BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7931

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614453.1|  PREDICTED: putative leucine--tRNA ligase, mi...    232   5e-67   Nicotiana tomentosiformis
gb|KDO78326.1|  hypothetical protein CISIN_1g002217mg                   223   2e-65   Citrus sinensis [apfelsine]
ref|XP_004232688.1|  PREDICTED: putative leucine--tRNA ligase, mi...    227   2e-65   
ref|XP_010316571.1|  PREDICTED: putative leucine--tRNA ligase, mi...    227   2e-65   
ref|XP_006348152.1|  PREDICTED: putative leucine--tRNA ligase, mi...    226   7e-65   Solanum tuberosum [potatoes]
ref|XP_010686792.1|  PREDICTED: putative leucine--tRNA ligase, mi...    225   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009800377.1|  PREDICTED: putative leucine--tRNA ligase, mi...    224   2e-64   Nicotiana sylvestris
ref|XP_006449782.1|  hypothetical protein CICLE_v10014171mg             223   4e-64   Citrus clementina [clementine]
ref|XP_006467397.1|  PREDICTED: putative leucine--tRNA ligase, mi...    223   5e-64   Citrus sinensis [apfelsine]
gb|KDO78323.1|  hypothetical protein CISIN_1g002217mg                   223   5e-64   Citrus sinensis [apfelsine]
gb|KDO78324.1|  hypothetical protein CISIN_1g002217mg                   223   5e-64   Citrus sinensis [apfelsine]
ref|XP_006467396.1|  PREDICTED: putative leucine--tRNA ligase, mi...    223   6e-64   Citrus sinensis [apfelsine]
ref|XP_011002586.1|  PREDICTED: putative leucine--tRNA ligase, mi...    223   7e-64   Populus euphratica
gb|EPS64803.1|  hypothetical protein M569_09978                         207   7e-64   Genlisea aurea
ref|XP_004134980.1|  PREDICTED: putative leucine--tRNA ligase, mi...    222   1e-63   Cucumis sativus [cucumbers]
gb|KGN49082.1|  hypothetical protein Csa_6G513460                       223   2e-63   Cucumis sativus [cucumbers]
ref|XP_008440038.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    221   3e-63   Cucumis melo [Oriental melon]
ref|XP_002264138.1|  PREDICTED: putative leucine--tRNA ligase, mi...    221   5e-63   Vitis vinifera
ref|XP_007026156.1|  TRNA synthetase class I (I, L, M and V) fami...    218   6e-63   
ref|XP_011095981.1|  PREDICTED: putative leucine--tRNA ligase, mi...    220   8e-63   Sesamum indicum [beniseed]
ref|XP_010057899.1|  PREDICTED: putative leucine--tRNA ligase, mi...    219   2e-62   
ref|XP_007026155.1|  TRNA synthetase class I (I, L, M and V) fami...    219   2e-62   
ref|XP_002317141.1|  hypothetical protein POPTR_0011s01420g             216   1e-61   
ref|XP_008384092.1|  PREDICTED: putative leucine--tRNA ligase, mi...    216   1e-61   
ref|XP_002518434.1|  leucyl-tRNA synthetase, putative                   216   1e-61   Ricinus communis
ref|XP_007153983.1|  hypothetical protein PHAVU_003G081300g             214   6e-61   Phaseolus vulgaris [French bean]
emb|CAN74190.1|  hypothetical protein VITISV_036142                     214   8e-61   Vitis vinifera
ref|XP_007153984.1|  hypothetical protein PHAVU_003G081300g             214   8e-61   Phaseolus vulgaris [French bean]
gb|KFK30967.1|  hypothetical protein AALP_AA6G050800                    214   1e-60   Arabis alpina [alpine rockcress]
ref|XP_008224706.1|  PREDICTED: putative leucine--tRNA ligase, mi...    214   1e-60   Prunus mume [ume]
ref|XP_010422266.1|  PREDICTED: putative leucine--tRNA ligase, mi...    213   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_007213686.1|  hypothetical protein PRUPE_ppa000869mg             213   2e-60   Prunus persica
ref|XP_010432889.1|  PREDICTED: putative leucine--tRNA ligase, mi...    213   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_002872690.1|  EMB2369                                            213   2e-60   
ref|XP_010422265.1|  PREDICTED: putative leucine--tRNA ligase, mi...    213   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_012091308.1|  PREDICTED: putative leucine--tRNA ligase, mi...    213   3e-60   
ref|XP_004295290.1|  PREDICTED: putative leucine--tRNA ligase, mi...    213   3e-60   Fragaria vesca subsp. vesca
ref|XP_006396696.1|  hypothetical protein EUTSA_v10028396mg             213   3e-60   Eutrema salsugineum [saltwater cress]
gb|KJB67266.1|  hypothetical protein B456_010G183100                    213   3e-60   Gossypium raimondii
ref|XP_006287002.1|  hypothetical protein CARUB_v10000148mg             213   3e-60   Capsella rubella
emb|CDY21299.1|  BnaC03g29830D                                          212   5e-60   Brassica napus [oilseed rape]
ref|XP_009134299.1|  PREDICTED: putative leucine--tRNA ligase, mi...    212   5e-60   Brassica rapa
emb|CDX90858.1|  BnaA03g25380D                                          212   5e-60   
ref|XP_010099169.1|  Leucine--tRNA ligase                               212   6e-60   Morus notabilis
gb|KHG27983.1|  Leucine--tRNA ligase                                    212   8e-60   Gossypium arboreum [tree cotton]
ref|XP_009357478.1|  PREDICTED: putative leucine--tRNA ligase, mi...    211   1e-59   Pyrus x bretschneideri [bai li]
ref|NP_192344.1|  tRNA synthetase class I (I, L, M and V) family ...    211   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010272272.1|  PREDICTED: putative leucine--tRNA ligase, mi...    211   1e-59   Nelumbo nucifera [Indian lotus]
emb|CDP04435.1|  unnamed protein product                                211   1e-59   Coffea canephora [robusta coffee]
ref|XP_010496176.1|  PREDICTED: putative leucine--tRNA ligase, mi...    209   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010496177.1|  PREDICTED: putative leucine--tRNA ligase, mi...    209   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010529456.1|  PREDICTED: putative leucine--tRNA ligase, mi...    209   6e-59   Tarenaya hassleriana [spider flower]
ref|XP_003529648.1|  PREDICTED: putative leucine--tRNA ligase, mi...    208   1e-58   Glycine max [soybeans]
ref|XP_010916288.1|  PREDICTED: putative leucine--tRNA ligase, mi...    207   3e-58   Elaeis guineensis
gb|AES92665.2|  leucyl-tRNA synthetase                                  206   6e-58   Medicago truncatula
ref|XP_003619258.1|  Leucyl-tRNA synthetase                             206   7e-58   
ref|XP_003610468.1|  Leucyl-tRNA synthetase                             207   8e-58   
ref|XP_009358062.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    205   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_009390214.1|  PREDICTED: putative leucine--tRNA ligase, mi...    203   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390213.1|  PREDICTED: putative leucine--tRNA ligase, mi...    204   5e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008776029.1|  PREDICTED: putative leucine--tRNA ligase, mi...    203   6e-57   Phoenix dactylifera
ref|XP_006600301.1|  PREDICTED: LOW QUALITY PROTEIN: leucine--tRN...    202   8e-57   
ref|XP_006838108.1|  PREDICTED: putative leucine--tRNA ligase, mi...    199   2e-55   Amborella trichopoda
gb|EEC69839.1|  hypothetical protein OsI_00164                          198   4e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_006643717.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    197   9e-55   
gb|EEE53778.1|  hypothetical protein OsJ_00171                          199   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002455289.1|  hypothetical protein SORBIDRAFT_03g007890          196   5e-54   Sorghum bicolor [broomcorn]
ref|XP_001765367.1|  predicted protein                                  195   5e-54   
ref|XP_010230387.1|  PREDICTED: putative leucine--tRNA ligase, mi...    194   1e-53   
ref|XP_004968118.1|  PREDICTED: LOW QUALITY PROTEIN: putative leu...    194   2e-53   
ref|XP_002948892.1|  hypothetical protein VOLCADRAFT_89222              192   5e-53   Volvox carteri f. nagariensis
emb|CBH32645.1|  leucyl-tRNA synthetase, putative, expressed            192   8e-53   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011398417.1|  Leucine-tRNA ligase                                193   1e-52   Auxenochlorella protothecoides
ref|XP_008655584.1|  PREDICTED: putative leucine--tRNA ligase, mi...    191   3e-52   
emb|CDM80420.1|  unnamed protein product                                190   5e-52   Triticum aestivum [Canadian hard winter wheat]
ref|XP_005842216.1|  leucyl-tRNA synthetase                             188   2e-51   Guillardia theta CCMP2712
ref|XP_003079670.1|  Isoleucyl-tRNA synthetase (ISS)                    187   4e-51   Ostreococcus tauri
emb|CCG48000.1|  leucyl-tRNA synthetase, putative, expressed            186   1e-50   Triticum aestivum [Canadian hard winter wheat]
ref|WP_006930182.1|  leucyl-tRNA synthetase                             184   3e-50   Caldithrix abyssi
ref|XP_003059586.1|  predicted protein                                  183   2e-49   Micromonas pusilla CCMP1545
ref|XP_005651384.1|  putative leucyl tRNA synthetase                    182   3e-49   Coccomyxa subellipsoidea C-169
ref|XP_001418146.1|  predicted protein                                  181   3e-49   Ostreococcus lucimarinus CCE9901
ref|WP_038556448.1|  leucyl-tRNA synthetase                             181   4e-49   Draconibacterium orientale
ref|XP_007513267.1|  leucyl-tRNA synthetase                             182   4e-49   Bathycoccus prasinos
ref|WP_045026272.1|  leucyl-tRNA synthase                               181   5e-49   Draconibacterium sediminis
ref|WP_021267760.1|  leucyl-tRNA synthetase                             179   2e-48   Bacteriovorax sp. BAL6_X
ref|XP_005537865.1|  leucine--tRNA ligase                               180   2e-48   Cyanidioschyzon merolae strain 10D
gb|EMS46157.1|  Leucyl-tRNA synthetase                                  179   4e-48   Triticum urartu
ref|WP_021978830.1|  leucyl-tRNA synthetase                             177   7e-48   
ref|WP_011403694.1|  leucine--tRNA ligase                               176   2e-47   Salinibacter ruber
ref|WP_014067706.1|  leucyl-tRNA synthetase                             177   2e-47   Rhodothermus marinus
gb|EMY07084.1|  tRNA ligases class I domain protein                     167   2e-47   Leptospira interrogans str. 2002000626
ref|XP_005851157.1|  hypothetical protein CHLNCDRAFT_55974              176   2e-47   Chlorella variabilis
ref|WP_001199935.1|  hypothetical protein                               167   3e-47   
ref|WP_021270809.1|  leucyl-tRNA synthetase                             175   4e-47   Bacteriovorax sp. BSW11_IV
ref|WP_025704615.1|  leucyl-tRNA synthetase                             171   5e-47   Paenibacillus graminis
dbj|BAD52586.1|  putative leucyl-tRNA synthetase                        176   5e-47   Oryza sativa Japonica Group [Japonica rice]
ref|WP_027088225.1|  leucyl-tRNA synthetase                             175   5e-47   Cohnella panacarvi
ref|XP_005703014.1|  leucyl-tRNA synthetase                             176   6e-47   Galdieria sulphuraria
ref|WP_041875508.1|  leucyl-tRNA synthetase                             175   7e-47   Verrucomicrobia bacterium SCGC AAA164-O14
ref|WP_013061526.1|  leucyl-tRNA synthetase                             175   7e-47   Salinibacter ruber
ref|WP_020060261.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus sp. 123MFChir2
ref|WP_000009448.1|  MULTISPECIES: leucine--tRNA ligase                 174   1e-46   Bacillus
ref|WP_000009450.1|  leucyl-tRNA synthetase                             174   1e-46   
ref|WP_001991042.1|  leucine--tRNA ligase                               174   1e-46   Bacillus cereus
ref|WP_038170035.1|  leucyl-tRNA synthetase                             167   1e-46   
ref|WP_012095876.1|  leucine--tRNA ligase                               174   1e-46   Bacillus cytotoxicus
ref|WP_000009451.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus cereus
ref|WP_000009476.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus cereus
ref|WP_002173861.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus cereus
ref|WP_000009455.1|  leucine--tRNA ligase                               174   1e-46   Bacillus
ref|WP_000009452.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus cereus
ref|WP_029440187.1|  leucine--tRNA ligase                               174   1e-46   Bacillus cereus group
ref|WP_000009454.1|  leucine--tRNA ligase                               174   1e-46   Bacillus cereus group
ref|WP_000009463.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus cereus group
ref|WP_000009465.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus sp. 7_6_55CFAA_CT2
ref|WP_027091186.1|  leucyl-tRNA synthetase                             174   1e-46   Cohnella thermotolerans
ref|WP_026593769.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus
gb|KGZ89134.1|  leucyl-tRNA synthetase                                  174   1e-46   Bacillus anthracis [anthrax]
ref|WP_000009449.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus cereus
ref|WP_000009445.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus cereus
ref|WP_017153787.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus bingmayongensis
ref|WP_000009470.1|  leucyl-tRNA synthetase                             174   1e-46   Bacillus cereus group
ref|WP_000009469.1|  MULTISPECIES: leucyl-tRNA synthetase               174   1e-46   Bacillus
gb|EMF80247.1|  putative leucine--tRNA ligase                           168   1e-46   Leptospira weilii serovar Topaz str. LT2116
ref|WP_044790847.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus thuringiensis
ref|WP_000009472.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus cereus group
ref|WP_000009457.1|  leucine--tRNA ligase                               173   2e-46   Bacillus
ref|WP_018970100.1|  leucyl-tRNA synthetase                             174   2e-46   Rubritalea marina
ref|WP_000009471.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus cereus
gb|AIM14154.1|  leucyl-tRNA synthetase                                  171   2e-46   Bacillus anthracis [anthrax]
ref|WP_000009458.1|  MULTISPECIES: leucyl-tRNA synthetase               173   2e-46   Bacillus cereus group
ref|WP_042875829.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus cereus group
ref|WP_025148915.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus sp. H1a
ref|WP_001971230.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus cereus group
ref|WP_000009461.1|  MULTISPECIES: leucine--tRNA ligase                 173   2e-46   Bacillus
ref|WP_000009459.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus cereus
ref|WP_000009467.1|  MULTISPECIES: leucyl-tRNA synthetase               173   2e-46   Bacillus
ref|WP_000009453.1|  MULTISPECIES: leucyl-tRNA synthetase               173   2e-46   Bacillus cereus group
ref|WP_000009460.1|  leucine--tRNA ligase                               173   2e-46   Bacillus
ref|WP_000009456.1|  leucine--tRNA ligase                               173   2e-46   Bacillus
ref|WP_000009464.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus
ref|WP_000009462.1|  MULTISPECIES: leucine--tRNA ligase                 173   2e-46   Bacillus
ref|WP_000009466.1|  MULTISPECIES: leucyl-tRNA synthetase               173   2e-46   Bacillus
ref|WP_042980446.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus
ref|WP_000009468.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus thuringiensis
ref|WP_018782090.1|  MULTISPECIES: leucyl-tRNA synthetase               173   2e-46   Bacillus
ref|WP_000009473.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus thuringiensis
ref|WP_002123189.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus cereus
ref|WP_018764566.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus
ref|WP_006096266.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus pseudomycoides
ref|WP_016135497.1|  leucine--tRNA ligase                               173   2e-46   Bacillus
ref|WP_001199936.1|  hypothetical protein                               166   2e-46   
ref|WP_000009475.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus cereus
ref|WP_000009474.1|  leucyl-tRNA synthetase                             173   2e-46   Bacillus cereus
ref|WP_039876233.1|  leucyl-tRNA synthetase                             173   2e-46   Paenibacillus sp. FSL R7-0273
gb|EJS78246.1|  leucyl-tRNA synthetase                                  173   3e-46   Bacillus cereus BAG2X1-3
ref|WP_041052219.1|  leucyl-tRNA synthetase                             173   3e-46   Paenibacillus sp. VKM B-2647
ref|WP_035436072.1|  leucyl-tRNA synthetase                             172   3e-46   Bacillus sp. UNC322MFChir4.1
ref|WP_022396714.1|  leucyl-tRNA synthetase                             173   3e-46   
ref|WP_022488782.1|  leucyl-tRNA synthetase                             172   3e-46   
ref|WP_016085871.1|  leucine--tRNA ligase                               172   3e-46   Bacillus
ref|WP_021996080.1|  leucyl-tRNA synthetase                             172   3e-46   
ref|WP_000009477.1|  leucyl-tRNA synthetase                             172   3e-46   Bacillus cereus group
ref|WP_016116728.1|  leucyl-tRNA synthetase                             172   3e-46   Bacillus cereus group
ref|WP_022198807.1|  leucyl-tRNA synthetase                             173   3e-46   Akkermansia muciniphila
ref|WP_022835958.1|  leucyl-tRNA synthetase                             173   3e-46   Salisaeta longa
ref|WP_000009439.1|  leucine--tRNA ligase                               172   3e-46   Bacillus cereus
ref|WP_020401766.1|  leucyl-tRNA synthetase                             173   3e-46   Gracilimonas tropica
ref|WP_012420688.1|  leucyl-tRNA synthetase                             173   3e-46   Akkermansia muciniphila
ref|WP_031213207.1|  leucyl-tRNA synthetase                             169   4e-46   
ref|WP_016080001.1|  leucyl-tRNA synthetase                             172   4e-46   Bacillus cereus
ref|WP_000009441.1|  MULTISPECIES: leucyl-tRNA synthetase               172   4e-46   Bacillus
ref|WP_016099046.1|  leucyl-tRNA synthetase                             172   4e-46   Bacillus cereus
ref|WP_029443454.1|  leucyl-tRNA synthetase                             172   4e-46   Bacillus cereus group
ref|WP_000009442.1|  MULTISPECIES: leucyl-tRNA synthetase               172   4e-46   Bacillus
ref|WP_002770420.1|  leucyl-tRNA synthetase                             173   4e-46   Leptonema illini
ref|WP_000009444.1|  leucyl-tRNA synthetase                             172   5e-46   Bacillus cereus group
ref|WP_043935252.1|  MULTISPECIES: leucyl-tRNA synthetase               172   5e-46   Bacillus
gb|ABO68087.1|  Leucyl-tRNA synthetase                                  172   5e-46   Geobacillus thermodenitrificans NG80-2
ref|WP_026690741.1|  leucyl-tRNA synthetase                             172   5e-46   Bacillus aurantiacus
ref|WP_008880943.1|  MULTISPECIES: leucine--tRNA ligase                 172   5e-46   Geobacillus
ref|WP_000009440.1|  leucyl-tRNA synthetase                             172   6e-46   Bacillus
ref|WP_000009443.1|  leucine--tRNA ligase                               172   6e-46   
ref|WP_042183121.1|  leucyl-tRNA synthetase                             172   6e-46   Paenibacillus sp. FSL R7-0331
ref|WP_033020166.1|  leucyl-tRNA synthetase                             172   6e-46   Geobacillus icigianus
gb|EMG12808.1|  tRNA ligases class I domain protein                     167   7e-46   Leptospira interrogans serovar Grippotyphosa str. LT2186
ref|WP_033844368.1|  leucyl-tRNA synthetase                             172   7e-46   Geobacillus
ref|WP_000009481.1|  leucyl-tRNA synthetase                             172   7e-46   Bacillus wiedmannii
gb|EJQ50297.1|  leucyl-tRNA synthetase                                  172   7e-46   Bacillus cereus BAG5X1-1
ref|WP_033710716.1|  leucyl-tRNA synthetase                             171   8e-46   Bacillus cereus
ref|WP_012843181.1|  leucyl-tRNA synthetase                             172   8e-46   Rhodothermus marinus
ref|WP_000009479.1|  leucyl-tRNA synthetase                             171   8e-46   Bacillus cereus group
ref|WP_042216922.1|  leucyl-tRNA synthetase                             172   8e-46   Paenibacillus borealis
ref|WP_042139488.1|  leucyl-tRNA synthetase                             172   8e-46   Paenibacillus sp. FSL P4-0081
ref|WP_007129371.1|  MULTISPECIES: leucyl-tRNA synthetase               171   8e-46   Bacillales
ref|WP_000009480.1|  leucyl-tRNA synthetase                             171   8e-46   Bacillus cereus group
ref|WP_022476500.1|  leucyl-tRNA synthetase                             171   9e-46   
ref|WP_044737514.1|  leucyl-tRNA synthetase                             171   1e-45   
ref|WP_002067653.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus mycoides
ref|WP_016130370.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus
ref|WP_016095957.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus cereus
ref|WP_002034430.1|  MULTISPECIES: leucyl-tRNA synthetase               171   1e-45   Bacillus cereus group
ref|WP_000009446.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus cereus
ref|WP_002145290.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus cereus
gb|EMO76983.1|  leucyl-tRNA synthetase, domain 2                        167   1e-45   Leptospira kirschneri str. 200801925
ref|WP_021278651.1|  leucyl-tRNA synthetase                             171   1e-45   Bacteriovorax sp. DB6_IX
ref|WP_012261857.1|  leucine--tRNA ligase                               171   1e-45   Bacillus mycoides
ref|WP_002015698.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus cereus group
ref|WP_002129511.1|  MULTISPECIES: leucyl-tRNA synthetase               171   1e-45   Bacillus
ref|WP_016102930.1|  MULTISPECIES: leucyl-tRNA synthetase               171   1e-45   Bacillus
ref|WP_002184798.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus mycoides
ref|WP_002190950.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus
ref|WP_002167530.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus mycoides
ref|WP_002143462.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus cereus
ref|WP_002089088.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus cereus
ref|WP_000009447.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus cereus
ref|WP_038595513.1|  leucyl-tRNA synthetase                             171   1e-45   Paenibacillus sp. FSL H7-0357
emb|CEX42074.1|  leucyl-tRNA synthetase                                 171   1e-45   Streptococcus pneumoniae
ref|WP_033674310.1|  leucyl-tRNA synthetase                             171   1e-45   Bacillus gaemokensis
ref|WP_022226580.1|  leucyl-tRNA synthetase                             171   1e-45   
ref|WP_022029418.1|  leucyl-tRNA synthetase                             171   1e-45   
ref|WP_033009813.1|  leucyl-tRNA synthetase                             171   1e-45   
ref|WP_014801419.1|  leucyl-tRNA synthetase                             171   1e-45   Turneriella parva
ref|WP_044736817.1|  leucyl-tRNA synthetase                             171   2e-45   Geobacillus kaustophilus
ref|WP_044730524.1|  leucyl-tRNA synthetase                             171   2e-45   Geobacillus kaustophilus
ref|WP_031407586.1|  leucyl-tRNA synthetase                             171   2e-45   Geobacillus vulcani
gb|EMO27254.1|  putative leucine--tRNA ligase                           167   2e-45   Leptospira interrogans serovar Bataviae str. HAI135
ref|WP_044744755.1|  leucyl-tRNA synthetase                             171   2e-45   Anoxybacillus geothermalis
ref|WP_013524386.1|  MULTISPECIES: leucyl-tRNA synthetase               171   2e-45   Geobacillus
