BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7912

Length=1799
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   860   0.0     Citrus sinensis [apfelsine]
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 858   0.0     
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 858   0.0     
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             855   0.0     Citrus clementina [clementine]
gb|AAB17186.1|  plasma membrane H+-ATPase                               853   0.0     Solanum lycopersicum
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                853   0.0     
ref|XP_010094202.1|  Plasma membrane ATPase 4                           852   0.0     Morus notabilis
gb|KHN22686.1|  Plasma membrane ATPase 4                                851   0.0     Glycine soja [wild soybean]
ref|XP_012075128.1|  PREDICTED: plasma membrane ATPase 4                849   0.0     
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             849   0.0     Phaseolus vulgaris [French bean]
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                849   0.0     Nicotiana sylvestris
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    848   0.0     Ricinus communis
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                848   0.0     Phoenix dactylifera
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    848   0.0     Glycine max [soybeans]
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  848   0.0     Elaeis guineensis
emb|CAN64375.1|  hypothetical protein VITISV_014422                     847   0.0     Vitis vinifera
gb|KJB22048.1|  hypothetical protein B456_004G027300                    847   0.0     Gossypium raimondii
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                847   0.0     Vitis vinifera
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           847   0.0     Sesamum indicum [beniseed]
emb|CDP02997.1|  unnamed protein product                                847   0.0     Coffea canephora [robusta coffee]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  847   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             847   0.0     Elaeis guineensis
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                847   0.0     Nicotiana tomentosiformis
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           846   0.0     Phoenix dactylifera
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           846   0.0     Cicer arietinum [garbanzo]
gb|KHN17608.1|  Plasma membrane ATPase 4                                845   0.0     Glycine soja [wild soybean]
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          845   0.0     
dbj|BAC77531.1|  plasma membrane H+-ATPase                              845   0.0     Sesbania rostrata
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          845   0.0     Medicago truncatula
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   834   0.0     Citrus sinensis [apfelsine]
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      845   0.0     Solanum tuberosum [potatoes]
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    845   0.0     Glycine max [soybeans]
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          844   0.0     Tarenaya hassleriana [spider flower]
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             844   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             843   0.0     Musa acuminata subsp. malaccensis [pisang utan]
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    843   0.0     Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006845683.1|  PREDICTED: plasma membrane ATPase 4                842   0.0     Amborella trichopoda
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           841   0.0     Glycine max [soybeans]
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             841   0.0     Phaseolus vulgaris [French bean]
gb|KHN15309.1|  Plasma membrane ATPase 4                                840   0.0     Glycine soja [wild soybean]
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    840   0.0     Tarenaya hassleriana [spider flower]
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           840   0.0     
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                840   0.0     Prunus mume [ume]
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             840   0.0     Elaeis guineensis
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  840   0.0     Phoenix dactylifera
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   835   0.0     Citrus sinensis [apfelsine]
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    838   0.0     Tarenaya hassleriana [spider flower]
ref|XP_012076337.1|  PREDICTED: plasma membrane ATPase 4                838   0.0     Jatropha curcas
emb|CAB69823.1|  plasma membrane H+ ATPase                              838   0.0     Prunus persica
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             837   0.0     Prunus persica
dbj|BAA37150.1|  p-type H+-ATPase                                       837   0.0     Vicia faba [broad bean]
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                837   0.0     Cucumis melo [Oriental melon]
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                837   0.0     Erythranthe guttata [common monkey flower]
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    836   0.0     Populus euphratica
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     836   0.0     Tarenaya hassleriana [spider flower]
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 835   0.0     
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     835   0.0     Pyrus x bretschneideri [bai li]
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     835   0.0     Pyrus x bretschneideri [bai li]
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           835   0.0     
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                835   0.0     Eucalyptus grandis [rose gum]
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     835   0.0     Tarenaya hassleriana [spider flower]
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   832   0.0     Citrus sinensis [apfelsine]
gb|AEO22063.1|  plasma membrane H+-ATPase                               834   0.0     Aeluropus littoralis
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   833   0.0     Citrus sinensis [apfelsine]
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             834   0.0     Citrus clementina [clementine]
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             834   0.0     Citrus sinensis [apfelsine]
