BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7968

Length=808
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004239250.1|  PREDICTED: uncharacterized protein LOC101257075    116   2e-25   Solanum lycopersicum
ref|XP_006354416.1|  PREDICTED: uncharacterized protein LOC102594...    111   1e-23   Solanum tuberosum [potatoes]
ref|XP_006351984.1|  PREDICTED: protein PAT1 homolog 1-like             106   5e-22   Solanum tuberosum [potatoes]
ref|XP_004251557.1|  PREDICTED: uncharacterized protein LOC101260...    105   7e-22   Solanum lycopersicum
ref|XP_009594235.1|  PREDICTED: protein PAT1 homolog 1-like             105   9e-22   Nicotiana tomentosiformis
ref|XP_009797313.1|  PREDICTED: protein PAT1 homolog 1-like             104   2e-21   Nicotiana sylvestris
ref|XP_009781689.1|  PREDICTED: uncharacterized protein LOC104230555    103   3e-21   Nicotiana sylvestris
ref|XP_009595696.1|  PREDICTED: protein PAT1 homolog 1-like             103   4e-21   Nicotiana tomentosiformis
ref|XP_008229675.1|  PREDICTED: protein PAT1 homolog 1-like             102   1e-20   Prunus mume [ume]
ref|XP_010313689.1|  PREDICTED: uncharacterized protein LOC101260...    101   2e-20   Solanum lycopersicum
ref|XP_011085449.1|  PREDICTED: protein PAT1 homolog 1-like             101   2e-20   Sesamum indicum [beniseed]
ref|XP_011100381.1|  PREDICTED: uncharacterized protein LOC105178578  98.6    2e-19   Sesamum indicum [beniseed]
ref|XP_009757677.1|  PREDICTED: uncharacterized protein LOC104210470  97.8    3e-19   Nicotiana sylvestris
ref|XP_002264820.1|  PREDICTED: protein PAT1 homolog 1-like           97.8    4e-19   Vitis vinifera
emb|CBI34052.3|  unnamed protein product                              96.7    4e-19   Vitis vinifera
ref|XP_009602223.1|  PREDICTED: uncharacterized protein LOC104097371  96.7    7e-19   Nicotiana tomentosiformis
ref|XP_009377953.1|  PREDICTED: protein PAT1 homolog 1-like           95.5    2e-18   Pyrus x bretschneideri [bai li]
gb|EYU42843.1|  hypothetical protein MIMGU_mgv1a001457mg              94.7    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_010112872.1|  hypothetical protein L484_017708                 94.7    4e-18   
ref|XP_008342293.1|  PREDICTED: protein PAT1 homolog 1-like           94.0    7e-18   
ref|XP_008378353.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  93.6    9e-18   
ref|XP_009375341.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  92.4    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_009375342.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  90.5    8e-17   
ref|XP_007217055.1|  hypothetical protein PRUPE_ppa001180mg           87.0    1e-15   
ref|XP_004303935.1|  PREDICTED: protein PAT1 homolog 1                86.7    2e-15   Fragaria vesca subsp. vesca
ref|XP_011008549.1|  PREDICTED: uncharacterized protein LOC105113895  83.6    1e-14   Populus euphratica
ref|XP_006373646.1|  hypothetical protein POPTR_0016s02130g           83.2    2e-14   
ref|XP_010435003.1|  PREDICTED: protein PAT1 homolog 1-like           82.8    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010525174.1|  PREDICTED: uncharacterized protein LOC104803017  82.8    3e-14   Tarenaya hassleriana [spider flower]
ref|XP_010532520.1|  PREDICTED: uncharacterized protein LOC104808528  82.4    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_010496132.1|  PREDICTED: protein PAT1 homolog 1-like           82.0    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010440363.1|  PREDICTED: protein PAT1 homolog 1-like           82.0    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006481340.1|  PREDICTED: uncharacterized protein LOC102618...  82.0    5e-14   Citrus sinensis [apfelsine]
ref|XP_006481341.1|  PREDICTED: uncharacterized protein LOC102618...  82.0    5e-14   Citrus sinensis [apfelsine]
emb|CDY39512.1|  BnaA01g24760D                                        82.0    5e-14   Brassica napus [oilseed rape]
emb|CDP16041.1|  unnamed protein product                              82.0    5e-14   Coffea canephora [robusta coffee]
ref|XP_009108983.1|  PREDICTED: uncharacterized protein LOC103834...  81.6    7e-14   Brassica rapa
ref|XP_002308825.2|  hypothetical protein POPTR_0006s02270g           80.5    1e-13   
dbj|BAF00849.1|  hypothetical protein                                 80.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188866.1|  Topoisomerase II-associated protein PAT1            80.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011004464.1|  PREDICTED: uncharacterized protein LOC105110947  80.1    2e-13   Populus euphratica
ref|XP_011036076.1|  PREDICTED: protein PAT1 homolog 1-like           80.1    2e-13   Populus euphratica
emb|CDY46332.1|  BnaC01g31660D                                        79.7    2e-13   Brassica napus [oilseed rape]
ref|XP_002883351.1|  hypothetical protein ARALYDRAFT_479740           79.3    3e-13   
ref|XP_010036063.1|  PREDICTED: protein PAT1 homolog 1-like           79.0    4e-13   Eucalyptus grandis [rose gum]
ref|NP_567452.2|  Topoisomerase II-associated protein PAT1            78.6    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004147742.1|  PREDICTED: uncharacterized protein LOC101213130  78.6    6e-13   Cucumis sativus [cucumbers]
ref|XP_008451848.1|  PREDICTED: uncharacterized protein LOC103493011  78.2    8e-13   Cucumis melo [Oriental melon]
ref|XP_009108988.1|  PREDICTED: uncharacterized protein LOC103834...  77.0    2e-12   Brassica rapa
ref|XP_006297023.1|  hypothetical protein CARUB_v10013016mg           76.3    3e-12   Capsella rubella
ref|XP_002868239.1|  hypothetical protein ARALYDRAFT_915331           75.5    6e-12   Arabidopsis lyrata subsp. lyrata
gb|KJB08598.1|  hypothetical protein B456_001G092700                  75.5    6e-12   Gossypium raimondii
ref|XP_006283147.1|  hypothetical protein CARUB_v10004170mg           75.1    7e-12   Capsella rubella
ref|XP_007049005.1|  Topoisomerase II-associated protein PAT1, pu...  75.1    8e-12   
gb|KJB08599.1|  hypothetical protein B456_001G092700                  74.7    1e-11   Gossypium raimondii
gb|EPS66560.1|  hypothetical protein M569_08215                       74.3    1e-11   Genlisea aurea
gb|KJB42926.1|  hypothetical protein B456_007G174200                  74.3    1e-11   Gossypium raimondii
gb|KJB42927.1|  hypothetical protein B456_007G174200                  73.9    2e-11   Gossypium raimondii
ref|XP_010488248.1|  PREDICTED: uncharacterized protein LOC104766124  73.9    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010466506.1|  PREDICTED: uncharacterized protein LOC104746679  73.2    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006414611.1|  hypothetical protein EUTSA_v10024461mg           73.2    3e-11   Eutrema salsugineum [saltwater cress]
gb|KFK39518.1|  hypothetical protein AALP_AA3G254500                  72.4    5e-11   Arabis alpina [alpine rockcress]
ref|XP_008353622.1|  PREDICTED: uncharacterized protein LOC103417209  67.8    6e-11   
ref|XP_010511200.1|  PREDICTED: uncharacterized protein LOC104787331  71.6    9e-11   
gb|KHG26425.1|  Protein PAT1                                          71.6    1e-10   Gossypium arboreum [tree cotton]
ref|XP_006406189.1|  hypothetical protein EUTSA_v10020108mg           71.6    1e-10   Eutrema salsugineum [saltwater cress]
emb|CDY54867.1|  BnaC01g22630D                                        71.2    1e-10   Brassica napus [oilseed rape]
gb|EYU43157.1|  hypothetical protein MIMGU_mgv1a016393mg              67.0    1e-10   Erythranthe guttata [common monkey flower]
gb|KJB10632.1|  hypothetical protein B456_001G212600                  69.7    4e-10   Gossypium raimondii
ref|XP_009147964.1|  PREDICTED: protein PAT1 homolog 1                68.9    7e-10   Brassica rapa
emb|CDY50269.1|  BnaAnng10330D                                        68.9    7e-10   Brassica napus [oilseed rape]
emb|CDY37402.1|  BnaC05g30280D                                        68.2    1e-09   Brassica napus [oilseed rape]
gb|KDO64332.1|  hypothetical protein CISIN_1g0038251mg                63.5    2e-09   Citrus sinensis [apfelsine]
ref|XP_006283146.1|  hypothetical protein CARUB_v10004170mg           67.4    2e-09   
ref|XP_002520595.1|  hypothetical protein RCOM_0673440                67.0    4e-09   Ricinus communis
gb|KFK23118.1|  hypothetical protein AALP_AAs49591U000400             67.0    4e-09   Arabis alpina [alpine rockcress]
emb|CAN68728.1|  hypothetical protein VITISV_033604                   64.3    2e-08   Vitis vinifera
dbj|BAB01945.1|  unnamed protein product                              62.0    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006597998.1|  PREDICTED: uncharacterized protein LOC100779...  62.0    2e-07   Glycine max [soybeans]
ref|XP_010684289.1|  PREDICTED: uncharacterized protein LOC104898860  61.6    2e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007133386.1|  hypothetical protein PHAVU_011G174900g           61.6    2e-07   Phaseolus vulgaris [French bean]
ref|XP_006597997.1|  PREDICTED: uncharacterized protein LOC100779...  61.2    3e-07   Glycine max [soybeans]
emb|CDY10630.1|  BnaA05g17320D                                        60.5    6e-07   Brassica napus [oilseed rape]
ref|XP_009145394.1|  PREDICTED: uncharacterized protein LOC103869095  60.1    7e-07   Brassica rapa
gb|KDP44628.1|  hypothetical protein JCGZ_22047                       59.3    1e-06   Jatropha curcas
ref|XP_012092372.1|  PREDICTED: protein PAT1 homolog 1-like           59.3    1e-06   Jatropha curcas
emb|CDP13609.1|  unnamed protein product                              59.3    1e-06   Coffea canephora [robusta coffee]
ref|XP_012087420.1|  PREDICTED: protein PAT1 homolog 1 isoform X2     59.3    1e-06   Jatropha curcas
ref|XP_012087418.1|  PREDICTED: protein PAT1 homolog 1 isoform X1     58.5    2e-06   Jatropha curcas
ref|XP_007049006.1|  Topoisomerase II-associated protein PAT1, pu...  58.2    3e-06   
gb|KHN16432.1|  hypothetical protein glysoja_046875                   57.4    6e-06   Glycine soja [wild soybean]
ref|XP_006597999.1|  PREDICTED: uncharacterized protein LOC100779...  57.0    7e-06   Glycine max [soybeans]
emb|CAB10277.1|  hypothetical protein                                 56.6    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004514400.1|  PREDICTED: uncharacterized protein LOC101512706  57.0    9e-06   
ref|XP_010923783.1|  PREDICTED: uncharacterized protein LOC105046771  56.6    9e-06   
ref|XP_009406732.1|  PREDICTED: uncharacterized protein LOC103989...  56.6    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406733.1|  PREDICTED: uncharacterized protein LOC103989...  56.6    1e-05   
gb|KDO64335.1|  hypothetical protein CISIN_1g0038251mg                53.1    1e-05   Citrus sinensis [apfelsine]
ref|NP_001044369.2|  Os01g0769000                                     56.2    1e-05   
ref|XP_010243929.1|  PREDICTED: protein PAT1 homolog 1-like           55.5    2e-05   Nelumbo nucifera [Indian lotus]
gb|KHG07822.1|  Protein PAT1                                          55.5    3e-05   Gossypium arboreum [tree cotton]
gb|EAZ23222.1|  hypothetical protein OsJ_06910                        55.1    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86044.1|  hypothetical protein OsI_07409                        55.1    3e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001046960.1|  Os02g0517300                                     55.1    3e-05   
emb|CBI21787.3|  unnamed protein product                              52.4    5e-05   Vitis vinifera
gb|KHG07107.1|  Protein PAT1                                          53.9    7e-05   Gossypium arboreum [tree cotton]
ref|XP_011038109.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  53.9    8e-05   Populus euphratica
ref|XP_011038110.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  53.9    8e-05   Populus euphratica
ref|XP_002441360.1|  hypothetical protein SORBIDRAFT_09g025190        53.9    8e-05   Sorghum bicolor [broomcorn]
ref|XP_011014090.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  53.9    9e-05   Populus euphratica
ref|XP_011014091.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  53.9    9e-05   Populus euphratica
ref|XP_010645006.1|  PREDICTED: uncharacterized protein LOC100267...  53.1    1e-04   Vitis vinifera
gb|KJB82133.1|  hypothetical protein B456_013G178200                  52.8    2e-04   Gossypium raimondii
ref|XP_009399054.1|  PREDICTED: protein PAT1 homolog 1-like           52.8    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006646364.1|  PREDICTED: uncharacterized protein LOC102701783  52.4    3e-04   Oryza brachyantha
ref|XP_002300546.2|  hypothetical protein POPTR_0001s46190g           52.4    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_004961543.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  52.4    3e-04   Setaria italica
ref|XP_003569904.1|  PREDICTED: uncharacterized protein LOC100838182  52.0    3e-04   Brachypodium distachyon [annual false brome]
ref|XP_004961544.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  52.0    3e-04   Setaria italica
ref|XP_006478034.1|  PREDICTED: uncharacterized protein LOC102611...  52.0    4e-04   Citrus sinensis [apfelsine]
ref|XP_006478033.1|  PREDICTED: uncharacterized protein LOC102611...  52.0    4e-04   Citrus sinensis [apfelsine]
gb|KDO40140.1|  hypothetical protein CISIN_1g003844mg                 52.0    4e-04   Citrus sinensis [apfelsine]
ref|XP_006441043.1|  hypothetical protein CICLE_v10018922mg           52.0    4e-04   Citrus clementina [clementine]
ref|XP_010243919.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.6    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010243918.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.6    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_008793552.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.2    5e-04   Phoenix dactylifera
ref|XP_008649853.1|  PREDICTED: uncharacterized protein LOC103630586  51.2    6e-04   Zea mays [maize]
ref|XP_009416760.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.2    7e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416762.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  50.8    7e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568135.1|  PREDICTED: protein PAT1 homolog 1-like           50.8    7e-04   Brachypodium distachyon [annual false brome]
ref|XP_009416761.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  50.8    8e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT17005.1|  Lipoyl synthase, mitochondrial                        50.8    8e-04   



