRVAVYFKEALQSLLNGSDTAA  239



>ref|XP_010531168.1| PREDICTED: scarecrow-like protein 15 [Tarenaya hassleriana]
Length=547

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 109/207 (53%), Gaps = 27/207 (13%)
 Frame = +1

Query  307  NSAAGNGWYEPKSVLELRRSPSPVLDQKAAP----------AGNFDVSDDPLELADNLLT  456
            N+    G+ EP SVL+LR SPSP    +  P           GN     +   L D+++ 
Sbjct  39   NAGRTLGFGEPTSVLDLRGSPSPAAIAEKPPVEVASLVSVGGGNTGQVSEQFPLDDHVMR  98

Query  457  NFEDWDSFMKELGLQDDRN--IKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQ  630
            +  DWDS M+EL L DD    +K        P+      Q    H  P+ +   DF  S+
Sbjct  99   SM-DWDSIMRELELDDDSAPALKTSFAAAAVPTHYGVDSQL---HGFPDQLHPVDFGSSE  154

Query  631  -FQGN-------INSFDENWSF---GFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLS  777
             + GN       +NS D +  F   GFD+I++LI+  +C  S  +QLAQV+L +LNQ+L 
Sbjct  155  VYSGNPVGVGYGLNSVDGSDGFVNGGFDFIEDLIRVVDCVQSEELQLAQVVLARLNQRLR  214

Query  778  SAAGNPLRRAAFLLQEALQSLLTGSTR  858
            S +G PL+RAAF  +EAL S+LTGSTR
Sbjct  215  SPSGRPLQRAAFYFKEALGSVLTGSTR  241



>ref|XP_007046999.1| GRAS family transcription factor, putative [Theobroma cacao]
 gb|EOX91156.1| GRAS family transcription factor, putative [Theobroma cacao]
Length=684

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 81/205 (40%), Positives = 115/205 (56%), Gaps = 30/205 (15%)
 Frame = +1

Query  286  VASNENWNSAAG--NGWYEPKSVLELRRSPSPVLDQKAAPAGNFD--VSDDPL-------  432
            +A N +++   G     YEP SVL+ RRSPSPV ++    + +    +S DP        
Sbjct  29   IARNISFHGLNGVQTSCYEPTSVLDPRRSPSPVPEKPVTNSVDVSNCISSDPHHHQAPSP  88

Query  433  ELADNLLTNFEDWDSFMKELGLQDDRNIKPDHNL---LFTPSSESQTHQFEFTHSLPEFV  603
            E  + +L N  DWDS MK+LGL DD ++ P   +   + +P  E+Q        SLPEF 
Sbjct  89   EWGEYVLRNM-DWDSIMKDLGL-DDESVPPIKTINPQVISPC-ENQIQ------SLPEFT  139

Query  604  PSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSA  783
             S +        + N+  + +S      +ELI+ A+CFD++ +QLA VIL +LNQ+L S 
Sbjct  140  -SCELTHQSVHSDFNNLYDFYS------EELIRAADCFDTHELQLAHVILARLNQRLRSP  192

Query  784  AGNPLRRAAFLLQEALQSLLTGSTR  858
            +G PL+RAAF   EALQSL TGSTR
Sbjct  193  SGKPLQRAAFYFNEALQSLFTGSTR  217



>ref|XP_010099836.1| hypothetical protein L484_009050 [Morus notabilis]
 gb|EXB80596.1| hypothetical protein L484_009050 [Morus notabilis]
Length=557

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 111/224 (50%), Gaps = 51/224 (23%)
 Frame = +1

Query  322  NGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  501
            N  YEP SVL+LRRSPSPV  + A P       +D LE  +    ++ DWDS M+ELGL 
Sbjct  48   NLCYEPTSVLDLRRSPSPVGGKPAQP-------NDSLEWEEQF--HYLDWDSLMRELGLH  98

Query  502  DDRNIKPDHNLLFTPSSESQTHQFEFT---HSLPEF-----------------VPSSDFN  621
            DD    P      T ++ S  HQ       H +P F                     + N
Sbjct  99   DDS--APAFKTATTNTTNSFAHQLNPNCDPHIIPHFSELISHHQPFDPTQLVHHHHHNLN  156

Query  622  FSQFQ---GNINSFDE----------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQL  762
            FS+      N+N FD           N + GFD++++LI+ A+CFDS+  QLAQ IL +L
Sbjct  157  FSEINLGDHNLNLFDTTSSGEFHNRGNINVGFDFVEDLIRVADCFDSDNSQLAQAILDRL  216

Query  763  NQKLSS-------AAGNPLRRAAFLLQEALQSLLTGSTRPASSS  873
            NQ+L S         G  L+RAA   ++ALQSLL+GS R A  S
Sbjct  217  NQRLRSNTSPVGKPVGRALQRAALYFKDALQSLLSGSNRTARLS  260



>ref|XP_006409136.1| hypothetical protein EUTSA_v10023133mg [Eutrema salsugineum]
 gb|ESQ50589.1| hypothetical protein EUTSA_v10023133mg [Eutrema salsugineum]
Length=516

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 116/216 (54%), Gaps = 28/216 (13%)
 Frame = +1

Query  274  MKVPVASNE-NWNSAAGN--GWYEPKSVLELRRSPSPVL--DQKAAPAGNFDVSDDPLEL  438
            M+V  +S+  N NS   N  G+ EP SVL+LRRSPSP    ++    A      D+   L
Sbjct  1    MRVSASSDTTNSNSGGRNLAGYNEPTSVLDLRRSPSPAAAEEKPVISAAEITGGDNQFPL  60

Query  439  ADNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDF  618
             D+++ +  DWDS MKEL L DD       N L    S + +  F     LP F      
Sbjct  61   DDHVMRSM-DWDSIMKELELDDDSAPNLKSNFL----SSAISPHFAVDQQLPGF--PDQL  113

Query  619  NFSQFQG-NINSFDENWSFG---------------FDYIDELIQFAECFDSNAVQLAQVI  750
            + ++F+  ++    + + F                FD+I++LI+  +C +S+ +QLAQV+
Sbjct  114  HPAEFRSSDVYPGGQGYGFESSNNNNNNEGSVNGGFDFIEDLIRVVDCVESDELQLAQVV  173

Query  751  LPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTR  858
            L +LNQ+L S AG PL+RAAF  +EAL S+L+GSTR
Sbjct  174  LSRLNQRLRSPAGRPLQRAAFYFKEALGSVLSGSTR  209



>gb|KJB17813.1| hypothetical protein B456_003G016500 [Gossypium raimondii]
Length=533

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 102/180 (57%), Gaps = 18/180 (10%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKA---APAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  501
            YEP SVLELRRSPSP  D                 PLE  +++L N  DWDS MK+LGL 
Sbjct  45   YEPTSVLELRRSPSPGHDNPVDHHQHQQQQQQHQAPLEWDEHVLRNM-DWDSIMKDLGLD  103

Query  502  DD-----RNIKPDHNLL-----FTPSSESQTHQFEFTHSLPEFVPSSDFNFSQFQG-NIN  648
            D+     + I P  N +     FT  S   TH  EF ++L +F PS + + S       N
Sbjct  104  DESVPSIKTIPPQENHIQNLPEFT--SCELTHPTEF-NNLYDFYPSHNIDISNTTTYGFN  160

Query  649  SFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEA  828
            +     + GFD+I+EL++ A+CFD+  +QLAQVIL +L Q+L S +G PL+RAAF  +EA
Sbjct  161  NMGNFINSGFDFIEELVRAADCFDTQELQLAQVILARLGQRLRSPSGKPLQRAAFYFKEA  220



>ref|XP_008453725.1| PREDICTED: scarecrow-like protein 15 [Cucumis melo]
Length=533

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 110/199 (55%), Gaps = 29/199 (15%)
 Frame = +1

Query  310  SAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDD-----PLELADNLLTNFEDWD  474
            S A    YEP SVL+LRRSPSPV     AP      SDD     PL+  +  L N  DWD
Sbjct  39   STAATTCYEPTSVLDLRRSPSPV-----APDNPLSSSDDRHNNHPLDWDEQALHNL-DWD  92