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     828   0.0     Eucalyptus grandis [rose gum]
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                833   0.0     
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                833   0.0     Vitis vinifera
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     832   0.0     Tarenaya hassleriana [spider flower]
gb|AAB84202.2|  plasma membrane proton ATPase                           833   0.0     Kosteletzkya pentacarpos [seashore mallow]
gb|KJB55190.1|  hypothetical protein B456_009G068100                    832   0.0     Gossypium raimondii
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    830   0.0     
gb|KJB82762.1|  hypothetical protein B456_013G212200                    825   0.0     Gossypium raimondii
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                832   0.0     Erythranthe guttata [common monkey flower]
gb|AFM52333.1|  plasma membrane H+-ATPase                               832   0.0     Malus baccata var. xiaojinensis
dbj|BAD16684.1|  plasma membrane H+-ATPase                              832   0.0     Daucus carota [carrots]
gb|KJB55189.1|  hypothetical protein B456_009G068100                    832   0.0     Gossypium raimondii
ref|XP_010111939.1|  Plasma membrane ATPase 4                           830   0.0     
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             831   0.0     Capsella rubella
ref|NP_001292696.1|  plasma membrane ATPase 4                           831   0.0     Cucumis sativus [cucumbers]
gb|KJB65971.1|  hypothetical protein B456_010G123000                    831   0.0     Gossypium raimondii
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    831   0.0     Fragaria vesca subsp. vesca
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           831   0.0     Cucumis melo [Oriental melon]
dbj|BAO45902.1|  plasma membrane H+-ATPase                              831   0.0     Acacia mangium
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    832   0.0     Fragaria vesca subsp. vesca
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             831   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_194748.1|  H(+)-ATPase 2                                         830   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             830   0.0     Phoenix dactylifera
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           830   0.0     
ref|NP_001190870.1|  H(+)-ATPase 2                                      831   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     828   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          830   0.0     Camelina sativa [gold-of-pleasure]
dbj|BAL41366.1|  plasma membrane H+-ATPase                              830   0.0     Aeluropus littoralis
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             830   0.0     Eutrema salsugineum [saltwater cress]
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             830   0.0     Elaeis guineensis
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     830   0.0     Eucalyptus grandis [rose gum]
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     829   0.0     Camelina sativa [gold-of-pleasure]
gb|AEQ27822.1|  PM H+-ATPase R                                          829   0.0     Eichhornia crassipes
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     831   0.0     Eucalyptus grandis [rose gum]
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           828   0.0     Malus domestica [apple tree]
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                828   0.0     Nelumbo nucifera [Indian lotus]
gb|KJB82763.1|  hypothetical protein B456_013G212200                    828   0.0     Gossypium raimondii
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           828   0.0     Pyrus x bretschneideri [bai li]
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                828   0.0     Fragaria vesca subsp. vesca
gb|KFK29576.1|  h(+)-atpase 2                                           827   0.0     Arabis alpina [alpine rockcress]
gb|ACL54575.1|  unknown                                                 827   0.0     Zea mays [maize]
ref|NP_001292776.1|  plasma membrane ATPase                             827   0.0     Zea mays [maize]
ref|XP_011649762.1|  PREDICTED: plasma membrane ATPase 4                827   0.0     Cucumis sativus [cucumbers]
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                827   0.0     Eucalyptus grandis [rose gum]
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             826   0.0     Setaria italica
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                826   0.0     Erythranthe guttata [common monkey flower]
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           825   0.0     Populus euphratica
emb|CBW30173.1|  Plasma membrane ATPase 4                               825   0.0     Musa balbisiana [starchy banana]
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           825   0.0     Cicer arietinum [garbanzo]
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             825   0.0     Oryza brachyantha
ref|NP_001292777.1|  proton-exporting ATPase4                           825   0.0     Zea mays [maize]
dbj|BAF03589.1|  P-type H+-ATPase                                       825   0.0     Zostera marina
ref|XP_006382164.1|  H+-ATPase family protein                           825   0.0     
emb|CBW30211.1|  Plasma membrane ATPase                                 824   0.0     Musa balbisiana [starchy banana]
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     825   0.0     
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           824   0.0     Cucumis melo [Oriental melon]
ref|NP_179486.1|  H(+)-ATPase 1                                         824   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           823   0.0     Sesamum indicum [beniseed]
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   823   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          823   0.0     Sorghum bicolor [broomcorn]
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       825   0.0     
dbj|BAD16687.1|  plasma membrane H+-ATPase                              823   0.0     Daucus carota [carrots]
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           823   0.0     
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          823   0.0     Brassica rapa
gb|AHK23067.1|  plasma membrane ATPase 4                                823   0.0     Fagopyrum tataricum [Kangra buckwheat]