>ref|XP_004239250.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321026.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321027.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321028.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
Length=820

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 117/154 (76%), Gaps = 7/154 (5%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS+ RDFKD T SS S SD  +F+ASQYAFFGRDIAEE+ELGGLED    +D S  G 
Sbjct  1    MERSNSRDFKDLTSSSGSISDGALFDASQYAFFGRDIAEEVELGGLEDG---QDNSDLGV  57

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                G         EYHLFEK+EGS +GSLSD+DDLATTF KLNR V GPRHPGVIGDRG
Sbjct  58   GGGLGDDEI----QEYHLFEKDEGSVVGSLSDIDDLATTFSKLNRNVTGPRHPGVIGDRG  113

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            SGSFSRESSS ADWAK+AD  DW DQH SDTECY
Sbjct  114  SGSFSRESSSAADWAKEADFHDWFDQHLSDTECY  147



>ref|XP_006354416.1| PREDICTED: uncharacterized protein LOC102594467 isoform X1 [Solanum 
tuberosum]
 ref|XP_006354417.1| PREDICTED: uncharacterized protein LOC102594467 isoform X2 [Solanum 
tuberosum]
Length=821

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 121/154 (79%), Gaps = 7/154 (5%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS+ RDFKD T SSSS SD  +F+ASQYAFFG DIAEE+ELGGLED +   D +    
Sbjct  1    MERSNSRDFKDLTSSSSSISDGALFDASQYAFFGLDIAEEVELGGLEDGQDNSDLA----  56

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                G G GDD + EYHLFEK+EGS +GSLSD+DDLATTF KLNR V GPRHPGVIGDRG
Sbjct  57   ---VGGGLGDDEIQEYHLFEKDEGSAVGSLSDIDDLATTFSKLNRNVTGPRHPGVIGDRG  113

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            SGSFSRESSS A+WAK+AD  DW DQH SDTECY
Sbjct  114  SGSFSRESSSAAEWAKEADFHDWFDQHLSDTECY  147



>ref|XP_006351984.1| PREDICTED: protein PAT1 homolog 1-like [Solanum tuberosum]
Length=816

 Score =   106 bits (264),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 100/154 (65%), Positives = 111/154 (72%), Gaps = 8/154 (5%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  +DF D ++SSSS SDS +F+ASQYAFFGRD  EE+EL                 
Sbjct  1    MERSDCKDFMDLSNSSSSISDSALFDASQYAFFGRDSGEEVEL--------GGLEEEGNN  52

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
             V    GG  D  HEYHLFEK+EGS LGSLSD+DDLATTF KLNR VAGPRHPG+IGDRG
Sbjct  53   CVPVVDGGFGDDTHEYHLFEKDEGSALGSLSDIDDLATTFSKLNRNVAGPRHPGIIGDRG  112

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            SGSFSRESSS A+WAK+ D PD  DQH SDTECY
Sbjct  113  SGSFSRESSSAAEWAKETDFPDCFDQHLSDTECY  146



>ref|XP_004251557.1| PREDICTED: uncharacterized protein LOC101260608 isoform X2 [Solanum 
lycopersicum]
Length=817

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  +DF D ++SSSS SD+ +F+ASQYAFFGRDI EE+EL          +   +  
Sbjct  1    MERSDCKDFMDLSNSSSSISDNALFDASQYAFFGRDIGEEVEL-------GGLEEEGNNC  53

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
              A   G GD   HEYHLFEK+EGS LGSLSD+DDLATTF KLNR VAGPRHPG+IGDRG
Sbjct  54   VPAVDGGFGDVDTHEYHLFEKDEGSALGSLSDIDDLATTFSKLNRNVAGPRHPGIIGDRG  113

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            SGSFSRESS  A+WAK+ D PD  DQH SDTECY
Sbjct  114  SGSFSRESSLAAEWAKETDFPDCFDQHLSDTECY  147



>ref|XP_009594235.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
 ref|XP_009594236.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=822

 Score =   105 bits (262),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 103/155 (66%), Positives = 114/155 (74%), Gaps = 8/155 (5%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasds-GVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  521
            MERS+ RD K    SSSS+     +F+ASQYAFFGRDI+EE+ELGGLEDE+   D +  G
Sbjct  1    MERSNSRDIKGLASSSSSSISDSALFDASQYAFFGRDISEEVELGGLEDEQENNDLAVGG  60

Query  522  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  701
                          HEYHLFEK+EGS L SLSDLDDLATTF KLNR V GPRHPGVIGDR
Sbjct  61   GLGDDEI-------HEYHLFEKDEGSVLSSLSDLDDLATTFSKLNRNVIGPRHPGVIGDR  113

Query  702  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            GSGSFSRESSS A+WAK+AD  DW DQH SDTECY
Sbjct  114  GSGSFSRESSSAAEWAKEADFHDWFDQHLSDTECY  148



>ref|XP_009797313.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana sylvestris]
Length=817

 Score =   104 bits (259),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 104/154 (68%), Positives = 115/154 (75%), Gaps = 7/154 (5%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+D  D + SSSS SDS  F+ASQYAFFGRDI EE+ELGGL       D   +  
Sbjct  1    MERSDGKDSMDLSHSSSSISDSAHFDASQYAFFGRDIGEEVELGGL-------DEEGNSC  53

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
              +   G GD+ V EYHLFEK+EGS LGSLSD+DDLATTF KLNR V GPRHPGVIGDRG
Sbjct  54   VPSVDGGFGDEDVQEYHLFEKDEGSALGSLSDIDDLATTFSKLNRNVTGPRHPGVIGDRG  113

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            SGSFSRESSS A+WAK+ D  DW DQH SDTECY
Sbjct  114  SGSFSRESSSAAEWAKETDFTDWFDQHLSDTECY  147



>ref|XP_009781689.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
 ref|XP_009781690.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
Length=814

 Score =   103 bits (258),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 103/155 (66%), Positives = 112/155 (72%), Gaps = 8/155 (5%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasds-GVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  521
            MERS+ RD K  T SSSS+     +F+ASQYAFFG DIAEE+EL GLEDE+   D    G
Sbjct  1    MERSNSRDIKGLTSSSSSSISDSALFDASQYAFFGLDIAEEVELSGLEDEQENNDLVVGG  60

Query  522  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  701
                          HEYHLFEK+EGS L SLSDLDDLATTF KLNR V GPRHPGVIGDR
Sbjct  61   GLGDDEI-------HEYHLFEKDEGSVLSSLSDLDDLATTFSKLNRNVTGPRHPGVIGDR  113

Query  702  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            GSGSFSRESSS A+WAK+AD  DW DQH SDTECY
Sbjct  114  GSGSFSRESSSAAEWAKEADFHDWFDQHLSDTECY  148



>ref|XP_009595696.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=817

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 115/154 (75%), Gaps = 7/154 (5%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+DF + + SSSS SDS +F+ASQYAFFGRDI EE+ELGGL       D   +  
Sbjct  1    MERSDGKDFNNLSHSSSSISDSALFDASQYAFFGRDIGEEVELGGL-------DEEGNSC  53

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
              +   G GD+ V EYHLF K+EGS LGSLSD+DDLATTF KLNR V GPRHPGVIGDRG
Sbjct  54   VPSVDGGFGDEDVQEYHLFAKDEGSALGSLSDIDDLATTFSKLNRNVTGPRHPGVIGDRG  113

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            SGSFSRESSS A+W K+ D  DW DQH SDTECY
Sbjct  114  SGSFSRESSSAAEWEKETDFTDWFDQHLSDTECY  147



>ref|XP_008229675.1| PREDICTED: protein PAT1 homolog 1-like [Prunus mume]
Length=808

 Score =   102 bits (254),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 87/152 (57%), Positives = 103/152 (68%), Gaps = 13/152 (9%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS+G DF+DF +SSS +SD+ +F+ASQY FFG+ +             V E       
Sbjct  1    MERSNGADFRDFLESSSGSSDNKLFDASQYEFFGQKL-------------VEEVELGGLE  47

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                         +EYHLFEK+EG GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  48   DEEDRKPLFGPVDNEYHLFEKDEGLGLGSLSDVDDLASTFAKLNKVVTGPRHPGVIGDRG  107

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS ADWA+D D  +WLDQH  DTE
Sbjct  108  SGSFSRESSSAADWAQDGDFSNWLDQHMFDTE  139



>ref|XP_010313689.1| PREDICTED: uncharacterized protein LOC101260608 isoform X1 [Solanum 
lycopersicum]
Length=818

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 112/155 (72%), Gaps = 8/155 (5%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasd-sGVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  521
            MERS  +DF D ++SSSS S  + +F+ASQYAFFGRDI EE+EL          +   + 
Sbjct  1    MERSDCKDFMDLSNSSSSISADNALFDASQYAFFGRDIGEEVEL-------GGLEEEGNN  53

Query  522  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  701
               A   G GD   HEYHLFEK+EGS LGSLSD+DDLATTF KLNR VAGPRHPG+IGDR
Sbjct  54   CVPAVDGGFGDVDTHEYHLFEKDEGSALGSLSDIDDLATTFSKLNRNVAGPRHPGIIGDR  113

Query  702  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            GSGSFSRESS  A+WAK+ D PD  DQH SDTECY
Sbjct  114  GSGSFSRESSLAAEWAKETDFPDCFDQHLSDTECY  148



>ref|XP_011085449.1| PREDICTED: protein PAT1 homolog 1-like [Sesamum indicum]
Length=812

 Score =   101 bits (251),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 98/155 (63%), Positives = 114/155 (74%), Gaps = 11/155 (7%)
 Frame = +3

Query  345  MERSSGRDFKDFTd-ssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  521
            MERS G+DF DFTD SSSSAS S +F+ASQYAFFG+DI +E          V        
Sbjct  1    MERSDGKDFNDFTDPSSSSASGSALFDASQYAFFGKDIVDE----------VELGGLGDE  50

Query  522  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  701
                 G  GG++ ++EYHLFEK+EGSGLGSLSD+DDLATTF KLN+VV+GPRHPGVIGDR
Sbjct  51   EEGLPGGFGGEEELNEYHLFEKDEGSGLGSLSDIDDLATTFAKLNKVVSGPRHPGVIGDR  110

Query  702  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            GSGSFSRESSS   W ++AD PDW DQH SD+E Y
Sbjct  111  GSGSFSRESSSATQWTREADFPDWFDQHISDSEYY  145



>ref|XP_011100381.1| PREDICTED: uncharacterized protein LOC105178578 [Sesamum indicum]
Length=815

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 123/155 (79%), Gaps = 8/155 (5%)
 Frame = +3

Query  345  MERSSGRDFKDFT-dssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  521
            MERS G+   DF   SSSS SDS +F+ASQYAFFG+ + +E+ELGGLE E+  ED     
Sbjct  1    MERSDGKGLNDFIHPSSSSVSDSALFDASQYAFFGKGVVDEVELGGLEYED--EDVP---  55

Query  522  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  701
              V GG  GG+D ++EYHLF+K+EGSGLGSLSD+DDLATTF KLNRVV+GPRHPGVIGDR
Sbjct  56   --VIGGKFGGEDELNEYHLFDKDEGSGLGSLSDMDDLATTFAKLNRVVSGPRHPGVIGDR  113

Query  702  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            GSGSFSRESSS  +WA++AD PDW D H SD+ECY
Sbjct  114  GSGSFSRESSSATEWAREADFPDWPDHHMSDSECY  148



>ref|XP_009757677.1| PREDICTED: uncharacterized protein LOC104210470 [Nicotiana sylvestris]
Length=814

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 90/154 (58%), Positives = 107/154 (69%), Gaps = 11/154 (7%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            ME+    DF +   SSSS S+  +F+ASQYAFFG ++             + ED ++   
Sbjct  1    MEKFDSNDFSNLASSSSSISEGALFDASQYAFFGEEVELRD---------LEEDENNGVP  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
             + GGFG  +    EYHLFEK+EGS LGSLSDLDDLATTF KLNR V GPRHPGVIGDRG
Sbjct  52   LLGGGFGDDELP--EYHLFEKDEGSALGSLSDLDDLATTFSKLNRNVTGPRHPGVIGDRG  109

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            SGSFSRESSS A+W K+AD PDW DQ+ SD+ECY
Sbjct  110  SGSFSRESSSAAEWTKEADFPDWFDQNLSDSECY  143