Query  475  SFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSL----------PEFVPSSDF-N  621
            S M +LGL DD N    +N     + +   H  EF HS           P+F  S  F N
Sbjct  93   SIMGDLGLHDDSNSSLKNNT----NHDHVPHFPEFLHSQSLDQTSHLLPPDFFLSEPFSN  148

Query  622  FS-QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL-SSAAGNP  795
             S     + NSF+ N +   D++++L+  A+CFDSN  QLA VIL +LNQ+L S+++ NP
Sbjct  149  HSPTILQSFNSFNPN-NPSLDFLEDLVAAADCFDSNDFQLAHVILERLNQRLQSTSSTNP  207

Query  796  LRRAAFLLQEALQSLLTGS  852
            L RAAF  +EALQSLL+ S
Sbjct  208  LHRAAFFFKEALQSLLSPS  226



>ref|XP_004300613.1| PREDICTED: scarecrow-like protein 15 [Fragaria vesca subsp. vesca]
Length=552

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 113/213 (53%), Gaps = 41/213 (19%)
 Frame = +1

Query  322  NGWYEPKSVLELRRSPSPVLDQKAAPAGNF-DV---SDDPLELADNLLTNFEDWDSFMKE  489
            N  YEP SVL+LR SPSPV   K +      DV    D PLE  + +     DWDS M++
Sbjct  39   NLCYEPTSVLDLRHSPSPVAADKPSKVSPISDVLTHHDQPLEWDEQV-----DWDSIMRD  93

Query  490  LGLQDDR--NIKPDHNLLFTPS----SESQTHQF-EFTHSLPEFVPS----SDFNFSQF-  633
            LGL DD   N+K         +    SE Q H   E+ H  P F P+    SDF+ S+  
Sbjct  94   LGLHDDSVPNLKATTTTNTHLNHHHNSEPQIHHLPEYPHPQP-FDPTQLVHSDFSLSEVY  152

Query  634  ------QGNINSFDE-------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  774
                    N+ S+D+       N + GFD+I+ELI+ A+CFDS+ + LAQVIL +LNQ+ 
Sbjct  153  SSQNFSHHNLTSYDQTDTHPSLNSNVGFDFIEELIRAADCFDSDELNLAQVILDRLNQRQ  212

Query  775  ------SSAAGNPLRRAAFLLQEALQSLLTGST  855
                  S   G PL+RAA   ++ALQSLL  ST
Sbjct  213  RLISPNSKPVGKPLQRAAVYFKDALQSLLNTST  245



>ref|XP_010489558.1| PREDICTED: scarecrow-like protein 15 [Camelina sativa]
Length=506

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 111/199 (56%), Gaps = 18/199 (9%)
 Frame = +1

Query  274  MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDD-PLELADNL  450
            M+VP +S+ N NS     + EP SVL+LRRSPSP      A      VSD  PL+  D+ 
Sbjct  1    MRVPASSDTNSNSNL-VCFNEPTSVLDLRRSPSP--SPSTAEEKPLLVSDQFPLDDDDHG  57

Query  451  LTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVP--SSDFNF  624
            +    DWDS MKEL L DD N+KP+      PSS   +     T + P  +P      + 
Sbjct  58   MRCSMDWDSIMKELDLDDD-NLKPNF-----PSSPHFS-----TAADPPLLPIFPDQLHP  106

Query  625  SQF-QGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLR  801
             +F  G+   F+     G D++++LI+     DS+ +QLAQVIL +LNQ+L S  G PL 
Sbjct  107  PEFPAGHGYGFNNEGGGGLDFVEDLIRVVNYVDSDELQLAQVILSRLNQRLRSPTGRPLE  166

Query  802  RAAFLLQEALQSLLTGSTR  858
            RAAF  +EAL SL+TG+ R
Sbjct  167  RAAFYFKEALGSLITGTNR  185



>gb|KGN53268.1| GRAS family transcription factor [Cucumis sativus]
Length=532

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 105/183 (57%), Gaps = 11/183 (6%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQDDR  510
            YEP SVL+LRRSPSPV       + +   ++ PL+  +  L N  DWDS M +LGL DD 
Sbjct  47   YEPTSVLDLRRSPSPVAPDNPLSSADDRHNNHPLDWDEQALHNL-DWDSIMGDLGLHDDS  105

Query  511  N--IKPDHNLLFTPSSESQTHQFEFTHSL----PEFVPSSDFNFS--QFQGNINSFDENW  666
            N  +K + N    P      H     H+     P+F  S  F+        + NSF+ N 
Sbjct  106  NSSLKNNTNHDHVPHFPEFLHSQSLDHTSHLLPPDFFLSEPFSNHPPTVLQSFNSFNPN-  164

Query  667  SFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL-SSAAGNPLRRAAFLLQEALQSLL  843
            +   D++++LI  A+CFDSN  QLA VIL +LNQ+L S+++ NPL RAAF  +EALQSLL
Sbjct  165  NPSLDFLEDLIAAADCFDSNDFQLAHVILERLNQRLQSTSSTNPLHRAAFFFKEALQSLL  224

Query  844  TGS  852
            + S
Sbjct  225  SPS  227



>ref|XP_004509243.1| PREDICTED: scarecrow-like protein 15-like [Cicer arietinum]
Length=531

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 103/201 (51%), Gaps = 39/201 (19%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQDD-  507
            YEP+SVLEL RSPSP    +  P    +V +D   L      N + WDS MK+LGLQDD 
Sbjct  40   YEPRSVLELCRSPSP----EKKPTQQEEVEEDHASLP-----NLDWWDSIMKDLGLQDDS  90

Query  508  ---------RNIK---------------PDHNLLFTPSSESQTHQFEFTHSLPEFVPSSD  615
                      NI                P H+    P   +         +L    P+++
Sbjct  91   STPIPLLKNTNINTHETSNPCIPEIYPNPSHDQFDQPQDFTTLSDIYSNQNLAYNYPNTN  150

Query  616  FNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNP  795
             N      + N+ + NW    D+I+ELI+ A+CFD++ +QLAQ IL +LNQ+L S  G P
Sbjct  151  TNLDHLVNDFNN-NSNW----DFIEELIRAADCFDNSHLQLAQAILERLNQRLRSPTGKP  205

Query  796  LRRAAFLLQEALQSLLTGSTR  858
            L RAAF  ++ALQSLL+GS R
Sbjct  206  LHRAAFHFKDALQSLLSGSNR  226



>gb|EPS73060.1| hypothetical protein M569_01698, partial [Genlisea aurea]
Length=492

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 114/202 (56%), Gaps = 30/202 (15%)
 Frame = +1

Query  334  EPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDS-FMKELGLQDDR  510
            EPKSVLEL+ SP    D++      F+V  + L+L D+L    +DW S +M ELGL  D 
Sbjct  1    EPKSVLELKGSPKLDSDRR------FEV--ETLQLEDHL--EVDDWGSCWMGELGLLKDD  50

Query  511  NIKPDHNLLFTPS------SESQTHQFEFTHSL-PEFVPSSDFNFS-QFQGNINSFDE--  660
              + +              +E++   +EF  S   E  P +DF FS  + G + S +   
Sbjct  51   EEEEEEEEDDDSGFSKCFPAENRQIVYEFPASFDSEQFPGADFEFSPGYGGAVGSLEGFA  110

Query  661  ------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQ  822
                  NW+ G DY+D+LI+ AECFD +++Q+ +VIL +LN++L S AG PL+RAAF  +
Sbjct  111  GDLVAGNWNVGLDYVDDLIRLAECFDGDSLQVREVILGRLNERLRSPAGKPLQRAAFYFK  170

Query  823  EALQSLLTG---STRPASSSFE  879
            EA+QS+LT    + R A+ S E
Sbjct  171  EAIQSILTAMAPAVRRAAGSSE  192



>ref|XP_009114695.1| PREDICTED: scarecrow-like protein 15 [Brassica rapa]
Length=491

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 106/199 (53%), Gaps = 20/199 (10%)
 Frame = +1

Query  274  MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLL  453
            M+VP +S+ N        + EP SVL LRRSP+P   ++          D+     D+ +
Sbjct  1    MRVPASSDSNSGGKNLVVYDEPTSVLGLRRSPTPTTVEEKPLVSAASGGDNQFPSDDHAM  60