ref|WP_013144426.1|  leucyl-tRNA synthetase                             171   2e-45   Geobacillus sp. C56-T3
ref|WP_041901725.1|  leucyl-tRNA synthetase                             171   2e-45   
ref|WP_021322703.1|  leucyl-tRNA synthetase                             171   2e-45   Geobacillus
ref|WP_033014546.1|  leucyl-tRNA synthetase                             171   2e-45   Geobacillus stearothermophilus
ref|WP_003201345.1|  leucyl-tRNA synthetase                             170   2e-45   Bacillus pseudomycoides
ref|WP_019006982.1|  leucyl-tRNA synthetase                             171   2e-45   Cohnella laeviribosi
gb|EMY25325.1|  putative leucine--tRNA ligase                           167   2e-45   Leptospira interrogans serovar Australis str. 200703203
ref|WP_011232314.1|  leucine--tRNA ligase                               170   2e-45   Geobacillus thermoleovorans group
ref|WP_034640994.1|  leucyl-tRNA synthetase                             170   2e-45   Bacillus manliponensis
ref|WP_016106405.1|  leucyl-tRNA synthetase                             170   3e-45   Bacillus cereus group
ref|WP_036732290.1|  leucyl-tRNA synthetase                             170   3e-45   Paenibacillus sp. FSL R7-277
ref|WP_039300930.1|  leucyl-tRNA synthetase                             170   3e-45   Paenibacillus sp. IHB B 3415
ref|WP_014681197.1|  leucyl-tRNA synthetase                             171   3e-45   Solitalea canadensis
ref|WP_037290055.1|  leucyl-tRNA synthetase                             170   3e-45   Saccharibacillus sacchari
ref|WP_002112382.1|  leucyl-tRNA synthetase                             170   3e-45   Bacillus cereus group
ref|WP_019909144.1|  leucyl-tRNA synthetase                             170   3e-45   Paenibacillus sp. HW567
gb|EQC75802.1|  Leucyl-tRNA synthetase                                  163   3e-45   Streptococcus sp. HSISS3
ref|WP_000009438.1|  leucine--tRNA ligase                               170   3e-45   Bacillus cereus
ref|WP_025949565.1|  leucyl-tRNA synthetase                             170   3e-45   Geobacillus
ref|WP_003208770.1|  leucyl-tRNA synthetase                             170   3e-45   Bacillus pseudomycoides
ref|WP_042267319.1|  leucyl-tRNA synthetase                             170   3e-45   Paenibacillus graminis
ref|WP_042201037.1|  leucyl-tRNA synthetase                             170   3e-45   Paenibacillus camerounensis
ref|WP_036597336.1|  leucyl-tRNA synthetase                             166   3e-45   
ref|WP_042238641.1|  leucyl-tRNA synthetase                             170   4e-45   Paenibacillus sp. FSL R5-0912
ref|WP_000009478.1|  leucyl-tRNA synthetase                             169   4e-45   Bacillus cereus
ref|WP_018126787.1|  leucyl-tRNA synthetase                             170   4e-45   Balneola vulgaris
ref|WP_020960966.1|  leucyl-tRNA synthetase                             169   4e-45   Geobacillus genomosp. 3
gb|EOB29810.1|  leucyl-tRNA ligase                                      160   4e-45   Streptococcus pneumoniae 357
gb|EHD52646.1|  leucyl-tRNA synthetase domain protein                   158   4e-45   Streptococcus pneumoniae GA16531
gb|EQC70103.1|  Leucyl-tRNA synthetase                                  164   5e-45   Streptococcus sp. HSISS1
gb|EZZ18391.1|  leucyl-tRNA synthetase                                  157   5e-45   Staphylococcus aureus Sau 74
ref|WP_020428093.1|  leucyl-tRNA synthetase                             169   5e-45   Paenibacillus riograndensis
ref|WP_039832771.1|  leucyl-tRNA synthetase                             169   6e-45   Paenibacillus sonchi
ref|WP_015255273.1|  leucyl-tRNA synthetase                             169   6e-45   Thermobacillus composti
ref|WP_019536066.1|  leucyl-tRNA synthetase                             169   6e-45   Paenibacillus ginsengihumi
gb|EPR26369.1|  Leucyl-tRNA synthetase                                  169   6e-45   Geobacillus sp. WSUCF1
ref|WP_034732278.1|  leucyl-tRNA synthetase                             169   6e-45   Bacteriovorax sp. Seq25_V
gb|EQC45487.1|  leucine--tRNA ligase                                    169   7e-45   Bacteriovorax sp. Seq25_V
gb|KHF29266.1|  Leucine--tRNA ligase                                    162   7e-45   Anoxybacillus sp. BCO1
ref|WP_003100327.1|  leucyl-tRNA synthetase                             169   7e-45   Streptococcus iniae
ref|WP_028544889.1|  leucyl-tRNA synthetase                             169   7e-45   Paenibacillus taiwanensis
gb|ERE61641.1|  hypothetical protein N036_46685                         160   7e-45   
ref|WP_018975751.1|  leucyl-tRNA synthetase                             169   8e-45   Saccharibacillus kuerlensis
gb|EQA61511.1|  putative leucine--tRNA ligase                           167   8e-45   Leptospira alexanderi serovar Manhao 3 str. L 60
ref|WP_026671701.1|  leucyl-tRNA synthetase                             169   9e-45   Bacillus bogoriensis
ref|WP_036690493.1|  leucyl-tRNA synthetase                             169   9e-45   Paenibacillus sp. FSL R7-269
ref|WP_033162463.1|  leucyl-tRNA synthetase                             169   9e-45   Sharpea azabuensis
gb|EHZ47588.1|  tRNA synthetases class I family protein                 164   1e-44   Streptococcus pneumoniae GA40563
gb|EFO54425.1|  leucyl-tRNA synthetase                                  164   1e-44   Streptococcus infantis SK1302
ref|WP_031868226.1|  leucyl-tRNA synthetase                             157   1e-44   
ref|WP_008408180.1|  MULTISPECIES: leucyl-tRNA synthetase               168   1e-44   
ref|WP_017645788.1|  hypothetical protein                               160   1e-44   
ref|WP_025197809.1|  hypothetical protein                               161   1e-44   
gb|EZW52098.1|  leucyl-tRNA synthetase                                  157   1e-44   
ref|WP_042102996.1|  leucyl-tRNA synthetase                             169   1e-44   
ref|WP_028399751.1|  leucyl-tRNA synthetase                             168   1e-44   
ref|WP_035346667.1|  leucyl-tRNA synthetase                             168   1e-44   
ref|WP_009962914.1|  leucyl-tRNA synthetase                             169   1e-44   
ref|WP_031867633.1|  leucyl-tRNA synthetase                             157   1e-44   
ref|WP_022509581.1|  leucyl-tRNA synthetase                             168   1e-44   
ref|WP_008300157.1|  leucyl-tRNA synthetase                             168   1e-44   
gb|EZW49633.1|  leucyl-tRNA synthetase                                  157   1e-44   
ref|WP_014545885.1|  leucyl-tRNA synthetase                             169   2e-44   
ref|WP_028260588.1|  leucyl-tRNA synthetase                             168   2e-44   
ref|WP_033006846.1|  leucyl-tRNA synthetase                             168   2e-44   
ref|WP_015246480.1|  leucyl-tRNA synthetase                             169   2e-44   
ref|WP_014196589.1|  MULTISPECIES: leucyl-tRNA synthetase               168   2e-44   
ref|WP_022775395.1|  leucyl-tRNA synthetase                             168   2e-44   
ref|WP_028987158.1|  leucyl-tRNA synthetase                             168   2e-44   
gb|EQC76806.1|  Leucyl-tRNA synthetase                                  165   2e-44   
ref|WP_015375656.1|  leucyl-tRNA synthetase                             168   2e-44   
gb|KIC75996.1|  Leucine--tRNA ligase                                    168   2e-44   
ref|WP_017648229.1|  hypothetical protein                               160   2e-44   
ref|WP_020156908.1|  leucyl-tRNA synthetase                             168   2e-44   
ref|WP_022423485.1|  leucyl-tRNA synthetase                             167   2e-44   
gb|KIC74007.1|  Leucine--tRNA ligase                                    168   2e-44   
ref|WP_009675382.1|  MULTISPECIES: leucyl-tRNA synthetase               167   2e-44   
ref|WP_010572741.1|  leucyl-tRNA synthetase                             168   2e-44   
ref|WP_022939527.1|  leucyl-tRNA synthetase                             167   2e-44   
ref|WP_025196425.1|  hypothetical protein                               161   2e-44   
gb|EJG57705.1|  leucyl-tRNA synthetase domain protein                   156   2e-44   
ref|WP_029473776.1|  leucyl-tRNA synthetase                             167   2e-44   
ref|WP_006982645.1|  leucyl-tRNA synthetase                             168   2e-44   
ref|WP_029748725.1|  hypothetical protein                               160   3e-44   
ref|WP_002756838.1|  leucyl-tRNA synthetase                             168   3e-44   
ref|WP_020781670.1|  leucyl-tRNA synthetase                             168   3e-44   
ref|WP_002722366.1|  leucyl-tRNA synthetase                             168   3e-44   
ref|WP_002623145.1|  leucyl-tRNA synthetase                             168   3e-44   
ref|WP_004500935.1|  leucyl-tRNA synthetase                             168   3e-44   
gb|ELU55040.1|  putative leucine--tRNA ligase                           161   3e-44   
ref|WP_045851685.1|  leucyl-tRNA synthetase                             167   3e-44   
ref|WP_016758500.1|  leucyl-tRNA synthetase                             168   3e-44   
ref|WP_004502651.1|  leucyl-tRNA synthetase                             168   3e-44   
ref|WP_002758452.1|  MULTISPECIES: leucyl-tRNA synthetase               168   3e-44   
ref|WP_022090460.1|  leucyl-tRNA synthetase                             167   3e-44   
ref|WP_002748599.1|  leucyl-tRNA synthetase                             168   3e-44   
ref|WP_009589237.1|  leucyl-tRNA synthetase                             166   3e-44   
ref|WP_004496491.1|  leucyl-tRNA synthetase                             168   3e-44   
ref|WP_010415619.1|  leucyl-tRNA synthetase                             168   3e-44   
ref|WP_010495567.1|  leucyl-tRNA synthetase                             167   3e-44   
ref|WP_023860252.1|  leucyl-tRNA synthetase                             167   3e-44   
ref|WP_035662994.1|  leucyl-tRNA synthetase                             167   3e-44   
ref|WP_003322746.1|  leucyl-tRNA synthetase                             167   3e-44   
ref|WP_010571179.1|  leucyl-tRNA synthetase                             167   3e-44   
ref|WP_022764265.1|  leucyl-tRNA synthetase                             167   4e-44   
ref|WP_017285139.1|  hypothetical protein                               154   4e-44   
ref|WP_000011736.1|  hypothetical protein                               161   4e-44   
ref|WP_011669510.1|  leucine--tRNA ligase                               167   4e-44   
gb|ACD82460.1|  Leucyl-tRNA synthetase                                  167   4e-44   
ref|WP_004478162.1|  leucyl-tRNA synthetase                             167   4e-44   
ref|WP_004480091.1|  leucyl-tRNA synthetase                             167   4e-44   
ref|WP_026508281.1|  leucyl-tRNA synthetase                             167   4e-44   
ref|WP_020774950.1|  leucyl-tRNA synthetase                             167   4e-44   
ref|WP_004457605.1|  MULTISPECIES: leucyl-tRNA synthetase               167   4e-44   
ref|WP_004469101.1|  leucyl-tRNA synthetase                             167   4e-44   
ref|WP_025691777.1|  leucyl-tRNA synthetase                             163   4e-44   
ref|WP_004465796.1|  leucyl-tRNA synthetase                             167   4e-44   
ref|WP_016762411.1|  leucyl-tRNA synthetase                             167   4e-44   
ref|WP_016754086.1|  leucyl-tRNA synthetase                             167   4e-44   
gb|EGJ17488.1|  tRNA synthetases class I family protein                 162   4e-44   
dbj|GAE04151.1|  leucyl-tRNA synthetase                                 162   5e-44   
ref|WP_036078453.1|  leucyl-tRNA synthetase                             167   5e-44   
ref|WP_044773647.1|  leucyl-tRNA synthetase                             157   5e-44   
gb|EHD83019.1|  tRNA synthetases class I family protein                 162   5e-44   
ref|WP_017434903.1|  leucyl-tRNA synthetase                             167   5e-44   
gb|EHE05941.1|  tRNA synthetases class I family protein                 162   5e-44   
ref|WP_016549702.1|  leucyl-tRNA synthetase                             167   5e-44   
ref|WP_004226007.1|  leucyl-tRNA synthetase                             166   5e-44   
ref|WP_003248538.1|  MULTISPECIES: leucyl-tRNA synthetase               166   5e-44   
ref|WP_002995549.1|  leucyl-tRNA synthetase                             167   5e-44   
ref|WP_023353925.1|  leucyl-tRNA synthetase                             167   5e-44   
ref|WP_039272311.1|  leucyl-tRNA synthetase                             167   5e-44   
dbj|GAJ39071.1|  leucyl-tRNA synthetase                                 166   5e-44   
ref|WP_029097348.1|  leucyl-tRNA synthetase                             166   5e-44   
ref|WP_002178120.1|  leucyl-tRNA synthetase                             167   5e-44   
ref|WP_044897611.1|  leucyl-tRNA synthetase                             166   5e-44   
gb|EHE32505.1|  tRNA synthetases class I family protein                 162   5e-44   
ref|WP_004448798.1|  leucyl-tRNA synthetase                             167   5e-44   
gb|EGI88017.1|  tRNA synthetases class I family protein                 162   6e-44   
ref|WP_016751470.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_004451824.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_004440485.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_004763529.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_040948306.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_044645124.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_031863481.1|  leucyl-tRNA synthetase                             156   6e-44   
gb|ESP69465.1|  leucyl-tRNA ligase                                      162   6e-44   
ref|WP_016560597.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_042407714.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_007431297.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_000011799.1|  hypothetical protein                               157   6e-44   
ref|WP_039384846.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_004782459.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_004770094.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_004765275.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_004754786.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_000011798.1|  hypothetical protein                               157   6e-44   
ref|WP_017215345.1|  leucyl-tRNA synthetase                             167   6e-44   
gb|EZV38010.1|  leucyl-tRNA synthetase                                  156   6e-44   
ref|WP_029515372.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_023989526.1|  MULTISPECIES: leucyl-tRNA synthetase               166   6e-44   
gb|KEQ42200.1|  leucyl-tRNA synthetase                                  162   6e-44   
ref|WP_025682013.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_024808714.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_004768294.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_025723410.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_025718841.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_017852595.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_004446815.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_016559356.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_037594298.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_016821632.1|  MULTISPECIES: leucyl-tRNA synthetase               166   6e-44   
ref|WP_027322101.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_004433550.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_013311190.1|  leucyl-tRNA synthetase                             166   6e-44   
ref|WP_015864859.1|  leucine--tRNA ligase                               166   6e-44   
ref|WP_004455150.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_020767452.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_020779317.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_010345310.1|  leucyl-tRNA synthetase                             166   6e-44   
gb|EHZ25107.1|  tRNA synthetases class I family protein                 162   6e-44   
ref|WP_001199937.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_001199942.1|  leucyl-tRNA synthetase                             167   6e-44   
ref|WP_001199947.1|  leucyl-tRNA synthetase                             167   7e-44   
ref|WP_001199943.1|  leucyl-tRNA synthetase                             167   7e-44   
ref|WP_002102197.1|  leucine--tRNA ligase                               167   7e-44   
ref|WP_019688080.1|  leucyl-tRNA synthetase                             166   7e-44   
ref|WP_014282541.1|  leucyl-tRNA synthetase                             166   7e-44   
ref|WP_002104138.1|  leucyl-tRNA synthetase                             167   7e-44   
ref|WP_017854639.1|  leucine--tRNA ligase                               167   7e-44   
ref|WP_001199949.1|  leucine--tRNA ligase                               167   7e-44   
ref|WP_020763829.1|  leucyl-tRNA synthetase                             167   7e-44   
ref|WP_001199948.1|  leucine--tRNA ligase                               167   7e-44   
ref|WP_001199940.1|  leucyl-tRNA synthetase                             167   7e-44   
ref|WP_002118761.1|  leucyl-tRNA synthetase                             167   7e-44   
ref|WP_001199941.1|  leucyl-tRNA synthetase                             167   7e-44   
ref|WP_043905827.1|  leucyl-tRNA synthetase                             166   7e-44   
ref|WP_024056244.1|  leucyl-tRNA synthetase                             162   7e-44   
ref|WP_002128538.1|  leucine--tRNA ligase                               167   7e-44   
ref|WP_002106551.1|  leucyl-tRNA synthetase                             167   7e-44   
ref|WP_031797928.1|  leucyl-tRNA synthetase                             156   7e-44   
ref|WP_044752085.1|  leucyl-tRNA synthetase                             156   7e-44   
ref|WP_044765136.1|  leucyl-tRNA synthetase                             156   7e-44   
ref|WP_001199946.1|  leucine--tRNA ligase                               167   7e-44   
ref|WP_044675805.1|  leucyl-tRNA synthetase                             157   7e-44   
ref|WP_001199939.1|  leucine--tRNA ligase                               167   7e-44   
ref|WP_001199945.1|  leucine--tRNA ligase                               167   7e-44   
ref|WP_013372195.1|  leucyl-tRNA synthetase                             166   7e-44   
ref|WP_042240833.1|  leucyl-tRNA synthetase                             166   7e-44   
ref|WP_025675594.1|  leucyl-tRNA synthetase                             166   7e-44   
gb|EZW77704.1|  leucyl-tRNA synthetase                                  156   7e-44   
gb|EMM95179.1|  leucine--tRNA ligase                                    167   7e-44   
ref|WP_004419464.1|  leucyl-tRNA synthetase                             167   7e-44   
gb|KFE64538.1|  Leucyl-tRNA synthetase                                  166   7e-44   
ref|WP_003390741.1|  leucyl-tRNA synthetase                             166   7e-44   
ref|WP_017858440.1|  leucyl-tRNA synthetase                             167   7e-44   
ref|WP_044758202.1|  leucyl-tRNA synthetase                             157   7e-44   
ref|WP_035609049.1|  leucyl-tRNA synthetase                             166   8e-44   
gb|EJG64505.1|  leucyl-tRNA synthetase domain protein                   161   8e-44   
ref|WP_036646564.1|  leucyl-tRNA synthetase                             166   8e-44   
ref|WP_044882258.1|  leucyl-tRNA synthase                               166   8e-44   
ref|WP_000145179.1|  leucyl-tRNA synthetase                             162   8e-44   
ref|WP_045762748.1|  leucyl-tRNA synthetase                             166   8e-44   
ref|WP_024984589.1|  leucyl-tRNA synthetase                             166   8e-44   
ref|WP_045640081.1|  leucyl-tRNA synthetase                             167   8e-44   
ref|WP_006146209.1|  leucyl-tRNA synthetase                             166   8e-44   
ref|WP_044667389.1|  leucyl-tRNA synthetase                             156   9e-44   
ref|WP_035202000.1|  leucyl-tRNA synthetase                             166   9e-44   
ref|WP_007360290.1|  leucyl-tRNA synthetase                             166   9e-44   
ref|WP_022783826.1|  leucyl-tRNA synthetase                             166   9e-44   
ref|WP_020152944.1|  leucyl-tRNA synthetase                             166   9e-44   
ref|WP_011247713.1|  leucine--tRNA ligase                               166   9e-44   
ref|WP_029509173.1|  leucyl-tRNA synthetase                             166   9e-44   
ref|WP_002886476.1|  leucyl-tRNA synthetase                             166   9e-44   
ref|WP_006154965.1|  leucyl-tRNA synthetase                             166   9e-44   
ref|WP_008245218.1|  leucyl-tRNA synthetase                             167   9e-44   
ref|WP_007893756.1|  leucyl-tRNA synthetase                             166   9e-44   
ref|WP_009512047.1|  leucyl-tRNA synthetase                             166   9e-44   
ref|WP_031941848.1|  leucyl-tRNA synthetase                             157   9e-44   
ref|WP_028668876.1|  leucyl-tRNA synthetase                             167   9e-44   
ref|WP_034490052.1|  leucyl-tRNA synthetase                             166   9e-44   
ref|WP_025197488.1|  leucyl-tRNA synthetase                             162   1e-43   
gb|ETJ00672.1|  Leucine-tRNA ligase                                     155   1e-43   
ref|WP_010001897.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_034484721.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_022753316.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_013102550.1|  MULTISPECIES: leucyl-tRNA synthetase               166   1e-43   
ref|WP_012198967.1|  leucyl-tRNA synthetase                             166   1e-43   
gb|EZZ18384.1|  leucyl-tRNA synthetase                                  157   1e-43   
ref|WP_025696243.1|  leucyl-tRNA synthetase                             162   1e-43   
ref|WP_019978940.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_004183766.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_022474865.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_022781940.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_019793872.1|  leucyl-tRNA synthetase                             161   1e-43   
ref|WP_023483874.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_040931521.1|  leucyl-tRNA synthetase                             164   1e-43   
ref|WP_034487695.1|  leucyl-tRNA synthetase                             165   1e-43   
ref|WP_022756928.1|  leucyl-tRNA synthetase                             165   1e-43   
ref|WP_022115282.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_025862960.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_026521524.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_000011804.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_013990004.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_008535773.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_035622459.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_036644499.1|  leucyl-tRNA synthetase                             166   1e-43   
ref|WP_022368929.1|  leucyl-tRNA synthetase                             165   1e-43   
emb|CFG69688.1|  leucyl-tRNA synthetase                                 161   1e-43   
ref|WP_031863483.1|  leucyl-tRNA synthetase                             159   1e-43   