>ref|XP_002264820.1| PREDICTED: protein PAT1 homolog 1-like [Vitis vinifera]
Length=812

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 83/153 (54%), Positives = 95/153 (62%), Gaps = 16/153 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G DFKD  ++SSS     +F+ASQY FFG+                 E+    G 
Sbjct  1    MERSQGLDFKDLPEASSSDG--ALFDASQYEFFGQHAV--------------EEVELGGL  44

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EY LFE+EE  GL SLSD+DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  45   ENEENIPVFGSVDDEYQLFEREESVGLSSLSDIDDLASTFSKLNRVVTGPRNPGVIGDRG  104

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  803
            SGSFSRESSS ADWA+D D P+WLDQH  D EC
Sbjct  105  SGSFSRESSSAADWAQDTDFPNWLDQHMFDAEC  137



>emb|CBI34052.3| unnamed protein product [Vitis vinifera]
Length=513

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 95/153 (62%), Gaps = 16/153 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G DFKD  ++SSS     +F+ASQY FFG+                 E+    G 
Sbjct  1    MERSQGLDFKDLPEASSSDG--ALFDASQYEFFGQHAV--------------EEVELGGL  44

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EY LFE+EE  GL SLSD+DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  45   ENEENIPVFGSVDDEYQLFEREESVGLSSLSDIDDLASTFSKLNRVVTGPRNPGVIGDRG  104

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  803
            SGSFSRESSS ADWA+D D P+WLDQH  D EC
Sbjct  105  SGSFSRESSSAADWAQDTDFPNWLDQHMFDAEC  137



>ref|XP_009602223.1| PREDICTED: uncharacterized protein LOC104097371 [Nicotiana tomentosiformis]
Length=814

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 89/154 (58%), Positives = 107/154 (69%), Gaps = 11/154 (7%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            ME+    DF +   SSSS S+  +F+ASQYAFFG ++             + ED ++   
Sbjct  1    MEKFDSNDFSNLASSSSSVSEGALFDASQYAFFGEEVELRG---------LEEDGNNGVP  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
             + GGFG  +    EYHLFEK+EGS LGSLSDLDDLATTF KLNR V GPRHPGVIGDRG
Sbjct  52   LLGGGFGDDELP--EYHLFEKDEGSALGSLSDLDDLATTFSKLNRNVTGPRHPGVIGDRG  109

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            SGSFSRESSS A+W K++D PDW DQ+ SD+ECY
Sbjct  110  SGSFSRESSSAAEWTKESDFPDWFDQNLSDSECY  143



>ref|XP_009377953.1| PREDICTED: protein PAT1 homolog 1-like [Pyrus x bretschneideri]
Length=817

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 85/152 (56%), Positives = 100/152 (66%), Gaps = 15/152 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS+G DF+D  + SSS +   +F+ASQY FFG+++             V E       
Sbjct  13   MERSNGTDFRDLLERSSSENK--LFDASQYEFFGQNL-------------VDEVELGGLD  57

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
             V           +EYHLFEKEEG GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  58   DVEDRKPLFGPVDNEYHLFEKEEGLGLGSLSDVDDLASTFAKLNKVVTGPRHPGVIGDRG  117

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  118  SGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  149



>gb|EYU42843.1| hypothetical protein MIMGU_mgv1a001457mg [Erythranthe guttata]
Length=816

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 117/155 (75%), Gaps = 8/155 (5%)
 Frame = +3

Query  345  MERSSGRDFKDF-TdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  521
            MERS G DF +F   SSSS SDS +F+ASQY FFG+ + +E+ELGGL      ED     
Sbjct  1    MERSDGNDFNEFLDPSSSSVSDSVLFDASQYTFFGKGMVDEVELGGL------EDEDEGV  54

Query  522  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  701
               AG F G D+  +EYHLF+K+EGSGLGSLSD+DDLATTF KLN+VV GPRHPGVIGDR
Sbjct  55   PVNAGRFSGEDEL-NEYHLFDKDEGSGLGSLSDIDDLATTFAKLNKVVTGPRHPGVIGDR  113

Query  702  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            GSGSFSRESSS  +WA++AD PDW + H SD+ECY
Sbjct  114  GSGSFSRESSSATEWAREADCPDWHEHHMSDSECY  148



>ref|XP_010112872.1| hypothetical protein L484_017708 [Morus notabilis]
 gb|EXC35007.1| hypothetical protein L484_017708 [Morus notabilis]
Length=812

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 90/160 (56%), Positives = 111/160 (69%), Gaps = 21/160 (13%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsG--------VFNASQYAFFGRdiaeeielggledeeVR  500
            MERS G+DF+DF ++SSS    G        +F+AS+Y FFG++  +E+ELGGLE+EE  
Sbjct  1    MERSDGKDFRDFVENSSSKPHLGDLSRSHNALFDASRYEFFGQNAGDEVELGGLEEEEDD  60

Query  501  EDTSSSgapvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRH  680
            +    S                EYHLFE+EE +G GSLSD+DDLA+TF KLN+VV GPRH
Sbjct  61   KTLFGSVDT-------------EYHLFEREESAGFGSLSDIDDLASTFAKLNKVVTGPRH  107

Query  681  PGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            PGVIGDRGSGSFSRESSS ADW +DAD  +WLDQH  DT+
Sbjct  108  PGVIGDRGSGSFSRESSSAADWVQDADFSNWLDQHMFDTD  147



>ref|XP_008342293.1| PREDICTED: protein PAT1 homolog 1-like [Malus domestica]
Length=803

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 98/152 (64%), Gaps = 15/152 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS+G DF+D    SSS +   +F+ASQY FFG+++             V E       
Sbjct  1    MERSNGTDFRDLLXRSSSENK--LFDASQYEFFGQNL-------------VDEVELGGLD  45

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                         +EYHLFEKEEG GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  46   DEEDRKPLFGPVDNEYHLFEKEEGLGLGSLSDIDDLASTFAKLNKVVTGPRHPGVIGDRG  105

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  106  SGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  137



>ref|XP_008378353.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103441447 
[Malus domestica]
Length=804

 Score = 93.6 bits (231),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 100/152 (66%), Gaps = 15/152 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS+G DF+D  +SSSS +   +F+ASQY FFG+++             V E       
Sbjct  1    MERSNGTDFRDLLESSSSENK--LFDASQYEFFGQNV-------------VDEVELGGLD  45

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
               G         +EYHLFEK+E  G+GSLSD+DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  46   HEEGRKPLFGPADNEYHLFEKDEALGMGSLSDIDDLASTFAKLNKVVTGPRHPGVIGDRG  105

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  106  SGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  137



>ref|XP_009375341.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=804

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 100/152 (66%), Gaps = 15/152 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS+G DF+D  +SSSS +   +F+ASQY FFG+++             V E       
Sbjct  1    MERSNGTDFRDVLESSSSENK--LFDASQYEFFGQNV-------------VDEVELGGLD  45

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
               G         +EYHLFEK+E  GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  46   YEEGRKPLFGPADNEYHLFEKDEALGLGSLSDIDDLASTFAKLNKVVTGPRHPGVIGDRG  105

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  106  SGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  137



>ref|XP_009375342.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=801

 Score = 90.5 bits (223),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 90/152 (59%), Gaps = 18/152 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS+G DF+D  +SSSS +   +F+ASQY FFG+++             V E       
Sbjct  1    MERSNGTDFRDVLESSSSENK--LFDASQYEFFGQNV-------------VDEVELGGLD  45

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
               G         +EYHLFEK+E  GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGD  
Sbjct  46   YEEGRKPLFGPADNEYHLFEKDEALGLGSLSDIDDLASTFAKLNKVVTGPRHPGVIGD--  103

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
                   S  T DWA+D D  +WLDQH  DTE
Sbjct  104  -RGSGSFSRETTDWAQDGDFNNWLDQHMFDTE  134



>ref|XP_007217055.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
 gb|EMJ18254.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
Length=886

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 73/129 (57%), Positives = 83/129 (64%), Gaps = 13/129 (10%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            +F+ASQY FFG+               V E                    +EYHLFEK+E
Sbjct  102  LFDASQYEFFGQKS-------------VEEVELGGLEDEEDRKPLFGPVDNEYHLFEKDE  148

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS ADWA+D D  +W
Sbjct  149  GLGLGSLSDVDDLASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSAADWAQDGDFSNW  208

Query  774  LDQHFSDTE  800
            LDQH  DTE
Sbjct  209  LDQHMFDTE  217



>ref|XP_004303935.1| PREDICTED: protein PAT1 homolog 1 [Fragaria vesca subsp. vesca]
Length=806

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 91/155 (59%), Positives = 109/155 (70%), Gaps = 18/155 (12%)
 Frame = +3

Query  345  MERSS---GRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSS  515
            MERS    G DF+D     SS+ ++ +F+ASQY FFG+++AEE+ELGGL+DE  R+    
Sbjct  1    MERSGSGGGADFRDL--LRSSSENNALFDASQYEFFGQNVAEEVELGGLDDENDRKSLFG  58

Query  516  SgapvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIG  695
            S               +EYHLFEK+EG GLGSLSD+DDLATTF KLN+VV GPRHPGVIG
Sbjct  59   SVD-------------NEYHLFEKDEGLGLGSLSDVDDLATTFAKLNKVVTGPRHPGVIG  105

Query  696  DrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            DRGSGSFSRESSS  DWA+D D   WLDQ   DT+
Sbjct  106  DRGSGSFSRESSSATDWAQDGDFGSWLDQQMFDTD  140



>ref|XP_011008549.1| PREDICTED: uncharacterized protein LOC105113895 [Populus euphratica]
Length=788

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 94/152 (62%), Gaps = 18/152 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+DFK+FT+SSS      +F+ASQY FFG+                 E+    G 
Sbjct  1    MERSDGKDFKEFTESSSG----ALFDASQYEFFGQHAV--------------EEVELGGL  42

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
               G          EY LF+++EG  LGSLS++DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  43   EDEGENLLLGPTNDEYRLFDRDEGVCLGSLSEIDDLASTFAKLNRVVTGPRNPGVIGDRG  102

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS  DWA+D +   WLDQ   + E
Sbjct  103  SGSFSRESSSATDWAQDGEFTSWLDQQMLNAE  134



>ref|XP_006373646.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
 gb|ERP51443.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
Length=788

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 94/152 (62%), Gaps = 18/152 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+DFK+FT+SSS      +F+ASQY FFG+                 E+    G 
Sbjct  1    MERSDGKDFKEFTESSSG----ALFDASQYEFFGQHAV--------------EEVELGGL  42

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
               G          EY LF+++EG  LGSLS++DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  43   EDEGENLLLGPTNDEYRLFDRDEGVCLGSLSEIDDLASTFAKLNRVVTGPRNPGVIGDRG  102

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS  DWA+D +   WLDQ   + E
Sbjct  103  SGSFSRESSSATDWAQDGEFTSWLDQQMFNAE  134



>ref|XP_010435003.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 96/147 (65%), Gaps = 16/147 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS+ +DF +F  ++SS +++ +F+ASQY FFG+ + E    G  ED  VR        
Sbjct  1    MERSNSKDFYNFARTTSSDNNNALFDASQYEFFGQSLEEVELGGLDEDASVRGHVDD---  57

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF+K EG+GLGSLS++DDLATTF KLNR V GP+H GVIGDRG
Sbjct  58   -------------EEYHLFDKREGAGLGSLSEMDDLATTFAKLNRNVTGPKHLGVIGDRG  104

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESS+  DW +D +   WLDQH
Sbjct  105  SGSFSRESSTATDWTQDNEFTSWLDQH  131



>ref|XP_010525174.1| PREDICTED: uncharacterized protein LOC104803017 [Tarenaya hassleriana]
Length=784

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 102/153 (67%), Gaps = 15/153 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS   DF +F  +SS      +F+ASQY FFG+++ EE+ELGGL      ED   +  
Sbjct  1    MERSDSWDFNNFARASSDT---ALFDASQYEFFGQNVLEEVELGGL------EDEVETTP  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF+K EG+GLGSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   VPGYADDD------EYHLFDKGEGAGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  105

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  803
            SGSFSRESSS  DW +DA+L  WLDQH  D + 
Sbjct  106  SGSFSRESSSATDWTQDAELSSWLDQHMLDEQA  138



>ref|XP_010532520.1| PREDICTED: uncharacterized protein LOC104808528 [Tarenaya hassleriana]
Length=785

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 95/155 (61%), Gaps = 19/155 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  R   DF+ +SS A    +F+ASQY FFG++              V E+    G 
Sbjct  1    MERSDSRGSYDFSRASSDA---ALFDASQYEFFGQN--------------VVEEVELGGL  43

Query  525  pvaggfgggddgvHE--YHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  698
                          E  YHLF+K EG+GLGSLSD+DDLATTF KLNRVV GP+HPGVIGD
Sbjct  44   EDEEAKAAVLGYADEDAYHLFDKGEGTGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGD  103

Query  699  rgsgsfsresssTADWAKDADLPDWLDQHFSDTEC  803
            RGSGSFSRESSS  DW +DA+L  WLDQH  D + 
Sbjct  104  RGSGSFSRESSSATDWTQDAELSSWLDQHMLDVQA  138



>ref|XP_010496132.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=796

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 93/147 (63%), Gaps = 16/147 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  +DF +F   +SS + S +F+ASQY FFG+ + E    G  ED  VR        
Sbjct  1    MERSDSKDFYNFARKTSSDNKSALFDASQYEFFGQSLEEVELGGLDEDASVRGHVDD---  57