Query  454  TNFEDWDSFMKELGLQDDR--NIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFS  627
             +  DWDS M+EL L DD   N+KP+    F P +    H       LP F      N +
Sbjct  61   RSM-DWDSIMRELELDDDSTPNLKPN----FPPPA----HFAVVDPPLPGF--PDQLNPA  109

Query  628  QFQGNINSFDEN--WSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLR  801
            ++      +D N     GFD I++LI+  +C DS+ +Q AQVIL +LNQ+L S AG PL 
Sbjct  110  EY-----GYDNNNEGGGGFDIIEDLIRVVDCVDSDELQHAQVILSRLNQRLRSPAGRPLL  164

Query  802  RAAFLLQEALQSLLTGSTR  858
            RAAF  +EAL SLL+GS R
Sbjct  165  RAAFYFKEALGSLLSGSNR  183



>ref|XP_004146541.1| PREDICTED: scarecrow-like protein 15 isoform X1 [Cucumis sativus]
 gb|KGN53267.1| hypothetical protein Csa_4G043830 [Cucumis sativus]
Length=508

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 118/210 (56%), Gaps = 22/210 (10%)
 Frame = +1

Query  274  MKVPVASNENWN--SAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADN  447
            M+VPV ++++ +  S+      EP SVL+LRR+PSPV         +   ++ PL+  + 
Sbjct  1    MRVPVPNHQSSSLPSSTPKLHSEPTSVLDLRRTPSPVAPDNPLSVAHDRHNNHPLDWDEQ  60

Query  448  LLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQF-EFTHSL----------P  594
             L N  DWDS M +LGL DD N    +N     ++  +   F EF HS           P
Sbjct  61   ALHNL-DWDSIMGDLGLHDDSNSSLQNN-----TNHDRVPNFPEFLHSQSLDQTSHLLPP  114

Query  595  EFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  774
            +F  S  F+ +     + SF+ N +   D+ ++L+  A+CFDSN  QLA VIL +LNQ+L
Sbjct  115  DFFLSEPFS-NHSPTILQSFNSN-NPSLDFFEDLVAAADCFDSNDFQLAHVILERLNQRL  172

Query  775  -SSAAGNPLRRAAFLLQEALQSLLTGSTRP  861
             S+++  PL RAAF ++EALQSLL+ ST P
Sbjct  173  QSTSSAKPLHRAAFFIKEALQSLLSPSTNP  202



>ref|XP_004146542.2| PREDICTED: scarecrow-like protein 15 isoform X2 [Cucumis sativus]
Length=507

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 118/209 (56%), Gaps = 23/209 (11%)
 Frame = +1

Query  274  MKVPVASNENWN--SAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADN  447
            M+VPV ++++ +  S+      EP SVL+LRR+PSPV         +   ++ PL+  + 
Sbjct  1    MRVPVPNHQSSSLPSSTPKLHSEPTSVLDLRRTPSPVAPDNPLSVAHDRHNNHPLDWDEQ  60

Query  448  LLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQF-EFTHSL----------P  594
             L N  DWDS M +LGL DD N    +N     ++  +   F EF HS           P
Sbjct  61   ALHNL-DWDSIMGDLGLHDDSNSSLQNN-----TNHDRVPNFPEFLHSQSLDQTSHLLPP  114

Query  595  EFVPSSDF-NFS-QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQ  768
            +F  S  F N S     + NSF+ N +   D++++LI  A+CFDSN  QLA VIL +LNQ
Sbjct  115  DFFLSEPFSNHSPTILQSFNSFNPN-NPSLDFLEDLIAAADCFDSNDFQLAHVILERLNQ  173

Query  769  KL-SSAAGNPLRRAAFLLQEALQSLLTGS  852
            +L S+++ NPL RAAF  +EALQSLL+ S
Sbjct  174  RLQSTSSTNPLHRAAFFFKEALQSLLSPS  202



>emb|CDY43895.1| BnaA07g01720D [Brassica napus]
Length=491

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 105/199 (53%), Gaps = 20/199 (10%)
 Frame = +1

Query  274  MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLL  453
            M+VP +S+ N        + EP SVL LRRSP+P   ++          D+     D+ +
Sbjct  1    MRVPASSDSNSGGKNLVVYDEPTSVLGLRRSPTPTTVEEKPLVSAASGGDNQFPSDDHAM  60

Query  454  TNFEDWDSFMKELGLQDDR--NIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFS  627
             +  DWDS M+EL L DD   N+KP+    F P +    H       LP F      N +
Sbjct  61   RSM-DWDSIMRELELDDDSTPNLKPN----FPPPA----HFAVVDPPLPVF--PDQLNPA  109

Query  628  QFQGNINSFDEN--WSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLR  801
            ++      +D N     GFD I++LI+  +C DS+ +Q A VIL +LNQ+L S AG PL 
Sbjct  110  EY-----GYDNNNEGGGGFDIIEDLIRVVDCVDSDELQHAHVILSRLNQRLRSPAGRPLL  164

Query  802  RAAFLLQEALQSLLTGSTR  858
            RAAF  +EAL SLL+GS R
Sbjct  165  RAAFYFKEALGSLLSGSNR  183



>ref|XP_003629479.1| GRAS family transcription factor [Medicago truncatula]
 gb|AET03955.1| GRAS family transcription factor [Medicago truncatula]
Length=542

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 112/201 (56%), Gaps = 33/201 (16%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNL-LTNFEDWDSFMKELGLQDD  507
            YEP+SVLEL RSPSP    +  P+      +  +E  D+  L N + WDS MK+LGLQDD
Sbjct  45   YEPRSVLELCRSPSP----EKKPSQQEQEHNPEVEQEDHASLPNLDWWDSIMKDLGLQDD  100

Query  508  RNIKPDHNLLFTPSSESQTH------QFEFTHSLPEFVPSSD---------FNFSQFQGN  642
             +  P   LL   ++ S+ +      QF+ T    +F   SD         +N+     N
Sbjct  101  SS-TPIIPLLKNTNNTSEIYPNPSQDQFDQTQ---DFTSLSDIYSNNQNLAYNYPNTNTN  156

Query  643  INSF---------DENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNP  795
            ++           + N +  +D+I+ELI+ A+CFD+N +QLAQ IL +LNQ+L S  G P
Sbjct  157  LDHLVNDFNNNQPNNNTNSNWDFIEELIRAADCFDNNHLQLAQAILERLNQRLRSPTGKP  216

Query  796  LRRAAFLLQEALQSLLTGSTR  858
            L RAAF  ++ALQSLL+GS R
Sbjct  217  LHRAAFHFKDALQSLLSGSNR  237



>emb|CDY13032.1| BnaC07g03310D [Brassica napus]
Length=493

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 106/197 (54%), Gaps = 14/197 (7%)
 Frame = +1

Query  274  MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLL  453
            M+VP +SN N        + EP SVL LRRSP+P   ++          D+     D+ +
Sbjct  1    MRVPASSNSNSGGKNLVVYDEPTSVLGLRRSPTPTTVEEKPLVSAASGGDNQFPSDDHAM  60

Query  454  TNFEDWDSFMKELGLQDDR--NIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFS  627
             +  DWDS M+EL L DD   N+KP+    F P +    H       LP F      N +
Sbjct  61   RSM-DWDSIMRELELDDDSTPNLKPN----FPPPA----HFAVVDPPLPVF--PDQLNPA  109

Query  628  QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRA  807
            ++ G  ++ +     GFD I++LI+  +C DS+ +Q A VIL +LNQ+L S AG PL RA
Sbjct  110  EY-GYDSNSNNGGGGGFDIIEDLIRVVDCVDSDELQHAHVILSRLNQRLRSPAGRPLLRA  168

Query  808  AFLLQEALQSLLTGSTR  858
            AF  +EAL SLL+GS R
Sbjct  169  AFYFKEALGSLLSGSNR  185



>ref|XP_009374236.1| PREDICTED: scarecrow-like protein 15 [Pyrus x bretschneideri]
Length=548

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 103/208 (50%), Gaps = 34/208 (16%)
 Frame = +1