>ref|XP_009614453.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Nicotiana 
tomentosiformis]
Length=972

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 147/173 (85%), Gaps = 5/173 (3%)
 Frame = +3

Query  117  CRRELLISTHfrpllrrrsfsflrlrlsNCV---SKTNGISCVKVEDEQKENEEQ--QVR  281
            C R L++S H RPLLR +S + +RLR+S+C    SK      VK  D QK NE+Q  QV+
Sbjct  21   CSRTLMLSAHRRPLLRHQSCTHVRLRVSSCTKSSSKNTVTELVKEVDGQKANEQQKQQVK  80

Query  282  RAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTAT  461
            R+YPFHEIEPKWQ +WEE KTFRTPDEIDTSKPK+YVLDMFPYPSGAGLHVGHPLGYTAT
Sbjct  81   RSYPFHEIEPKWQHYWEENKTFRTPDEIDTSKPKFYVLDMFPYPSGAGLHVGHPLGYTAT  140

Query  462  DILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            DILARFKRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNI+RFR QL
Sbjct  141  DILARFKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNISRFRSQL  193



>gb|KDO78326.1| hypothetical protein CISIN_1g002217mg [Citrus sinensis]
Length=577

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  201  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  380
            +C +    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +WE  +TFRTPDEIDTSKP
Sbjct  35   SCSTSGAIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWENNRTFRTPDEIDTSKP  94

Query  381  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  560
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  95   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  154

Query  561  TGTHPrittirninrFRLQL  620
            TGTHP+ITT+RNINRFR QL
Sbjct  155  TGTHPKITTLRNINRFRTQL  174



>ref|XP_004232688.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Solanum lycopersicum]
Length=975

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 149/194 (77%), Gaps = 7/194 (4%)
 Frame = +3

Query  60   FEIHSRLRLLQQP---FSQPPFCRRELLISTHfrpllrrrsfsflrlrlsNCV---SKTN  221
             ++H+  RL   P     +PP  R  LL+    RPLLRR   +  R  +SNC    SK  
Sbjct  3    IQLHTSTRLHHLPSHLLPRPPLLRSALLLPACRRPLLRREFCNHERFGVSNCTKSSSKNT  62

Query  222  GISCVKVEDEQKENEE-QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLD  398
                V   D QK NE+ ++V+RAYPFHEIEPKWQ +WEE KTFRTPDEIDTSKPK+YVLD
Sbjct  63   VTVLVNAIDGQKINEKHEKVKRAYPFHEIEPKWQHYWEENKTFRTPDEIDTSKPKFYVLD  122

Query  399  MFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPr  578
            MFPYPSGAGLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAI+TGTHP+
Sbjct  123  MFPYPSGAGLHVGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIDTGTHPK  182

Query  579  ittirninrFRLQL  620
            ITT+RNI+RFR QL
Sbjct  183  ITTLRNISRFRSQL  196



>ref|XP_010316571.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Solanum lycopersicum]
Length=994

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 149/194 (77%), Gaps = 7/194 (4%)
 Frame = +3

Query  60   FEIHSRLRLLQQP---FSQPPFCRRELLISTHfrpllrrrsfsflrlrlsNCV---SKTN  221
             ++H+  RL   P     +PP  R  LL+    RPLLRR   +  R  +SNC    SK  
Sbjct  3    IQLHTSTRLHHLPSHLLPRPPLLRSALLLPACRRPLLRREFCNHERFGVSNCTKSSSKNT  62

Query  222  GISCVKVEDEQKENEE-QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLD  398
                V   D QK NE+ ++V+RAYPFHEIEPKWQ +WEE KTFRTPDEIDTSKPK+YVLD
Sbjct  63   VTVLVNAIDGQKINEKHEKVKRAYPFHEIEPKWQHYWEENKTFRTPDEIDTSKPKFYVLD  122

Query  399  MFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPr  578
            MFPYPSGAGLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAI+TGTHP+
Sbjct  123  MFPYPSGAGLHVGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIDTGTHPK  182

Query  579  ittirninrFRLQL  620
            ITT+RNI+RFR QL
Sbjct  183  ITTLRNISRFRSQL  196



>ref|XP_006348152.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial-like 
[Solanum tuberosum]
Length=975

 Score =   226 bits (575),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = +3

Query  201  NCV---SKTNGISCVKVEDEQKENEE-QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEID  368
            NC    SK      VK  D QK NE+ ++V+RAYPFHEIEPKWQ +WEE KTFRTPDEID
Sbjct  53   NCTKSSSKNTVTLLVKAIDAQKTNEQHEKVKRAYPFHEIEPKWQHYWEENKTFRTPDEID  112

Query  369  TSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQ  548
            TSKPK+YVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQ
Sbjct  113  TSKPKFYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQ  172

Query  549  YAIETGTHPrittirninrFRLQL  620
            YAI+TGTHP+ITT+RNI+RFR QL
Sbjct  173  YAIDTGTHPKITTLRNISRFRSQL  196



>ref|XP_010686792.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=989

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  207  VSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKY  386
             S+ NG    KVED ++E   QQV+RAYP+HEIEPKWQK+W++ KTFRTPD++DTSKPK+
Sbjct  75   ASEING-ELGKVEDIEEEKNVQQVKRAYPYHEIEPKWQKYWDDNKTFRTPDDVDTSKPKF  133

Query  387  YVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETG  566
            YVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAI+TG
Sbjct  134  YVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIDTG  193

Query  567  THPrittirninrFRLQL  620
            THP++TT+RNI RFR QL
Sbjct  194  THPKVTTMRNIGRFRSQL  211



>ref|XP_009800377.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Nicotiana 
sylvestris]
Length=972

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 148/176 (84%), Gaps = 6/176 (3%)
 Frame = +3

Query  111  PFCRR-ELLISTHfrpllrrrsfsflrlrlsNCV---SKTNGISCVKVEDEQKENEEQQ-  275
            P C R  L+IS H RPLLR +S++ +RLR+S+C    SK      VK  D QK N++QQ 
Sbjct  19   PLCLRISLIISAHRRPLLRHQSYTHIRLRVSSCTKSSSKNTVTELVKAVDGQKANDQQQQ  78

Query  276  -VRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
             V+R YPFHEIEPKWQ +WEE KTFRTPDEIDTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  79   QVKRPYPFHEIEPKWQHYWEENKTFRTPDEIDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  138

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNI+RFR QL
Sbjct  139  TATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNISRFRSQL  194



>ref|XP_006449782.1| hypothetical protein CICLE_v10014171mg [Citrus clementina]
 gb|ESR63022.1| hypothetical protein CICLE_v10014171mg [Citrus clementina]
Length=951

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  201  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  380
            +C S    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +W+  +TFRTPDEIDTSKP
Sbjct  34   SCSSSGGIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWQNNRTFRTPDEIDTSKP  93

Query  381  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  560
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  94   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  153

Query  561  TGTHPrittirninrFRLQL  620
            TGTHP+ITT+RNINRFR QL
Sbjct  154  TGTHPKITTLRNINRFRTQL  173



>ref|XP_006467397.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=926

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  201  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  380
            +C +    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +WE  +TFRTPDEIDTSKP
Sbjct  35   SCSTSGAIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWENNRTFRTPDEIDTSKP  94

Query  381  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  560
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  95   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  154

Query  561  TGTHPrittirninrFRLQL  620
            TGTHP+ITT+RNINRFR QL
Sbjct  155  TGTHPKITTLRNINRFRTQL  174



>gb|KDO78323.1| hypothetical protein CISIN_1g002217mg [Citrus sinensis]
Length=926

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  201  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  380
            +C +    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +WE  +TFRTPDEIDTSKP
Sbjct  35   SCSTSGAIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWENNRTFRTPDEIDTSKP  94

Query  381  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  560
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  95   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  154

Query  561  TGTHPrittirninrFRLQL  620
            TGTHP+ITT+RNINRFR QL
Sbjct  155  TGTHPKITTLRNINRFRTQL  174



>gb|KDO78324.1| hypothetical protein CISIN_1g002217mg [Citrus sinensis]
Length=952

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  201  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  380
            +C +    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +WE  +TFRTPDEIDTSKP
Sbjct  35   SCSTSGAIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWENNRTFRTPDEIDTSKP  94

Query  381  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  560
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  95   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  154

Query  561  TGTHPrittirninrFRLQL  620
            TGTHP+ITT+RNINRFR QL
Sbjct  155  TGTHPKITTLRNINRFRTQL  174



>ref|XP_006467396.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial-like 
isoform X1 [Citrus sinensis]
Length=952

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  201  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  380
            +C +    + C   E E+++ ++Q V+RAYPFHEIEPKWQ +WE  +TFRTPDEIDTSKP
Sbjct  35   SCSTSGAIVRCSVNEIEEQKQKQQVVKRAYPFHEIEPKWQSYWENNRTFRTPDEIDTSKP  94

Query  381  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  560
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  95   KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  154

Query  561  TGTHPrittirninrFRLQL  620
            TGTHP+ITT+RNINRFR QL
Sbjct  155  TGTHPKITTLRNINRFRTQL  174



>ref|XP_011002586.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Populus 
euphratica]
 ref|XP_011002587.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Populus 
euphratica]
Length=1006

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 122/133 (92%), Gaps = 1/133 (1%)
 Frame = +3

Query  225  ISCVKVE-DEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDM  401
            I C   E +EQKE ++Q V+RAYPFHEIEPKWQ +WE+ +TFRTPDE+DTSKPK+YVLDM
Sbjct  96   IRCSNSEVEEQKEKQQQVVKRAYPFHEIEPKWQSYWEKNQTFRTPDEVDTSKPKFYVLDM  155

Query  402  FPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPri  581
            FPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+I
Sbjct  156  FPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKI  215

Query  582  ttirninrFRLQL  620
            TT+RNINRFR QL
Sbjct  216  TTLRNINRFRSQL  228



>gb|EPS64803.1| hypothetical protein M569_09978, partial [Genlisea aurea]
Length=192

 Score =   207 bits (528),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  267  EQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPL  446
            E+QVRRAYPF+EIE KWQ++WE+ KTFRTPDEID SKPK+YVLDMFPYPSGAGLHVGHPL
Sbjct  1    EEQVRRAYPFNEIEAKWQRYWEDDKTFRTPDEIDISKPKFYVLDMFPYPSGAGLHVGHPL  60

Query  447  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            GYTATDILAR KRMQG+NVLHPMGWDAFGLPAEQYAI+TGTHPRITT +NI+RFR QL
Sbjct  61   GYTATDILARLKRMQGFNVLHPMGWDAFGLPAEQYAIDTGTHPRITTRKNIDRFRSQL  118



>ref|XP_004134980.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Cucumis 
sativus]
Length=978

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 3/129 (2%)
 Frame = +3

Query  234  VKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYP  413
            VK  +EQKE   Q+VRRAYPFHEIEPKWQ++W+E +TFRTPDE+DTSKPK+YVLDMFPYP
Sbjct  76   VKDVEEQKE---QEVRRAYPFHEIEPKWQRYWDENRTFRTPDEVDTSKPKFYVLDMFPYP  132

Query  414  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittir  593
            SG+GLHVGHPLGYT+TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT+R
Sbjct  133  SGSGLHVGHPLGYTSTDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLR  192

Query  594  ninrFRLQL  620
            NINRFR QL
Sbjct  193  NINRFRSQL  201



>gb|KGN49082.1| hypothetical protein Csa_6G513460 [Cucumis sativus]
Length=1059

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 3/129 (2%)
 Frame = +3

Query  234  VKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYP  413
            VK  +EQKE   Q+VRRAYPFHEIEPKWQ++W+E +TFRTPDE+DTSKPK+YVLDMFPYP
Sbjct  157  VKDVEEQKE---QEVRRAYPFHEIEPKWQRYWDENRTFRTPDEVDTSKPKFYVLDMFPYP  213

Query  414  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittir  593
            SG+GLHVGHPLGYT+TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT+R
Sbjct  214  SGSGLHVGHPLGYTSTDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLR  273

Query  594  ninrFRLQL  620
            NINRFR QL
Sbjct  274  NINRFRSQL  282



>ref|XP_008440038.1| PREDICTED: LOW QUALITY PROTEIN: putative leucine--tRNA ligase, 
mitochondrial [Cucumis melo]
Length=978

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 122/129 (95%), Gaps = 3/129 (2%)
 Frame = +3

Query  234  VKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYP  413
            VK  +EQKE   Q+VRRAYPFHEIEPKWQ++W+E +TFRTPDE+DTSKPK+YVLDMFPYP
Sbjct  76   VKDVEEQKE---QEVRRAYPFHEIEPKWQRYWDENRTFRTPDEVDTSKPKFYVLDMFPYP  132

Query  414  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittir  593
            SG+GLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT+R
Sbjct  133  SGSGLHVGHPLGYTATDILARFKRMQGHNVLHPMGWDAFGLPAEQYAIETGTHPKITTLR  192

Query  594  ninrFRLQL  620
            NINRFR QL
Sbjct  193  NINRFRSQL  201



>ref|XP_002264138.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Vitis 
vinifera]
 emb|CBI23202.3| unnamed protein product [Vitis vinifera]
Length=971

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +3

Query  201  NCVSKTNGISCVK-VEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSK  377
            N VS++   S  K + + + ++ ++ +RRAYPFHEIEP+WQ+FWEE +TFRTPD++DTSK
Sbjct  53   NGVSRSIRNSATKELSEVEGQDRKEPIRRAYPFHEIEPRWQRFWEENRTFRTPDDVDTSK  112

Query  378  PKYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI  557
            PK+YVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI
Sbjct  113  PKFYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI  172

Query  558  ETGTHPrittirninrFRLQL  620
            ETGTHP+ITT RNI RFR QL
Sbjct  173  ETGTHPKITTTRNIARFRSQL  193



>ref|XP_007026156.1| TRNA synthetase class I (I, L, M and V) family protein isoform 
2 [Theobroma cacao]
 gb|EOY28778.1| TRNA synthetase class I (I, L, M and V) family protein isoform 
2 [Theobroma cacao]
Length=687

 Score =   218 bits (555),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 122/128 (95%), Gaps = 1/128 (1%)
 Frame = +3

Query  237  KVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPS  416
            +VE+EQK+ +   V+RAYPF+EIEPKWQ++WEE +TFRTPD++DTSKPKYYVLDMFPYPS
Sbjct  76   EVEEEQKQ-KSVVVKRAYPFNEIEPKWQRYWEENRTFRTPDDVDTSKPKYYVLDMFPYPS  134

Query  417  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  596
            GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  135  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTLRN  194

Query  597  inrFRLQL  620
            INRFR QL
Sbjct  195  INRFRSQL  202



>ref|XP_011095981.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Sesamum indicum]
 ref|XP_011095982.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Sesamum indicum]
Length=967

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +3

Query  201  NCVSKTNGISCVKVEDEQKE---NEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDT  371
            NC++ T         +E +E   + E++VRRAYPFHEIEPKWQ++WE+ KTFRTPDE+DT
Sbjct  47   NCLNATAYDKNTNPSEESEEFTGSLEEEVRRAYPFHEIEPKWQRYWEDNKTFRTPDELDT  106

Query  372  SKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQY  551
            SKPK+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQG+NVLHPMGWDAFGLPAEQY
Sbjct  107  SKPKFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGFNVLHPMGWDAFGLPAEQY  166

Query  552  AIETGTHPrittirninrFRLQL  620
            AIETGTHP+ITT++NI+RFR QL
Sbjct  167  AIETGTHPKITTMKNIDRFRSQL  189



>ref|XP_010057899.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
 gb|KCW75246.1| hypothetical protein EUGRSUZ_E03997 [Eucalyptus grandis]
Length=982

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  252  QKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLH  431
            Q++ +E  V+RAYPFHEIEPKWQ++WE+ KTFRTPDEIDTS+PK+YVLDMFPYPSGAGLH
Sbjct  82   QEQKQEPLVKRAYPFHEIEPKWQEYWEKNKTFRTPDEIDTSRPKFYVLDMFPYPSGAGLH  141

Query  432  VGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFR  611
            VGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNINRFR
Sbjct  142  VGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNINRFR  201

Query  612  LQL  620
            +QL
Sbjct  202  IQL  204



>ref|XP_007026155.1| TRNA synthetase class I (I, L, M and V) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28777.1| TRNA synthetase class I (I, L, M and V) family protein isoform 
1 [Theobroma cacao]
Length=980

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 122/128 (95%), Gaps = 1/128 (1%)
 Frame = +3

Query  237  KVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPS  416
            +VE+EQK+ +   V+RAYPF+EIEPKWQ++WEE +TFRTPD++DTSKPKYYVLDMFPYPS
Sbjct  76   EVEEEQKQ-KSVVVKRAYPFNEIEPKWQRYWEENRTFRTPDDVDTSKPKYYVLDMFPYPS  134

Query  417  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  596
            GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  135  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTLRN  194

Query  597  inrFRLQL  620
            INRFR QL
Sbjct  195  INRFRSQL  202



>ref|XP_002317141.1| hypothetical protein POPTR_0011s01420g [Populus trichocarpa]
 gb|EEE97753.1| hypothetical protein POPTR_0011s01420g [Populus trichocarpa]
Length=974

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = +3

Query  225  ISCVKVE-DEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDM  401
            I C   E +EQKE + Q V+RAYPFHEIEPKWQ +WE+ +TFRTPDE+DTSKPK+YVLDM
Sbjct  63   IRCSVSEVEEQKEKQLQVVKRAYPFHEIEPKWQSYWEKNQTFRTPDEVDTSKPKFYVLDM  122

Query  402  FPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  575
            FPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP
Sbjct  123  FPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  180



>ref|XP_008384092.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=978

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +3

Query  249  EQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  428
            EQK  ++  V+R YPFHEIE KWQ +WEE +TFRTPDEIDTSKPKYYVLDMFPYPSGAGL
Sbjct  78   EQKPKQQAVVKRPYPFHEIELKWQCYWEENRTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  137

Query  429  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  608
            HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT++NI+RF
Sbjct  138  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLKNIDRF  197

Query  609  RLQL  620
            R QL
Sbjct  198  RSQL  201



>ref|XP_002518434.1| leucyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF43821.1| leucyl-tRNA synthetase, putative [Ricinus communis]
Length=960

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  246  DEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAG  425
            +E++E ++  V++AYPFHEIEPKWQ++WE+  TFRTPDEIDTSKPK+YVLDMFPYPSG+G
Sbjct  58   NEEQEQKQPMVKKAYPFHEIEPKWQRYWEDNHTFRTPDEIDTSKPKFYVLDMFPYPSGSG  117

Query  426  LHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninr  605
            LHVGHPLGYTATDILARF+RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNINR
Sbjct  118  LHVGHPLGYTATDILARFRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNINR  177

Query  606  FRLQL  620
            FR QL
Sbjct  178  FRSQL  182



>ref|XP_007153983.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
 gb|ESW25977.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
Length=824

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = +3

Query  240  VEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDE-IDTSKPKYYVLDMFPYPS  416
            V +   E+++Q V RAYPFHEIEPKWQ+FWE  +TFRTPD+ IDT+KPKYYVLDMFPYPS
Sbjct  63   VANGGTEHQKQPVNRAYPFHEIEPKWQRFWEHNRTFRTPDDDIDTTKPKYYVLDMFPYPS  122

Query  417  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  596
            GAGLHVGHPLGYTATDILAR+KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  123  GAGLHVGHPLGYTATDILARYKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTVRN  182

Query  597  inrFRLQL  620
            INRFR QL
Sbjct  183  INRFRTQL  190



>emb|CAN74190.1| hypothetical protein VITISV_036142 [Vitis vinifera]
Length=893

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  282  RAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTAT  461
            RAYPFHEIEP+WQ+FWEE +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGYTAT
Sbjct  3    RAYPFHEIEPRWQRFWEENRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGYTAT  62

Query  462  DILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            DILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNI RFR QL
Sbjct  63   DILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTTRNIARFRSQL  115



>ref|XP_007153984.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
 ref|XP_007153985.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
 gb|ESW25978.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
 gb|ESW25979.1| hypothetical protein PHAVU_003G081300g [Phaseolus vulgaris]
Length=967

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 1/128 (1%)
 Frame = +3

Query  240  VEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDE-IDTSKPKYYVLDMFPYPS  416
            V +   E+++Q V RAYPFHEIEPKWQ+FWE  +TFRTPD+ IDT+KPKYYVLDMFPYPS
Sbjct  63   VANGGTEHQKQPVNRAYPFHEIEPKWQRFWEHNRTFRTPDDDIDTTKPKYYVLDMFPYPS  122

Query  417  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  596
            GAGLHVGHPLGYTATDILAR+KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  123  GAGLHVGHPLGYTATDILARYKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTVRN  182

Query  597  inrFRLQL  620
            INRFR QL
Sbjct  183  INRFRTQL  190



>gb|KFK30967.1| hypothetical protein AALP_AA6G050800 [Arabis alpina]
Length=968

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 4/131 (3%)
 Frame = +3

Query  240  VEDEQKENEEQQV----RRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFP  407
            V +EQ   +E+ +    +R YPFHEIEPKWQ++WEE +TFRTPD++DTSKPK+YVLDMFP
Sbjct  60   VTEEQSNRKEEALAIESKRVYPFHEIEPKWQRYWEENRTFRTPDDVDTSKPKFYVLDMFP  119

Query  408  YPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPritt  587
            YPSGAGLHVGHPLGYTATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT
Sbjct  120  YPSGAGLHVGHPLGYTATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTT  179

Query  588  irninrFRLQL  620
            ++NI+RFR+QL
Sbjct  180  LKNIDRFRVQL  190



>ref|XP_008224706.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Prunus 
mume]
Length=975

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  69   HSRLRLLQQPFSQPPFCRRELLISTHfrpllrrrsfsflrlrlsN----CV-SKTNGISC  233
            H++L L  Q    PP     +L  +H     R R+ SF      N    CV  + +G+  
Sbjct  5    HAQLHLQLQALPPPPLRFGSVLFPSHPIQSKRIRNSSFSLRLYHNGSKSCVFGRKSGVIR  64

Query  234  VKVEDEQ------KENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVL  395
              V +E       K  ++  V+R YPFHEIE KWQ++WEE +TFRTPDEIDTSKPKYYVL
Sbjct  65   SSVAEEANGAAEPKPKQQVTVKRPYPFHEIELKWQRYWEENQTFRTPDEIDTSKPKYYVL  124

Query  396  DMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  575
            DMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP
Sbjct  125  DMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  184

Query  576  rittirninrFRLQL  620
            +ITT++NI+RFR QL
Sbjct  185  KITTLKNIDRFRSQL  199



>ref|XP_010422266.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=857

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            +++R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ELKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  195



>ref|XP_007213686.1| hypothetical protein PRUPE_ppa000869mg [Prunus persica]
 gb|EMJ14885.1| hypothetical protein PRUPE_ppa000869mg [Prunus persica]
Length=976

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 6/140 (4%)
 Frame = +3

Query  201  NCVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  380
            +   K+NG +      E K  ++  V+R YPFHEIE KWQ++WE+ +TFRTPDEIDTSKP
Sbjct  66   SVAEKSNGAA------EPKPKQQVTVKRPYPFHEIELKWQRYWEDNQTFRTPDEIDTSKP  119

Query  381  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  560
            KYYVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  120  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  179