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF+K EG+GLGSLSD+DDLATTF KLNR V GP+H GVIGDRG
Sbjct  58   -------------EEYHLFDKREGAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRG  104

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESS+  DW +D +   WLDQH
Sbjct  105  SGSFSRESSTATDWTQDNEFTSWLDQH  131



>ref|XP_010440363.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 93/147 (63%), Gaps = 16/147 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  +DF +F  ++SS + S +F+ASQY FFG+ + E    G  ED  VR        
Sbjct  1    MERSDSKDFYNFARTTSSDNKSALFDASQYEFFGQSLEEVELGGLDEDASVRGHVDD---  57

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF+K EG+GLGS S++DDLATTF KLNR V GP+H GVIGDRG
Sbjct  58   -------------EEYHLFDKREGTGLGSFSEMDDLATTFAKLNRNVTGPKHLGVIGDRG  104

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESS+  DW +D +   WLDQH
Sbjct  105  SGSFSRESSTATDWTQDNEFTSWLDQH  131



>ref|XP_006481340.1| PREDICTED: uncharacterized protein LOC102618153 isoform X1 [Citrus 
sinensis]
Length=793

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 100/152 (66%), Gaps = 15/152 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+DF +FT +SS +    +F+ASQY FFG+++ EE+ELGGL      ED   + A
Sbjct  1    MERSRGKDFLNFTRTSSGS---AMFDASQYEFFGQNVGEEVELGGL------EDEGDNNA  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
            PV G          EYHLF+K EG GLGSLSD+DDL TTF KLNRVV GPR+PGVIGDR 
Sbjct  52   PVFGSVTDD-----EYHLFDKGEGLGLGSLSDVDDLTTTFAKLNRVVTGPRNPGVIGDRS  106

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
                   S++T DWA+D +  +WLDQ   D E
Sbjct  107  GSFSRESSTAT-DWAQDGEFGNWLDQQMLDLE  137



>ref|XP_006481341.1| PREDICTED: uncharacterized protein LOC102618153 isoform X2 [Citrus 
sinensis]
Length=768

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 100/152 (66%), Gaps = 15/152 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+DF +FT +SS +    +F+ASQY FFG+++ EE+ELGGL      ED   + A
Sbjct  1    MERSRGKDFLNFTRTSSGS---AMFDASQYEFFGQNVGEEVELGGL------EDEGDNNA  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
            PV G          EYHLF+K EG GLGSLSD+DDL TTF KLNRVV GPR+PGVIGDR 
Sbjct  52   PVFGSVTDD-----EYHLFDKGEGLGLGSLSDVDDLTTTFAKLNRVVTGPRNPGVIGDRS  106

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
                   S++T DWA+D +  +WLDQ   D E
Sbjct  107  GSFSRESSTAT-DWAQDGEFGNWLDQQMLDLE  137



>emb|CDY39512.1| BnaA01g24760D [Brassica napus]
Length=774

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 95/146 (65%), Gaps = 10/146 (7%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS+  +S VF+ASQY FFG+++ E    G  +DE +         
Sbjct  1    MERSDSRDLYNFARASSADQNSSVFDASQYDFFGKNLDEMSLGGLDDDEAI---------  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G D   EYHLF+K E  G GSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   -APVLGHPGADADDEYHLFDKAEAGGFGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  110

Query  705  sgsfsresssTADWAKDADLPDWLDQ  782
            SGSFSRESSS  DW  DA+L  WLD+
Sbjct  111  SGSFSRESSSATDWTHDAELTSWLDE  136



>emb|CDP16041.1| unnamed protein product [Coffea canephora]
Length=958

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 90/132 (68%), Positives = 106/132 (80%), Gaps = 5/132 (4%)
 Frame = +3

Query  411  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  590
             +F+ASQYAFFG+DI EE++LGGLE     E   S+  PV GGFG  DD + EYHLF+K+
Sbjct  32   ALFDASQYAFFGKDIVEEVDLGGLE----EEYDDSASIPVLGGFGARDDDLQEYHLFDKD  87

Query  591  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  770
            EGSGLGSLSD+DDLATTF KLNRVV GPRHPGVIGDRGSGSFSRESSS A+W +++D P+
Sbjct  88   EGSGLGSLSDMDDLATTFSKLNRVVTGPRHPGVIGDRGSGSFSRESSSAAEWVQESDFPE  147

Query  771  WLDQHFSDTECY  806
            W D H SD+E Y
Sbjct  148  WRD-HMSDSEFY  158



>ref|XP_009108983.1| PREDICTED: uncharacterized protein LOC103834665 isoform X1 [Brassica 
rapa]
Length=774

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 95/146 (65%), Gaps = 10/146 (7%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS+  +S VF+ASQY FFG+++ E    G  +DE +         
Sbjct  1    MERSDSRDLYNFARASSADQNSSVFDASQYDFFGKNLDEMSLGGLDDDEVI---------  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G D   EYHLF+K E  G GSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   -APVLGHPGADADDEYHLFDKAEAGGFGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  110

Query  705  sgsfsresssTADWAKDADLPDWLDQ  782
            SGSFSRESSS  DW  DA+L  WLD+
Sbjct  111  SGSFSRESSSATDWTHDAELTSWLDE  136



>ref|XP_002308825.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
 gb|EEE92348.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
Length=789

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 92/148 (62%), Gaps = 18/148 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+DFK+FTDSSS      +F+AS+Y FFG+                 E+    G 
Sbjct  1    MERSDGKDFKEFTDSSSG----ALFDASRYEFFGQHAV--------------EEVELGGL  42

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
               G          EY LF+++EG  LGSLS++DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  43   EDEGDNLVLGPADDEYRLFDRDEGVSLGSLSEIDDLASTFAKLNRVVTGPRNPGVIGDRG  102

Query  705  sgsfsresssTADWAKDADLPDWLDQHF  788
            SGSFSRESSS  DWA+D +   WLDQ  
Sbjct  103  SGSFSRESSSATDWAQDGEFAGWLDQQM  130



>dbj|BAF00849.1| hypothetical protein [Arabidopsis thaliana]
Length=782

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 96/147 (65%), Gaps = 13/147 (9%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS   +S +F+ASQY FFG+++ +    G  +D  +         
Sbjct  1    MERSDSRDLYNFVRASSLDKNSTLFDASQYEFFGQNLDDMELGGLDDDGVI---------  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G     EYHLF+K EG+GLGSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   ----APVLGHADDDEYHLFDKGEGAGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  107

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTQDAELTSWLDEQ  134



>ref|NP_188866.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AEE76616.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=782

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 96/147 (65%), Gaps = 13/147 (9%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS   +S +F+ASQY FFG+++ +    G  +D  +         
Sbjct  1    MERSDSRDLYNFVRASSLDKNSTLFDASQYEFFGQNLDDMELGGLDDDGVI---------  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G     EYHLF+K EG+GLGSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   ----APVLGHADDDEYHLFDKGEGAGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  107

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTQDAELTSWLDEQ  134



>ref|XP_011004464.1| PREDICTED: uncharacterized protein LOC105110947 [Populus euphratica]
Length=789

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 92/148 (62%), Gaps = 18/148 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+DFK+FTDSSS      +F+AS+Y FFG+                 E+    G 
Sbjct  1    MERSDGKDFKEFTDSSSG----ALFDASRYEFFGQHDV--------------EEVELGGL  42

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
               G          EY LF+++EG  LGSLS++DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  43   EDEGDNPVLGPADDEYRLFDRDEGVSLGSLSEIDDLASTFAKLNRVVTGPRNPGVIGDRG  102

Query  705  sgsfsresssTADWAKDADLPDWLDQHF  788
            SGSFSRESSS  DWA+D +   WLDQ  
Sbjct  103  SGSFSRESSSATDWAQDGEFAGWLDQQM  130



>ref|XP_011036076.1| PREDICTED: protein PAT1 homolog 1-like [Populus euphratica]
Length=789

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 92/148 (62%), Gaps = 18/148 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+DFK+FTDSSS      +F+AS+Y FFG+                 E+    G 
Sbjct  1    MERSDGKDFKEFTDSSSG----ALFDASRYEFFGQHDV--------------EEVELGGL  42

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
               G          EY LF+++EG  LGSLS++DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  43   EDEGDNPVLGPADDEYRLFDRDEGVSLGSLSEIDDLASTFAKLNRVVTGPRNPGVIGDRG  102

Query  705  sgsfsresssTADWAKDADLPDWLDQHF  788
            SGSFSRESSS  DWA+D +   WLDQ  
Sbjct  103  SGSFSRESSSATDWAQDGEFAGWLDQQM  130



>emb|CDY46332.1| BnaC01g31660D [Brassica napus]
Length=774

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 94/147 (64%), Gaps = 10/147 (7%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS+   S VF+ASQY FFG+++ E +  G  +DE +         
Sbjct  1    MERSESRDLYNFARASSADQKSSVFDASQYDFFGKNLDEMLLGGLDDDEAI---------  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                      D   EYHLF+K E  GLGSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   -APVLGLADADADAEYHLFDKAEAPGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  110

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESSS  DW  D +L  WLD+ 
Sbjct  111  SGSFSRESSSATDWTYDPELTSWLDEQ  137



>ref|XP_002883351.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59610.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
Length=782

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 95/147 (65%), Gaps = 13/147 (9%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS   +S +F+ASQY FFG+++ +    G  +D  +         
Sbjct  1    MERSDSRDLYNFVRASSLDKNSTLFDASQYEFFGQNLDDMEIGGLDDDGVI---------  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G     EYHLF+K EG+GLGSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   ----APVLGHADDDEYHLFDKGEGAGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  107

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESSS  DW  DA+L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTHDAELTSWLDEQ  134



>ref|XP_010036063.1| PREDICTED: protein PAT1 homolog 1-like [Eucalyptus grandis]
 gb|KCW47590.1| hypothetical protein EUGRSUZ_K01336 [Eucalyptus grandis]
Length=806

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 79/152 (52%), Positives = 92/152 (61%), Gaps = 17/152 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  +D K+  D SS      +F+ASQYAFFG+++             V E       
Sbjct  1    MERSDSKDSKELPDGSSG----ALFDASQYAFFGQNL-------------VEEMELGGLE  43

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                 F        EYHLFE+EEG GLGSLS++DDLATTF KLNRVV GPR+PGVIGDRG
Sbjct  44   DGVQDFPVFGPADDEYHLFEREEGGGLGSLSEVDDLATTFAKLNRVVTGPRNPGVIGDRG  103

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS  DWA+D D   W D +  D E
Sbjct  104  SGSFSRESSSATDWAQDGDFSTWPDPYSFDAE  135



>ref|NP_567452.2| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AAK59544.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83534.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=787

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 92/147 (63%), Gaps = 17/147 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RDF +F  +SS  +   +F+ASQY FFG+ + E    G  +D  VR        
Sbjct  1    MERSDSRDFYNFAKTSSDNNS-ALFDASQYEFFGQSLEEVELGGLDDDGTVRGHVDD---  56

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF+K EG+GLGSLSD+DDLATTF KLNR V GP+H GVIGDRG
Sbjct  57   -------------EEYHLFDKREGAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRG  103

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESS+  DW +D +   WLDQH
Sbjct  104  SGSFSRESSTATDWTQDNEFTSWLDQH  130



>ref|XP_004147742.1| PREDICTED: uncharacterized protein LOC101213130 [Cucumis sativus]
 gb|KGN53503.1| hypothetical protein Csa_4G062390 [Cucumis sativus]
Length=808

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 78/153 (51%), Positives = 102/153 (67%), Gaps = 17/153 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            ME+S   D +D   S+ ++S + +F+AS+Y FFG+++  E+ELGG     + ED  +   
Sbjct  1    MEQSDVNDLRD---SAENSSANSLFDASRYEFFGQNVVGEVELGG-----LEEDEDAPLF  52

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EY LF +EE +GLGSLS++DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  53   GSTD---------EEYRLFVREESAGLGSLSEMDDLASTFAKLNKVVTGPRHPGVIGDRG  103

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  803
            SGSFSRESSS  DWA+D D  +WL+QH  D EC
Sbjct  104  SGSFSRESSSATDWAQDGDFCNWLEQHVFDPEC  136



>ref|XP_008451848.1| PREDICTED: uncharacterized protein LOC103493011 [Cucumis melo]
Length=808

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 73/153 (48%), Positives = 94/153 (61%), Gaps = 17/153 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            ME+S   D +D   S+ ++S + +F+AS+Y FFG++              V  +    G 
Sbjct  1    MEQSDVNDLRD---SAENSSANSLFDASRYEFFGQN--------------VVGEVELGGL  43

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EY LF +EE +GLGSLS++DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  44   EEDEDVPLFGSTDEEYRLFVREESAGLGSLSEMDDLASTFAKLNKVVTGPRHPGVIGDRG  103

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  803
            SGSFSRESSS  DWA+D D  +WL+QH  D EC
Sbjct  104  SGSFSRESSSATDWAQDGDFCNWLEQHVFDPEC  136



>ref|XP_009108988.1| PREDICTED: uncharacterized protein LOC103834665 isoform X2 [Brassica 
rapa]
Length=773

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 93/146 (64%), Gaps = 11/146 (8%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS  +   VF+ASQY FFG+++ E    G  +DE +         
Sbjct  1    MERSDSRDLYNFARASSDQNS-SVFDASQYDFFGKNLDEMSLGGLDDDEVI---------  50