Query  325  GWYEPKSVLELRRSPSPVLDQKAAPAGNFD-----VSDDPLELADNLLTNFEDWDSFMKE  489
            G YEP SVL+LR+SPSPV  +K +            + DPLE  D  + +  DWDS M++
Sbjct  38   GGYEPTSVLDLRQSPSPVSAEKPSKISGISNVLSHSNHDPLEWEDEQVLHNLDWDSIMRD  97

Query  490  LGLQDDR--NIKPDHNLLFTPSSESQTHQF-EFTHSLPEFVPSS------DFNFSQFQGN  642
            LGL DD   N+K        P   +   Q  E+ H   +F P+       D N S+   +
Sbjct  98   LGLHDDNVPNLKTS-----IPQLNANDPQISEYPHP-QQFDPTQLVHSDYDINLSEVYSS  151

Query  643  INSFDE---------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA---  786
             N +D          NW+ G D+I+ELI+ A+CFD+  +QLAQVIL +LN +L S++   
Sbjct  152  QNCYDHVTNDFHPSGNWNVGLDFIEELIRAADCFDTEELQLAQVILDRLNHRLRSSSPSK  211

Query  787  --GNPLRRAAFLLQEALQSLLTGSTRPA  864
              G P            QSLL GS   A
Sbjct  212  PVGKPXXXXXXXXXXXXQSLLNGSDTAA  239



>ref|XP_008453726.1| PREDICTED: scarecrow-like protein 15 [Cucumis melo]
Length=511

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 117/210 (56%), Gaps = 23/210 (11%)
 Frame = +1

Query  274  MKVPVASNENWNSAAGNGWY--EPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADN  447
            M+VPV ++++ + ++       EP SVL+L R+PSPV       + +   ++ PL+  + 
Sbjct  1    MRVPVPNHQSSSLSSSTPKLHSEPTSVLDLHRTPSPVAPDNPLSSAHDRHNNHPLDWDEQ  60

Query  448  LLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQF-EFTHSL----------P  594
             L N  DWDS M +LGL DD N    +N     +S      F EF HS           P
Sbjct  61   ALHNL-DWDSIMGDLGLHDDSNSSLKNN-----TSHDHVPNFPEFLHSQSLDQTSHLLPP  114

Query  595  EFVPSSDFNFS--QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQ  768
            +F  S  F+        + NSF+ N +   D++++L+  A+CFDSN  QLA VIL +LNQ
Sbjct  115  DFFISEPFSNHPPTILQSFNSFNSN-NPSLDFLEDLVAAADCFDSNDFQLAHVILERLNQ  173

Query  769  KL-SSAAGNPLRRAAFLLQEALQSLLTGST  855
            +L S+++  P+ RAAF ++EALQSLL+ ST
Sbjct  174  RLQSTSSAKPIHRAAFFIKEALQSLLSPST  203



>ref|XP_010548348.1| PREDICTED: scarecrow-like protein 15 [Tarenaya hassleriana]
Length=562

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 112/214 (52%), Gaps = 28/214 (13%)
 Frame = +1

Query  289  ASNENWNSAAGNGWYEPKSVLELRRSPSP-----------VLDQKAAPAGNFDVSDDPLE  435
            +S     +  G G+ EP SVL+LR SPSP           V  + +   G      +   
Sbjct  36   SSVATVTAGGGLGFNEPTSVLDLRGSPSPAAAAADKPPVAVAGEVSGGGGTTGQVSEQFP  95

Query  436  LADNLLTNFEDWDSFMKELGLQDDRN--IKPDHNLLFTPSSESQTHQFEFTHSLPEFVPS  609
            L ++++ +  DWDS M+EL L DD    +K        P+      Q     S P+ +  
Sbjct  96   LDEHVMRSM-DWDSIMRELELDDDSAPALKSSFTTAAIPTHYGADSQLP---SFPDQLHP  151

Query  610  SDFNFS------QFQGN--INSFDENWSF---GFDYIDELIQFAECFDSNAVQLAQVILP  756
            +DF  S      Q  G   +NS D +  F   GFD+I++LI+  +C DS+ +QLAQV+L 
Sbjct  152  ADFESSEVYLGHQIGGGHGLNSVDVSDGFVNGGFDFIEDLIRVVDCVDSDELQLAQVVLA  211

Query  757  QLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTR  858
            +LNQ+L S +G PL+RAAF  +EAL ++L+GSTR
Sbjct  212  RLNQRLRSPSGRPLKRAAFYFKEALATVLSGSTR  245



>gb|EYU44670.1| hypothetical protein MIMGU_mgv1a026210mg [Erythranthe guttata]
Length=483

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 106/217 (49%), Gaps = 48/217 (22%)
 Frame = +1

Query  274  MKVPVASNENWNSAAGNGWYEP----KSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELA  441
            MKVP + N   N              KSVLEL    SP+ +QK            PL L 
Sbjct  1    MKVPFSVNTQNNPKPPPATAAAAYEPKSVLEL--CGSPISNQK------------PLILV  46

Query  442  DNLLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFN  621
            D  L    DWDSF  ELGL D      D N +  P+     HQ   +H L + +P+  ++
Sbjct  47   DPQLV---DWDSF-SELGLHDHH----DPNSVSKPT----IHQLN-SHPLTQIIPTDQYS  93

Query  622  FSQFQGN----------------INSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVIL  753
                Q +                INSFD   SF   Y++ELIQ AE  D+N++QL  V+L
Sbjct  94   NQLLQTDFGSLSDIPLIHDNSYSINSFDSFTSFD-GYVNELIQLAESIDTNSLQLGNVLL  152

Query  754  PQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTRPA  864
             +LNQ LSS AG PL+R AF  +EALQ LLT STRP+
Sbjct  153  SRLNQTLSSPAGKPLQRIAFYFKEALQCLLTESTRPS  189



>ref|XP_010667697.1| PREDICTED: scarecrow-like protein 15 [Beta vulgaris subsp. vulgaris]
Length=589

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 98/205 (48%), Gaps = 41/205 (20%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAPA-----GNFDVSDDPLELADNLLTNFEDWDSFMKELG  495
            YEP SVL+L+RSPSP                 + +  P    D  L N E WDS + ELG
Sbjct  53   YEPTSVLDLQRSPSPATAATKTATPPPSDTKHNTNHPPTTAVD--LDNLEGWDSILSELG  110

Query  496  LQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEF--------------VPSSDFNFSQF  633
            L DD N   +  LL +  S  ++H    T  LP+F              +PS   NF  F
Sbjct  111  LNDDSNTN-NSKLLLSQISPCESH---LTQVLPDFPSSQPFDHSQPPINLPSDYANFCDF  166

Query  634  QGNIN------SFDE----------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLN  765
              N N       FD           N +FG D+ID+LI+ A+ F+SN  Q   VIL +LN
Sbjct  167  SYNQNLNPNFGPFDHQLHHQTNTNSNTNFGLDFIDDLIRAAQAFESNDSQQVHVILARLN  226

Query  766  QKLSSAAGNPLRRAAFLLQEALQSL  840
            Q+L S  G PL+RAAF  +EALQ L
Sbjct  227  QRLRSPVGKPLQRAAFYFKEALQHL  251



>ref|XP_003519903.1| PREDICTED: scarecrow-like protein 15-like [Glycine max]
Length=523

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 106/203 (52%), Gaps = 32/203 (16%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQDDR  510
            YEP SVL+L RSPSP  ++K          ++ L+L D++L N + W+S MK+L L +D 
Sbjct  26   YEPTSVLDLCRSPSP--EKKLTVPKPEPQHNNQLDLDDHVLPNSDWWESIMKDLTLPEDS  83

Query  511  -----NIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDF----------------NFS  627
                    P     F PSS+  +    F H  P+F   S+                 +F 
Sbjct  84   PTPLLKTNPSCIPDFPPSSQDPS----FDHPTPDFTSLSEIYNQNIPFNYPSNTLEPSFH  139

Query  628  QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQK-LSSAAGNPLRR  804
                +++  + NW    D+I+E I+ A+C+DS+  QLAQ IL +LN + L S  G PL R
Sbjct  140  DLNHSLHPHNNNW----DFIEEFIRAADCYDSSHFQLAQAILERLNNRLLRSPMGKPLHR  195