Query  561  TGTHPrittirninrFRLQL  620
            TGTHP+ITT++NI+RFR QL
Sbjct  180  TGTHPKITTLKNIDRFRSQL  199



>ref|XP_010432889.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=973

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            +++R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ELKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  195



>ref|XP_002872690.1| EMB2369 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48949.1| EMB2369 [Arabidopsis lyrata subsp. lyrata]
Length=972

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            +++R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  79   ELKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  138

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  139  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  194



>ref|XP_010422265.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=973

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            +++R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ELKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  195



>ref|XP_012091308.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Jatropha curcas]
 ref|XP_012091309.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Jatropha curcas]
 gb|KDP20709.1| hypothetical protein JCGZ_21180 [Jatropha curcas]
Length=984

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = +3

Query  243  EDEQKENEEQ-QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSG  419
            E E K+ ++Q  V+RAYPFHEIEPKWQ++W++  TFRTPDEIDTSKPK+YVLDMFPYPSG
Sbjct  80   EPELKQTQKQPVVKRAYPFHEIEPKWQRYWDDNYTFRTPDEIDTSKPKFYVLDMFPYPSG  139

Query  420  AGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirni  599
            +GLHVGHPLGYTATDILARF+RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT+RNI
Sbjct  140  SGLHVGHPLGYTATDILARFRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLRNI  199

Query  600  nrFRLQL  620
            NRFR QL
Sbjct  200  NRFRSQL  206



>ref|XP_004295290.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=955

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 122/139 (88%), Gaps = 3/139 (2%)
 Frame = +3

Query  204  CVSKTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPK  383
            CVS T   S     ++  E++ +Q +RAYPFHEIEPKWQ++WE+ KTFRTPDE+D SKPK
Sbjct  43   CVSIT--ASSANEPNDVVEHKPKQ-KRAYPFHEIEPKWQRYWEKDKTFRTPDEVDMSKPK  99

Query  384  YYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIET  563
            +YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIET
Sbjct  100  FYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIET  159

Query  564  GTHPrittirninrFRLQL  620
            GTHP+ITT++NI+RFR QL
Sbjct  160  GTHPKITTLKNIDRFRSQL  178



>ref|XP_006396696.1| hypothetical protein EUTSA_v10028396mg [Eutrema salsugineum]
 gb|ESQ38149.1| hypothetical protein EUTSA_v10028396mg [Eutrema salsugineum]
Length=973

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            + +R YPFHEIEPKWQ++WEE +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ESKRVYPFHEIEPKWQRYWEENRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  195



>gb|KJB67266.1| hypothetical protein B456_010G183100 [Gossypium raimondii]
 gb|KJB67267.1| hypothetical protein B456_010G183100 [Gossypium raimondii]
 gb|KJB67268.1| hypothetical protein B456_010G183100 [Gossypium raimondii]
Length=976

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 121/128 (95%), Gaps = 1/128 (1%)
 Frame = +3

Query  237  KVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPS  416
            +VE+EQK+ +   V+RAYPF EIEPKWQ++WE+ +TFRTP+++DTSKPK+YVLDMFPYPS
Sbjct  71   EVEEEQKQ-KPVLVKRAYPFDEIEPKWQRYWEQNRTFRTPNDVDTSKPKFYVLDMFPYPS  129

Query  417  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  596
            GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  130  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTLRN  189

Query  597  inrFRLQL  620
            INRFR QL
Sbjct  190  INRFRSQL  197



>ref|XP_006287002.1| hypothetical protein CARUB_v10000148mg [Capsella rubella]
 gb|EOA19900.1| hypothetical protein CARUB_v10000148mg [Capsella rubella]
Length=976

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            +++R YPFHEIEPKWQ++WE+  TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  83   ELKRVYPFHEIEPKWQRYWEDNSTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  142

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  143  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKATTLKNIDRFRLQL  198



>emb|CDY21299.1| BnaC03g29830D [Brassica napus]
Length=957

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  270  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  449
            +  +R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLG
Sbjct  66   ETAKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLG  125

Query  450  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            YTATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  126  YTATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  182



>ref|XP_009134299.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Brassica 
rapa]
Length=956

 Score =   212 bits (540),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  270  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  449
            +  +R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLG
Sbjct  65   ETAKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLG  124

Query  450  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            YTATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  125  YTATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  181



>emb|CDX90858.1| BnaA03g25380D [Brassica napus]
Length=956

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  270  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  449
            +  +R YPFHEIEPKWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLG
Sbjct  65   ETAKRVYPFHEIEPKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLG  124

Query  450  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            YTATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  125  YTATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  181



>ref|XP_010099169.1| Leucine--tRNA ligase [Morus notabilis]
 gb|EXB77041.1| Leucine--tRNA ligase [Morus notabilis]
Length=980

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +3

Query  276  VRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYT  455
            VRRAYPFHEIEPKWQ+FW++  TFRTP ++DTSKPK+YVLDMFPYPSGAGLHVGHPLGYT
Sbjct  87   VRRAYPFHEIEPKWQRFWDDNFTFRTPGDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGYT  146

Query  456  ATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNINRFR QL
Sbjct  147  ATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTERNINRFRTQL  201



>gb|KHG27983.1| Leucine--tRNA ligase [Gossypium arboreum]
Length=976

 Score =   212 bits (539),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = +3

Query  237  KVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPS  416
            +VE EQK+ +   V+RAYPF EIEPKWQ++WE+ +TFRTP+++DTSKPK+YVLDMFPYPS
Sbjct  71   EVEAEQKQ-KPLLVKRAYPFDEIEPKWQRYWEQNRTFRTPNDVDTSKPKFYVLDMFPYPS  129

Query  417  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirn  596
            GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++TT+RN
Sbjct  130  GAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLTTLRN  189

Query  597  inrFRLQL  620
            INRFR QL
Sbjct  190  INRFRSQL  197



>ref|XP_009357478.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Pyrus 
x bretschneideri]
Length=978

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  249  EQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  428
            EQK  ++  V+R YPFHEIE KWQ +WEE +TFRTPDEIDTSKPKYYVLDMFPYPSGAGL
Sbjct  78   EQKPKQQAVVKRPYPFHEIELKWQCYWEENRTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  137

Query  429  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  608
            HVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ITT++NI+RF
Sbjct  138  HVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKITTLKNIDRF  197

Query  609  RLQL  620
              QL
Sbjct  198  CSQL  201



>ref|NP_192344.1| tRNA synthetase class I (I, L, M and V) family protein [Arabidopsis 
thaliana]
 gb|AAD36946.1|AF069441_6 putative leucyl tRNA synthetase [Arabidopsis thaliana]
 emb|CAB77903.1| putative leucyl tRNA synthetase [Arabidopsis thaliana]
 gb|AAL84999.1| AT4g04350/T19B17_7 [Arabidopsis thaliana]
 gb|AAN72260.1| At4g04350/T19B17_7 [Arabidopsis thaliana]
 gb|AEE82383.1| tRNA synthetase class I (I, L, M and V) family protein [Arabidopsis 
thaliana]
Length=973

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            +++R YPFHEIEPKWQ++WE+ + FRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ELKRVYPFHEIEPKWQRYWEDNRIFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  195



>ref|XP_010272272.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Nelumbo 
nucifera]
Length=968

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 4/144 (3%)
 Frame = +3

Query  201  NCVSKTNGISCVKVEDEQKENEEQQVR----RAYPFHEIEPKWQKFWEEKKTFRTPDEID  368
            N VS ++  S   +++E  + E+Q+++    RAYPFHEIEP+WQ++WEE +TFRTPDE+D
Sbjct  47   NGVSNSSISSQSTLKEEYNKEEQQKLQQPRTRAYPFHEIEPRWQRYWEENRTFRTPDEVD  106

Query  369  TSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQ  548
            TSKPK+Y+LDMFPYPSGAGLHVGHPLGYTATDILAR+KRM+G+NVLHPMGWDAFGLPAEQ
Sbjct  107  TSKPKFYILDMFPYPSGAGLHVGHPLGYTATDILARYKRMKGFNVLHPMGWDAFGLPAEQ  166

Query  549  YAIETGTHPrittirninrFRLQL  620
            YAIETGTHP+ITT RNI RFR QL
Sbjct  167  YAIETGTHPKITTARNIERFRSQL  190



>emb|CDP04435.1| unnamed protein product [Coffea canephora]
Length=972

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 149/196 (76%), Gaps = 7/196 (4%)
 Frame = +3

Query  48   MNTQFEIHSRLRLLQQPFSQ-PPFCRRELLISTHfr--pllrrrsfsflrlrlsNCVSKT  218
            M TQF  H+   L   P +  PP  RR +L+ +H       RR +     LR+S+C++ T
Sbjct  1    MYTQF--HTSTLLPTLPLTHSPPLSRRTILLYSHRLPPLHRRRPTSLRFPLRISSCINST  58

Query  219  NGI-SCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTP-DEIDTSKPKYYV  392
              I S +  E+E++     +  +AYPFHEIEPKWQ++WEE KTFRTP D++DT+KPKYYV
Sbjct  59   GTICSSLSTEEEEERPSNNKRVKAYPFHEIEPKWQRYWEEHKTFRTPHDDLDTTKPKYYV  118

Query  393  LDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTH  572
            LDMFPYPSGAGLHVGHPLGYTATDILARFKRMQG+NVLHPMGWDAFGLPAEQYAI+TGTH
Sbjct  119  LDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGFNVLHPMGWDAFGLPAEQYAIQTGTH  178

Query  573  PrittirninrFRLQL  620
            P+ITT+RNI RFR QL
Sbjct  179  PKITTLRNIERFRSQL  194



>ref|XP_010496176.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=967

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            +++R YPFHEIE KWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  74   ELKRVYPFHEIERKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  133

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  134  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  189



>ref|XP_010496177.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=973

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            +++R YPFHEIE KWQ++WE+ +TFRTPD++DTSKPK+YVLDMFPYPSGAGLHVGHPLGY
Sbjct  80   ELKRVYPFHEIERKWQRYWEDNRTFRTPDDVDTSKPKFYVLDMFPYPSGAGLHVGHPLGY  139

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDILAR +RMQGYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT++NI+RFRLQL
Sbjct  140  TATDILARLRRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKTTTLKNIDRFRLQL  195



>ref|XP_010529456.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Tarenaya 
hassleriana]
Length=968

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 116/140 (83%), Gaps = 6/140 (4%)
 Frame = +3

Query  219  NGISCVKVEDEQKENEEQQ------VRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKP  380
             G+     E ++  N ++        +R YPFHEIEPKWQ++WEE +TFRTP+++DT+KP
Sbjct  51   GGVRSSAAETQETGNSKRDSSATVVTKRVYPFHEIEPKWQQYWEENRTFRTPEDVDTAKP  110

Query  381  KYYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIE  560
            K+YVLDMFPYPSGAGLHVGHPLGYTATDILAR KRMQGYNVLHPMGWDAFGLPAEQYAIE
Sbjct  111  KFYVLDMFPYPSGAGLHVGHPLGYTATDILARLKRMQGYNVLHPMGWDAFGLPAEQYAIE  170

Query  561  TGTHPrittirninrFRLQL  620
            TGTHP++TT +NI RFR QL
Sbjct  171  TGTHPKVTTAKNIERFRTQL  190



>ref|XP_003529648.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial-like 
[Glycine max]
 gb|KHN35716.1| Leucine--tRNA ligase [Glycine soja]
Length=972

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = +3

Query  228  SCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDE-IDTSKPKYYVLDMF  404
            S  K    + E+ +Q V RAYPFHEIE KWQ+FW+  +TF+TPD+ IDTSKPKYYVLDMF
Sbjct  64   SAAKGGVSETEHNKQPVTRAYPFHEIELKWQRFWDHNRTFQTPDDDIDTSKPKYYVLDMF  123

Query  405  PYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrit  584
            PYPSGAGLHVGHPLGYTATDILAR+KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP++T
Sbjct  124  PYPSGAGLHVGHPLGYTATDILARYKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPKLT  183

Query  585  tirninrFRLQL  620
            T+RNINRFR QL
Sbjct  184  TVRNINRFRTQL  195



>ref|XP_010916288.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Elaeis 
guineensis]
Length=950

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +3

Query  270  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  449
            QQ RR+YPF EIEP+WQ++WEE +TFRTPDE+DTSKPK Y+LDMFPYPSGAGLHVGHPLG
Sbjct  60   QQQRRSYPFDEIEPRWQRYWEENRTFRTPDEVDTSKPKCYILDMFPYPSGAGLHVGHPLG  119

Query  450  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            YTATDIL+R+KRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT +NI RFR QL
Sbjct  120  YTATDILSRYKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTKQNIERFRSQL  176



>gb|AES92665.2| leucyl-tRNA synthetase [Medicago truncatula]
Length=970

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 114/129 (88%), Gaps = 4/129 (3%)
 Frame = +3

Query  246  DEQKENEEQQ--VRRAYPFHEIEPKWQKFWEEKKTFRTPDE--IDTSKPKYYVLDMFPYP  413
            D Q    EQ+  V RAYPFHEIEPKWQ+FW+E  TFRTPD+  IDTSKPKYY+LDMFPYP
Sbjct  64   DVQLNETEQKKPVNRAYPFHEIEPKWQRFWDEFCTFRTPDDDDIDTSKPKYYILDMFPYP  123

Query  414  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittir  593
            SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI+TGTHP++TT+ 
Sbjct  124  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIQTGTHPKLTTVT  183

Query  594  ninrFRLQL  620
            NINRF  QL
Sbjct  184  NINRFTSQL  192



>ref|XP_003619258.1| Leucyl-tRNA synthetase [Medicago truncatula]
Length=1009

 Score =   206 bits (525),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 114/129 (88%), Gaps = 4/129 (3%)
 Frame = +3

Query  246  DEQKENEEQQ--VRRAYPFHEIEPKWQKFWEEKKTFRTPDE--IDTSKPKYYVLDMFPYP  413
            D Q    EQ+  V RAYPFHEIEPKWQ+FW+E  TFRTPD+  IDTSKPKYY+LDMFPYP
Sbjct  64   DVQLNETEQKKPVNRAYPFHEIEPKWQRFWDEFCTFRTPDDDDIDTSKPKYYILDMFPYP  123

Query  414  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittir  593
            SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI+TGTHP++TT+ 
Sbjct  124  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIQTGTHPKLTTVT  183

Query  594  ninrFRLQL  620
            NINRF  QL
Sbjct  184  NINRFTSQL  192



>ref|XP_003610468.1| Leucyl-tRNA synthetase [Medicago truncatula]
Length=1091

 Score =   207 bits (527),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 114/129 (88%), Gaps = 4/129 (3%)
 Frame = +3

Query  246  DEQKENEEQQ--VRRAYPFHEIEPKWQKFWEEKKTFRTPDE--IDTSKPKYYVLDMFPYP  413
            D Q    EQ+  V RAYPFHEIEPKWQ+FW+E  TFRTPD+  IDTSKPKYY+LDMFPYP
Sbjct  64   DVQLNETEQKKPVNRAYPFHEIEPKWQRFWDEFCTFRTPDDDDIDTSKPKYYILDMFPYP  123

Query  414  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittir  593
            SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAI+TGTHP++TT+ 
Sbjct  124  SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIQTGTHPKLTTVT  183

Query  594  ninrFRLQL  620
            NINRF  QL
Sbjct  184  NINRFTSQL  192



>ref|XP_009358062.1| PREDICTED: LOW QUALITY PROTEIN: putative leucine--tRNA ligase, 
mitochondrial [Pyrus x bretschneideri]
Length=811

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  249  EQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGL  428
            E K  ++  V+R YPFHEIE KWQ++WEE +TFRTP+EIDTSKPKYYVLDMFPYPSGAGL
Sbjct  80   EHKPKQQPAVKRPYPFHEIELKWQRYWEENRTFRTPEEIDTSKPKYYVLDMFPYPSGAGL  139

Query  429  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  608
            HVGHPLGYTAT ILAR KRMQGY VLHPMGWDAFGLPAEQYAI+TGTHP+ITT++NI+RF
Sbjct  140  HVGHPLGYTATYILARLKRMQGYTVLHPMGWDAFGLPAEQYAIDTGTHPKITTLKNIDRF  199

Query  609  RLQL  620
            R QL
Sbjct  200  RSQL  203



>ref|XP_009390214.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=820

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = +3

Query  261  NEEQQV--RRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHV  434
            N +QQV  R+AYPF  IEP+WQ++WEE +TFRTPDE+DTSKPK Y+LDMFPYPSGAGLHV
Sbjct  54   NPQQQVQQRKAYPFDAIEPRWQRYWEENRTFRTPDEVDTSKPKCYILDMFPYPSGAGLHV  113

Query  435  GHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRL  614
            GHPLGYTATDIL+R+KRM+G+NVLHPMGWDAFGLPAEQYAIETGTHP++TT RNI RFR 
Sbjct  114  GHPLGYTATDILSRYKRMKGFNVLHPMGWDAFGLPAEQYAIETGTHPKVTTKRNIERFRS  173

Query  615  QL  620
            QL
Sbjct  174  QL  175



>ref|XP_009390213.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=949

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = +3

Query  261  NEEQQV--RRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHV  434
            N +QQV  R+AYPF  IEP+WQ++WEE +TFRTPDE+DTSKPK Y+LDMFPYPSGAGLHV
Sbjct  54   NPQQQVQQRKAYPFDAIEPRWQRYWEENRTFRTPDEVDTSKPKCYILDMFPYPSGAGLHV  113

Query  435  GHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRL  614
            GHPLGYTATDIL+R+KRM+G+NVLHPMGWDAFGLPAEQYAIETGTHP++TT RNI RFR 
Sbjct  114  GHPLGYTATDILSRYKRMKGFNVLHPMGWDAFGLPAEQYAIETGTHPKVTTKRNIERFRS  173

Query  615  QL  620
            QL
Sbjct  174  QL  175



>ref|XP_008776029.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=960

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +3

Query  270  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  449
            Q+ RR+YPF EIEP+WQ++WEE  TFRTPDE+DTSKPK Y+LDMFPYPSGAGLHVGHPLG
Sbjct  60   QKQRRSYPFDEIEPRWQRYWEENCTFRTPDEVDTSKPKCYILDMFPYPSGAGLHVGHPLG  119

Query  450  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            YTATDIL+R+KRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNI RFR QL
Sbjct  120  YTATDILSRYKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTKRNIERFRSQL  176



>ref|XP_006600301.1| PREDICTED: LOW QUALITY PROTEIN: leucine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=898

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 112/124 (90%), Gaps = 1/124 (1%)
 Frame = +3

Query  252  QKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDE-IDTSKPKYYVLDMFPYPSGAGL  428
            + E+ +  V RAYPFHEIEPK Q+FWE  +TFRTPD+ IDTSKPKYYVLDMFPYPSGAGL
Sbjct  64   ETEHSKLPVTRAYPFHEIEPKXQRFWEYNRTFRTPDDDIDTSKPKYYVLDMFPYPSGAGL  123

Query  429  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  608
            HVGHPLGYTATDILAR+KRMQGYNVLHPM WDAFGLPAEQYAIETGTHP++ T+RNINRF
Sbjct  124  HVGHPLGYTATDILARYKRMQGYNVLHPMRWDAFGLPAEQYAIETGTHPKLNTVRNINRF  183

Query  609  RLQL  620
            R QL
Sbjct  184  RTQL  187



>ref|XP_006838108.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Amborella 
trichopoda]
 gb|ERN00677.1| hypothetical protein AMTR_s00106p00046740 [Amborella trichopoda]
Length=967

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 122/139 (88%), Gaps = 7/139 (5%)
 Frame = +3

Query  225  ISC-VKVEDEQKENEEQQVR-----RAYPFHEIEPKWQKFWEEKKTFRTPDE-IDTSKPK  383
            ++C V+ ++ QKE EE+  R     +AYPF EIEP+WQ +WEE +TFRTPD+ +DTSKPK
Sbjct  62   VACGVRAQEMQKEEEEEIERGSKKQKAYPFDEIEPRWQGYWEENRTFRTPDDDLDTSKPK  121

Query  384  YYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIET  563
            +Y+LDMFPYPSGAGLHVGHPLGYTATDIL+R+KRMQG+NVLHPMGWDAFGLPAEQYAIET
Sbjct  122  FYILDMFPYPSGAGLHVGHPLGYTATDILSRYKRMQGFNVLHPMGWDAFGLPAEQYAIET  181

Query  564  GTHPrittirninrFRLQL  620
            GTHP++TT++NI RFR QL
Sbjct  182  GTHPKVTTLQNITRFRCQL  200



>gb|EEC69839.1| hypothetical protein OsI_00164 [Oryza sativa Indica Group]
Length=946

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 113/139 (81%), Gaps = 3/139 (2%)
 Frame = +3

Query  213  KTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPK  383
            +  G  C    +      + Q RRAYP+ EIEP+WQ+ WEE +TFRTPD    +DTSKPK
Sbjct  40   RRGGGWCRCCANADAGKAQAQARRAYPYDEIEPRWQRHWEEHRTFRTPDIGHGLDTSKPK  99

Query  384  YYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIET  563
             Y+LDMFPYPSGAGLHVGHPLGYTATDIL+RFKRMQG+NVLHPMGWDAFGLPAEQYAIET
Sbjct  100  CYILDMFPYPSGAGLHVGHPLGYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQYAIET  159

Query  564  GTHPrittirninrFRLQL  620
            GTHP+ITT RNINRFR QL
Sbjct  160  GTHPKITTERNINRFRSQL  178



>ref|XP_006643717.1| PREDICTED: LOW QUALITY PROTEIN: putative leucine--tRNA ligase, 
mitochondrial-like [Oryza brachyantha]
Length=969

 Score =   197 bits (502),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 109/119 (92%), Gaps = 3/119 (3%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHP  443
            QVRRAYP+ EIEP+WQ+ WEE +TFRTPD    +DTS+PK Y+LDMFPYPSGAGLHVGHP
Sbjct  51   QVRRAYPYDEIEPRWQRHWEEHRTFRTPDIGDGLDTSRPKCYILDMFPYPSGAGLHVGHP  110

Query  444  LGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            LGYTATDIL+RFKRMQG+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNI+RFR QL
Sbjct  111  LGYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTERNIDRFRSQL  169



>gb|EEE53778.1| hypothetical protein OsJ_00171 [Oryza sativa Japonica Group]
Length=1257

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 113/139 (81%), Gaps = 3/139 (2%)
 Frame = +3

Query  213  KTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPK  383
            +  G  C    +      + Q RRAYP+ EIEP+WQ+ WEE +TFRTPD    +DTSKPK
Sbjct  351  RRGGGWCRCCANADAGKAQAQARRAYPYDEIEPRWQRHWEEHRTFRTPDIGHGLDTSKPK  410