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G D   EYHLF+K E  G GSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  51   -APVLGHPGADADDEYHLFDKAEAGGFGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  109

Query  705  sgsfsresssTADWAKDADLPDWLDQ  782
            SGSFSRESSS  DW  DA+L  WLD+
Sbjct  110  SGSFSRESSSATDWTHDAELTSWLDE  135



>ref|XP_006297023.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 ref|XP_006297024.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29921.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29922.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
Length=784

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 97/145 (67%), Gaps = 12/145 (8%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS   +S +F+ASQY FFG+++ E    GGL+D+ V         
Sbjct  1    MERSDSRDLYNFVRASSLDKNSTLFDASQYEFFGQNLDEMEIGGGLDDDGV---------  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G     EYHLF+K EG+GLGSLSD+DDLATTF K+NRVV GP+HPGVIGDRG
Sbjct  52   ---IAPVLGLTDDDEYHLFDKGEGAGLGSLSDMDDLATTFAKINRVVPGPKHPGVIGDRG  108

Query  705  sgsfsresssTADWAKDADLPDWLD  779
            SGSFSRESSS  +W  DA+L  WLD
Sbjct  109  SGSFSRESSSATEWTHDAELTSWLD  133



>ref|XP_002868239.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44498.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
Length=788

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 91/147 (62%), Gaps = 17/147 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RDF  F  +SS  +   +F+ASQY FFG+ + E    G  +D  VR        
Sbjct  1    MERSDSRDFYTFARTSSDKNS-ALFDASQYEFFGQSLEEVELGGLDDDVTVRGHVDD---  56

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF+K EG+GLGSLS++DDLATTF KLNR V GP+H GVIGDRG
Sbjct  57   -------------EEYHLFDKREGAGLGSLSEMDDLATTFAKLNRNVTGPKHLGVIGDRG  103

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESS+  DW +D +   WLDQ+
Sbjct  104  SGSFSRESSTATDWTQDNEFTSWLDQN  130



>gb|KJB08598.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=810

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 73/152 (48%), Positives = 90/152 (59%), Gaps = 16/152 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+    F+ +SS      +F+ASQY FFG++   E+            D      
Sbjct  1    MERSDGKLPSSFSQASSDN---ALFDASQYEFFGQNAVAEV------------DLGGLED  45

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF++ E  GLGSLSD+DDLA+TF KLNRVV GPR+PGVIGD  
Sbjct  46   GEEDSPVFASTEDDEYHLFDRGELVGLGSLSDMDDLASTFAKLNRVVTGPRNPGVIGD-R  104

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS ADW++D D  +W+DQH  D E
Sbjct  105  SGSFSRESSSAADWSQDGDYLNWMDQHMFDVE  136



>ref|XP_006283147.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16045.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=792

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 91/147 (62%), Gaps = 17/147 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  +DF +F  +SS   +  +F+ASQY FFG+ + E    G  +D  VR        
Sbjct  1    MERSDSKDFYNFARTSSDNKN-ALFDASQYEFFGQSLEEVELGGLDDDASVRGHVDDEA-  58

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                           YHLF+K EG+GLGSLSD+DDLATTF KLNR V GP+H GVIGDRG
Sbjct  59   ---------------YHLFDKREGAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRG  103

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESS+  DW +D +   WLDQH
Sbjct  104  SGSFSRESSTATDWTQDNEFTSWLDQH  130



>ref|XP_007049005.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
 gb|EOX93162.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
Length=798

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 102/152 (67%), Gaps = 16/152 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            M+RS G+   +F+ +SS      +F+ASQY FFG++  EE+ELGGL+D E      +S  
Sbjct  1    MDRSDGKLPNNFSQTSSGN---ALFDASQYEFFGQNAMEEVELGGLDDGEQDAPVFASAE  57

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF++ E  GLGSLSD+DDLA+TF KLNRVV GPR+PGVIGD  
Sbjct  58   DD------------EYHLFDRGEVVGLGSLSDMDDLASTFAKLNRVVTGPRNPGVIGD-R  104

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSSTADWA+D +  +WLDQH  D E
Sbjct  105  SGSFSRESSSTADWAQDGEYVNWLDQHMFDAE  136



>gb|KJB08599.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=792

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 90/152 (59%), Gaps = 16/152 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+    F+ +SS      +F+ASQY FFG++   E+            D      
Sbjct  1    MERSDGKLPSSFSQASSDN---ALFDASQYEFFGQNAVAEV------------DLGGLED  45

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF++ E  GLGSLSD+DDLA+TF KLNRVV GPR+PGVIGD  
Sbjct  46   GEEDSPVFASTEDDEYHLFDRGELVGLGSLSDMDDLASTFAKLNRVVTGPRNPGVIGD-R  104

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS ADW++D D  +W+DQH  D E
Sbjct  105  SGSFSRESSSAADWSQDGDYLNWMDQHMFDVE  136



>gb|EPS66560.1| hypothetical protein M569_08215, partial [Genlisea aurea]
Length=772

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  564  HEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTAD  743
            ++Y LF+++EG G+ S SD+DDLATTF K+NR V+GPRHPGVIGDR SGSFSRESSS  D
Sbjct  48   NDYRLFQRDEGLGMDSSSDIDDLATTFAKINRDVSGPRHPGVIGDRASGSFSRESSSATD  107

Query  744  WAKDADLPDWLDQHFSDTECY  806
            WA++AD PDWLD    D + Y
Sbjct  108  WAREADYPDWLDHQLPDFDIY  128



>gb|KJB42926.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=776

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 101/152 (66%), Gaps = 15/152 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            M+RS G+   +F+  SSS +   +F+ASQY FFG++  EE+ELGG     + +D   +  
Sbjct  1    MDRSDGKLHNNFSSLSSSDN--ALFDASQYEFFGQNAMEEVELGG-----LEDDEQDAPV  53

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
              +           EYHLF+K E  GLGSLSD+DDLATTF KLNRVV GPR+PGVIGD  
Sbjct  54   FASPEDD-------EYHLFDKGEVVGLGSLSDVDDLATTFAKLNRVVTGPRNPGVIGD-R  105

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS ADWA+D +  +W+DQH  D +
Sbjct  106  SGSFSRESSSAADWAQDGEYVNWMDQHLFDAD  137



>gb|KJB42927.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=797

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 101/152 (66%), Gaps = 15/152 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            M+RS G+   +F+  SSS +   +F+ASQY FFG++  EE+ELGG     + +D   +  
Sbjct  1    MDRSDGKLHNNFSSLSSSDN--ALFDASQYEFFGQNAMEEVELGG-----LEDDEQDAPV  53

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
              +           EYHLF+K E  GLGSLSD+DDLATTF KLNRVV GPR+PGVIGD  
Sbjct  54   FASPEDD-------EYHLFDKGEVVGLGSLSDVDDLATTFAKLNRVVTGPRNPGVIGD-R  105

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            SGSFSRESSS ADWA+D +  +W+DQH  D +
Sbjct  106  SGSFSRESSSAADWAQDGEYVNWMDQHLFDAD  137



>ref|XP_010488248.1| PREDICTED: uncharacterized protein LOC104766124 [Camelina sativa]
Length=784

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 94/147 (64%), Gaps = 13/147 (9%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS   +S +F+ASQY FFG+++ E    G  +D  +         
Sbjct  1    MERSDSRDLFNFVRASSLDKNSTLFDASQYEFFGQNLDEMEIGGLDDDGVI---------  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G     EYHLF+K EG GLGSLS++DDLATTF K+NR V GP+HPGVIGDRG
Sbjct  52   ----APVLGHTDDDEYHLFDKGEGGGLGSLSEIDDLATTFAKINRNVTGPKHPGVIGDRG  107

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTQDAELTSWLDEQ  134



>ref|XP_010466506.1| PREDICTED: uncharacterized protein LOC104746679 [Camelina sativa]
Length=782

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 93/147 (63%), Gaps = 13/147 (9%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS   ++ +F+ASQY FFG+++ E    G  +D  +         
Sbjct  1    MERSDSRDLYNFVRASSLDKNTTLFDASQYEFFGQNLDEMEIGGLDDDGMI---------  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G     EYHLF+K EG GLGSLS++DDLATTF K+NR V GP+HPGVIGDRG
Sbjct  52   ----APVLGHTDDDEYHLFDKGEGGGLGSLSEIDDLATTFAKINRNVTGPKHPGVIGDRG  107

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESSS  DW  DA+L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTHDAELTSWLDEQ  134



>ref|XP_006414611.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 ref|XP_006414612.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56064.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56065.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
Length=784

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 90/149 (60%), Gaps = 17/149 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsG-VFNASQYAFFGRdiaeeielggledeeVREDTSSSg  521
            MERS  RD      +SS   ++  +F+ASQY FFG+ + E    G  +D  +        
Sbjct  1    MERSDSRDLYSLARASSDNINNSTLFDASQYEFFGQSLEEVELGGLDDDAAL--------  52

Query  522  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  701
                     G     EYHLF+K EG+ LGSLSD+DDLATTF KLNRVV GP+HPGVIG R
Sbjct  53   --------LGHADDEEYHLFDKREGAALGSLSDMDDLATTFAKLNRVVTGPKHPGVIGVR  104

Query  702  gsgsfsresssTADWAKDADLPDWLDQHF  788
            GSGSFSRESS+  DW +D +   WLDQH 
Sbjct  105  GSGSFSRESSTATDWTQDNEFTSWLDQHM  133



>gb|KFK39518.1| hypothetical protein AALP_AA3G254500 [Arabis alpina]
Length=781

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 94/150 (63%), Gaps = 14/150 (9%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS  +   +F+ASQY FFG+++ E    G  +DE +         
Sbjct  1    MERSDSRDLFNFVRASSDTTSK-LFDASQYEFFGQNLDEVSLGGFDDDEVI---------  50

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G     EYHLF+K EG GLGSL+++DDLATTF K+NRVV GP+HPGVIGDRG
Sbjct  51   ----APVLGHADDDEYHLFDKGEGGGLGSLAEMDDLATTFAKINRVVTGPKHPGVIGDRG  106

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSD  794
            SGSFSRESSS  DW  DA+   W+D+   D
Sbjct  107  SGSFSRESSSATDWTHDAEATSWMDEQDQD  136



>ref|XP_008353622.1| PREDICTED: uncharacterized protein LOC103417209 [Malus domestica]
Length=114

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 71/118 (60%), Gaps = 15/118 (13%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS+G DF+D    SSS +   +F+ASQY FFG+++             V E       
Sbjct  1    MERSNGTDFRDLLXRSSSENK--LFDASQYEFFGQNL-------------VDEVELGGLD  45

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  698
                         +EYHLFEKEEG GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGD
Sbjct  46   DEEDRKPLFGPVDNEYHLFEKEEGLGLGSLSDIDDLASTFAKLNKVVTGPRHPGVIGD  103



>ref|XP_010511200.1| PREDICTED: uncharacterized protein LOC104787331 [Camelina sativa]
Length=782

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 91/147 (62%), Gaps = 13/147 (9%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS    S +F+ASQY FFG+++ E    G  +D  +         
Sbjct  1    MERSDSRDLYNFVRASSLDKSSTLFDASQYEFFGQNLDEMEIGGLDDDGVI---------  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G     EYHLF+K EG GLGSLS++DDLATTF K+NR V GP+HPGVIGDRG
Sbjct  52   ----APVLGHTDDDEYHLFDKGEGGGLGSLSEIDDLATTFAKINRNVTGPKHPGVIGDRG  107

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESSS  DW  D +L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTHDVELTSWLDEQ  134



>gb|KHG26425.1| Protein PAT1 [Gossypium arboreum]
Length=795

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 94/152 (62%), Gaps = 16/152 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+   +F  +SS  +    F+ASQY FFG++  EE+ELGGLED EV     +S  
Sbjct  1    MERSDGKLPINFFQTSSDNAH---FDASQYEFFGQNAMEEVELGGLEDGEVEGPVFASIE  57

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF++ +   LGSLSD+DDLA+TF KLNRVV GPRHPGVIGDR 
Sbjct  58   DD------------EYHLFDRGDVGSLGSLSDMDDLASTFAKLNRVVTGPRHPGVIGDRS  105

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
                   SS+T DWA D +  +W+DQH  +TE
Sbjct  106  CSFSRESSSAT-DWAVDGEHLNWMDQHMFETE  136



>ref|XP_006406189.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
 gb|ESQ47642.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
Length=784

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 89/148 (60%), Gaps = 15/148 (10%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  +SS  + S +F+ASQY FFG+++ E    G  +DE +         
Sbjct  1    MERSDSRDLYNFVRASSDQNSS-LFDASQYEFFGQNLDEMSLGGIDDDEMI---------  50

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                    G     EYHLF+K EG+GLGSLSDLDDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  51   ----APVLGHADDDEYHLFDKGEGAGLGSLSDLDDLATTFAKLNRVVTGPKHPGVIGDRG  106

Query  705  sgsfsresssTA-DWAKDADLPDWLDQH  785
                    SS+A DW  D +L  WLD+ 
Sbjct  107  GSGSFSRESSSATDWTHDTELTSWLDEQ  134



>emb|CDY54867.1| BnaC01g22630D [Brassica napus]
Length=764

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 100/156 (64%), Gaps = 15/156 (10%)
 Frame = +3