Query  805  AAFLLQEALQSLLTGSTRPASSS  873
            AAF  ++ALQS+L+GS R  + S
Sbjct  196  AAFHFKDALQSILSGSNRNGNGS  218



>ref|XP_009356715.1| PREDICTED: scarecrow-like protein 15, partial [Pyrus x bretschneideri]
Length=220

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 103/196 (53%), Gaps = 43/196 (22%)
 Frame = +1

Query  325  GWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSD-------DPLELADNLLTNFEDWDSFM  483
            G YEP SVL+LR SPSPV  +K  P+    +SD       DP+E  + +     DWDS M
Sbjct  38   GGYEPTSVLDLRHSPSPVSAEK--PSKILAISDVLSHSNHDPVEWEEQV-----DWDSIM  90

Query  484  KELGLQDDR--NIKPDHNLLFTPSSESQTHQF-EFTHSLPEFVPS----SDFN--FSQFQ  636
            ++LGL DD   N+K        P   S   Q  E+ H  P F PS    SDFN   S+  
Sbjct  91   RDLGLHDDNVPNLKNS-----IPQLNSNDPQISEYLHPQP-FDPSQLVHSDFNINLSEVY  144

Query  637  GNINSFDE---------NWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA-  786
             + N +D          +W+ G D+I+ELI  A+ FDS+ + LAQVIL +LN +L S++ 
Sbjct  145  SSQNCYDHVINDFHQSGSWNVGVDFIEELIGAADRFDSDELPLAQVILDRLNNRLRSSSP  204

Query  787  ----GNPLRRAAFLLQ  822
                G PL+RAA   +
Sbjct  205  SKPVGKPLQRAAVYFK  220



>gb|KFK40237.1| hypothetical protein AALP_AA3G348400 [Arabis alpina]
Length=438

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 102/198 (52%), Gaps = 45/198 (23%)
 Frame = +1

Query  274  MKVPVASNENWNSAAGNGWYEPKSVLELRRSPSP--VLDQKAAPAGNFDVSDDPLELADN  447
            M+VP +S+ N N   G  + EP SVL+LRRSPSP  V+ Q         V ++ L    +
Sbjct  1    MRVPASSDSNSNLVIG--YNEPTSVLDLRRSPSPTNVIHQT--------VDENGLCSHHH  50

Query  448  LLTNFEDWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFS  627
            ++ +  DWDS MKEL L D+       NL              F+   P   P+++ N  
Sbjct  51   VMHSI-DWDSIMKELELDDETTPTLKSNLPLNTI---------FSIDPP---PNTNNN--  95

Query  628  QFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRA  807
                             DY+ +LI+ A+C DS+ +QLAQVIL +LN  L S  G PL+RA
Sbjct  96   -----------------DYVSDLIRVADCIDSDELQLAQVILSRLNHCLRSPVGRPLQRA  138

Query  808  AFLLQEALQS-LLTGSTR  858
            AF  +EAL+S L+TGS R
Sbjct  139  AFYFKEALESVLITGSNR  156



>ref|XP_009142446.1| PREDICTED: scarecrow-like protein 15 [Brassica rapa]
 emb|CDX75590.1| BnaA01g01120D [Brassica napus]
Length=487

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 82/143 (57%), Gaps = 15/143 (10%)
 Frame = +1

Query  466  DWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFSQFQ  636
            DWDS MKEL L DD    P     FT +  +    +    +LP F   +  SDF+ S   
Sbjct  40   DWDSIMKELELDDDSTPNPLKTE-FTTTDSAIGPLYAVDSNLPGFPDQIQPSDFDSSDAY  98

Query  637  GN---------INSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  789
             N         ++S D     GFD++++LI+  +C +S+ +QLAQVIL +LNQ+L S AG
Sbjct  99   QNQTTGYGFTSLDSVDNGG--GFDFVEDLIRVVDCVESDELQLAQVILSRLNQRLRSPAG  156

Query  790  NPLRRAAFLLQEALQSLLTGSTR  858
             PL+RAAF  +EAL SLLTGS R
Sbjct  157  RPLQRAAFYFKEALGSLLTGSNR  179



>emb|CDX69238.1| BnaC01g02150D [Brassica napus]
Length=489

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 82/143 (57%), Gaps = 15/143 (10%)
 Frame = +1

Query  466  DWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFSQFQ  636
            DWDS MKEL L DD    P     FT +  +    +    +LP F   +  SDF+ S   
Sbjct  40   DWDSIMKELELDDDSTPNPLKTE-FTTTDSAIGPLYAVDSNLPGFPDQIQPSDFDSSDAY  98

Query  637  GN---------INSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAG  789
             N         ++S D     GFD++++LI+  +C +S+ +QLAQVIL +LNQ+L S AG
Sbjct  99   QNQTAGYGFTSLDSVDNGG--GFDFVEDLIRVVDCVESDELQLAQVILSRLNQRLRSPAG  156

Query  790  NPLRRAAFLLQEALQSLLTGSTR  858
             PL+RAAF  +EAL SLLTGS R
Sbjct  157  RPLQRAAFYFKEALGSLLTGSNR  179



>gb|KJB71048.1| hypothetical protein B456_011G102400 [Gossypium raimondii]
Length=517

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 114/235 (49%), Gaps = 57/235 (24%)
 Frame = +1

Query  274  MKVPVAS--------------NENWNSAAGNGWY----------EPKSVLELRRSPSPVL  381
            M+VPV S              N N    AGN  +          EP   L+LRRSPS  +
Sbjct  1    MRVPVCSPQGNHYPIPKPDINNNNITITAGNISFLNSSVPASSCEPTLDLDLRRSPSSAV  60

Query  382  DQKAA--PAGN---FDVS-----DDPLELADNLLTNFEDWDSFMKELGLQDD-----RNI  516
             +K    PA N   F VS        LE  +++L N  DWD+ +K+ GL D+     + I
Sbjct  61   TEKPVSNPADNSNCFSVSGPHQQQAGLEWDEHVLRNM-DWDAILKDFGLDDESVPATKTI  119

Query  517  KPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSDFNFSQFQGNINSFDENWSFGFDYIDEL  696
             P    +  P  ++         ++PE   S +        + N ++        Y ++L
Sbjct  120  PPQ---VINPRLDNHIQ------NVPELT-SCELTHHPLHSDFNLYE-------SYSEDL  162

Query  697  IQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTRP  861
            I+ A CFD++ +QLAQVIL +L+Q+L S +G PL+RAAF  +EALQSL TGST P
Sbjct  163  IRAANCFDTHDLQLAQVILDRLHQRLRSPSGEPLQRAAFYFKEALQSLFTGSTWP  217



>ref|XP_006283643.1| hypothetical protein CARUB_v10004700mg [Capsella rubella]
 gb|EOA16541.1| hypothetical protein CARUB_v10004700mg [Capsella rubella]
Length=483

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 84/146 (58%), Gaps = 17/146 (12%)
 Frame = +1

Query  466  DWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTH---QFEFTHSLPEF---VPSSDFNFS  627
            DWDS MKEL L DD    P+      P+S + +     +    +LP F   +  SDF  S
Sbjct  34   DWDSIMKELELDDDS--APNSLKTSFPTSTTDSTILPLYAVDSNLPGFPDQIQPSDFESS  91

Query  628  --------QFQG-NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSS  780
                    Q  G   NS D   + GFD+I++LI+  +C +S+ +QLAQV+L +LNQ+L S
Sbjct  92   TDVYPGQNQATGYGFNSLDSVDNGGFDFIEDLIRVVDCVESDELQLAQVVLSRLNQRLRS  151

Query  781  AAGNPLRRAAFLLQEALQSLLTGSTR  858
             AG PL+RAAF  +EAL SLLTG+ R
Sbjct  152  PAGRPLQRAAFYFKEALGSLLTGNNR  177



>gb|AAT75161.1| SCARECROW-like protein [Brassica napus]
 emb|CDX72597.1| BnaC07g46190D [Brassica napus]
Length=461

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 20/136 (15%)
 Frame = +1

Query  466  DWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTHQFEFTHSLPEF--VPSSDF--NFSQF  633
            DWDS MKEL + DD             S+  Q     F  +LP F  + SSD     +Q 
Sbjct  37   DWDSIMKELEVDDD-------------SAPYQLQPSSF--NLPVFPDIDSSDVYPGPNQI  81