Query  384  YYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIET  563
             Y+LDMFPYPSGAGLHVGHPLGYTATDIL+RFKRMQG+NVLHPMGWDAFGLPAEQYAIET
Sbjct  411  CYILDMFPYPSGAGLHVGHPLGYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQYAIET  470

Query  564  GTHPrittirninrFRLQL  620
            GTHP+ITT RNINRFR QL
Sbjct  471  GTHPKITTERNINRFRSQL  489



>ref|XP_002455289.1| hypothetical protein SORBIDRAFT_03g007890 [Sorghum bicolor]
 gb|EES00409.1| hypothetical protein SORBIDRAFT_03g007890 [Sorghum bicolor]
Length=958

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 107/121 (88%), Gaps = 3/121 (2%)
 Frame = +3

Query  267  EQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVG  437
            +   RRAYPF EIEP+WQ+ WEE +TFRTPD    +DTSKPK Y+LDMFPYPSGAGLHVG
Sbjct  64   QAAARRAYPFDEIEPRWQRHWEEHRTFRTPDIGDGLDTSKPKCYILDMFPYPSGAGLHVG  123

Query  438  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQ  617
            HPLGYTATDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNI RFR Q
Sbjct  124  HPLGYTATDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTERNIGRFRTQ  183

Query  618  L  620
            L
Sbjct  184  L  184



>ref|XP_001765367.1| predicted protein [Physcomitrella patens]
 gb|EDQ69830.1| predicted protein [Physcomitrella patens]
Length=906

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  246  DEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAG  425
            D++K  E  Q  R YPF EIE +WQ++WE+ +TFRTPD +DT+KPKYYVLDMFPYPSGAG
Sbjct  16   DQEKGLETPQKIRGYPFPEIEARWQQYWEDNQTFRTPDVVDTTKPKYYVLDMFPYPSGAG  75

Query  426  LHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninr  605
            LHVGHP GYTATDI+AR+KRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHPR TT++NI+R
Sbjct  76   LHVGHPEGYTATDIMARYKRMRGFNVLHPMGWDAFGLPAEQYAIQTGTHPRETTLKNIDR  135

Query  606  FRLQL  620
            FR QL
Sbjct  136  FRSQL  140



>ref|XP_010230387.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=936

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 108/124 (87%), Gaps = 3/124 (2%)
 Frame = +3

Query  258  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGL  428
            + +  + RRAYP+ EIEP+WQ  WEE +TFRTPD    +DTSKPK Y+LDMFPYPSGAGL
Sbjct  39   DADAGKARRAYPYDEIEPRWQAHWEEHRTFRTPDLGDGLDTSKPKCYILDMFPYPSGAGL  98

Query  429  HVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrF  608
            HVGHPLGYTATDIL+RFKRMQG+NVLHPMGWDAFGLPAEQYAI+TGTHP+ TT +NI+RF
Sbjct  99   HVGHPLGYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQYAIQTGTHPKFTTAQNIDRF  158

Query  609  RLQL  620
            R QL
Sbjct  159  RTQL  162



>ref|XP_004968118.1| PREDICTED: LOW QUALITY PROTEIN: putative leucine--tRNA ligase, 
mitochondrial-like [Setaria italica]
Length=984

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 3/117 (3%)
 Frame = +3

Query  279  RRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  449
            RRAYP+ EIEP+WQ+ WEE +TFRTPD    +DTSKPK Y+LDMFPYPSGAGLHVGHPLG
Sbjct  65   RRAYPYDEIEPRWQRHWEEHRTFRTPDIGEGLDTSKPKCYILDMFPYPSGAGLHVGHPLG  124

Query  450  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            YTATDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAIETGTHP+ITT RNI RFR QL
Sbjct  125  YTATDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTERNIERFRTQL  181



>ref|XP_002948892.1| hypothetical protein VOLCADRAFT_89222 [Volvox carteri f. nagariensis]
 gb|EFJ50272.1| hypothetical protein VOLCADRAFT_89222 [Volvox carteri f. nagariensis]
Length=938

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  255  KENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHV  434
            + + +    +AYPF EIE KWQ +WE+ +TF TPD++DTSKPKYYVLDMFPYPSGAGLHV
Sbjct  82   QADAKSAASQAYPFTEIEAKWQAYWEQNQTFHTPDQVDTSKPKYYVLDMFPYPSGAGLHV  141

Query  435  GHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRL  614
            GHP GYTATDILAR+KRM+G+NVLHPMGWDAFGLPAEQYA++TGTHP +TT RN+ RFR 
Sbjct  142  GHPEGYTATDILARYKRMRGFNVLHPMGWDAFGLPAEQYALQTGTHPAVTTQRNVTRFRQ  201

Query  615  QL  620
            QL
Sbjct  202  QL  203



>emb|CBH32645.1| leucyl-tRNA synthetase, putative, expressed [Triticum aestivum]
Length=965

 Score =   192 bits (488),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 105/117 (90%), Gaps = 3/117 (3%)
 Frame = +3

Query  279  RRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  449
            RRAYP+ EIEP+WQ  WEE++TFRTPD    +DTS+PK Y+LDMFPYPSGAGLHVGHPLG
Sbjct  52   RRAYPYDEIEPRWQAHWEERRTFRTPDIGDGLDTSRPKCYILDMFPYPSGAGLHVGHPLG  111

Query  450  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            YTATDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ TT RNI+ FR QL
Sbjct  112  YTATDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIQTGTHPKTTTARNIDHFRTQL  168



>ref|XP_011398417.1| Leucine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM25521.1| Leucine-tRNA ligase [Auxenochlorella protothecoides]
Length=1317

 Score =   193 bits (491),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 2/114 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPD--EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTA  458
            AYPF E+EPKWQ++WEE +TFRTP+  ++DTSKPK+YVLDMFPYPSG+GLHVGHP GYTA
Sbjct  82   AYPFAELEPKWQRYWEENQTFRTPEFKDLDTSKPKFYVLDMFPYPSGSGLHVGHPEGYTA  141

Query  459  TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TDILAR+KRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP  TT  NI RFR QL
Sbjct  142  TDILARYKRMRGFNVLHPMGWDAFGLPAEQYAIQTGTHPAATTATNITRFRQQL  195



>ref|XP_008655584.1| PREDICTED: putative leucine--tRNA ligase, mitochondrial [Zea 
mays]
Length=954

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 105/118 (89%), Gaps = 3/118 (3%)
 Frame = +3

Query  276  VRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPL  446
             RRAYPF EIEP+WQ+ WEE +TFRT D    +DTSKPK Y+LDMFPYPSGAGLHVGHPL
Sbjct  63   ARRAYPFDEIEPRWQRHWEEHRTFRTLDIGEGLDTSKPKCYILDMFPYPSGAGLHVGHPL  122

Query  447  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            GYTATDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ITT RNI RFR QL
Sbjct  123  GYTATDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIQTGTHPKITTERNIERFRTQL  180



>emb|CDM80420.1| unnamed protein product [Triticum aestivum]
Length=968

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 3/116 (3%)
 Frame = +3

Query  282  RAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            RAYP+ EIEP+WQ  WEE++TFRTPD    +DTS+PK Y+LDMFPYPSGAGLHVGHPLGY
Sbjct  56   RAYPYDEIEPRWQAHWEERRTFRTPDIGDGLDTSRPKCYILDMFPYPSGAGLHVGHPLGY  115

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ TT RNI+ FR QL
Sbjct  116  TATDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIQTGTHPKTTTARNIDHFRTQL  171



>ref|XP_005842216.1| leucyl-tRNA synthetase [Guillardia theta CCMP2712]
 gb|EKX55236.1| leucyl-tRNA synthetase [Guillardia theta CCMP2712]
Length=888

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  264  EEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHP  443
            +E     AYPF EIE KWQ FW+E+ TFRTP+++D SKPKYYVLDMFPYPSGAGLHVGHP
Sbjct  4    KESSTSSAYPFQEIERKWQGFWKEQDTFRTPEKVDMSKPKYYVLDMFPYPSGAGLHVGHP  63

Query  444  LGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
             GYTATDIL+R+K+M  YNV+HPMGWDAFGLPAEQYAI+TGTHP +TT +NI+RFR QL
Sbjct  64   EGYTATDILSRYKKMNDYNVMHPMGWDAFGLPAEQYAIQTGTHPSVTTKKNIDRFREQL  122



>ref|XP_003079670.1| Isoleucyl-tRNA synthetase (ISS) [Ostreococcus tauri]
 emb|CAL53315.1| Valyl/Leucyl/Isoleucyl-tRNA synthetase, class I,anticodon-binding 
[Ostreococcus tauri]
Length=880

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +3

Query  246  DEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAG  425
            D  ++         YPF  IE KWQKFW + KTF+TP EID SKPK+Y LDMFPYPSGAG
Sbjct  9    DASRDASTTTNEGGYPFGAIEGKWQKFWSDDKTFKTPREIDASKPKFYALDMFPYPSGAG  68

Query  426  LHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninr  605
            LHVGHP GYTATDI+AR+KRM G+NVLHPMGWDAFGLPAEQYAIETGTHP  TT++N+ R
Sbjct  69   LHVGHPEGYTATDIVARYKRMTGHNVLHPMGWDAFGLPAEQYAIETGTHPSQTTVKNVGR  128

Query  606  FRLQL  620
            FR QL
Sbjct  129  FREQL  133



>emb|CCG48000.1| leucyl-tRNA synthetase, putative, expressed [Triticum aestivum]
Length=916

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 104/114 (91%), Gaps = 3/114 (3%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTA  458
            +P+ EIEP+WQ  WEE++TFRTPD    +DTS+PK Y+LDMFPYPSGAGLHVGHPLGYTA
Sbjct  6    HPYDEIEPRWQAHWEERRTFRTPDIGDGLDTSRPKCYILDMFPYPSGAGLHVGHPLGYTA  65

Query  459  TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TDIL+RFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ TT RNI+RFR+QL
Sbjct  66   TDILSRFKRMKGFNVLHPMGWDAFGLPAEQYAIQTGTHPKTTTARNIDRFRMQL  119



>ref|WP_006930182.1| leucyl-tRNA synthetase [Caldithrix abyssi]
 gb|EHO42830.1| leucyl-tRNA synthetase [Caldithrix abyssi DSM 13497]
Length=877

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 102/112 (91%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            AYPF +IE KWQKFWEE+KTF+T D+ D  +PKYYVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    AYPFGKIEKKWQKFWEEQKTFKTEDKFD--QPKYYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I+AR+KRM+G+NVLHPMGWDAFGLPAEQYAIETGTHPRITT RNI RFR QL
Sbjct  60   IMARYKRMKGFNVLHPMGWDAFGLPAEQYAIETGTHPRITTERNIERFRKQL  111



>ref|XP_003059586.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56718.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1061

 Score =   183 bits (465),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 90/131 (69%), Positives = 104/131 (79%), Gaps = 7/131 (5%)
 Frame = +3

Query  249  EQKENEEQQVRRA--YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYP---  413
            E   + E    R+  YPF +IE +WQK W E KTF+TPD+IDT+KPK+Y LDMFPYP   
Sbjct  94   ETSSDAESTAARSGGYPFADIEARWQKHWAENKTFKTPDQIDTTKPKFYALDMFPYPRRV  153

Query  414  --SGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPritt  587
              +GAGLHVGHP GYTATDI+AR+KRM G+NVLHPMGWDAFGLPAEQYAIETGTHPR TT
Sbjct  154  VAAGAGLHVGHPEGYTATDIVARYKRMTGHNVLHPMGWDAFGLPAEQYAIETGTHPRDTT  213

Query  588  irninrFRLQL  620
            + N+ RFR QL
Sbjct  214  VANVARFREQL  224



>ref|XP_005651384.1| putative leucyl tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE26840.1| putative leucyl tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=891

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPD--EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTA  458
            +YPF E+E KWQ FW   KTFRTPD  E+DTSKPK Y+LDMFPYPSGAGLHVGHP GYTA
Sbjct  37   SYPFTELEAKWQDFWLRNKTFRTPDIGELDTSKPKAYILDMFPYPSGAGLHVGHPAGYTA  96

Query  459  TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TDILAR KRMQG NVLHP+GWDAFGLPAEQYA++TGTHPR+TT RN+NRFR QL
Sbjct  97   TDILARLKRMQGANVLHPIGWDAFGLPAEQYALQTGTHPRVTTERNVNRFRQQL  150



>ref|XP_001418146.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96439.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=879

 Score =   181 bits (460),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 78/103 (76%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  267  EQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPL  446
            E+     Y F ++E KWQKFW E+KTF TP  ID +KPK+Y LDMFPYPSGAGLHVGHP 
Sbjct  49   ERTTSAGYAFGDVEAKWQKFWREEKTFATPRAIDATKPKFYALDMFPYPSGAGLHVGHPE  108

Query  447  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHP  575
            GYTATDI+AR+KRM G+NVLHPMGWDAFGLPAEQYAIETGTHP
Sbjct  109  GYTATDIVARYKRMTGHNVLHPMGWDAFGLPAEQYAIETGTHP  151



>ref|WP_038556448.1| leucyl-tRNA synthetase [Draconibacterium orientale]
 gb|AHW59211.1| leucyl-tRNA synthetase [Draconibacterium orientale]
Length=883

 Score =   181 bits (460),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 85/111 (77%), Positives = 98/111 (88%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y F EIEPKWQK+WEE KTF+T D  D SKPKYY+LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YKFAEIEPKWQKYWEENKTFKTND--DYSKPKYYILDMFPYPSGAGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+R+KRM+G+NVLHPMG+DAFGLPAEQYA++TGTHP ITT +N + FR Q+
Sbjct  61   LSRYKRMKGFNVLHPMGYDAFGLPAEQYAMQTGTHPAITTQKNCDNFRRQI  111



>ref|XP_007513267.1| leucyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO16825.1| leucyl-tRNA synthetase [Bathycoccus prasinos]
Length=941

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 3/114 (3%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTA  458
            YPF EIE KWQK W+E KTF+TP     +D SKPK+Y LDMFPYPSGAGLHVGHP GYTA
Sbjct  72   YPFAEIEQKWQKNWQENKTFQTPSLNSGLDQSKPKFYALDMFPYPSGAGLHVGHPEGYTA  131

Query  459  TDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TDI+AR+KRM+GYNVLHPMGWDAFGLPAEQYAIETGTHP+ TT +N+NRFR QL
Sbjct  132  TDIMARYKRMKGYNVLHPMGWDAFGLPAEQYAIETGTHPKETTAKNVNRFREQL  185



>ref|WP_045026272.1| leucyl-tRNA synthase [Draconibacterium sp. JN14CK-3]
 gb|KJF44738.1| leucyl-tRNA synthase [Draconibacterium sp. JN14CK-3]
Length=883

 Score =   181 bits (459),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 85/111 (77%), Positives = 98/111 (88%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y F EIEPKWQK+WEE KTF+T D  D SKPKYY+LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YKFAEIEPKWQKYWEENKTFKTND--DYSKPKYYILDMFPYPSGAGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+R+KRM+G+NVLHPMG+DAFGLPAEQYA++TGTHP ITT +N + FR Q+
Sbjct  61   LSRYKRMKGFNVLHPMGYDAFGLPAEQYAMQTGTHPAITTQKNCDNFRRQI  111



>ref|WP_021267760.1| leucyl-tRNA synthetase [Bacteriovorax sp. BAL6_X]
 gb|EPZ49213.1| leucine--tRNA ligase [Bacteriovorax sp. BAL6_X]
Length=802

 Score =   179 bits (453),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 86/111 (77%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y F EIEPKWQKFW++ KTFRT D  D SKPKYYVLDMFPYPSGAGLHVGH  GYTATDI
Sbjct  3    YNFGEIEPKWQKFWDDNKTFRT-DSTDKSKPKYYVLDMFPYPSGAGLHVGHVEGYTATDI  61

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            LARFKRM G+NVLHPMGWD+FGLPAE YAI+TGTHP + T  NI  F  QL
Sbjct  62   LARFKRMNGHNVLHPMGWDSFGLPAENYAIKTGTHPNVITKENIGNFTRQL  112



>ref|XP_005537865.1| leucine--tRNA ligase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM81829.1| leucine--tRNA ligase [Cyanidioschyzon merolae strain 10D]
Length=1048

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            AY F  +E +WQ+FWE ++ FRTPDE+D ++PKYY+LDMFPYPSGAGLHVGHP GYTATD
Sbjct  147  AYDFLAVERRWQEFWEREQIFRTPDEVDWNRPKYYILDMFPYPSGAGLHVGHPEGYTATD  206

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR+KRM+GYNVLHPMGWDAFGLPAEQ+A++TG HP + T RNI RFR QL
Sbjct  207  ILARYKRMRGYNVLHPMGWDAFGLPAEQFALDTGIHPAVATERNITRFRKQL  258



>gb|EMS46157.1| Leucyl-tRNA synthetase [Triticum urartu]
Length=919

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 99/109 (91%), Gaps = 3/109 (3%)
 Frame = +3

Query  303  IEPKWQKFWEEKKTFRTPD---EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILA  473
            IEP+WQ  WEE++TFRTPD    +DTS+PK Y+LDMFPYPSGAGLHVGHPLGYTATDIL+
Sbjct  25   IEPRWQAHWEERRTFRTPDIGDGLDTSRPKCYILDMFPYPSGAGLHVGHPLGYTATDILS  84

Query  474  RFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            RFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ TT RNI+RFR QL
Sbjct  85   RFKRMKGFNVLHPMGWDAFGLPAEQYAIQTGTHPKTTTARNIDRFRTQL  133



>ref|WP_021978830.1| leucyl-tRNA synthetase [Clostridium sp. CAG:793]
 emb|CCY99660.1| leucine--tRNA ligase [Clostridium sp. CAG:793]
Length=798

 Score =   177 bits (449),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 84/111 (76%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y F EIEPKWQK+W+E KTF+T D  D SKPKYY LDMFPYPSG GLHVGHP GYTATDI
Sbjct  2    YNFKEIEPKWQKYWDENKTFKT-DSWDFSKPKYYALDMFPYPSGQGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            + R KRMQGYNVLHPMGWDAFGLPAEQYAI+TG HP   T +NI  F+ QL
Sbjct  61   ICRMKRMQGYNVLHPMGWDAFGLPAEQYAIKTGNHPEGFTKKNIETFKRQL  111



>ref|WP_011403694.1| leucine--tRNA ligase [Salinibacter ruber]
 ref|YP_445066.1| leucyl-tRNA synthetase [Salinibacter ruber DSM 13855]
 sp|Q2S415.1|SYL_SALRD RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Salinibacter ruber DSM 13855]
 gb|ABC46207.1| leucyl-tRNA synthetase [Salinibacter ruber DSM 13855]
Length=863

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            AYPFH+IE KWQ++WEE +TFRTPDE+   + ++YVLDMFPYPSG+GLHVGHP GYTATD
Sbjct  2    AYPFHDIETKWQQYWEEHQTFRTPDEVPDDQEEFYVLDMFPYPSGSGLHVGHPEGYTATD  61

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I+AR+KR QG+NVLHPMGWDAFGLPAEQYA++T THPR TT +NI +F+ QL
Sbjct  62   IVARYKRKQGFNVLHPMGWDAFGLPAEQYALKTNTHPRETTEKNIAQFKRQL  113



>ref|WP_014067706.1| leucyl-tRNA synthetase [Rhodothermus marinus]
 gb|AEN74111.1| leucyl-tRNA synthetase [Rhodothermus marinus SG0.5JP17-172]
Length=906

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 100/116 (86%), Gaps = 4/116 (3%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRT--PDE--IDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
             YPF EIE KWQ++W+E KTFRT  P E   D +KPKYYVLDMFPYPSGAGLHVGHP GY
Sbjct  3    GYPFKEIEKKWQRYWDEHKTFRTAGPKEPGFDPNKPKYYVLDMFPYPSGAGLHVGHPEGY  62

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDI+AR++RM+GYNVLHPMGWDAFGLPAEQYAIET THPRITT RNI RFR QL
Sbjct  63   TATDIMARYRRMKGYNVLHPMGWDAFGLPAEQYAIETNTHPRITTERNIARFRAQL  118



>gb|EMY07084.1| tRNA ligases class I domain protein [Leptospira interrogans str. 
2002000626]
Length=240

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR Q+
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKDNIDNFRRQI  111



>ref|XP_005851157.1| hypothetical protein CHLNCDRAFT_55974 [Chlorella variabilis]
 gb|EFN59055.1| hypothetical protein CHLNCDRAFT_55974 [Chlorella variabilis]
Length=873

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 97/108 (90%), Gaps = 2/108 (2%)
 Frame = +3

Query  303  IEPKWQKFWEEKKTFRTPD--EIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILAR  476
            IE KWQ FWEE +TFRTP+  E+DTSKPK+Y LDMFPYPSGAGLHVGHP GYTATDI+AR
Sbjct  8    IEAKWQAFWEEHQTFRTPEFHELDTSKPKFYALDMFPYPSGAGLHVGHPEGYTATDIMAR  67

Query  477  FKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            +KRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP +TT +NI RFR QL
Sbjct  68   YKRMRGFNVLHPMGWDAFGLPAEQYAIQTGTHPAVTTDKNIARFRQQL  115



>ref|WP_001199935.1| hypothetical protein, partial [Leptospira interrogans]
Length=245

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR Q+
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKDNIDNFRRQI  111



>ref|WP_021270809.1| leucyl-tRNA synthetase [Bacteriovorax sp. BSW11_IV]
 gb|EQC48585.1| leucine--tRNA ligase [Bacteriovorax sp. BSW11_IV]
Length=801

 Score =   175 bits (444),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 83/111 (75%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y F +IE KWQ +W+E KTF+T + +D SKPKYYVLDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YNFQDIEKKWQDYWDENKTFKT-EALDKSKPKYYVLDMFPYPSGAGLHVGHPEGYTATDI  61

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            LAR+KRM G+NVLHPMGWD+FGLPAE YAI+TGTHP ITT +NI  F+ QL
Sbjct  62   LARYKRMTGHNVLHPMGWDSFGLPAENYAIKTGTHPDITTKKNIETFKRQL  112



>ref|WP_025704615.1| leucyl-tRNA synthetase, partial [Paenibacillus graminis]
Length=420

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +3

Query  258  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVG  437
            +N        Y    IEPKWQKFW+E KTF+T +  D  KPK+Y LDMFPYPSGAGLHVG
Sbjct  3    DNNTTSTASGYRAQTIEPKWQKFWDENKTFKTGE--DAGKPKFYALDMFPYPSGAGLHVG  60

Query  438  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQ  617
            HP GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR Q
Sbjct  61   HPEGYTATDIVSRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPREITFKNIDNFRRQ  120

Query  618  L  620
            +
Sbjct  121  I  121



>dbj|BAD52586.1| putative leucyl-tRNA synthetase [Oryza sativa Japonica Group]
Length=910

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +3

Query  213  KTNGISCVKVEDEQKENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPD---EIDTSKPK  383
            +  G  C    +      + Q RRAYP+ EIEP+WQ+ WEE +TFRTPD    +DTSKPK
Sbjct  40   RRGGGWCRCCANADAGKAQAQARRAYPYDEIEPRWQRHWEEHRTFRTPDIGHGLDTSKPK  99

Query  384  YYVLDMFPYPSGAGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQ  548
             Y+LDMFPYPSGAGLHVGHPLGYTATDIL+RFKRMQG+NVLHPMGWDAFGLPAEQ
Sbjct  100  CYILDMFPYPSGAGLHVGHPLGYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQ  154



>ref|WP_027088225.1| leucyl-tRNA synthetase [Cohnella panacarvi]
Length=811

 Score =   175 bits (443),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 82/117 (70%), Positives = 97/117 (83%), Gaps = 2/117 (2%)
 Frame = +3

Query  270  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  449
            Q  ++ Y    IEPKWQK+W+E KTFRT +  D +KPK+Y LDMFPYPSGAGLHVGHP G
Sbjct  3    QDNQQGYRPQTIEPKWQKYWDENKTFRTTE--DAAKPKFYALDMFPYPSGAGLHVGHPEG  60

Query  450  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            YTATDI++RFKRM+G+NVLHPMGWDAFGLPAEQYA++TG HPR  T+ NIN FR Q+
Sbjct  61   YTATDIVSRFKRMKGFNVLHPMGWDAFGLPAEQYALQTGRHPREITVENINNFRRQI  117



>ref|XP_005703014.1| leucyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME26494.1| leucyl-tRNA synthetase [Galdieria sulphuraria]
Length=986

 Score =   176 bits (446),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = +3

Query  243  EDEQKENEEQQV-RRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSG  419
            ED     ++QQ+    Y F  +E KWQ +WE+ KTF+ P  +DTSKPKYYVLDMFPYPSG
Sbjct  85   EDSNVNFDKQQLPLDTYDFTRVESKWQHYWEKNKTFQVPIHVDTSKPKYYVLDMFPYPSG  144

Query  420  AGLHVGHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirni  599
            AGLHVGHP GYTATDI+ARFKRMQGY VLHP+G+DAFGLPAEQYA++TGTHP ITT RN 
Sbjct  145  AGLHVGHPEGYTATDIIARFKRMQGYQVLHPIGFDAFGLPAEQYAMQTGTHPAITTERNK  204

Query  600  nrFRLQL  620
             RFR QL
Sbjct  205  ERFRQQL  211



>ref|WP_041875508.1| leucyl-tRNA synthetase [Verrucomicrobia bacterium SCGC AAA164-O14]
Length=843

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = +3

Query  279  RRAYPFHEIEPKWQKFWEEKKTFRTP----DEIDTSKPKYYVLDMFPYPSGAGLHVGHPL  446
            R+ YPF + EPKWQ  W E KT+ TP    +  D SKPKYY+LDMFPYPSGAGLHVGHP 
Sbjct  5    RKPYPFDQFEPKWQSHWSENKTYGTPSPGEEGFDASKPKYYILDMFPYPSGAGLHVGHPE  64

Query  447  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            GYTATDI+ R+KRM GYNVLHPMGWDAFGLPAEQYAI+TG HP +TT  NIN FR QL
Sbjct  65   GYTATDIVGRYKRMNGYNVLHPMGWDAFGLPAEQYAIKTGQHPSVTTEANINNFRRQL  122



>ref|WP_013061526.1| leucyl-tRNA synthetase [Salinibacter ruber]
 emb|CBH24047.1| leucyl-tRNA synthetase [Salinibacter ruber M8]
Length=863

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            AYPFH+IE KWQ+ WEE +TFRTPDE+   + ++YVLDMFPYPSG+GLHVGHP GYTATD
Sbjct  2    AYPFHDIETKWQQHWEEHQTFRTPDEVPDDQEEFYVLDMFPYPSGSGLHVGHPEGYTATD  61

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I+AR+KR QG+NVLHPMGWDAFGLPAEQYA++T THPR TT +NI +F+ QL
Sbjct  62   IVARYKRKQGFNVLHPMGWDAFGLPAEQYALKTNTHPRETTEKNIAQFKRQL  113



>ref|WP_020060261.1| leucyl-tRNA synthetase [Bacillus sp. 123MFChir2]
Length=802

 Score =   174 bits (441),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE D  KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDETD--KPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEQNINTFRNQI  111



>ref|WP_000009448.1| MULTISPECIES: leucine--tRNA ligase [Bacillus cereus group]
 ref|NP_847185.1| leucine--tRNA ligase [Bacillus anthracis str. Ames]
 ref|YP_030881.1| leucyl-tRNA synthetase [Bacillus anthracis str. Sterne]
 sp|Q81KK6.1|SYL_BACAN RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus anthracis]
 sp|Q632V2.1|SYL_BACCZ RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus E33L]
 sp|A0RJX2.1|SYL_BACAH RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus thuringiensis str. Al Hakam]
 sp|B7JT07.1|SYL_BACC0 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus AH820]
 sp|C3PBK0.1|SYL_BACAA RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus anthracis str. A0248]
 sp|C3LAX2.1|SYL_BACAC RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus anthracis str. CDC 684]
 sp|C1EW09.1|SYL_BACC3 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus 03BB102]
 gb|AAP28671.1| leucine--tRNA ligase [Bacillus anthracis str. Ames]
 gb|AAT34117.1| leucyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor']
 gb|AAT56931.1| leucyl-tRNA synthetase [Bacillus anthracis str. Sterne]
 gb|AAU15783.1| leucine--tRNA ligase (leucyl-tRNA synthetase) [Bacillus cereus 
E33L]
 gb|ABK87515.1| leucyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam]
 gb|EDR20118.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0488]
 gb|EDR89191.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0193]
 gb|EDR93330.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0442]
 gb|EDS98330.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0389]
 gb|EDT21209.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0465]
 gb|EDT68163.1| leucyl-tRNA synthetase [Bacillus anthracis str. A0174]
 gb|EDV14563.1| leucyl-tRNA synthetase [Bacillus anthracis str. Tsiankovskii-I]
 gb|EDX58512.1| leucyl-tRNA synthetase [Bacillus cereus W]
 gb|EDX64049.1| leucyl-tRNA synthetase [Bacillus cereus 03BB108]
 gb|ACK89591.1| leucyl-tRNA synthetase [Bacillus cereus AH820]
 gb|ACO27953.1| leucine--tRNA ligase [Bacillus cereus 03BB102]
 gb|ACP13417.1| leucine--tRNA ligase [Bacillus anthracis str. CDC 684]
 gb|EEK54119.1| Leucyl-tRNA synthetase [Bacillus cereus BGSC 6E1]
 gb|EEL14783.1| Leucyl-tRNA synthetase [Bacillus cereus 95/8201]
 gb|EEM57511.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar monterrey 
BGSC 4AJ1]
 gb|EEM69422.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar andalousiensis 
BGSC 4AW1]
 gb|EEM75473.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar pondicheriensis 
BGSC 4BA1]
 gb|EEM87332.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar pulsiensis 
BGSC 4CC1]
 gb|ACQ46248.1| leucine--tRNA ligase [Bacillus anthracis str. A0248]
 gb|AEW57875.1| Leucyl-tRNA synthetase [Bacillus cereus F837/76]
 gb|AFH86155.1| Leucyl-tRNA synthetase [Bacillus anthracis str. H9401]
 gb|AHE86389.1| leucyl-tRNA synthetase [Bacillus anthracis str. A16R]
 gb|AHE92245.1| leucyl-tRNA synthetase [Bacillus anthracis str. A16]
 dbj|GAF00343.1| leucyl-tRNA synthetase [Bacillus anthracis CZC5]
 gb|EVT89693.1| leucyl-tRNA synthetase [Bacillus anthracis 8903-G]
 gb|EVT96032.1| leucyl-tRNA synthetase [Bacillus anthracis 9080-G]
 gb|EVU02324.1| leucyl-tRNA synthetase [Bacillus anthracis 52-G]
 gb|AHK40918.1| leucyl-tRNA synthetase [Bacillus anthracis str. SVA11]
 gb|EXJ18395.1| leucyl-tRNA synthetase [Bacillus anthracis str. 95014]
 gb|AIF58895.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KEY93311.1| leucyl-tRNA synthetase [Bacillus anthracis str. Carbosap]
 gb|KFJ80317.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AIK35078.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AIK59215.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AIK66133.1| leucine--tRNA ligase [Bacillus anthracis str. Vollum]
 gb|AIK53583.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|KFL65730.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|KFL68892.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AIM08659.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ41936.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ49179.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ55199.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ61091.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ64512.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ65724.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ76789.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ80349.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ90846.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KGZ96850.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA02086.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA11740.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA13096.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA17516.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA26417.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA31367.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA31941.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHA38852.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHG47252.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHG47573.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|KHG58428.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|AJA88935.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|AJF92307.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|AJG31425.1| leucyl-tRNA synthetase [Bacillus anthracis]
 gb|AJG48967.1| leucine--tRNA ligase [Bacillus anthracis str. Turkey32]
 gb|AJG52039.1| leucine--tRNA ligase [Bacillus cereus 03BB102]
 gb|AJG61622.1| leucine--tRNA ligase [Bacillus cereus D17]
 gb|AJG63119.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJG70363.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJG75313.1| leucine--tRNA ligase [Bacillus thuringiensis]
 gb|AJG83326.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJG85841.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH28670.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH36945.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH39394.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH44967.1| leucine--tRNA ligase [Bacillus anthracis str. Sterne]
 gb|AJH53872.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH57776.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJH63463.1| leucine--tRNA ligase [Bacillus cereus]
 gb|AJH97443.1| leucine--tRNA ligase [Bacillus anthracis str. V770-NP-1R]
 gb|AJH70568.1| leucine--tRNA ligase [Bacillus thuringiensis]
 gb|AJI12472.1| leucine--tRNA ligase [Bacillus cereus 03BB108]
 gb|AJH82758.1| leucine--tRNA ligase [Bacillus thuringiensis]
 gb|AJH90542.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJI28543.1| leucine--tRNA ligase [Bacillus cereus E33L]
 gb|AJH96755.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJI38951.1| leucine--tRNA ligase [Bacillus anthracis]
 gb|AJK34779.1| leucine--tRNA ligase [Bacillus cereus]
 gb|AJM83232.1| leucyl-tRNA synthetase [Bacillus anthracis]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009450.1| leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_001991042.1| leucine--tRNA ligase [Bacillus cereus]
 gb|EDX66939.1| leucine--tRNA ligase [Bacillus cereus NVH0597-99]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_038170035.1| leucyl-tRNA synthetase, partial [Verrucomicrobium sp. BvORR106]
Length=322

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = +3

Query  279  RRAYPFHEIEPKWQKFWEEKKTFRT----PDEIDTSKPKYYVLDMFPYPSGAGLHVGHPL  446
            R+ YPF E EP+WQ  W+  K+FRT     +  D SKPKY+VLDMFPYPSG GLHVGHP 
Sbjct  6    RKQYPFDEFEPQWQSHWDANKSFRTLGPGDEGFDASKPKYFVLDMFPYPSGQGLHVGHPE  65

Query  447  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            GYTATDI+AR+KRM G+NVLHPMGWDAFGLPAEQYAI+TG HPR TT +N+  FR QL
Sbjct  66   GYTATDIVARYKRMTGHNVLHPMGWDAFGLPAEQYAIKTGQHPRTTTEKNVENFRNQL  123



>ref|WP_012095876.1| leucine--tRNA ligase [Bacillus cytotoxicus]
 sp|A7GU19.1|SYL_BACCN RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cytotoxicus NVH 391-98]
 gb|ABS23627.1| leucyl-tRNA synthetase [Bacillus cytotoxicus NVH 391-98]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE D  KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDETD--KPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_000009451.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR09795.1| leucyl-tRNA synthetase [Bacillus cereus MSX-A12]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009476.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ98283.1| leucyl-tRNA synthetase [Bacillus cereus ISP3191]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TKKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_002173861.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR49997.1| leucyl-tRNA synthetase [Bacillus cereus VD107]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFSHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_000009455.1| leucine--tRNA ligase [Bacillus thuringiensis]
 ref|YP_038784.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar konkukian 
str. 97-27]
 sp|Q6HCE2.1|SYL_BACHK RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus thuringiensis serovar konkukian 
str. 97-27]
 gb|AAT63896.1| leucine--tRNA ligase (leucyl-tRNA synthetase) [Bacillus thuringiensis 
serovar konkukian str. 97-27]
 gb|AJI36623.1| leucine--tRNA ligase [Bacillus thuringiensis]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009452.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEK81861.1| Leucyl-tRNA synthetase [Bacillus cereus ATCC 4342]
 gb|KFM86849.1| leucine--tRNA ligase [Bacillus cereus ATCC 4342]
 gb|AJH75982.1| leucine--tRNA ligase [Bacillus cereus ATCC 4342]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_029440187.1| leucine--tRNA ligase [Bacillus thuringiensis]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009454.1| leucine--tRNA ligase [Bacillus cereus]
 gb|AFQ10198.1| leucyl-tRNA ligase [Bacillus cereus FRI-35]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009463.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR42425.1| leucyl-tRNA synthetase [Bacillus cereus VD045]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009465.1| leucyl-tRNA synthetase [Bacillus sp. 7_6_55CFAA_CT2]
 gb|EHL77718.1| leucyl-tRNA synthetase [Bacillus sp. 7_6_55CFAA_CT2]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_027091186.1| leucyl-tRNA synthetase [Cohnella thermotolerans]
Length=810

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/117 (71%), Positives = 93/117 (79%), Gaps = 2/117 (2%)
 Frame = +3

Query  270  QQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  449
            Q     Y    +EPKWQK+WEE KTFRT D  D  KPK+Y LDMFPYPSGAGLHVGHP G
Sbjct  3    QDNEHGYKPQTLEPKWQKYWEENKTFRTRD--DEGKPKFYALDMFPYPSGAGLHVGHPEG  60

Query  450  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            YTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYAI+TG HPR  T  NI+ FR Q+
Sbjct  61   YTATDIVSRYKRMRGYNVLHPMGWDAFGLPAEQYAIQTGKHPRDFTQLNIDNFRRQI  117



>ref|WP_026593769.1| leucyl-tRNA synthetase [Bacillus sp. UNC437CL72CviS29]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQSYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>gb|KGZ89134.1| leucyl-tRNA synthetase [Bacillus anthracis]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009449.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|ADK07321.1| leucyl-tRNA synthetase [Bacillus cereus biovar anthracis str. 
CI]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009445.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL48836.1| Leucyl-tRNA synthetase [Bacillus cereus Rock3-44]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_017153787.1| leucyl-tRNA synthetase [Bacillus sp. FJAT-13831]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_000009470.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ83896.1| leucyl-tRNA synthetase [Bacillus cereus HuB5-5]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_000009469.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEL20690.1| Leucyl-tRNA synthetase [Bacillus cereus Rock1-3]
 gb|EEL32263.1| Leucyl-tRNA synthetase [Bacillus cereus Rock3-28]
 gb|EEL38146.1| Leucyl-tRNA synthetase [Bacillus cereus Rock3-29]
 gb|EJQ35918.1| leucyl-tRNA synthetase [Bacillus cereus BAG5O-1]
 gb|EJQ76866.1| leucyl-tRNA synthetase [Bacillus cereus HuB4-10]
 gb|EJR68415.1| leucyl-tRNA synthetase [Bacillus cereus VD148]
 gb|EJS56958.1| leucyl-tRNA synthetase [Bacillus cereus BAG1O-2]
 gb|EJV51940.1| leucyl-tRNA synthetase [Bacillus cereus BAG4X2-1]
 gb|EJV54031.1| leucyl-tRNA synthetase [Bacillus cereus BAG6O-1]
 gb|EJV96346.1| leucyl-tRNA synthetase [Bacillus cereus HuB2-9]
 gb|EOP20424.1| leucyl-tRNA synthetase [Bacillus cereus VD131]
 gb|EOP21689.1| leucyl-tRNA synthetase [Bacillus cereus HuA2-3]
 gb|EOP36884.1| leucyl-tRNA synthetase [Bacillus cereus VD214]
 gb|EPF03637.1| leucyl-tRNA synthetase [Bacillus cereus BAG2O-2]
 gb|AHA07982.1| Leucyl-tRNA synthetase [Bacillus toyonensis BCT-7112]
Length=802

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>gb|EMF80247.1| putative leucine--tRNA ligase [Leptospira weilii serovar Topaz 
str. LT2116]
Length=360

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEENKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR Q+
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKNNIDNFRRQI  111



>ref|WP_044790847.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
Length=802

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009472.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL59104.1| Leucyl-tRNA synthetase [Bacillus cereus Rock4-18]
Length=802

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_000009457.1| leucine--tRNA ligase [Bacillus cereus]
 sp|Q72YY8.1|SYL_BACC1 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus ATCC 10987]
 sp|B7HSS7.1|SYL_BACC7 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus AH187]
 sp|B9J1E1.1|SYL_BACCQ RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus Q1]
 gb|AAS43783.1| leucyl-tRNA synthetase [Bacillus cereus ATCC 10987]
 gb|EDZ55842.1| leucyl-tRNA synthetase [Bacillus cereus H3081.97]
 gb|ACJ79239.1| leucyl-tRNA synthetase [Bacillus cereus AH187]
 gb|ACM14979.1| leucyl-tRNA synthetase [Bacillus cereus Q1]
 gb|EEK42734.1| Leucyl-tRNA synthetase [Bacillus cereus m1293]
 gb|EEK98256.1| Leucyl-tRNA synthetase [Bacillus cereus BDRD-ST26]
 dbj|BAL20440.1| leucyl-tRNA synthetase [Bacillus cereus NC7401]
 gb|EJP92589.1| leucyl-tRNA synthetase [Bacillus cereus IS075]
 gb|EJQ04837.1| leucyl-tRNA synthetase [Bacillus cereus AND1407]
 gb|EJR21407.1| leucyl-tRNA synthetase [Bacillus cereus MSX-D12]
 gb|EJR53892.1| leucyl-tRNA synthetase [Bacillus cereus VD102]
 gb|EOO93147.1| leucyl-tRNA synthetase [Bacillus cereus IS845/00]
 gb|EOO98748.1| leucyl-tRNA synthetase [Bacillus cereus IS195]
 gb|KFK73327.1| leucine--tRNA ligase [Bacillus cereus]
 gb|KFL84219.1| leucine--tRNA ligase [Bacillus cereus]
Length=802

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_018970100.1| leucyl-tRNA synthetase [Rubritalea marina]
Length=872

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 4/117 (3%)
 Frame = +3

Query  282  RAYPFHEIEPKWQKFWEEKKTFRTPD----EIDTSKPKYYVLDMFPYPSGAGLHVGHPLG  449
            + +PF   EPKWQ+ W++ KTFRT +    + D SKPKY+VLDMFPYPSGAGLHVGHP G
Sbjct  2    KPFPFDAFEPKWQQIWDDNKTFRTANPGDADFDASKPKYFVLDMFPYPSGAGLHVGHPEG  61

Query  450  YTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            YTATDIL R+KRM G+NVLHPMGWDAFGLPAEQYAI+TG HPRITT +N+N FR QL
Sbjct  62   YTATDILGRYKRMNGFNVLHPMGWDAFGLPAEQYAIKTGQHPRITTEQNVNNFRKQL  118



>ref|WP_000009471.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR68660.1| leucyl-tRNA synthetase [Bacillus cereus VD115]
Length=802

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>gb|AIM14154.1| leucyl-tRNA synthetase [Bacillus anthracis]
Length=512

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009458.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEM51249.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki 
str. T03a001]
 gb|EJQ17711.1| leucyl-tRNA synthetase [Bacillus cereus BAG3X2-2]
 gb|EJV92134.1| leucyl-tRNA synthetase [Bacillus cereus HD73]
 gb|AGE80626.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki 
str. HD73]
 gb|EOP17511.1| leucyl-tRNA synthetase [Bacillus cereus HuB13-1]
 gb|EOP57236.1| leucyl-tRNA synthetase [Bacillus cereus ISP2954]
 gb|EOP99438.1| leucyl-tRNA synthetase [Bacillus cereus BMG1.7]
 gb|ETE92899.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar aizawai 
str. Leapi01]
 gb|ETE96706.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar aizawai 
str. Hu4-2]
 gb|EXY09651.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 gb|AHZ53583.1| leucyl-tRNA ligase [Bacillus thuringiensis serovar kurstaki str. 
YBT-1520]
 gb|KEH50727.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki 
str. HD-1]
 gb|AIE36011.1| leucyl-tRNA ligase [Bacillus thuringiensis serovar kurstaki str. 
HD-1]
 gb|AIM29596.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki 
str. YBT-1520]
 gb|AJA21928.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar galleriae]
 gb|AJK39544.1| leucine--tRNA ligase [Bacillus thuringiensis serovar kurstaki]
 gb|KKB32171.1| Leucine--tRNA ligase [Bacillus thuringiensis serovar mexicanensis]
Length=802