Query  345  MERSSGRD--FKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSS  518
            MERS  RD  +     SSSS ++  +F+ASQY FFG+ + E    G      + +D ++S
Sbjct  1    MERSDSRDLYYNLARASSSSNNNITLFDASQYEFFGQSLEEVELGG------LDDDDAAS  54

Query  519  gapvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  698
                A    G       YHLF+K EG+GLGSLS++DDLATTF KLNRVV+GP+HPGVIGD
Sbjct  55   VLGHADDGDG-------YHLFDKREGAGLGSLSEMDDLATTFAKLNRVVSGPKHPGVIGD  107

Query  699  rgsgsfsresssTADWAKDADLPDWLDQHFSDTECY  806
            RGSGSFSRESSS  DW +D +   WLDQ   + + +
Sbjct  108  RGSGSFSRESSSATDWTQDNEFTSWLDQQTLEEQAH  143



>gb|EYU43157.1| hypothetical protein MIMGU_mgv1a016393mg [Erythranthe guttata]
Length=123

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 9/120 (8%)
 Frame = +3

Query  345  MERSSGRDFKDFT--dssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSS  518
            ME S G+DF DFT   +S+S S SG+F+ASQYAFFG++I +E ELGGLE          +
Sbjct  1    MESSDGKDFNDFTDPSTSTSVSGSGMFDASQYAFFGKEITDEEELGGLE-------DEEA  53

Query  519  gapvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  698
            G     G  GGD+ ++EYHLF+K+EGSGLGSLSD+DDL TTF KLN++V+GPRHPGVIGD
Sbjct  54   GLSAFTGTFGGDEELNEYHLFDKDEGSGLGSLSDIDDLTTTFAKLNKIVSGPRHPGVIGD  113



>gb|KJB10632.1| hypothetical protein B456_001G212600 [Gossypium raimondii]
Length=796

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 94/152 (62%), Gaps = 16/152 (11%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+   +F  +SS  +    F+AS+Y FFG++  EE+ELGGLED EV     +S  
Sbjct  1    MERSDGKLPINFFQTSSDNAH---FDASRYEFFGQNAMEEVELGGLEDGEVEAPVFASIE  57

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
                          EYHLF++ +   LGSLSD+DDLA+TF KLNRVV GPRHPGVIGDR 
Sbjct  58   DD------------EYHLFDRGDVGSLGSLSDMDDLASTFAKLNRVVTGPRHPGVIGDRS  105

Query  705  sgsfsresssTADWAKDADLPDWLDQHFSDTE  800
                   SS+T DWA D +  +W+DQH  +TE
Sbjct  106  GSFSRESSSAT-DWAVDGEHLNWMDQHMFETE  136



>ref|XP_009147964.1| PREDICTED: protein PAT1 homolog 1 [Brassica rapa]
Length=768

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  570  YHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWA  749
            YHLF+K EG+GLGSLS++DDLATTF KLNRVV+GP+HPGVIGDRGSGSFSRESSS  DW 
Sbjct  64   YHLFDKREGAGLGSLSEMDDLATTFAKLNRVVSGPKHPGVIGDRGSGSFSRESSSATDWT  123

Query  750  KDADLPDWLDQHFSDTECY  806
            +D +   WLDQ   + + +
Sbjct  124  QDNEFTSWLDQQTLEEQAH  142



>emb|CDY50269.1| BnaAnng10330D [Brassica napus]
Length=768

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  570  YHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWA  749
            YHLF+K EG+GLGSLS++DDLATTF KLNRVV+GP+HPGVIGDRGSGSFSRESSS  DW 
Sbjct  64   YHLFDKREGAGLGSLSEMDDLATTFAKLNRVVSGPKHPGVIGDRGSGSFSRESSSATDWT  123

Query  750  KDADLPDWLDQHFSDTECY  806
            +D +   WLDQ   + + +
Sbjct  124  QDNEFTSWLDQQTLEEQAH  142



>emb|CDY37402.1| BnaC05g30280D [Brassica napus]
Length=785

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 94/147 (64%), Gaps = 12/147 (8%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  SSS ++   +F+ASQY FFG+++ E    G  +DE V         
Sbjct  1    MERSDSRDLYNFVRSSSDSNSK-LFDASQYEFFGQNLDEMSLGGIDDDEVV---------  50

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  704
              A   G       EYHLF K EG+GLGSLSD+DDLATTF KLNR V GP+H GVIGDRG
Sbjct  51   --APVLGHTSPDDDEYHLFNKGEGAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRG  108

Query  705  sgsfsresssTADWAKDADLPDWLDQH  785
            SGSFSRESSS  DW  D +L +WLD+ 
Sbjct  109  SGSFSRESSSATDWTHDTELTNWLDEQ  135



>gb|KDO64332.1| hypothetical protein CISIN_1g0038251mg, partial [Citrus sinensis]
 gb|KDO64333.1| hypothetical protein CISIN_1g0038251mg, partial [Citrus sinensis]
 gb|KDO64334.1| hypothetical protein CISIN_1g0038251mg, partial [Citrus sinensis]
Length=112

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 83/118 (70%), Gaps = 14/118 (12%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G+DF +FT +SS ++   +F+ASQY FFG+++ EE+ELGGL      ED   + A
Sbjct  1    MERSRGKDFLNFTRTSSGSA---MFDASQYEFFGQNVGEEVELGGL------EDEGDNNA  51

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  698
            PV G          EYHLF+K EG GLGSLSD+DDL TTF KLNRVV GPR+PGVIGD
Sbjct  52   PVFGSVTD-----DEYHLFDKGEGLGLGSLSDVDDLTTTFAKLNRVVTGPRNPGVIGD  104



>ref|XP_006283146.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16044.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=781

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 78/124 (63%), Gaps = 16/124 (13%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            +F+ASQY FFG+ + E    G  +D  VR                       YHLF+K E
Sbjct  12   LFDASQYEFFGQSLEEVELGGLDDDASVRGHVDDEA----------------YHLFDKRE  55

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G+GLGSLSD+DDLATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   W
Sbjct  56   GAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSW  115

Query  774  LDQH  785
            LDQH
Sbjct  116  LDQH  119



>ref|XP_002520595.1| hypothetical protein RCOM_0673440 [Ricinus communis]
 gb|EEF41828.1| hypothetical protein RCOM_0673440 [Ricinus communis]
Length=739

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            ATTF KLNRVV GPRHPGVIGDRGSGSFSRESSS  DWA+D +L  WLDQ   D E
Sbjct  17   ATTFAKLNRVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDEELASWLDQQMFDIE  72



>gb|KFK23118.1| hypothetical protein AALP_AAs49591U000400 [Arabis alpina]
Length=788

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 92/151 (61%), Gaps = 17/151 (11%)
 Frame = +3

Query  345  MERSSGR-DFKDFTdssssasdsG-VFNASQYAFFGRdiaeeielggledeeVREDTSSS  518
            MERS  R  + +F  +SSS ++   +F+ASQY FFG+               + E     
Sbjct  1    MERSDSRVSYNNFARTSSSENNKSTLFDASQYEFFGQS--------------LEEVELGG  46

Query  519  gapvaggfgggddgvHEYHLFE-KEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIG  695
                A    GG     EYHLF+ K EG+GLGS+S++DDLATTF KLNRVV GP+H GVIG
Sbjct  47   LDDDAATVLGGHVDDEEYHLFDNKREGAGLGSVSEMDDLATTFAKLNRVVTGPKHLGVIG  106

Query  696  DrgsgsfsresssTADWAKDADLPDWLDQHF  788
            DRGSGSFSRESSS  DW +D +   WLDQH 
Sbjct  107  DRGSGSFSRESSSATDWTQDNEFTSWLDQHM  137



>emb|CAN68728.1| hypothetical protein VITISV_033604 [Vitis vinifera]
Length=867

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 66/118 (56%), Gaps = 16/118 (14%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS G DFKD  ++SSS     +F+ASQY FFG+                 E+    G 
Sbjct  1    MERSQGLDFKDLPEASSSDG--ALFDASQYEFFGQHAV--------------EEVELGGL  44

Query  525  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  698
                          EY LFE+EE  GL SLSD+DDLA+TF KLNRVV GPR+PGVIGD
Sbjct  45   ENENNIPVFGSVDDEYQLFEREESVGLSSLSDIDDLASTFSKLNRVVTGPRNPGVIGD  102



>dbj|BAB01945.1| unnamed protein product [Arabidopsis thaliana]
Length=703

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  785
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  5    ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTQDAELTSWLDEQ  55



>ref|XP_006597998.1| PREDICTED: uncharacterized protein LOC100779096 isoform X2 [Glycine 
max]
Length=878

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 79/130 (61%), Gaps = 16/130 (12%)
 Frame = +3

Query  411  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  590
            GVF+ASQYAFFG+D+AEE+EL GL      ED                +   E  L  KE
Sbjct  24   GVFDASQYAFFGKDVAEEVELRGL------EDEDD------YKAMPAAEFKEEDFLLNKE  71

Query  591  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  770
            E   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      SRE+SS ++W++  D+P 
Sbjct  72   EAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE----RGSRENSSASEWSQRDDIPY  127

Query  771  WLDQHFSDTE  800
            W DQH  D E
Sbjct  128  WFDQHAYDPE  137



>ref|XP_010684289.1| PREDICTED: uncharacterized protein LOC104898860 [Beta vulgaris 
subsp. vulgaris]
Length=844

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 81/130 (62%), Gaps = 19/130 (15%)
 Frame = +3

Query  417  FNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEEg  596
            F+ASQY FFGR++ EE+ELGGLED+  R+D S                  EYHLF K+EG
Sbjct  52   FDASQYEFFGRNVGEEVELGGLEDD--RDDIS-----------VVPLHTDEYHLFNKDEG  98

Query  597  sglgslsdldd--lATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  770
              +   S  +   L TT+LKLNR V GPR+PGVIGDRGSGS SRESSS ADW++D     
Sbjct  99   QDVSLASLSEADDLETTYLKLNRAVTGPRNPGVIGDRGSGSLSRESSSAADWSRDG----  154

Query  771  WLDQHFSDTE  800
            WLD    D +
Sbjct  155  WLDHGVGDVD  164



>ref|XP_007133386.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
 gb|ESW05380.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
Length=882

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 71/130 (55%), Gaps = 18/130 (14%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLF-EKE  590
            VF+ASQYAFFG+++               E                    +E  LF  KE
Sbjct  26   VFDASQYAFFGKNV-------------AEEVELGGLEDQDEYKAMLAVEFNEEDLFLNKE  72

Query  591  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  770
            E   + SLSD+DDL TTFLKLN+VV GPR PGVIG+      SRE+SS ++W++  D+P 
Sbjct  73   EAEDIRSLSDIDDLTTTFLKLNKVVTGPRSPGVIGE----RGSRENSSASEWSQRDDIPY  128

Query  771  WLDQHFSDTE  800
            W DQH  D+E
Sbjct  129  WFDQHSYDSE  138



>ref|XP_006597997.1| PREDICTED: uncharacterized protein LOC100779096 isoform X1 [Glycine 
max]
Length=881

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 76/130 (58%), Gaps = 13/130 (10%)
 Frame = +3

Query  411  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  590
            GVF+ASQYAFFG+D+AEE+EL GL      ED                +   E  L  KE
Sbjct  24   GVFDASQYAFFGKDVAEEVELRGL------EDEDD------YKAMPAAEFKEEDFLLNKE  71

Query  591  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  770
            E   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      +   SS ++W++  D+P 
Sbjct  72   EAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE-RGSRENFTDSSASEWSQRDDIPY  130

Query  771  WLDQHFSDTE  800
            W DQH  D E
Sbjct  131  WFDQHAYDPE  140



>emb|CDY10630.1| BnaA05g17320D [Brassica napus]
Length=765

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 92/148 (62%), Gaps = 12/148 (8%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  SSS ++   +F+ASQY FFG+++ E    G  +D+ V      S  
Sbjct  1    MERSDSRDLYNFVRSSSDSNSK-LFDASQYEFFGQNLDEMSLGGIDDDDVVAPVLGHSAT  59

Query  525  pvaggfgggddgvHEYHLFEKE-EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  701
                          EYHLF K  EG+GLGSLSD+DDLATTF KLNR V GP+  GVIGDR
Sbjct  60   DDDD----------EYHLFNKGGEGAGLGSLSDMDDLATTFAKLNRNVTGPKPLGVIGDR  109

Query  702  gsgsfsresssTADWAKDADLPDWLDQH  785
            GSGSFSRESSS  DW  D +L +WLD+ 
Sbjct  110  GSGSFSRESSSATDWTHDTELTNWLDEQ  137



>ref|XP_009145394.1| PREDICTED: uncharacterized protein LOC103869095 [Brassica rapa]
Length=791

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 92/148 (62%), Gaps = 12/148 (8%)
 Frame = +3

Query  345  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  524
            MERS  RD  +F  SSS ++   +F+ASQY FFG+++ E    G  +D+ V      S  
Sbjct  1    MERSDSRDLYNFVRSSSDSNSK-LFDASQYEFFGQNLDEMSLGGIDDDDVVAPVLGHSAT  59

Query  525  pvaggfgggddgvHEYHLFEKE-EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  701
                          EYHLF K  EG+GLGSLSD+DDLATTF KLNR V GP+  GVIGDR
Sbjct  60   DDDD----------EYHLFNKGGEGAGLGSLSDMDDLATTFAKLNRNVTGPKPLGVIGDR  109