Query  634  QG-NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAA  810
             G   NS D   + GFDYI++LI+  +C +S+ + LA V+L QLNQ+L ++AG PL+RAA
Sbjct  82   TGYGFNSLDSVDNGGFDYIEDLIRVVDCIESDELHLAHVVLSQLNQRLQTSAGRPLQRAA  141

Query  811  FLLQEALQSLLTGSTR  858
            F  +EAL SLLTG+ R
Sbjct  142  FYFKEALGSLLTGTNR  157



>ref|XP_006411970.1| hypothetical protein EUTSA_v10025054mg [Eutrema salsugineum]
 gb|ESQ53423.1| hypothetical protein EUTSA_v10025054mg [Eutrema salsugineum]
Length=484

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 20/146 (14%)
 Frame = +1

Query  466  DWDSFMKELGLQDDRNIKPDH-NLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFSQF  633
            DWDS MKEL L DD    P+     FT +  +    +    +LP F   +  SDF  S  
Sbjct  38   DWDSIMKELELDDDS--APNSLKTGFTTTDSAIGPLYAVDSNLPGFPDQIQPSDFESSDV  95

Query  634  Q-----------GNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSS  780
                        G+++S D     GFD+I++LI+  +C +S+ +Q+A VIL +L Q+L S
Sbjct  96   YPAHNQTAGYGFGSLDSVDNG---GFDFIEDLIRVVDCIESDELQIAHVILSRLGQRLRS  152

Query  781  AAGNPLRRAAFLLQEALQSLLTGSTR  858
             AG PL+RAAF  +EAL SLLTGS R
Sbjct  153  PAGRPLQRAAFYFKEALGSLLTGSNR  178



>dbj|BAP91520.1| gras family protein [Glycine max]
Length=541

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 113/204 (55%), Gaps = 25/204 (12%)
 Frame = +1

Query  331  YEPKSVLELRRSPSP---VLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  501
            YEP SVL+L RSPSP   +   K  P  N + ++  L+L D++L N + W+S MK+L L 
Sbjct  33   YEPTSVLDLCRSPSPEKKLTVPKPEPQHNNNNNNLNLDLDDHVLPNSDWWESIMKDLALP  92

Query  502  DD-------RNIKPDHNLLFTPSSESQT--HQFEFT-------HSLPEFVPS-----SDF  618
            +D        NI P     F PSS+     H  +FT        +LP   P+     S +
Sbjct  93   EDSPTPLLKTNINPSCIPDFPPSSQDPPFDHPQDFTSLSEIYNQNLPYNYPTNTLEHSFY  152

Query  619  NFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQK-LSSAAGNP  795
            + S    + N+ +   +  +D+I+ELI+ A+CFDS+  QLAQ IL +LN + L S  G P
Sbjct  153  DLSHNHHHNNNNNNVNNNNWDFIEELIRAADCFDSSHFQLAQAILERLNNRLLRSPMGKP  212

Query  796  LRRAAFLLQEALQSLLTGSTRPAS  867
            L RAAF  ++ALQS+L GS R +S
Sbjct  213  LHRAAFHFKDALQSILAGSNRTSS  236



>ref|XP_003547994.1| PREDICTED: scarecrow-like protein 15-like [Glycine max]
 dbj|BAP91521.1| gras family protein [Glycine max]
Length=540

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 112/203 (55%), Gaps = 24/203 (12%)
 Frame = +1

Query  331  YEPKSVLELRRSPSP---VLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELGLQ  501
            YEP SVL+L RSPSP   +   K  P  N + ++  L+L D++L N + W+S MK+L L 
Sbjct  33   YEPTSVLDLCRSPSPEKKLTVPKPEPQHNNNNNNLNLDLDDHVLPNSDWWESIMKDLALP  92

Query  502  DD-------RNIKPDHNLLFTPSSESQT--HQFEFT-------HSLPEFVPSSDFNFSQF  633
            +D        NI P     F PSS+     H  +FT        +LP   P++    S +
Sbjct  93   EDSPTPLLKTNINPSCIPDFPPSSQDPPFDHPQDFTSLSEIYNQNLPYNYPTNTLEHSFY  152

Query  634  ----QGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQK-LSSAAGNPL  798
                  + N+ +   +  +D+I+ELI+ A+CFDS+  QLAQ IL +LN + L S  G PL
Sbjct  153  DLSHNHHHNNNNNVNNNNWDFIEELIRAADCFDSSHFQLAQAILERLNNRLLRSPMGKPL  212

Query  799  RRAAFLLQEALQSLLTGSTRPAS  867
             RAAF  ++ALQS+L GS R +S
Sbjct  213  HRAAFHFKDALQSILAGSNRTSS  235



>ref|XP_010437312.1| PREDICTED: scarecrow-like protein 15 isoform X2 [Camelina sativa]
 ref|XP_010437313.1| PREDICTED: scarecrow-like protein 15 isoform X3 [Camelina sativa]
Length=486

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 82/148 (55%), Gaps = 17/148 (11%)
 Frame = +1

Query  466  DWDSFMKELGLQDD---RNIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFS  627
            DWDS MKEL L DD    ++K         +  +    +    +LP F   +  SDF  S
Sbjct  33   DWDSIMKELELDDDSAPNSLKTGFTTTTATTDSTILPLYAVDSNLPGFPDQIQPSDFESS  92

Query  628  Q---FQG--------NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  774
                + G          NS D   + GFD+I++LI+  +C +S+ +QLAQVIL +LNQ+L
Sbjct  93   TDIVYPGQNQQPTGYGFNSLDGVDNGGFDFIEDLIRVVDCVESDELQLAQVILSRLNQRL  152

Query  775  SSAAGNPLRRAAFLLQEALQSLLTGSTR  858
             S +G PL+RAAF  +EAL SLLTG+ R
Sbjct  153  RSPSGRPLQRAAFYFKEALASLLTGTNR  180



>ref|XP_010437311.1| PREDICTED: scarecrow-like protein 15 isoform X1 [Camelina sativa]
Length=486

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 82/148 (55%), Gaps = 17/148 (11%)
 Frame = +1

Query  466  DWDSFMKELGLQDDR---NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFS  627
            DWDS MKEL L DD    ++K         +  +    +    +LP F   +  SDF  S
Sbjct  33   DWDSIMKELELDDDSAPNSLKTGFTTTTATTDSTILPLYAVDSNLPGFPDQIQPSDFESS  92

Query  628  Q---FQG--------NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  774
                + G          NS D   + GFD+I++LI+  +C +S+ +QLAQVIL +LNQ+L
Sbjct  93   TDIVYPGQNQQPTGYGFNSLDGVDNGGFDFIEDLIRVVDCVESDELQLAQVILSRLNQRL  152

Query  775  SSAAGNPLRRAAFLLQEALQSLLTGSTR  858
             S +G PL+RAAF  +EAL SLLTG+ R
Sbjct  153  RSPSGRPLQRAAFYFKEALASLLTGTNR  180



>ref|XP_010432142.1| PREDICTED: scarecrow-like protein 15 [Camelina sativa]
Length=486

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 82/148 (55%), Gaps = 17/148 (11%)
 Frame = +1

Query  466  DWDSFMKELGLQDDR---NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFS  627
            DWDS MKEL L DD    ++K         S  +    +    +LP F   +  SDF  S
Sbjct  33   DWDSIMKELELDDDSAPNSLKTGFTTTTATSDSTILPLYAVDSNLPGFPDQIQPSDFESS  92

Query  628  Q---FQG--------NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  774
                + G          NS D   + GFD+I++LI+  +C +S+ +QLAQVIL +LNQ+L
Sbjct  93   TDIVYPGQNQQPTGYGFNSLDGVDNGGFDFIEDLIRVVDCVESDELQLAQVILSRLNQRL  152

Query  775  SSAAGNPLRRAAFLLQEALQSLLTGSTR  858
             S +G PL+RAAF  +EAL SLLTG+ R
Sbjct  153  RSPSGRPLQRAAFYFKEALASLLTGTNR  180



>ref|XP_010446751.1| PREDICTED: scarecrow-like protein 15 isoform X3 [Camelina sativa]
Length=489

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 82/149 (55%), Gaps = 18/149 (12%)
 Frame = +1