gb|AAY42950.1|  plasma membrane H+ ATPase                               823   0.0     Lupinus albus
gb|EPS73574.1|  hypothetical protein M569_01174                         815   0.0     Genlisea aurea
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                822   0.0     Beta vulgaris subsp. vulgaris [field beet]
ref|NP_200545.1|  H(+)-ATPase 3                                         822   0.0     Arabidopsis thaliana [mouse-ear cress]
dbj|BAD16685.1|  plasma membrane H+-ATPase                              821   0.0     Daucus carota [carrots]
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          821   0.0     
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    821   0.0     Populus euphratica
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    821   0.0     
gb|AAL09726.1|  AT5g57350/MJB24_16                                      821   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AFW04239.1|  plasma membrane H+-ATPase                               821   0.0     Sesuvium portulacastrum [sea-purslane]
dbj|BAD16688.1|  plasma membrane H+-ATPase                              821   0.0     Daucus carota [carrots]
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    821   0.0     Glycine max [soybeans]
ref|NP_001054118.1|  Os04g0656100                                       820   0.0     
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          820   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           820   0.0     Cicer arietinum [garbanzo]
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          820   0.0     Medicago truncatula
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    820   0.0     Glycine max [soybeans]
gb|AAB41898.1|  H+-transporting ATPase                                  820   0.0     Mesembryanthemum crystallinum
gb|KEH39758.1|  plasma membrane H+-ATPase                               819   0.0     Medicago truncatula
ref|XP_011045013.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     814   0.0     Populus euphratica
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     818   0.0     
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                818   0.0     Sesamum indicum [beniseed]
emb|CDY67153.1|  BnaAnng23670D                                          816   0.0     Brassica napus [oilseed rape]
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             817   0.0     Capsella rubella
ref|NP_001292679.1|  plasma membrane ATPase 4                           817   0.0     Cucumis sativus [cucumbers]
gb|AAY42949.1|  plasma membrane H+ ATPase                               817   0.0     Lupinus albus
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      817   0.0     Glycine max [soybeans]
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             817   0.0     Phaseolus vulgaris [French bean]
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          816   0.0     Brassica rapa
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             816   0.0     Musa acuminata subsp. malaccensis [pisang utan]
gb|AAY42948.1|  plasma membrane H+ ATPase                               816   0.0     Lupinus albus
gb|KHN16462.1|  Plasma membrane ATPase 4                                816   0.0     Glycine soja [wild soybean]
gb|EPS65442.1|  hypothetical protein M569_09334                         816   0.0     Genlisea aurea
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    816   0.0     Glycine max [soybeans]
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          816   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_003594954.1|  Plasma membrane ATPase                             815   0.0     Medicago truncatula
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             815   0.0     Phaseolus vulgaris [French bean]
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          815   0.0     
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     814   0.0     Populus euphratica
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          814   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           813   0.0     Elaeis guineensis
dbj|BAJ34124.1|  unnamed protein product                                812   0.0     Eutrema halophilum
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  812   0.0     Brachypodium distachyon [annual false brome]
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             812   0.0     Capsella rubella
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    811   0.0     Camelina sativa [gold-of-pleasure]
emb|CAA59799.1|  H(+)-transporting ATPase                               811   0.0     Phaseolus vulgaris [French bean]
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             811   0.0     
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     811   0.0     
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             811   0.0     
emb|CDY25913.1|  BnaC09g32850D                                          810   0.0     Brassica napus [oilseed rape]
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    811   0.0     Camelina sativa [gold-of-pleasure]
emb|CAC29436.1|  P-type H+-ATPase                                       810   0.0     Vicia faba [broad bean]
ref|XP_002324397.1|  H+-ATPase family protein                           810   0.0     
emb|CDX72218.1|  BnaC07g42400D                                          808   0.0     
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          810   0.0     Brassica rapa
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    809   0.0     Triticum aestivum [Canadian hard winter wheat]
gb|EMT26270.1|  Plasma membrane ATPase                                  809   0.0     
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             809   0.0     Eutrema salsugineum [saltwater cress]
emb|CDX82608.1|  BnaC07g02580D                                          808   0.0     
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    809   0.0     Phoenix dactylifera
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    808   0.0     Phoenix dactylifera
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    807   0.0     Eucalyptus grandis [rose gum]
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    808   0.0     Brassica rapa
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          807   0.0     Brassica rapa
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    807   0.0     Arabis alpina [alpine rockcress]
ref|XP_006848755.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     807   0.0     Amborella trichopoda