Query  702  gsgsfsresssTADWAKDADLPDWLDQH  785
            GSGSFSRESSS  DW  D +L +WLD+ 
Sbjct  110  GSGSFSRESSSATDWTHDTELTNWLDEQ  137



>gb|KDP44628.1| hypothetical protein JCGZ_22047 [Jatropha curcas]
Length=737

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNRVV GPR+ GVIGDRGSGSFSRESSS  DWA+D D   WLDQ   D E
Sbjct  24   ASTFAKLNRVVTGPRNVGVIGDRGSGSFSRESSSATDWAQDEDFSSWLDQQMFDIE  79



>ref|XP_012092372.1| PREDICTED: protein PAT1 homolog 1-like [Jatropha curcas]
Length=749

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNRVV GPR+ GVIGDRGSGSFSRESSS  DWA+D D   WLDQ   D E
Sbjct  36   ASTFAKLNRVVTGPRNVGVIGDRGSGSFSRESSSATDWAQDEDFSSWLDQQMFDIE  91



>emb|CDP13609.1| unnamed protein product [Coffea canephora]
Length=817

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 78/153 (51%), Gaps = 21/153 (14%)
 Frame = +3

Query  342  IMERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  521
            I E S+ +D   F ++ +      VF+ASQYAFFG D              V E      
Sbjct  10   IKESSNSQDLGQFGENPTGD---AVFDASQYAFFGNDA-------------VEEVELGGL  53

Query  522  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  701
                           EY L ++EEG  LGS +++DDLA TF KLN+VV+GPR  G IGD 
Sbjct  54   EDDEDEIPQVGLADEEYQL-DREEGEVLGSFTEIDDLARTFSKLNKVVSGPRDAGAIGD-  111

Query  702  gsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
                 SRESSS A+W ++ D P W DQ+  DTE
Sbjct  112  ---MGSRESSSAAEWVREEDFPSWADQNAFDTE  141



>ref|XP_012087420.1| PREDICTED: protein PAT1 homolog 1 isoform X2 [Jatropha curcas]
Length=804

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 70/124 (56%), Gaps = 18/124 (15%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D              + E+    G           +   E  LF ++E
Sbjct  30   VFDASQYAFFGKD--------------LVEEVELGGLDDEEEALPAAELDEEEFLFGRQE  75

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  + SLSD+DDLA+TF KLN+VV+GPR  GVIGD      SRESSS A+WA+  D P+W
Sbjct  76   GEIVRSLSDIDDLASTFSKLNKVVSGPRGAGVIGD----RGSRESSSAAEWAQGDDFPNW  131

Query  774  LDQH  785
             DQ 
Sbjct  132  FDQQ  135



>ref|XP_012087418.1| PREDICTED: protein PAT1 homolog 1 isoform X1 [Jatropha curcas]
 gb|KDP25122.1| hypothetical protein JCGZ_22657 [Jatropha curcas]
Length=805

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 55/125 (44%), Positives = 70/125 (56%), Gaps = 18/125 (14%)
 Frame = +3

Query  411  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  590
             VF+ASQYAFFG+D              + E+    G           +   E  LF ++
Sbjct  30   AVFDASQYAFFGKD--------------LVEEVELGGLDDEEEALPAAELDEEEFLFGRQ  75

Query  591  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  770
            EG  + SLSD+DDLA+TF KLN+VV+GPR  GVIGD      SRESSS A+WA+  D P+
Sbjct  76   EGEIVRSLSDIDDLASTFSKLNKVVSGPRGAGVIGD----RGSRESSSAAEWAQGDDFPN  131

Query  771  WLDQH  785
            W DQ 
Sbjct  132  WFDQQ  136



>ref|XP_007049006.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
 gb|EOX93163.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
Length=724

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +3

Query  648  KLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            KLNRVV GPR+PGVIGD  SGSFSRESSSTADWA+D +  +WLDQH  D E
Sbjct  13   KLNRVVTGPRNPGVIGD-RSGSFSRESSSTADWAQDGEYVNWLDQHMFDAE  62



>gb|KHN16432.1| hypothetical protein glysoja_046875 [Glycine soja]
Length=823

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +3

Query  567  EYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADW  746
            E  L  KEE   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      SRE+SS ++W
Sbjct  9    EDFLLNKEEAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE----RGSRENSSASEW  64

Query  747  AKDADLPDWLDQHFSDTE  800
            ++  D+P W DQH  D E
Sbjct  65   SQRDDIPYWFDQHAYDPE  82



>ref|XP_006597999.1| PREDICTED: uncharacterized protein LOC100779096 isoform X3 [Glycine 
max]
Length=826

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +3

Query  567  EYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADW  746
            E  L  KEE   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      +   SS ++W
Sbjct  9    EDFLLNKEEAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE-RGSRENFTDSSASEW  67

Query  747  AKDADLPDWLDQHFSDTE  800
            ++  D+P W DQH  D E
Sbjct  68   SQRDDIPYWFDQHAYDPE  85



>emb|CAB10277.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78541.1| hypothetical protein [Arabidopsis thaliana]
Length=679

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  785
            ATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   WLDQH
Sbjct  5    ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSWLDQH  55



>ref|XP_004514400.1| PREDICTED: uncharacterized protein LOC101512706 [Cicer arietinum]
Length=880

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 70/129 (54%), Gaps = 18/129 (14%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D              V E+    G      +        E      EE
Sbjct  31   VFDASQYAFFGKD--------------VAEEVELGGLDDENDYIPSVAFNEEEFFLNGEE  76

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
               + SLSD+DDL TTFLKLN+VV+GPR  GVIGD      SRE+SS ++W++  ++P W
Sbjct  77   ADDVRSLSDIDDLTTTFLKLNKVVSGPRSAGVIGD----RVSRENSSASEWSQRDEIPYW  132

Query  774  LDQHFSDTE  800
            +D H  D+E
Sbjct  133  VDHHTYDSE  141



>ref|XP_010923783.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923784.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923785.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
Length=814

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 57/133 (43%), Positives = 75/133 (56%), Gaps = 18/133 (14%)
 Frame = +3

Query  417  FNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYH---LFEK  587
            F+ASQYAFFG+++             + E          G  G       EYH   + ++
Sbjct  30   FDASQYAFFGKEV-------------MEEVELGGLEDDDGDAGFIGRDDEEYHFRSIGDR  76

Query  588  EEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLP  767
            EE  GLGSLSD+DDL +TF KLNR ++ PR+ GVIGDRGS S    S  TADW ++AD  
Sbjct  77   EEVEGLGSLSDIDDLTSTFEKLNRTISDPRNAGVIGDRGSFSRESSS--TADWTQEADSS  134

Query  768  DWLDQHFSDTECY  806
            +W+DQ+  D E Y
Sbjct  135  NWIDQNILDAENY  147



>ref|XP_009406732.1| PREDICTED: uncharacterized protein LOC103989576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=811

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +3

Query  636  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            +TF KLNRVV+ PR  GVIGDRGS S    S  TADWA++AD P W+DQ   D E
Sbjct  93   STFRKLNRVVSEPRSVGVIGDRGSFSRESSS--TADWAQEADFPSWIDQEILDAE  145



>ref|XP_009406733.1| PREDICTED: uncharacterized protein LOC103989576 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=793

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +3

Query  636  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            +TF KLNRVV+ PR  GVIGDRGS S    S  TADWA++AD P W+DQ   D E
Sbjct  93   STFRKLNRVVSEPRSVGVIGDRGSFSRESSS--TADWAQEADFPSWIDQEILDAE  145



>gb|KDO64335.1| hypothetical protein CISIN_1g0038251mg, partial [Citrus sinensis]
Length=100

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 67/95 (71%), Gaps = 11/95 (12%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            +F+ASQY FFG+++ EE+ELGGL      ED   + APV G          EYHLF+K E
Sbjct  9    MFDASQYEFFGQNVGEEVELGGL------EDEGDNNAPVFGSVTD-----DEYHLFDKGE  57

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  698
            G GLGSLSD+DDL TTF KLNRVV GPR+PGVIGD
Sbjct  58   GLGLGSLSDVDDLTTTFAKLNRVVTGPRNPGVIGD  92



>ref|NP_001044369.2| Os01g0769000 [Oryza sativa Japonica Group]
 dbj|BAD52714.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD53338.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94608.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06283.2| Os01g0769000 [Oryza sativa Japonica Group]
Length=809

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+DA+ P+W+DQ   + E
Sbjct  87   ASTFAKLNRSISGTRNPGVIGD--RRSISRGSSLTVDWAEDAEFPNWVDQDILEGE  140



>ref|XP_010243929.1| PREDICTED: protein PAT1 homolog 1-like [Nelumbo nucifera]
Length=826

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 60/145 (41%), Positives = 77/145 (53%), Gaps = 17/145 (12%)
 Frame = +3

Query  372  KDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfggg  551
            KDF   + S+S+   F+ASQYAFFG+D+             + E           G    
Sbjct  17   KDFKGLAESSSEDARFDASQYAFFGKDV-------------MEEVELGGLEDEDDGVPLI  63

Query  552  ddgvHEYHLFEKEEgsglg--slsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsre  725
                 EY L ++EE  G G  SLSD+DDLA+TF KLN  V+ PR  GVIG+ GS S    
Sbjct  64   GFDGDEYALSDREELQGEGVGSLSDIDDLASTFSKLNSAVSKPRTAGVIGEMGSFSRESS  123

Query  726  sssTADWAKDADLPDWLDQHFSDTE  800
            S    DWA+D+D P+WLD H  +TE
Sbjct  124  S--ATDWAQDSDFPNWLDTHIFETE  146



>gb|KHG07822.1| Protein PAT1 [Gossypium arboreum]
Length=785

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 69/129 (53%), Gaps = 18/129 (14%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG D              V E+    G               E  LF++EE
Sbjct  19   VFDASQYAFFGND--------------VLEEVELGGLDGDDEDLPAAGLDEEEFLFDQEE  64

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L +LSD+DDL +TF KLN  V+ PR  G+IGD      SRESSS A+WA+  + P W
Sbjct  65   GGVLRALSDIDDLESTFSKLNTAVSRPRGSGIIGD----RGSRESSSVAEWAQGEEFPYW  120

Query  774  LDQHFSDTE  800
            LDQH  +TE
Sbjct  121  LDQHALETE  129



>gb|EAZ23222.1| hypothetical protein OsJ_06910 [Oryza sativa Japonica Group]
Length=825

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+D + P+W+DQ   + E
Sbjct  103  ASTFAKLNRTISGTRNPGVIGD--RRSISRGSSLTVDWAEDVEFPNWVDQDILEDE  156



>gb|EAY86044.1| hypothetical protein OsI_07409 [Oryza sativa Indica Group]
Length=825

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+D + P+W+DQ   + E
Sbjct  103  ASTFAKLNRTISGTRNPGVIGD--RRSISRGSSLTVDWAEDVEFPNWVDQDILEDE  156



>ref|NP_001046960.1| Os02g0517300 [Oryza sativa Japonica Group]
 dbj|BAD46717.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD46150.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08874.1| Os02g0517300 [Oryza sativa Japonica Group]
Length=815

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+D + P+W+DQ   + E
Sbjct  93   ASTFAKLNRTISGTRNPGVIGD--RRSISRGSSLTVDWAEDVEFPNWVDQDILEDE  146



>emb|CBI21787.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 81/129 (63%), Gaps = 20/129 (16%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D+ EE+ELGGLEDE++                       E  L ++EE
Sbjct  16   VFDASQYAFFGKDVVEEVELGGLEDEDL----------------PVAGFDEEEFLLDREE  59

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+DDLA+TF KL   V+GPR+ G+IGD      SRESSS A+WA++ DL  W
Sbjct  60   GEVLRSLSDIDDLASTFSKLETGVSGPRNAGIIGD----RGSRESSSAAEWAQEEDLHYW  115

Query  774  LDQHFSDTE  800
             DQH  +TE
Sbjct  116  FDQHMFETE  124



>gb|KHG07107.1| Protein PAT1 [Gossypium arboreum]
Length=716

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +3

Query  648  KLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            KLNRVV GPR+PGVIGD  SGSFSRESSS ADWA+D +  +W+DQH  D +
Sbjct  7    KLNRVVTGPRNPGVIGD-RSGSFSRESSSAADWAQDGEYVNWMDQHLFDAD  56



>ref|XP_011038109.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Populus euphratica]
Length=798

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 70/129 (54%), Gaps = 19/129 (15%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D                E+    G          D    E+ LF+++E
Sbjct  23   VFDASQYAFFGKDHV--------------EEVELGGLEDDEELPAADFEEEEF-LFDRQE  67

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+DDLA TF KLN+ V GPR  G+IGD      SRESSS A+WA+  D P+W
Sbjct  68   GEVLRSLSDIDDLAITFSKLNKGVNGPRSTGIIGD----RGSRESSSAAEWAQGEDFPNW  123

Query  774  LDQHFSDTE  800
             DQ   D +
Sbjct  124  SDQQLLDQD  132



>ref|XP_011038110.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Populus euphratica]
Length=797

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 70/129 (54%), Gaps = 19/129 (15%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D                E+    G          D    E+ LF+++E
Sbjct  22   VFDASQYAFFGKDHV--------------EEVELGGLEDDEELPAADFEEEEF-LFDRQE  66

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+DDLA TF KLN+ V GPR  G+IGD      SRESSS A+WA+  D P+W
Sbjct  67   GEVLRSLSDIDDLAITFSKLNKGVNGPRSTGIIGD----RGSRESSSAAEWAQGEDFPNW  122