Query  466  DWDSFMKELGLQDDR---NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFS  627
            DWDS MKEL L DD    ++K         +  +    +    +LP F   +  SDF  S
Sbjct  34   DWDSIMKELELDDDSAPNSLKTGFTTTTATTDSTILPLYAVDSNLPGFPDQIQPSDFESS  93

Query  628  Q---FQG---------NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQK  771
                + G           NS D   + GFD+I++LI+  +C +S+ +QLAQVIL +LNQ+
Sbjct  94   TDIVYPGQNQQQPTGYGFNSLDGVDNGGFDFIEDLIRVVDCVESDELQLAQVILSRLNQR  153

Query  772  LSSAAGNPLRRAAFLLQEALQSLLTGSTR  858
            L S +G PL+RAAF  +EAL SLLTG+ R
Sbjct  154  LRSPSGRPLQRAAFYFKEALASLLTGTNR  182



>ref|XP_010446749.1| PREDICTED: scarecrow-like protein 15 isoform X1 [Camelina sativa]
 ref|XP_010446750.1| PREDICTED: scarecrow-like protein 15 isoform X2 [Camelina sativa]
Length=488

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 82/149 (55%), Gaps = 18/149 (12%)
 Frame = +1

Query  466  DWDSFMKELGLQDDR---NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDF---  618
            DWDS MKEL L DD    ++K         +  +    +    +LP F   +  SDF   
Sbjct  34   DWDSIMKELELDDDSAPNSLKTGFTTTTATTDSTILPLYAVDSNLPGFPDQIQPSDFESS  93

Query  619  --------NFSQFQG-NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQK  771
                    N  Q  G   NS D   + GFD+I++LI+  +C +S+ +QLAQVIL +LNQ+
Sbjct  94   TDIVYPGQNQQQPTGYGFNSLDGVDNGGFDFIEDLIRVVDCVESDELQLAQVILSRLNQR  153

Query  772  LSSAAGNPLRRAAFLLQEALQSLLTGSTR  858
            L S +G PL+RAAF  +EAL SLLTG+ R
Sbjct  154  LRSPSGRPLQRAAFYFKEALASLLTGTNR  182



>ref|NP_195389.4| scarecrow-like protein 15 [Arabidopsis thaliana]
 sp|O23210.3|SCL15_ARATH RecName: Full=Scarecrow-like protein 15; Short=AtSCL15; AltName: 
Full=GRAS family protein 25; Short=AtGRAS-25 [Arabidopsis 
thaliana]
 dbj|BAC43101.1| ap2 SCARECROW-like protein [Arabidopsis thaliana]
 gb|AEE86692.1| scarecrow-like protein 15 [Arabidopsis thaliana]
Length=486

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 78/144 (54%), Gaps = 13/144 (9%)
 Frame = +1

Query  466  DWDSFMKELGLQDD----------RNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSD  615
            DWDS MKEL L DD               D  +L   + +S    F       +F  SSD
Sbjct  37   DWDSIMKELELDDDSAPNSLKTGFTTTTTDSTILPLYAVDSNLPGFPDQIQPSDFESSSD  96

Query  616  FNFSQFQGN---INSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  786
                Q Q      NS D   + GFD+I++LI+  +C +S+ +QLAQV+L +LNQ+L S A
Sbjct  97   VYPGQNQTTGYGFNSLDSVDNGGFDFIEDLIRVVDCVESDELQLAQVVLSRLNQRLRSPA  156

Query  787  GNPLRRAAFLLQEALQSLLTGSTR  858
            G PL+RAAF  +EAL S LTGS R
Sbjct  157  GRPLQRAAFYFKEALGSFLTGSNR  180



>ref|XP_002869027.1| hypothetical protein ARALYDRAFT_490963 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45286.1| hypothetical protein ARALYDRAFT_490963 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 80/145 (55%), Gaps = 14/145 (10%)
 Frame = +1

Query  466  DWDSFMKELGLQDDR--NIKPDHNLLFTPSSESQTHQFEFTHSLPEF---VPSSDFNFS-  627
            DWDS MKEL L DD   N         T +  +    +    +LP F   +  SDF  S 
Sbjct  36   DWDSIMKELELDDDSAPNSLKTGFTTTTTTDSTILPLYAVDSNLPGFPDQIQPSDFESSS  95

Query  628  -------QFQG-NINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSA  783
                   Q  G   NS D   + GFD+I++LI+  +C +S+ +QLAQV+L +LNQ+L S 
Sbjct  96   DVYPGQNQTTGYGFNSLDSVDNGGFDFIEDLIRVVDCVESDELQLAQVVLSRLNQRLRSP  155

Query  784  AGNPLRRAAFLLQEALQSLLTGSTR  858
            AG  L+RAAF  +EAL SLLTGS R
Sbjct  156  AGRALQRAAFYFKEALGSLLTGSNR  180



>emb|CAB16826.1| SCARECROW-like protein [Arabidopsis thaliana]
 emb|CAB80337.1| SCARECROW-like protein [Arabidopsis thaliana]
Length=486

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 78/144 (54%), Gaps = 13/144 (9%)
 Frame = +1

Query  466  DWDSFMKELGLQDD----------RNIKPDHNLLFTPSSESQTHQFEFTHSLPEFVPSSD  615
            DWDS MKEL L DD               D  +L   + +S    F       +F  SSD
Sbjct  37   DWDSIMKELELDDDSAPNSLKTGFTTTTTDSTILPLYAVDSNLPGFPDQIQPSDFESSSD  96

Query  616  FNFSQFQGN---INSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  786
                Q Q      NS D   + GFD+I++LI+  +C +S+ +QLAQV+L +LNQ+L S A
Sbjct  97   VYPGQNQTTGYGFNSLDSVDNGGFDFIEDLIRVVDCVESDELQLAQVVLSRLNQRLRSPA  156

Query  787  GNPLRRAAFLLQEALQSLLTGSTR  858
            G PL+RAAF  +EAL S LTGS R
Sbjct  157  GRPLQRAAFYFKEALGSFLTGSNR  180



>gb|KFK30292.1| hypothetical protein AALP_AA7G242600 [Arabis alpina]
Length=493

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 77/144 (53%), Gaps = 14/144 (10%)
 Frame = +1

Query  466  DWDSFMKELGLQDDRNIKPDHNLLFTPSSESQTH-QFEFTHSLPEF---VPSSDFNFSQF  633
            DWDS MKEL L DD           T +++S     +    +LP F   +  SDF  S  
Sbjct  35   DWDSIMKELELDDDSTPNSLKTSFTTTNTDSTILPLYTVDTNLPGFPDQIQPSDFESSDV  94

Query  634  QGNINSFDENWSF---------GFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAA  786
              N N  +  +SF         GFD+I++LI+  +C +S+ +QL  VIL +LNQ+L S  
Sbjct  95   FQNQNQ-NSGYSFNSLENIDNGGFDFIEDLIRVVDCVESDELQLGHVILSRLNQRLRSPV  153

Query  787  GNPLRRAAFLLQEALQSLLTGSTR  858
            G PL+RAAF  +E L SLLTG  R
Sbjct  154  GRPLQRAAFYFKEGLNSLLTGLNR  177



>ref|XP_007156025.1| hypothetical protein PHAVU_003G252200g [Phaseolus vulgaris]
 gb|ESW28019.1| hypothetical protein PHAVU_003G252200g [Phaseolus vulgaris]
Length=544

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 104/212 (49%), Gaps = 37/212 (17%)
 Frame = +1

Query  331  YEPKSVLELRRSPSPVLDQKAAP-----------AGNFDVSDDPLELADNLLTNFEDWDS  477
            YEP SVL+L RSPSP   +   P                 +++ L+L D++L N + W+S
Sbjct  33   YEPTSVLDLCRSPSPE-KKPTVPKPEPQHNTNNITTITTTNNNNLDLDDHVLPNSDWWES  91

Query  478  FMKELGLQDD--------RNIKP-------------DHNLLFTPSSESQTHQFEFTHSLP  594
             MK+L L +D         NI P             DH   FT  SE       + ++  
Sbjct  92   IMKDLALPEDSPTPLSKPNNINPCIPDFPPSHDPPFDHPPDFTSLSEIYNQNLPYNYTTT  151