dbj|BAJ33915.1|  unnamed protein product                                807   0.0     Eutrema halophilum
emb|CDX72217.1|  BnaC07g42390D                                          806   0.0     
emb|CDY51650.1|  BnaAnng10900D                                          805   0.0     Brassica napus [oilseed rape]
emb|CDY47940.1|  BnaA02g08160D                                          806   0.0     Brassica napus [oilseed rape]
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    806   0.0     Prunus mume [ume]
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    807   0.0     Brassica rapa
emb|CDY38294.1|  BnaA10g11420D                                          806   0.0     Brassica napus [oilseed rape]
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     806   0.0     Brassica rapa
emb|CDY64741.1|  BnaCnng44750D                                          806   0.0     Brassica napus [oilseed rape]
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           806   0.0     Cicer arietinum [garbanzo]
ref|XP_011625062.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     806   0.0     
gb|KFK27283.1|  h(+)-atpase 3                                           805   0.0     Arabis alpina [alpine rockcress]
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   805   0.0     Vicia faba [broad bean]
gb|EMS60594.1|  Plasma membrane ATPase                                  803   0.0     Triticum urartu
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  803   0.0     Nelumbo nucifera [Indian lotus]
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          803   0.0     Brassica rapa
gb|KEH39757.1|  plasma membrane H+-ATPase                               798   0.0     Medicago truncatula
gb|AAV71150.1|  plasma membrane H+-ATPase                               803   0.0     Triticum aestivum [Canadian hard winter wheat]
emb|CDY14186.1|  BnaA08g13170D                                          803   0.0     Brassica napus [oilseed rape]
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           803   0.0     
ref|XP_011625063.1|  PREDICTED: plasma membrane ATPase 4 isoform X3     802   0.0     
gb|AAK31799.2|  plasma membrane H+ ATPase                               802   0.0     Lilium longiflorum [Easter lily]
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           801   0.0     Elaeis guineensis
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                802   0.0     Elaeis guineensis
gb|KEH35952.1|  plasma membrane H+-ATPase                               801   0.0     Medicago truncatula
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             801   0.0     Musa acuminata subsp. malaccensis [pisang utan]
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        800   0.0     Lilium longiflorum [Easter lily]
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           799   0.0     
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           799   0.0     
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          798   0.0     Glycine soja [wild soybean]
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    797   0.0     
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             796   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          795   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    795   0.0     Eucalyptus grandis [rose gum]
emb|CAD29313.1|  plasma membrane H+-ATPase                              794   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_012067540.1|  PREDICTED: ATPase 9, plasma membrane-type          794   0.0     Jatropha curcas
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                793   0.0     
gb|EPS63245.1|  hypothetical protein M569_11541                         793   0.0     Genlisea aurea
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          793   0.0     Vitis vinifera
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             792   0.0     Cicer arietinum [garbanzo]
gb|ABR18001.1|  unknown                                                 792   0.0     Picea sitchensis
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          792   0.0     Cucumis melo [Oriental melon]
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    791   0.0     
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             791   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       791   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    790   0.0     Eucalyptus grandis [rose gum]
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type          790   0.0     Cucumis sativus [cucumbers]
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           790   0.0     Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY51651.1|  BnaAnng10910D                                          788   0.0     Brassica napus [oilseed rape]
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          788   0.0     Tarenaya hassleriana [spider flower]
ref|XP_006848753.2|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    788   0.0     
emb|CDY69631.1|  BnaCnng64550D                                          771   0.0     Brassica napus [oilseed rape]
gb|KEH39753.1|  plasma membrane H+-ATPase                               788   0.0     Medicago truncatula
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    787   0.0     Arabis alpina [alpine rockcress]
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             787   0.0     Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    787   0.0     Arabis alpina [alpine rockcress]
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     786   0.0     Morus notabilis
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           786   0.0     Sesamum indicum [beniseed]
ref|XP_010468541.1|  PREDICTED: ATPase 6, plasma membrane-type-like     781   0.0     Camelina sativa [gold-of-pleasure]
gb|KEH19962.1|  plasma membrane H+-ATPase                               786   0.0     Medicago truncatula
emb|CDY67606.1|  BnaAnng24780D                                          769   0.0     Brassica napus [oilseed rape]
ref|XP_011625064.1|  PREDICTED: plasma membrane ATPase 4 isoform X4     786   0.0     
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          785   0.0     Cucumis melo [Oriental melon]
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   775   0.0     Citrus sinensis [apfelsine]
gb|KJB66333.1|  hypothetical protein B456_010G136300                    785   0.0     Gossypium raimondii
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   785   0.0     Citrus sinensis [apfelsine]
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             785   0.0     