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_042875829.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|AIE81296.1| Leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_025148915.1| leucyl-tRNA synthetase [Bacillus sp. H1a]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_001971230.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EAL16276.1| leucyl-tRNA synthetase [Bacillus cereus G9241]
 gb|KDB42703.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|AIY73897.1| leucine--tRNA ligase [Bacillus cereus]
 gb|AJG92908.1| leucine--tRNA ligase [Bacillus cereus]
 gb|AJI06211.1| leucine--tRNA ligase [Bacillus cereus G9241]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009461.1| MULTISPECIES: leucine--tRNA ligase [Bacillus]
 ref|NP_834441.1| leucyl-tRNA synthetase [Bacillus cereus ATCC 14579]
 sp|Q816T0.1|SYL_BACCR RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus ATCC 14579]
 gb|AAP11642.1| Leucyl-tRNA synthetase [Bacillus cereus ATCC 14579]
 gb|EEK92621.1| Leucyl-tRNA synthetase [Bacillus cereus BDRD-ST24]
 gb|EEL09336.1| Leucyl-tRNA synthetase [Bacillus cereus BDRD-Cer4]
 gb|EEL26491.1| Leucyl-tRNA synthetase [Bacillus cereus Rock1-15]
 gb|EEL74282.1| Leucyl-tRNA synthetase [Bacillus cereus AH676]
 gb|ADH09186.1| leucyl-tRNA synthetase [Bacillus thuringiensis BMB171]
 gb|EJR87221.1| leucyl-tRNA synthetase [Bacillus cereus VD169]
 gb|EJR94595.1| leucyl-tRNA synthetase [Bacillus cereus VD200]
 emb|CCW07383.1| Leucyl-tRNA synthetase [Bacillus sp. GeD10]
 gb|EOO63201.1| leucyl-tRNA synthetase [Bacillus cereus VD196]
 gb|ETT85474.1| leucyl-tRNA ligase [Bacillus weihenstephanensis FSL R5-860]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009459.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR87500.1| leucyl-tRNA synthetase [Bacillus cereus VD166]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009467.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEM81494.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar huazhongensis 
BGSC 4BD1]
 gb|EJR17011.1| leucyl-tRNA synthetase [Bacillus cereus VD014]
 gb|EJR87069.1| leucyl-tRNA synthetase [Bacillus cereus VD156]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009453.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEM45626.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar pakistani 
str. T13001]
 gb|EJR69723.1| leucyl-tRNA synthetase [Bacillus cereus VD154]
 gb|KIU76685.1| leucyl-tRNA ligase [Bacillus thuringiensis Sbt003]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009460.1| leucine--tRNA ligase [Bacillus thuringiensis]
 gb|EEM26536.1| Leucyl-tRNA synthetase [Bacillus thuringiensis Bt407]
 gb|EEM32870.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar thuringiensis 
str. T01001]
 gb|EEM63832.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar berliner 
ATCC 10792]
 gb|AEA18419.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar chinensis 
CT-43]
 gb|AFV20572.1| leucine--tRNA ligase LeuS [Bacillus thuringiensis Bt407]
 gb|AGG03548.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar thuringiensis 
str. IS5056]
 gb|ERI02957.1| Leucine--tRNA ligase [Bacillus thuringiensis T01-328]
 gb|AHA74363.1| leucyl-tRNA ligase [Bacillus thuringiensis YBT-1518]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009456.1| leucine--tRNA ligase [Bacillus thuringiensis]
 gb|EEM20202.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar tochigiensis 
BGSC 4Y1]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009464.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEK48336.1| Leucyl-tRNA synthetase [Bacillus cereus ATCC 10876]
 gb|KFL77693.1| leucine--tRNA ligase [Bacillus cereus ATCC 10876]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009462.1| MULTISPECIES: leucine--tRNA ligase [Bacillus]
 sp|B7H798.1|SYL_BACC4 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus B4264]
 gb|ACK59437.1| leucine--tRNA ligase [Bacillus cereus B4264]
 gb|EEK87198.1| Leucyl-tRNA synthetase [Bacillus cereus m1550]
 gb|EOQ05509.1| leucyl-tRNA synthetase [Bacillus cereus VD184]
 gb|KIZ29283.1| leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009466.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus]
 gb|EDZ52483.1| leucyl-tRNA synthetase [Bacillus cereus AH1134]
 gb|EEK59874.1| Leucyl-tRNA synthetase [Bacillus cereus 172560W]
 gb|EEL53793.1| Leucyl-tRNA synthetase [Bacillus cereus Rock4-2]
 gb|EEL62822.1| Leucyl-tRNA synthetase [Bacillus cereus F65185]
 gb|EJQ15199.1| leucyl-tRNA synthetase [Bacillus cereus BAG3O-2]
 gb|EJQ22068.1| leucyl-tRNA synthetase [Bacillus cereus BAG4O-1]
 gb|EJQ26395.1| leucyl-tRNA synthetase [Bacillus cereus BAG4X12-1]
 gb|EOO33442.1| leucyl-tRNA synthetase [Bacillus cereus VD133]
 gb|EOP86985.1| leucyl-tRNA synthetase [Bacillus cereus BAG5X12-1]
 gb|EOP91573.1| leucyl-tRNA synthetase [Bacillus cereus VD140]
 emb|CDN38300.1| unnamed protein product [Bacillus thuringiensis DB27]
 gb|AHX20735.1| leucyl-tRNA synthetase [Bacillus bombysepticus str. Wang]
 gb|KGT42253.1| leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_042980446.1| leucyl-tRNA synthetase [Bacillus mycoides]
 gb|KFM98685.1| leucine--tRNA ligase [Bacillus mycoides]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_000009468.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 gb|ADY23895.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar finitimus 
YBT-020]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_018782090.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus]
 gb|AIK40237.1| leucine--tRNA ligase [Bacillus mycoides]
 gb|AJI15204.1| leucine--tRNA ligase [Bacillus cereus]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_000009473.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 gb|AFU15441.1| Leucyl-tRNA synthetase [Bacillus thuringiensis MC28]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002123189.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ46041.1| leucyl-tRNA synthetase [Bacillus cereus BAG6X1-2]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_018764566.1| leucyl-tRNA synthetase [Bacillus sp. 105MF]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_006096266.1| leucyl-tRNA synthetase [Bacillus pseudomycoides]
 gb|EEM14852.1| Leucyl-tRNA synthetase [Bacillus pseudomycoides DSM 12442]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_016135497.1| leucine--tRNA ligase [Bacillus cereus]
 gb|EOQ24186.1| leucyl-tRNA synthetase [Bacillus cereus BAG3O-1]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   E+E KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEVEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_001199936.1| hypothetical protein, partial [Leptospira interrogans]
Length=305

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR Q+
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKDNIDNFRRQI  111



>ref|WP_000009475.1| leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_000009474.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJS73646.1| leucyl-tRNA synthetase [Bacillus cereus BAG2X1-1]
Length=802

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_039876233.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL R7-0273]
 gb|AIQ48846.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL R7-0273]
Length=816

 Score =   173 bits (438),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 99/122 (81%), Gaps = 3/122 (2%)
 Frame = +3

Query  258  ENEEQQVRRA-YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHV  434
            EN+   V  A Y    IEPKWQKFW+E KTF+T ++ D  KPK+Y LDMFPYPSGAGLHV
Sbjct  3    ENQTSTVAGAGYRAQTIEPKWQKFWDENKTFKTGEDAD--KPKFYALDMFPYPSGAGLHV  60

Query  435  GHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRL  614
            GHP GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR 
Sbjct  61   GHPEGYTATDIISRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFRR  120

Query  615  QL  620
            Q+
Sbjct  121  QI  122



>gb|EJS78246.1| leucyl-tRNA synthetase [Bacillus cereus BAG2X1-3]
Length=810

 Score =   173 bits (438),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  10   SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  67

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  68   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  119



>ref|WP_041052219.1| leucyl-tRNA synthetase [Paenibacillus sp. VKM B-2647]
 gb|KIL37926.1| leucyl-tRNA synthetase [Paenibacillus sp. VKM B-2647]
Length=818

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 100/121 (83%), Gaps = 2/121 (2%)
 Frame = +3

Query  258  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVG  437
            +N+E +  + Y    +EPKWQ++W+E KTF+TPD  D+ KPK+Y LDMFPYPSGAGLHVG
Sbjct  3    DNKETRDSQGYNPQALEPKWQRYWDEHKTFKTPD--DSDKPKFYALDMFPYPSGAGLHVG  60

Query  438  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQ  617
            HP GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T  NI+ FR Q
Sbjct  61   HPEGYTATDIVSRYKRMRGYNVLHPMGWDAFGLPAEQYALQTGRHPRDITKENIDNFRRQ  120

Query  618  L  620
            +
Sbjct  121  I  121



>ref|WP_035436072.1| leucyl-tRNA synthetase [Bacillus sp. UNC322MFChir4.1]
Length=802

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE D  KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQKIEKKWQAYWEENKTFRTPDETD--KPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_022396714.1| leucyl-tRNA synthetase [Akkermansia sp. CAG:344]
 emb|CDD97137.1| leucine--tRNA ligase [Akkermansia sp. CAG:344]
Length=857

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = +3

Query  279  RRAYPFHEIEPKWQKFWEEKKTFRT--PDE--IDTSKPKYYVLDMFPYPSGAGLHVGHPL  446
            ++ YPF   EPKWQ+ W+E+KTF+   P E   D SKPKYYVLDMFPYPSGAGLHVGHP 
Sbjct  5    KKPYPFDVFEPKWQQIWDERKTFKVSNPGEEGFDASKPKYYVLDMFPYPSGAGLHVGHPE  64

Query  447  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            GYTATDI+ARFKRM G+NVLHPMGWD+FGLPAEQYAI+TG HP +TT +NI+ FR QL
Sbjct  65   GYTATDIVARFKRMNGFNVLHPMGWDSFGLPAEQYAIKTGQHPSVTTFQNIDNFRRQL  122



>ref|WP_022488782.1| leucyl-tRNA synthetase [Clostridium sp. CAG:914]
 emb|CDE95292.1| leucine--tRNA ligase [Clostridium sp. CAG:914]
Length=796

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 81/111 (73%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y + +IE KWQK+WEE KTF+T D  D S+PKYYVLDMFPYPSG GLH GHP GYTATDI
Sbjct  2    YNYTKIEKKWQKYWEENKTFKT-DIYDFSRPKYYVLDMFPYPSGVGLHAGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            +AR KRMQGYNVLHPMG+D+FGLPAEQYAI+TG HP+  T +NI  FR QL
Sbjct  61   MARMKRMQGYNVLHPMGYDSFGLPAEQYAIQTGNHPKEFTEKNIAHFREQL  111



>ref|WP_016085871.1| leucine--tRNA ligase [Bacillus cereus]
 gb|EOP14509.1| leucyl-tRNA synthetase [Bacillus cereus BAG2O-3]
 gb|EOQ07985.1| leucyl-tRNA synthetase [Bacillus cereus B5-2]
Length=802

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   E+E KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEVEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_021996080.1| leucyl-tRNA synthetase [Clostridium sp. CAG:780]
 emb|CCZ17272.1| leucine--tRNA ligase [Clostridium sp. CAG:780]
Length=795

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            +Y F EIE KWQ +W+E KTF T D  D SKPKYY LDMFPYPSG GLHVGHP GYTATD
Sbjct  2    SYNFREIEQKWQDYWDENKTFYT-DVWDFSKPKYYALDMFPYPSGQGLHVGHPEGYTATD  60

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I++R +RMQGYNVLHPMGWDAFGLPAEQYAI+TG HP   T +NI  F+ QL
Sbjct  61   IVSRMRRMQGYNVLHPMGWDAFGLPAEQYAIKTGNHPATFTQKNIETFKKQL  112



>ref|WP_000009477.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ56700.1| leucyl-tRNA synthetase [Bacillus cereus BAG5X2-1]
Length=802

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   E+E KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEVEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_016116728.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOP49380.1| leucyl-tRNA synthetase [Bacillus cereus VD136]
 gb|EOP64492.1| leucyl-tRNA synthetase [Bacillus cereus VDM006]
 gb|EOQ01727.1| leucyl-tRNA synthetase [Bacillus cereus VDM021]
Length=802

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_022198807.1| leucyl-tRNA synthetase [Akkermansia muciniphila CAG:154]
 emb|CDB55961.1| leucine--tRNA ligase [Akkermansia muciniphila CAG:154]
Length=857

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = +3

Query  279  RRAYPFHEIEPKWQKFWEEKKTFRT--PDE--IDTSKPKYYVLDMFPYPSGAGLHVGHPL  446
            ++ YPF   EPKWQ+ W+E+KTF+   P E   D SKPKYYVLDMFPYPSGAGLHVGHP 
Sbjct  5    KKPYPFDVFEPKWQQIWDERKTFKVNNPGEEGFDASKPKYYVLDMFPYPSGAGLHVGHPE  64

Query  447  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            GYTATDI+ARFKRM G+NVLHPMGWD+FGLPAEQYAI+TG HP +TT RNI+ FR QL
Sbjct  65   GYTATDIVARFKRMNGFNVLHPMGWDSFGLPAEQYAIKTGQHPSVTTFRNIDNFRRQL  122



>ref|WP_022835958.1| leucyl-tRNA synthetase [Salisaeta longa]
Length=871

 Score =   173 bits (439),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            +YPF  IEPKWQ++W+E +TFRTPD+I     K YVLDMFPYPSG+GLHVGHP GYTATD
Sbjct  2    SYPFETIEPKWQRYWDEHQTFRTPDDIPEDAEKCYVLDMFPYPSGSGLHVGHPEGYTATD  61

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I AR+KRMQG +VLHPMGWDAFGLPAEQYA++T THPR+TT RNI  F+ QL
Sbjct  62   IFARYKRMQGVHVLHPMGWDAFGLPAEQYALKTNTHPRVTTERNIATFKKQL  113



>ref|WP_000009439.1| leucine--tRNA ligase [Bacillus cereus]
 gb|EEL43337.1| Leucyl-tRNA synthetase [Bacillus cereus Rock3-42]
Length=802

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_020401766.1| leucyl-tRNA synthetase [Gracilimonas tropica]
Length=843

 Score =   173 bits (438),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +3

Query  282  RAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTAT  461
            ++Y   +IE KWQ++W E KTF+TP   DTSKPKYYVLDMFPYPSGAGLHVGHP GYTAT
Sbjct  2    QSYNPDKIESKWQQYWLENKTFKTP--TDTSKPKYYVLDMFPYPSGAGLHVGHPEGYTAT  59

Query  462  DILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            DI+AR+KRM G+NVLHP+GWDAFGLPAEQYA++TGTHPRITT +N+N+FR QL
Sbjct  60   DIIARYKRMNGFNVLHPIGWDAFGLPAEQYAVKTGTHPRITTEKNVNKFREQL  112



>ref|WP_012420688.1| leucyl-tRNA synthetase [Akkermansia muciniphila]
 gb|ACD05473.1| leucyl-tRNA synthetase [Akkermansia muciniphila ATCC BAA-835]
Length=857

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = +3

Query  279  RRAYPFHEIEPKWQKFWEEKKTFRT--PDE--IDTSKPKYYVLDMFPYPSGAGLHVGHPL  446
            ++ YPF   EPKWQ+ W+E+KTF+   P E   D SKPKYYVLDMFPYPSGAGLHVGHP 
Sbjct  5    KKPYPFDVFEPKWQQIWDERKTFKVNNPGEEGFDASKPKYYVLDMFPYPSGAGLHVGHPE  64

Query  447  GYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            GYTATDI+ARFKRM G+NVLHPMGWD+FGLPAEQYAI+TG HP +TT RNI+ FR QL
Sbjct  65   GYTATDIVARFKRMNGFNVLHPMGWDSFGLPAEQYAIKTGQHPSVTTFRNIDNFRRQL  122



>ref|WP_031213207.1| leucyl-tRNA synthetase, partial [Geobacillus sp. MAS1]
Length=475

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = +3

Query  300  EIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILARF  479
            EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATDILAR 
Sbjct  7    EIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATDILARM  64

Query  480  KRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  65   KRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_016080001.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOO30967.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X1-1]
 gb|EOO45845.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X2-1]
 gb|EOO55371.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X2-2]
 gb|EOO57475.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X2-3]
 gb|EOP02795.1| leucyl-tRNA synthetase [Bacillus cereus BAG2O-1]
Length=802

 Score =   172 bits (436),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEININTFRNQI  111



>ref|WP_000009441.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EAO52566.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar israelensis 
ATCC 35646]
 gb|EEM39401.1| Leucyl-tRNA synthetase [Bacillus thuringiensis serovar sotto 
str. T04001]
 gb|EEN00889.1| Leucyl-tRNA synthetase [Bacillus thuringiensis IBL 4222]
 gb|EJP94884.1| leucyl-tRNA synthetase [Bacillus cereus VD022]
 gb|EJR10124.1| leucyl-tRNA synthetase [Bacillus cereus MSX-A1]
 gb|AFQ18437.1| leucyl-tRNA ligase [Bacillus thuringiensis HD-771]
 gb|AFQ28617.1| leucyl-tRNA ligase [Bacillus thuringiensis HD-789]
 gb|EOO10966.1| leucyl-tRNA synthetase [Bacillus cereus str. Schrouff]
 gb|EOO90379.1| leucyl-tRNA synthetase [Bacillus cereus K-5975c]
 gb|EOQ60094.1| leucyl-tRNA synthetase [Bacillus cereus TIAC219]
 gb|EXL35499.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar israelensis]
 gb|KIP24036.1| leucine--tRNA ligase [Bacillus thuringiensis serovar morrisoni]
 gb|AJH05621.1| leucine--tRNA ligase [Bacillus thuringiensis HD1002]
 gb|AJQ61470.1| leucyl-tRNA synthetase [Bacillus thuringiensis serovar morrisoni]
Length=802

 Score =   172 bits (436),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_016099046.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOP82313.1| leucyl-tRNA synthetase [Bacillus cereus HuB4-4]
Length=802

 Score =   172 bits (436),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_029443454.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
Length=802

 Score =   172 bits (436),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEININTFRNQI  111



>ref|WP_000009442.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus]
 gb|EJS51461.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X1-2]
 gb|EJV84892.1| leucyl-tRNA synthetase [Bacillus cereus HuB1-1]
 gb|EPF15520.1| leucyl-tRNA synthetase [Bacillus cereus BAG1O-3]
Length=802

 Score =   172 bits (436),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_002770420.1| leucyl-tRNA synthetase [Leptonema illini]
 gb|EHQ05616.1| leucyl-tRNA synthetase [Leptonema illini DSM 21528]
Length=888

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            +YPF  IE KWQ++WE++KTFRTP E D S+PKYYVLDMFPYPSG GLHVGHP GYTATD
Sbjct  2    SYPFSSIEKKWQEYWEKEKTFRTPPE-DPSRPKYYVLDMFPYPSGQGLHVGHPEGYTATD  60

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I+AR+KR +G+NVLHPMGWDAFGLPAE+YA++TG HP  TT +NI+ FR QL
Sbjct  61   IMARYKRQKGFNVLHPMGWDAFGLPAERYAMQTGIHPAETTKKNIDNFRRQL  112



>ref|WP_000009444.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL79905.1| Leucyl-tRNA synthetase [Bacillus cereus AH1271]
Length=802

 Score =   172 bits (436),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_043935252.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus]
 gb|KIQ91613.1| leucyl-tRNA synthetase [Bacillus sp. L_1B0_5]
 gb|KIQ92963.1| leucyl-tRNA synthetase [Bacillus sp. L_1B0_8]
Length=802

 Score =   172 bits (436),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEININTFRNQI  111



>gb|ABO68087.1| Leucyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2]
Length=811

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPDE D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  8    SFNHREIEKKWQDYWEQHKTFRTPDESD--KPKFYVLDMFPYPSGAGLHVGHPEGYTATD  65

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  66   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  117



>ref|WP_026690741.1| leucyl-tRNA synthetase [Bacillus aurantiacus]
Length=806

 Score =   172 bits (436),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 81/112 (72%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            A+   +IEPKWQK+W+++KTF+T DEI   K K+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    AFNHKDIEPKWQKYWDQEKTFKTEDEI--GKEKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG HPR  T+ NI+ FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNHPRDFTLANIDTFRRQI  111



>ref|WP_008880943.1| MULTISPECIES: leucine--tRNA ligase [Geobacillus]
 sp|A4IRY3.2|SYL_GEOTN RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Geobacillus thermodenitrificans NG80-2]
 gb|EDY05284.1| leucyl-tRNA synthetase [Geobacillus sp. G11MC16]
Length=805

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPDE D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEKKWQDYWEQHKTFRTPDESD--KPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_000009440.1| leucyl-tRNA synthetase [Bacillus thuringiensis]
 gb|EEM93847.1| Leucyl-tRNA synthetase [Bacillus thuringiensis IBL 200]
Length=802

 Score =   172 bits (435),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_000009443.1| leucine--tRNA ligase [Bacillus cereus]
 gb|EEK76584.1| Leucyl-tRNA synthetase [Bacillus cereus R309803]
Length=802

 Score =   172 bits (435),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_042183121.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL R7-0331]
 gb|AIQ54300.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL R7-0331]
Length=816

 Score =   172 bits (435),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 98/122 (80%), Gaps = 3/122 (2%)
 Frame = +3

Query  258  ENEEQQVRRA-YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHV  434
            EN+   V  A Y    IEPKWQKFW+E KTF+T  + D  KPK+Y LDMFPYPSGAGLHV
Sbjct  3    ENQTTTVAGAGYRAQTIEPKWQKFWDENKTFKTGKDAD--KPKFYALDMFPYPSGAGLHV  60

Query  435  GHPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRL  614
            GHP GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR 
Sbjct  61   GHPEGYTATDIISRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFRR  120

Query  615  QL  620
            Q+
Sbjct  121  QI  122



>ref|WP_033020166.1| leucyl-tRNA synthetase [Geobacillus sp. G1w1]
 gb|KFX33470.1| leucyl-tRNA synthetase [Geobacillus sp. G1w1]
Length=805

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPDE D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEKKWQDYWEKNKTFRTPDEDD--KPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTRKNIDNFRRQI  111



>gb|EMG12808.1| tRNA ligases class I domain protein [Leptospira interrogans serovar 
Grippotyphosa str. LT2186]
Length=408

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR Q+
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKDNIDNFRRQI  111



>ref|WP_033844368.1| leucyl-tRNA synthetase [Geobacillus subterraneus]
Length=805

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPDE D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEKKWQDYWEKNKTFRTPDEDD--KPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_000009481.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJV58548.1| leucyl-tRNA synthetase [Bacillus cereus BAG6X1-1]
Length=802

 Score =   172 bits (435),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++    IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQNIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>gb|EJQ50297.1| leucyl-tRNA synthetase [Bacillus cereus BAG5X1-1]
 gb|EJQ99708.1| leucyl-tRNA synthetase [Bacillus cereus MC67]
 gb|EOP04772.1| leucyl-tRNA synthetase [Bacillus cereus MC118]
Length=810

 Score =   172 bits (435),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  10   SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  67

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  68   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  119



>ref|WP_033710716.1| leucyl-tRNA synthetase [Bacillus cereus]
Length=802

 Score =   171 bits (434),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_012843181.1| leucyl-tRNA synthetase [Rhodothermus marinus]
 gb|ACY47569.1| leucyl-tRNA synthetase [Rhodothermus marinus DSM 4252]
Length=906

 Score =   172 bits (437),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 4/116 (3%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRT--PDE--IDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
             YPF E E KWQ++W+E K FRT  P E   D +KPKYYVLDMFPYPSGAGLHVGHP GY
Sbjct  3    GYPFKETEKKWQRYWDEHKIFRTAGPKEPGFDPNKPKYYVLDMFPYPSGAGLHVGHPEGY  62

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDI+AR++RM+GYNVLHPMGWDAFGLPAEQYAIET THPRITT RNI RFR QL
Sbjct  63   TATDIMARYRRMKGYNVLHPMGWDAFGLPAEQYAIETNTHPRITTERNITRFRSQL  118



>ref|WP_000009479.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEK65298.1| Leucyl-tRNA synthetase [Bacillus cereus MM3]
Length=802