Query  595  EFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKL  774
              +   D +F     + ++   N +  +D+I+ELI+ A+CFDS+  QLAQ IL +LN +L
Sbjct  152  NAL---DHSFQDLNHHHHNPTNNVNNNWDFIEELIRAADCFDSSHFQLAQAILERLNNRL  208

Query  775  -SSAAGNPLRRAAFLLQEALQSLLTGSTRPAS  867
              S    PL RAAF  ++AL S+L+GS R  S
Sbjct  209  IRSPMAKPLHRAAFHFKDALHSILSGSNRAGS  240



>ref|XP_010070042.1| PREDICTED: scarecrow-like protein 15 [Eucalyptus grandis]
 gb|KCW58597.1| hypothetical protein EUGRSUZ_H01257 [Eucalyptus grandis]
Length=464

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 77/154 (50%), Gaps = 22/154 (14%)
 Frame = +1

Query  466  DWDSFMKELGLQDDRNIKPDHNLLFTPS---------SESQTHQFEFTHSLPEFVPSSDF  618
            DWDS M++LGL DD       N    P+               Q +      +  P   F
Sbjct  5    DWDSIMRDLGLHDDSAPPFRANPHVCPADAFPPPPPPPPHHQQQQQQQQHHQQLEPPGHF  64

Query  619  ---NFSQFQGNINSFDE------NW-SFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQ  768
                F+   G  N  D        W   G D+ DELIQ AECFDS+ +QLAQ+IL +LNQ
Sbjct  65   LPHEFALSDGYSNPLDSCADSPAGWNGLGPDFFDELIQAAECFDSSELQLAQMILARLNQ  124

Query  769  KLSSAAGNPLRRAAFLLQEALQSLL---TGSTRP  861
            +L S AG P++RAAF  +EA QSLL   +GS RP
Sbjct  125  RLRSPAGKPVQRAAFYFKEAFQSLLLLQSGSNRP  158



>gb|KDO59927.1| hypothetical protein CISIN_1g007284mg [Citrus sinensis]
Length=609

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 108/237 (46%), Gaps = 74/237 (31%)
 Frame = +1

Query  316  AGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELG  495
            +G+  YEP SVLELRRSPSP+                P    D  +    DW+SF+K+LG
Sbjct  71   SGSKCYEPTSVLELRRSPSPI----------------PEWDRDEHMLRTMDWESFIKDLG  114

Query  496  LQDD-------------RNIKP--------DH--------------------NLLFTPSS  552
              DD             +++ P        DH                    +++   SS
Sbjct  115  GLDDDCSSDVAAPQLQIQHLHPISTDDDSIDHQQQSDFNFNFSSNFNVPAADDVVSLSSS  174

Query  553  ESQTHQFEFTHSLPEFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAV  732
             +Q H   F    P+ V ++D N       +N+    + F ++YI+ELI+ AEC DSN +
Sbjct  175  TTQYHN-NFPDHHPDAVSNNDNNMIV----VNNLGGGFEFDYNYIEELIRAAECLDSNEL  229

Query  733  QLAQVILPQLNQK--------LSSAAGNPLRRAAFLLQEALQSLLT----GSTRPAS  867
            Q+AQ+IL +LN          +  AAG PL+RAA   +EAL SLL     G TRP S
Sbjct  230  QVAQMILARLNHSQNLVGSPPVVVAAGKPLQRAAIFFKEALSSLLLSLLNGLTRPTS  286



>ref|XP_006428037.1| hypothetical protein CICLE_v10025197mg [Citrus clementina]
 ref|XP_006493843.1| PREDICTED: scarecrow-like protein 15-like [Citrus sinensis]
 gb|ESR41277.1| hypothetical protein CICLE_v10025197mg [Citrus clementina]
Length=609

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 107/237 (45%), Gaps = 74/237 (31%)
 Frame = +1

Query  316  AGNGWYEPKSVLELRRSPSPVLDQKAAPAGNFDVSDDPLELADNLLTNFEDWDSFMKELG  495
            +G+  YEP SVLELRRSPSP+                P    D  +    DW+SF+K+LG
Sbjct  71   SGSKCYEPTSVLELRRSPSPI----------------PEWDRDEHMLRTMDWESFIKDLG  114

Query  496  LQDD-------------RNIKP--------DH--------------------NLLFTPSS  552
              DD             +++ P        DH                    +++   SS
Sbjct  115  GLDDDCSSDVAAPQLQIQHLHPISTDDDSIDHQQQSDFNFNFSSNFNVPAADDVVSLSSS  174

Query  553  ESQTHQFEFTHSLPEFVPSSDFNFSQFQGNINSFDENWSFGFDYIDELIQFAECFDSNAV  732
             +Q H     ++ P+  P +  N       +N+    + F ++YI+ELI+ AEC DSN +
Sbjct  175  TTQYH-----NNFPDHHPDAVSNNGNNMIVMNNLGGGFEFDYNYIEELIRAAECLDSNEL  229

Query  733  QLAQVILPQLNQK--------LSSAAGNPLRRAAFLLQEALQSLLT----GSTRPAS  867
            Q+AQ+IL +LN          +  AAG PL+RAA   +EAL SLL     G TRP S
Sbjct  230  QVAQMILARLNHSQNLVGSPPVVVAAGKPLQRAAIFFKEALSSLLLSLLNGLTRPTS  286



>ref|XP_010255200.1| PREDICTED: scarecrow-like protein 15 [Nelumbo nucifera]
Length=549

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 100/221 (45%), Gaps = 32/221 (14%)
 Frame = +1

Query  286  VASNENWN--SAAGNGWYEPKSVLELRRSPSPVLDQ----KAAPAGNFDVSDDPLELADN  447
             A N  +N  + +    YEP SVL+LRRS SPV          PA +   S++P    D 
Sbjct  25   TAENNTFNQPAVSSTSCYEPTSVLDLRRSSSPVAAVPDSFNPVPAFSGVSSEEPSFQWDG  84

Query  448  --LLTNFEDWDSFMKELGLQDDRNIKPDHNLL--FTPSSESQTHQFEFT----------H  585
              L  + +DWDS M    L++  N  P    L  F P      +    T          H
Sbjct  85   HVLPLSSDDWDSMM--WALEEKDNSAPLSKSLPQFGPHGPQSPNFSHLTAPDSFFGSSPH  142

Query  586  SLPEF-VPSSD--------FNFSQFQGNINS-FDENWSFGFDYIDELIQFAECFDSNAVQ  735
            S+P F  PS+         FN S     I S   E   F    +D+L Q A C +SN  Q
Sbjct  143  SVPAFNHPSAASWNHSPTYFNLSNNFHQIGSNGGEGIEFDCSQLDQLFQAAGCLESNESQ  202

Query  736  LAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLTGSTR  858
             A  IL +LNQ+L    G PL+RAAF  +EAL SLLTGS R
Sbjct  203  SALTILARLNQRLQFPMGKPLQRAAFYFKEALLSLLTGSNR  243



>ref|XP_009394367.1| PREDICTED: scarecrow-like protein 15 [Musa acuminata subsp. malaccensis]
Length=531

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +1

Query  667  SFGFDYIDELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLLT  846
            SF    +D LI  A C ++N    A VIL +LN  L SA  +PL RA FL +EAL +LL 
Sbjct  155  SFDRAQLDLLISAARCLEANDFATAHVILSRLNHHLPSAGASPLLRAVFLFKEALLALLR  214

Query  847  GST  855
             ST
Sbjct  215  PST  217



>gb|ACB31517.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31518.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31519.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31520.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31521.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31522.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31523.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31524.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31525.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31526.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31527.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31528.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31529.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31530.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31531.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31532.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31533.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31534.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31535.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31536.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31537.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31538.1| SCL6-IV, partial [Arabidopsis thaliana]
 gb|ACB31539.1| SCL6-IV, partial [Arabidopsis thaliana]
Length=168

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = +1

Query  688  DELIQFAECFDSNAVQLAQVILPQLNQKLSSAAGNPLRRAAFLLQEALQSLL  843
            ++L++ AE  +S+   LAQ IL +LNQ+LSS  G PL RAAF  +EAL +LL
Sbjct  68   EQLVKAAEVIESDTC-LAQGILARLNQQLSSPVGKPLERAAFYFKEALNNLL  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1991073159785