Query  774  LDQHFSDTE  800
             DQ   D +
Sbjct  123  SDQQLLDQD  131



>ref|XP_002441360.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
 gb|EES19790.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
Length=802

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  794
            A+TF  LNR ++G R+PGVIGD    S SRESS TADWA+DAD  +W+DQ   D
Sbjct  92   ASTFAMLNRSISGTRNPGVIGD--RRSISRESSLTADWAQDADFSNWVDQDILD  143



>ref|XP_011014090.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Populus euphratica]
Length=797

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 70/129 (54%), Gaps = 19/129 (15%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D                E+    G          D    E+ LF+++E
Sbjct  23   VFDASQYAFFGKDHV--------------EEVELGGLEDDEELPAADFEEEEF-LFDRQE  67

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+DDLA TF KLN+ V GPR  G+IGD      SRESSS A+WA+  D P+W
Sbjct  68   GEVLRSLSDIDDLAITFSKLNKGVNGPRSTGIIGD----RGSRESSSAAEWAQGEDFPNW  123

Query  774  LDQHFSDTE  800
             DQ   D +
Sbjct  124  SDQQLLDQD  132



>ref|XP_011014091.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Populus euphratica]
Length=796

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 70/129 (54%), Gaps = 19/129 (15%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D                E+    G          D    E+ LF+++E
Sbjct  22   VFDASQYAFFGKDHV--------------EEVELGGLEDDEELPAADFEEEEF-LFDRQE  66

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+DDLA TF KLN+ V GPR  G+IGD      SRESSS A+WA+  D P+W
Sbjct  67   GEVLRSLSDIDDLAITFSKLNKGVNGPRSTGIIGD----RGSRESSSAAEWAQGEDFPNW  122

Query  774  LDQHFSDTE  800
             DQ   D +
Sbjct  123  SDQQLLDQD  131



>ref|XP_010645006.1| PREDICTED: uncharacterized protein LOC100267869 isoform X1 [Vitis 
vinifera]
Length=828

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 66/129 (51%), Positives = 82/129 (64%), Gaps = 20/129 (16%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D+ EE+ELGGLED    ED   +G               E  L ++EE
Sbjct  31   VFDASQYAFFGKDVVEEVELGGLED----EDLPVAGFD------------EEEFLLDREE  74

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+DDLA+TF KL   V+GPR+ G+IGD      SRESSS A+WA++ DL  W
Sbjct  75   GEVLRSLSDIDDLASTFSKLETGVSGPRNAGIIGD----RGSRESSSAAEWAQEEDLHYW  130

Query  774  LDQHFSDTE  800
             DQH  +TE
Sbjct  131  FDQHMFETE  139



>gb|KJB82133.1| hypothetical protein B456_013G178200 [Gossypium raimondii]
Length=785

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 68/129 (53%), Gaps = 18/129 (14%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG D              V E+    G               E  LF++EE
Sbjct  19   VFDASQYAFFGND--------------VLEEVELGGIDDEDEDLPAAGLDEEEFLFDQEE  64

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L +LSD+DDL +TF KLN  V+ PR  G+IGD      SRESSS A+WA+  + P W
Sbjct  65   GGVLRALSDIDDLESTFSKLNTAVSRPRGSGIIGD----RGSRESSSVAEWAQGEEFPYW  120

Query  774  LDQHFSDTE  800
            LDQ   +TE
Sbjct  121  LDQQALETE  129



>ref|XP_009399054.1| PREDICTED: protein PAT1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=822

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 71/132 (54%), Gaps = 18/132 (14%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYH---LFE  584
            +F+ASQYAFFG+ +             + E          G   G      EYH   + +
Sbjct  34   LFDASQYAFFGKGV-------------MEEVELGCIEDNGGDNAGFIGIDDEYHFSTVGD  80

Query  585  KEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADL  764
            +EE   L SLSD DDLA+TF KLNRVV  PR  GVIGD   GS SRESSST DW ++ D 
Sbjct  81   REEAVVLDSLSDADDLASTFAKLNRVVNDPRTAGVIGD--RGSSSRESSSTVDWTQEGDY  138

Query  765  PDWLDQHFSDTE  800
             +W+DQ   D E
Sbjct  139  LNWIDQRILDAE  150



>ref|XP_006646364.1| PREDICTED: uncharacterized protein LOC102701783 [Oryza brachyantha]
Length=808

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNR ++G R+PGVIGD    S SR SS T DW +D + P+W+DQ   + E
Sbjct  86   ASTFAKLNRSISGTRNPGVIGD--RRSISRGSSLTVDWPEDVEFPNWVDQDILEDE  139



>ref|XP_002300546.2| hypothetical protein POPTR_0001s46190g [Populus trichocarpa]
 gb|EEE85351.2| hypothetical protein POPTR_0001s46190g [Populus trichocarpa]
Length=801

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 68/129 (53%), Gaps = 19/129 (15%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D                E+    G          D    E+ LF+++E
Sbjct  23   VFDASQYAFFGKDHV--------------EEVELGGLEDGEELPAADFEEEEF-LFDRQE  67

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+D LA TF KLN+ V GPR  G+I D      SRESSS A+WA+  D P+W
Sbjct  68   GEVLRSLSDIDGLAITFSKLNKGVNGPRSTGIISD----RGSRESSSAAEWAQGEDFPNW  123

Query  774  LDQHFSDTE  800
             DQ   D +
Sbjct  124  FDQQLLDQD  132



>ref|XP_004961543.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Setaria italica]
Length=813

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNR ++G R+PGVIGD    S SRESS T DW +DAD   W+DQ   D +
Sbjct  93   ASTFAKLNRSISGTRNPGVIGD--RRSISRESSLTTDWVQDADFHSWVDQGMLDGD  146



>ref|XP_003569904.1| PREDICTED: uncharacterized protein LOC100838182 [Brachypodium 
distachyon]
Length=805

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNR V+G R+PGVIGD    S SR SS T DW +D + P+W DQ   + E
Sbjct  84   ASTFAKLNRTVSGTRNPGVIGD--RRSISRGSSFTVDWDEDVEFPNWQDQDILENE  137



>ref|XP_004961544.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Setaria italica]
Length=731

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNR ++G R+PGVIGD    S SRESS T DW +DAD   W+DQ   D +
Sbjct  11   ASTFAKLNRSISGTRNPGVIGD--RRSISRESSLTTDWVQDADFHSWVDQGMLDGD  64



>ref|XP_006478034.1| PREDICTED: uncharacterized protein LOC102611484 isoform X2 [Citrus 
sinensis]
Length=791

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 69/129 (53%), Gaps = 18/129 (14%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D              V E+    G               E  LF+KEE
Sbjct  24   VFDASQYAFFGKD--------------VVEEVELGGLEDEEDNLPAPAYDEEEFLFDKEE  69

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+DDLA+TF KLN  V+GPR  G+IGD      SRESSS A+W +  D  + 
Sbjct  70   GEVLRSLSDIDDLASTFSKLNTDVSGPRGAGIIGD----WGSRESSSAAEWVQGDDYRNL  125

Query  774  LDQHFSDTE  800
            L+Q   DTE
Sbjct  126  LEQQMLDTE  134



>ref|XP_006478033.1| PREDICTED: uncharacterized protein LOC102611484 isoform X1 [Citrus 
sinensis]
Length=792

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 69/129 (53%), Gaps = 18/129 (14%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D              V E+    G               E  LF+KEE
Sbjct  25   VFDASQYAFFGKD--------------VVEEVELGGLEDEEDNLPAPAYDEEEFLFDKEE  70

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+DDLA+TF KLN  V+GPR  G+IGD      SRESSS A+W +  D  + 
Sbjct  71   GEVLRSLSDIDDLASTFSKLNTDVSGPRGAGIIGD----WGSRESSSAAEWVQGDDYRNL  126

Query  774  LDQHFSDTE  800
            L+Q   DTE
Sbjct  127  LEQQMLDTE  135



>gb|KDO40140.1| hypothetical protein CISIN_1g003844mg [Citrus sinensis]
Length=791

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 69/129 (53%), Gaps = 18/129 (14%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D              V E+    G               E  LF+KEE
Sbjct  24   VFDASQYAFFGKD--------------VVEEVELGGLEDEEDNLPAPAYDEEEFLFDKEE  69

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+DDLA+TF KLN  V+GPR  G+IGD      SRESSS A+W +  D  + 
Sbjct  70   GEVLRSLSDIDDLASTFSKLNTDVSGPRGAGIIGD----WGSRESSSAAEWVQGDDYRNL  125

Query  774  LDQHFSDTE  800
            L+Q   DTE
Sbjct  126  LEQQMLDTE  134



>ref|XP_006441043.1| hypothetical protein CICLE_v10018922mg [Citrus clementina]
 gb|ESR54283.1| hypothetical protein CICLE_v10018922mg [Citrus clementina]
 gb|KDO40139.1| hypothetical protein CISIN_1g003844mg [Citrus sinensis]
Length=792

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 69/129 (53%), Gaps = 18/129 (14%)
 Frame = +3

Query  414  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  593
            VF+ASQYAFFG+D              V E+    G               E  LF+KEE
Sbjct  25   VFDASQYAFFGKD--------------VVEEVELGGLEDEEDNLPAPAYDEEEFLFDKEE  70

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
            G  L SLSD+DDLA+TF KLN  V+GPR  G+IGD      SRESSS A+W +  D  + 
Sbjct  71   GEVLRSLSDIDDLASTFSKLNTDVSGPRGAGIIGD----WGSRESSSAAEWVQGDDYRNL  126

Query  774  LDQHFSDTE  800
            L+Q   DTE
Sbjct  127  LEQQMLDTE  135



>ref|XP_010243919.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Nelumbo nucifera]
Length=824

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +3

Query  636  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            +TF KLN+ V+ PR  GVIGDRGS S    S  T +WA+++D P+WLD H  D+E
Sbjct  93   STFSKLNKAVSEPRTAGVIGDRGSFSRESSS--TTEWAQESDFPNWLDPHIFDSE  145



>ref|XP_010243918.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Nelumbo nucifera]
Length=825

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +3

Query  636  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            +TF KLN+ V+ PR  GVIGDRGS S    S  T +WA+++D P+WLD H  D+E
Sbjct  94   STFSKLNKAVSEPRTAGVIGDRGSFSRESSS--TTEWAQESDFPNWLDPHIFDSE  146



>ref|XP_008793552.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Phoenix dactylifera]
Length=815

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 17/131 (13%)
 Frame = +3

Query  417  FNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYH-LFEKEE  593
            F+ASQYAFFG++              V E+    G     GF G  D  + +  + ++EE
Sbjct  33   FDASQYAFFGKE--------------VMEEVELGGLEDDAGFIGLHDEEYRFSSIGDREE  78

Query  594  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  773
              GLGSLSD+DDL +TF KLNR ++ PR  GVIGD    SFSRESSSTADW ++AD  +W
Sbjct  79   VEGLGSLSDIDDLTSTFAKLNRTISDPRSAGVIGD--RRSFSRESSSTADWMQEADCSNW  136

Query  774  LDQHFSDTECY  806
            +D++  D E +
Sbjct  137  IDENIIDAENF  147



>ref|XP_008649853.1| PREDICTED: uncharacterized protein LOC103630586 [Zea mays]
 gb|AFW78649.1| hypothetical protein ZEAMMB73_732523 [Zea mays]
Length=797

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  794
            A+TF  LNR ++G R+PG+IGD    S SRESS TADW +DAD  +W+DQ   D
Sbjct  86   ASTFAMLNRNISGTRNPGIIGD--RRSISRESSLTADWVQDADFSNWVDQDILD  137



>ref|XP_009416760.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=836

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +3

Query  636  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            +TF KLNRVV+ PR  G+IGD   GSFSRESSS A+W ++AD P W+DQ   D E
Sbjct  120  STFRKLNRVVSEPRSVGIIGD--RGSFSRESSSAAEWTQEADFPSWIDQEIFDAE  172



>ref|XP_009416762.1| PREDICTED: protein PAT1 homolog 1-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=742

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +3

Query  636  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            +TF KLNRVV+ PR  G+IGD   GSFSRESSS A+W ++AD P W+DQ   D E
Sbjct  26   STFRKLNRVVSEPRSVGIIGD--RGSFSRESSSAAEWTQEADFPSWIDQEIFDAE  78



>ref|XP_003568135.1| PREDICTED: protein PAT1 homolog 1-like [Brachypodium distachyon]
Length=806

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLD  779
            A+TF KLNR ++G R+PGVIGD    S SRESS T DW  +AD P+W+D
Sbjct  90   ASTFAKLNRTISGTRNPGVIGD--RRSISRESSLTNDWVPEADFPNWVD  136



>ref|XP_009416761.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=808

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +3

Query  636  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            +TF KLNRVV+ PR  G+IGD   GSFSRESSS A+W ++AD P W+DQ   D E
Sbjct  92   STFRKLNRVVSEPRSVGIIGD--RGSFSRESSSAAEWTQEADFPSWIDQEIFDAE  144



>gb|EMT17005.1| Lipoyl synthase, mitochondrial [Aegilops tauschii]
Length=1181

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +3

Query  633  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  800
            A+TF KLNR + G R+PGVIGD    S SRESS T DWA++A+  +W+D    D++
Sbjct  93   ASTFAKLNRSIGGTRNPGVIGD--RRSISRESSLTTDWAQEAEFSNWVDHDILDSD  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1683214431688