 Score =   171 bits (434),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++    IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQNIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_042216922.1| leucyl-tRNA synthetase [Paenibacillus borealis]
 gb|AIQ60345.1| leucyl-tRNA synthetase [Paenibacillus borealis]
Length=815

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 96/121 (79%), Gaps = 2/121 (2%)
 Frame = +3

Query  258  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVG  437
            +N   Q    Y    IEPKWQKFW+E KTF+T +E    KPK+Y LDMFPYPSGAGLHVG
Sbjct  3    DNTFTQAHTGYRAQTIEPKWQKFWDENKTFKTSEE--AGKPKFYALDMFPYPSGAGLHVG  60

Query  438  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQ  617
            HP GYTATDI++RFKRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR Q
Sbjct  61   HPEGYTATDIVSRFKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFRRQ  120

Query  618  L  620
            +
Sbjct  121  I  121



>ref|WP_042139488.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL P4-0081]
 gb|AIQ31815.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL P4-0081]
Length=815

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 96/121 (79%), Gaps = 2/121 (2%)
 Frame = +3

Query  258  ENEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVG  437
            +N   Q    Y    IEPKWQKFW+E KTF+T +E    KPK+Y LDMFPYPSGAGLHVG
Sbjct  3    DNTFTQAHTGYRAQTIEPKWQKFWDENKTFKTSEE--AGKPKFYALDMFPYPSGAGLHVG  60

Query  438  HPLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQ  617
            HP GYTATDI++RFKRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR Q
Sbjct  61   HPEGYTATDIVSRFKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFRRQ  120

Query  618  L  620
            +
Sbjct  121  I  121



>ref|WP_007129371.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillales]
 gb|EHB65057.1| leucyl-tRNA synthetase [Paenibacillus lactis 154]
Length=813

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 99/119 (83%), Gaps = 2/119 (2%)
 Frame = +3

Query  264  EEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHP  443
            ++Q     Y    IEPKWQK+WEE KTF+T D  ++SKPK+Y LDMFPYPSGAGLHVGHP
Sbjct  3    DQQSAGHGYKPQVIEPKWQKYWEENKTFKTED--NSSKPKFYALDMFPYPSGAGLHVGHP  60

Query  444  LGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
             GYTATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  TI+NIN FR Q+
Sbjct  61   EGYTATDIISRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGKHPREFTIQNINNFRRQI  119



>ref|WP_000009480.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJS73287.1| leucyl-tRNA synthetase [Bacillus cereus BAG2X1-2]
Length=802

 Score =   171 bits (434),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++    IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQNIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_022476500.1| leucyl-tRNA synthetase [Clostridium sp. CAG:273]
 emb|CDE84625.1| leucine--tRNA ligase [Clostridium sp. CAG:273]
Length=798

 Score =   171 bits (434),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 81/112 (72%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            AY F EIE KWQ  W+E+KTF+T D  D SKPK+Y LDMFPYPSG GLHVGHP GYTATD
Sbjct  2    AYNFKEIEKKWQDKWDEEKTFKT-DAWDFSKPKFYALDMFPYPSGQGLHVGHPEGYTATD  60

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I++R +RMQGYNVLHPMGWDAFGLPAEQYAI+TG HP   T +NI  F+ QL
Sbjct  61   IISRMRRMQGYNVLHPMGWDAFGLPAEQYAIKTGNHPETFTKKNIETFKKQL  112



>ref|WP_044737514.1| leucyl-tRNA synthetase [Bacillus mycoides]
Length=802

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002067653.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL68583.1| Leucyl-tRNA synthetase [Bacillus cereus AH603]
Length=802

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_016130370.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOP49726.1| leucyl-tRNA synthetase [Bacillus cereus VDM053]
Length=802

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_016095957.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOO17955.1| leucyl-tRNA synthetase [Bacillus cereus HuA3-9]
Length=802

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002034430.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEL03911.1| Leucyl-tRNA synthetase [Bacillus cereus BDRD-ST196]
 dbj|GAE40279.1| leucine--tRNA ligase [Bacillus weihenstephanensis NBRC 101238 
= DSM 11821]
 gb|AIW82827.1| leucine--tRNA ligase [Bacillus weihenstephanensis]
Length=802

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_000009446.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJS60728.1| leucyl-tRNA synthetase [Bacillus cereus BAG1X1-3]
 gb|EOO71381.1| leucyl-tRNA synthetase [Bacillus cereus BAG1O-1]
Length=802

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002145290.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ85759.1| leucyl-tRNA synthetase [Bacillus cereus HuA4-10]
Length=802

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>gb|EMO76983.1| leucyl-tRNA synthetase, domain 2 [Leptospira kirschneri str. 
200801925]
Length=408

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR Q+
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKNNIDNFRRQI  111



>ref|WP_021278651.1| leucyl-tRNA synthetase [Bacteriovorax sp. DB6_IX]
 gb|EQC49771.1| putative leucine--tRNA ligase [Bacteriovorax sp. DB6_IX]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 81/111 (73%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y F EIE KWQ +WEE +TF+T D  D SKPKYY LDMFP+PSGAGLHVGHP GYTATDI
Sbjct  3    YNFGEIEKKWQAYWEENETFKT-DSSDRSKPKYYALDMFPFPSGAGLHVGHPEGYTATDI  61

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ++R+KRM GYNVLHPMGWD+FGLPAE YAI+TGTHP  TT +NI  F  QL
Sbjct  62   MSRYKRMNGYNVLHPMGWDSFGLPAENYAIKTGTHPEETTQKNIGTFTRQL  112



>ref|WP_012261857.1| leucine--tRNA ligase [Bacillus weihenstephanensis]
 sp|A9VLA2.1|SYL_BACWK RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus weihenstephanensis KBAB4]
 gb|ABY45726.1| leucyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002015698.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEK71094.1| Leucyl-tRNA synthetase [Bacillus cereus AH621]
 gb|EJR39917.1| leucyl-tRNA synthetase [Bacillus cereus VD048]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002129511.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EEL97199.1| Leucyl-tRNA synthetase [Bacillus mycoides DSM 2048]
 gb|EJQ57590.1| leucyl-tRNA synthetase [Bacillus cereus CER057]
 gb|EJQ69858.1| leucyl-tRNA synthetase [Bacillus cereus CER074]
 gb|EJV62308.1| leucyl-tRNA synthetase [Bacillus cereus BtB2-4]
 gb|EJV79211.1| leucyl-tRNA synthetase [Bacillus cereus HuA2-1]
 gb|EOO17698.1| leucyl-tRNA synthetase [Bacillus cereus HuA2-9]
 gb|EOO36188.1| leucyl-tRNA synthetase [Bacillus cereus VDM019]
 gb|EOP34014.1| leucyl-tRNA synthetase [Bacillus cereus VD146]
 gb|ETT70065.1| leucyl-tRNA ligase [Bacillus weihenstephanensis FSL H7-687]
 gb|KEZ81287.1| leucyl-tRNA synthetase [Bacillus weihenstephanensis]
 gb|AJH22129.1| leucine--tRNA ligase [Bacillus mycoides]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_016102930.1| MULTISPECIES: leucyl-tRNA synthetase [Bacillus cereus group]
 gb|EOO69552.1| leucyl-tRNA synthetase [Bacillus cereus VD021]
 gb|KIV67767.1| Leucyl-tRNA synthetase [Bacillus mycoides]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002184798.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJS08645.1| leucyl-tRNA synthetase [Bacillus cereus VDM022]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002190950.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJS02860.1| leucyl-tRNA synthetase [Bacillus cereus VDM034]
 gb|EJS15977.1| leucyl-tRNA synthetase [Bacillus cereus VDM062]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002167530.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJR44606.1| leucyl-tRNA synthetase [Bacillus cereus VD078]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002143462.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJQ65840.1| leucyl-tRNA synthetase [Bacillus cereus HuA2-4]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_002089088.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJP87997.1| leucyl-tRNA synthetase [Bacillus cereus VD142]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_000009447.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EEL85725.1| Leucyl-tRNA synthetase [Bacillus cereus AH1272]
 gb|EEL91530.1| Leucyl-tRNA synthetase [Bacillus cereus AH1273]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_038595513.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL H7-0357]
 gb|AIQ19985.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL H7-0357]
Length=816

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
             Y    IEPKWQKFW+E KTF+T +  D+SKPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  13   GYRAQSIEPKWQKFWDENKTFKTGE--DSSKPKFYALDMFPYPSGAGLHVGHPEGYTATD  70

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR Q+
Sbjct  71   IVSRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFRRQI  122



>emb|CEX42074.1| leucyl-tRNA synthetase [Streptococcus pneumoniae]
Length=751

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_033674310.1| leucyl-tRNA synthetase [Bacillus gaemokensis]
 gb|KEK24543.1| leucyl-tRNA synthetase [Bacillus gaemokensis]
Length=802

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KR QGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRAQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_022226580.1| leucyl-tRNA synthetase [Clostridium sp. CAG:302]
 emb|CDB91880.1| leucine--tRNA ligase [Clostridium sp. CAG:302]
Length=796

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 80/111 (72%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y F + E KWQ +WEE KTF+T D  D SKPKYY LDMFPYPSG GLHVGHP GYTATDI
Sbjct  2    YNFRKTEKKWQDYWEENKTFKT-DTKDFSKPKYYALDMFPYPSGVGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ++R KRMQGYNVLHPMGWDAFGLPAEQYA++TG HP   T  NI  F+ QL
Sbjct  61   VSRMKRMQGYNVLHPMGWDAFGLPAEQYAVKTGNHPSGFTESNIKVFKKQL  111



>ref|WP_022029418.1| leucyl-tRNA synthetase [Clostridium sp. CAG:762]
 emb|CCZ57092.1| leucine--tRNA ligase [Clostridium sp. CAG:762]
Length=796

 Score =   171 bits (432),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 80/111 (72%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y F ++E KW K+W+E +TF+T D  D SKPKYYVLDMFPYPSG GLH GHP GYTATDI
Sbjct  2    YNFRKVEKKWIKYWDEHETFKT-DIHDFSKPKYYVLDMFPYPSGVGLHAGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            +AR KRMQGYNVLHPMGWDAFGLPAEQYAI TG HP   T  NI  F+ QL
Sbjct  61   IARMKRMQGYNVLHPMGWDAFGLPAEQYAITTGNHPSSFTSENIKTFKEQL  111



>ref|WP_033009813.1| leucyl-tRNA synthetase [Geobacillus stearothermophilus]
 gb|KFL16260.1| leucyl-tRNA synthetase [Geobacillus stearothermophilus]
 gb|KFX34249.1| leucyl-tRNA synthetase [Geobacillus stearothermophilus]
Length=805

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_014801419.1| leucyl-tRNA synthetase [Turneriella parva]
 gb|AFM10898.1| leucyl-tRNA synthetase [Turneriella parva DSM 21527]
Length=853

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            +YPF EIE KWQ +WE  +TF T +  D SKPKYYVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SYPFAEIEKKWQLYWENNQTFATGE--DLSKPKYYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I+AR +RMQG+NVLHPMGWDAFGLPAE+YA++TG HP++TT +NI+ FR QL
Sbjct  60   IIARKRRMQGFNVLHPMGWDAFGLPAERYAMQTGIHPKVTTKQNIDNFRRQL  111



>ref|WP_044736817.1| leucyl-tRNA synthetase [Geobacillus kaustophilus]
Length=805

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_044730524.1| leucyl-tRNA synthetase [Geobacillus kaustophilus]
 gb|KJE27545.1| leucine--tRNA ligase [Geobacillus kaustophilus]
Length=805

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_031407586.1| leucyl-tRNA synthetase [Geobacillus vulcani]
Length=805

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEKKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>gb|EMO27254.1| putative leucine--tRNA ligase [Leptospira interrogans serovar 
Bataviae str. HAI135]
Length=470

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR Q+
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKNNIDNFRRQI  111



>ref|WP_044744755.1| leucyl-tRNA synthetase [Anoxybacillus sp. ATCC BAA-2555]
Length=805

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_013524386.1| MULTISPECIES: leucyl-tRNA synthetase [Geobacillus]
 gb|ACX77342.1| leucyl-tRNA synthetase [Geobacillus sp. Y412MC61]
 gb|ADU95256.1| leucyl-tRNA synthetase [Geobacillus sp. Y412MC52]
Length=805

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_013144426.1| leucyl-tRNA synthetase [Geobacillus sp. C56-T3]
 gb|ADI25698.1| leucyl-tRNA synthetase [Geobacillus sp. C56-T3]
Length=805

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_041901725.1| leucyl-tRNA synthetase [Marinimicrobia bacterium SCGC AAA160-B08]
Length=813

 Score =   171 bits (432),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 81/112 (72%), Positives = 95/112 (85%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            AY    IEPKWQK+W + +TF+T    D+ KPKYYVLDMFPYPSG+GLHVGH LGY ATD
Sbjct  2    AYNHKAIEPKWQKYWSDNETFKT--GTDSEKPKYYVLDMFPYPSGSGLHVGHALGYVATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I+ARFKRM+G+NVLHPMGWDAFGLPAEQYAI+TGTHP+ITT  NI+ F+ Q+
Sbjct  60   IVARFKRMKGFNVLHPMGWDAFGLPAEQYAIKTGTHPKITTADNISNFKRQI  111



>ref|WP_021322703.1| leucyl-tRNA synthetase [Geobacillus sp. A8]
 gb|EQB94236.1| leucyl-tRNA synthetase [Geobacillus sp. A8]
Length=805

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_033014546.1| leucyl-tRNA synthetase [Geobacillus stearothermophilus]
Length=805

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_003201345.1| leucyl-tRNA synthetase [Bacillus mycoides]
 gb|EEM03550.1| Leucyl-tRNA synthetase [Bacillus mycoides Rock1-4]
Length=802

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE  KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEGNKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



>ref|WP_019006982.1| leucyl-tRNA synthetase [Cohnella laeviribosi]
Length=812

 Score =   171 bits (432),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 2/106 (2%)
 Frame = +3

Query  303  IEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDILARFK  482
            IEPKWQ++WEE KTFRT +  D  KPK+Y LDMFPYPSGAGLHVGHP GYTATDI++R+K
Sbjct  15   IEPKWQRYWEEHKTFRTTE--DKDKPKFYALDMFPYPSGAGLHVGHPEGYTATDIVSRYK  72

Query  483  RMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            RM+GYNVLHPMGWDAFGLPAEQYA++TG HP+  T  NIN FR Q+
Sbjct  73   RMRGYNVLHPMGWDAFGLPAEQYALQTGRHPKDITEENINNFRRQI  118



>gb|EMY25325.1| putative leucine--tRNA ligase [Leptospira interrogans serovar 
Australis str. 200703203]
Length=471

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            YPF E+E  WQKFWEE K+F+T   I +SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  3    YPFQEVESFWQKFWEEHKSFQT--NIRSSKPKFYCLDMFPYPSGAGLHVGHPEGYTATDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+RFKRM+G+ VLHPMGWDAFGLPAE+YA++TG HP ITT  NI+ FR Q+
Sbjct  61   LSRFKRMKGFEVLHPMGWDAFGLPAERYAMQTGIHPAITTKDNIDNFRRQI  111



>ref|WP_011232314.1| leucine--tRNA ligase [Geobacillus kaustophilus]
 sp|Q5KW09.1|SYL_GEOKA RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Geobacillus kaustophilus HTA426]
 dbj|BAD77127.1| leucyl-tRNA synthetase [Geobacillus kaustophilus HTA426]
Length=805

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKNKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_034640994.1| leucyl-tRNA synthetase [Bacillus manliponensis]
 gb|KEK18467.1| leucyl-tRNA synthetase [Bacillus manliponensis]
Length=802

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 81/112 (72%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WE  KTFRTPDE D  KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQAYWEGNKTFRTPDETD--KPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEQNINTFRNQI  111



>ref|WP_016106405.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EOP64410.1| leucyl-tRNA synthetase [Bacillus cereus VD118]
Length=802

 Score =   170 bits (431),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQKIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_036732290.1| leucyl-tRNA synthetase [Paenibacillus sp. FSL R7-277]
 gb|ETT58964.1| leucyl-tRNA ligase [Paenibacillus sp. FSL R7-277]
Length=809

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 94/112 (84%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
             Y    IEPKWQKFW+E KTF+T +E  + KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  6    GYRAQTIEPKWQKFWDENKTFKTSEE--SGKPKFYALDMFPYPSGAGLHVGHPEGYTATD  63

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            I++RFKRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR Q+
Sbjct  64   IVSRFKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFRRQI  115



>ref|WP_039300930.1| leucyl-tRNA synthetase [Paenibacillus sp. IHB B 3415]
 gb|KHL94606.1| leucyl-tRNA synthetase [Paenibacillus sp. IHB B 3415]
Length=813

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = +3

Query  261  NEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGH  440
            ++  Q    Y    IEPKWQKFW+E KTF+T +E    KPK+Y LDMFPYPSGAGLHVGH
Sbjct  2    SDNTQAPTGYRAQTIEPKWQKFWDENKTFKTSEE--AGKPKFYALDMFPYPSGAGLHVGH  59

Query  441  PLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            P GYTATDI++RFKRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T +NI+ FR Q+
Sbjct  60   PEGYTATDIVSRFKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITFKNIDNFRRQI  119



>ref|WP_014681197.1| leucyl-tRNA synthetase [Solitalea canadensis]
 gb|AFD07970.1| leucyl-tRNA synthetase [Solitalea canadensis DSM 3403]
Length=947

 Score =   171 bits (434),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 80/111 (72%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y F EIE KWQKFW + KTF+   +ID++KPKYYVLDMFPYPSGAGLHVGHPLGY A+DI
Sbjct  3    YSFREIEKKWQKFWADNKTFKV--DIDSNKPKYYVLDMFPYPSGAGLHVGHPLGYIASDI  60

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
              RFK+++G+NVLHPMG+DAFGLPAEQYAI+TG HP ITT +N  R+R QL
Sbjct  61   FTRFKKLKGFNVLHPMGYDAFGLPAEQYAIQTGQHPAITTDQNTKRYRGQL  111



>ref|WP_037290055.1| leucyl-tRNA synthetase [Saccharibacillus sacchari]
Length=817

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 99/120 (83%), Gaps = 1/120 (1%)
 Frame = +3

Query  261  NEEQQVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGH  440
            NE+      Y    IEPKWQ+ W+E+KTF+T D++D SKPK+Y +DMFPYPSGAGLHVGH
Sbjct  5    NEQGAAASGYRAQTIEPKWQQKWDEEKTFKT-DDMDHSKPKFYAMDMFPYPSGAGLHVGH  63

Query  441  PLGYTATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            P GYTATDI++R+KRMQG+NV+HPMGWDAFGLPAEQYAI+ G HPR  T++NIN FR Q+
Sbjct  64   PEGYTATDIVSRYKRMQGFNVMHPMGWDAFGLPAEQYAIDNGGHPREFTLKNINTFRRQI  123



>ref|WP_002112382.1| leucyl-tRNA synthetase [Bacillus cereus]
 gb|EJV65964.1| leucyl-tRNA synthetase [Bacillus cereus BAG6O-2]
Length=802

 Score =   170 bits (431),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ  WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQKIEKKWQGHWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTELNINTFRNQI  111



>ref|WP_019909144.1| leucyl-tRNA synthetase [Paenibacillus sp. HW567]
Length=816

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +3

Query  273  QVRRAYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGY  452
            + +  Y    IEPKWQKFW+E KTF+T +  D  KPK+Y LDMFPYPSGAGLHVGHP GY
Sbjct  9    EAQAGYRAQTIEPKWQKFWDENKTFKTGE--DAGKPKFYALDMFPYPSGAGLHVGHPEGY  66

Query  453  TATDILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            TATDI++R+KRM+GYNVLHPMGWDAFGLPAEQYA++TG HPR  T++NIN FR Q+
Sbjct  67   TATDIVSRYKRMRGYNVLHPMGWDAFGLPAEQYAMDTGQHPRDITVKNINNFRRQI  122



>gb|EQC75802.1| Leucyl-tRNA synthetase [Streptococcus sp. HSISS3]
Length=311

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +3

Query  288  YPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATDI  467
            Y   EIEPKWQK+W +  TF+T    D SKPK+Y LDMFPYPSGAGLHVGHP GYTATDI
Sbjct  4    YNHKEIEPKWQKYWADNHTFKTG--TDASKPKFYALDMFPYPSGAGLHVGHPEGYTATDI  61

Query  468  LARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            L+RFKR QGYNVLHPMGWDAFGLPAEQYA++TG  P   T  NI  F+ Q+
Sbjct  62   LSRFKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAENIANFKRQI  112



>ref|WP_000009438.1| leucine--tRNA ligase [Bacillus cereus]
 sp|B7IL05.1|SYL_BACC2 RecName: Full=Leucine--tRNA ligase; AltName: Full=Leucyl-tRNA 
synthetase; Short=LeuRS [Bacillus cereus G9842]
 gb|ACK97313.1| leucyl-tRNA synthetase [Bacillus cereus G9842]
Length=802

 Score =   170 bits (430),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   +IE KWQ +WEE KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQDIEKKWQGYWEENKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGY VLHPMGWDAFGLPAEQYA++TG  P   T  NIN FR Q+
Sbjct  60   ILSRMKRMQGYKVLHPMGWDAFGLPAEQYALDTGNSPAEFTEHNINTFRNQI  111



>ref|WP_025949565.1| leucyl-tRNA synthetase [Geobacillus thermocatenulatus]
Length=805

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE+ KTFRTPD  D  KPK+YVLDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHREIEQKWQDYWEKHKTFRTPD--DDDKPKFYVLDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            ILAR KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NI+ FR Q+
Sbjct  60   ILARMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQKNIDNFRRQI  111



>ref|WP_003208770.1| leucyl-tRNA synthetase [Bacillus mycoides]
 gb|EEM09208.1| Leucyl-tRNA synthetase [Bacillus mycoides Rock3-17]
 gb|KFN13831.1| leucine--tRNA ligase [Bacillus mycoides]
Length=802

 Score =   170 bits (430),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +3

Query  285  AYPFHEIEPKWQKFWEEKKTFRTPDEIDTSKPKYYVLDMFPYPSGAGLHVGHPLGYTATD  464
            ++   EIE KWQ +WE  KTFRTPDE  T KPK+Y LDMFPYPSGAGLHVGHP GYTATD
Sbjct  2    SFNHQEIEKKWQAYWEGNKTFRTPDE--TEKPKFYALDMFPYPSGAGLHVGHPEGYTATD  59

Query  465  ILARFKRMQGYNVLHPMGWDAFGLPAEQYAIETGTHPrittirninrFRLQL  620
            IL+R KRMQGYNVLHPMGWDAFGLPAEQYA++TG  P   T +NIN FR Q+
Sbjct  60   ILSRMKRMQGYNVLHPMGWDAFGLPAEQYALDTGNSPAEFTEKNINTFRNQI  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 885656638944