ref|XP_007023381.1|  H(+)-ATPase 9                                      785   0.0     
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             785   0.0     Capsella rubella
gb|KJB19307.1|  hypothetical protein B456_003G094300                    781   0.0     Gossypium raimondii
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     784   0.0     Glycine max [soybeans]
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   774   0.0     Citrus sinensis [apfelsine]
ref|XP_010539792.1|  PREDICTED: ATPase 3, plasma membrane-type-like     783   0.0     Tarenaya hassleriana [spider flower]
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     784   0.0     
ref|XP_007012006.1|  H(+)-ATPase 8                                      784   0.0     
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          784   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_010431653.1|  PREDICTED: ATPase 9, plasma membrane-type-like     771   0.0     Camelina sativa [gold-of-pleasure]
ref|NP_178762.1|  H(+)-ATPase 6                                         783   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                783   0.0     Sesamum indicum [beniseed]
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     782   0.0     Camelina sativa [gold-of-pleasure]
ref|XP_009150710.1|  PREDICTED: ATPase 1, plasma membrane-type-like     782   0.0     Brassica rapa
emb|CAN61424.1|  hypothetical protein VITISV_027272                     782   0.0     Vitis vinifera
ref|XP_010429431.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    774   0.0     
gb|KJB19302.1|  hypothetical protein B456_003G094300                    781   0.0     
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type          781   0.0     
gb|KJB19303.1|  hypothetical protein B456_003G094300                    780   0.0     
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     780   0.0     
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     780   0.0     
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           780   0.0     
dbj|BAC77530.1|  plasma membrane H+-ATPase                              780   0.0     
ref|XP_008659774.1|  PREDICTED: plasma membrane ATPase 4-like           780   0.0     
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             780   0.0     
gb|KEH39623.1|  plasma membrane H+-ATPase                               780   0.0     
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          780   0.0     
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          779   0.0     
dbj|BAM20989.1|  plasma membrane H+-ATPase                              779   0.0     
gb|ABA18090.1|  putative plasma membrane ATPase                         779   0.0     
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    775   0.0     
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          778   0.0     
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             778   0.0     
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     778   0.0     
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     778   0.0     
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    778   0.0     
gb|KJB19305.1|  hypothetical protein B456_003G094300                    778   0.0     
gb|KJB56561.1|  hypothetical protein B456_009G125200                    778   0.0     
gb|KJB19306.1|  hypothetical protein B456_003G094300                    779   0.0     
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    778   0.0     
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             778   0.0     
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          778   0.0     
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          778   0.0     
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     778   0.0     
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    777   0.0     
ref|XP_012080196.1|  PREDICTED: ATPase 11, plasma membrane-type         778   0.0     
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             777   0.0     
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           777   0.0     
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     777   0.0     
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       778   0.0     
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             776   0.0     
gb|ABA18112.1|  putative plasma membrane ATPase                         776   0.0     
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     776   0.0     
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    776   0.0     
ref|NP_178181.1|  H(+)-ATPase 9                                         776   0.0     
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     776   0.0     
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             776   0.0     
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       777   0.0     
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    776   0.0     
emb|CDX93092.1|  BnaA03g38140D                                          776   0.0     
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     776   0.0     
emb|CDY50939.1|  BnaC03g74390D                                          775   0.0     
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                775   0.0     
ref|XP_006654259.1|  PREDICTED: plasma membrane ATPase 4-like           775   0.0     
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          775   0.0     
gb|KEH32174.1|  plasma membrane H+-ATPase                               775   0.0     
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     775   0.0     
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             775   0.0     
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          775   0.0     
ref|NP_189850.1|  H(+)-ATPase 8                                         775   0.0     
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             775   0.0     
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          775   0.0     
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             775   0.0     
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             775   0.0     
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           774   0.0     
ref|XP_002438748.1|  hypothetical protein SORBIDRAFT_10g025470          775   0.0     
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    775   0.0     
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              769   0.0     
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     774   0.0     
gb|EYU35893.1|  hypothetical protein MIMGU_mgv1a0008591mg               764   0.0     
gb|KEH31901.1|  plasma membrane H+-ATPase                               774   0.0     
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    774   0.0     
gb|EPS66977.1|  hypothetical protein M569_07799                         773   0.0     
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          774   0.0     
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          774   0.0     
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    773   0.0     
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           773   0.0     
ref|XP_002864812.1|  AHA11-ATPASE 11                                    774   0.0     
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     773   0.0     
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    772   0.0     
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          773   0.0     
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                774   0.0     
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    773   0.0     
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    773   0.0     
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    773   0.0     
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          773   0.0     
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             773   0.0     
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     772   0.0     
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    772   0.0     
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             773   0.0     
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     772   0.0     
ref|XP_008649034.1|  PREDICTED: ATPase 2, plasma membrane-type-like     772   0.0     
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    771   0.0     
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    772   0.0     
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    771   0.0     
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          771   0.0     
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                772   0.0     
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    772   0.0     
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    771   0.0     
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    772   0.0     
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             771   0.0     
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    771   0.0     
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          771   0.0     
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                771   0.0     
gb|AAR32129.2|  proton P-ATPase                                         771   0.0     
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    770   0.0     
ref|XP_003573592.1|  PREDICTED: ATPase 2, plasma membrane-type-like     771   0.0     
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    771   0.0     
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         770   0.0     
gb|EMS59303.1|  Plasma membrane ATPase                                  773   0.0     
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          770   0.0     
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                     770   0.0     
ref|XP_006838797.1|  PREDICTED: plasma membrane ATPase 3                770   0.0     
gb|AAA34052.1|  H+-translocating ATPase                                 770   0.0     
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                770   0.0     
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                770   0.0     
ref|NP_201073.1|  H(+)-ATPase 11                                        769   0.0     
ref|NP_001234477.1|  plasma membrane H+-ATPase                          769   0.0     
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             769   0.0     
ref|NP_001067382.1|  Os12g0638700                                       769   0.0     
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                769   0.0     
gb|AFC88896.1|  plasma membrane H+-ATPase                               769   0.0     
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           769   0.0     
dbj|BAD19091.1|  putative H+-exporting ATPase                           769   0.0     
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150             766   0.0     
emb|CBI35956.3|  unnamed protein product                                769   0.0     
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    769   0.0     
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          770   0.0     
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    768   0.0     
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     768   0.0     
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040          768   0.0     
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     768   0.0     
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    768   0.0     
emb|CAD29312.1|  plasma membrane H+-ATPase                              768   0.0     
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           768   0.0     
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    768   0.0     
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          776   0.0     
ref|XP_011468858.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    769   0.0     
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         768   0.0     
ref|NP_001059093.1|  Os07g0191200                                       768   0.0     
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             768   0.0     
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     768   0.0     
ref|XP_002324564.1|  ATPase 6 family protein                            768   0.0     
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    768   0.0     
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         768   0.0     
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    767   0.0     
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     767   0.0     
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          767   0.0     
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                767   0.0     
emb|CAN78639.1|  hypothetical protein VITISV_031738                     767   0.0     
ref|XP_002309321.1|  ATPase 6 family protein                            766   0.0     
gb|KJB70727.1|  hypothetical protein B456_011G089100                    767   0.0     
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      767   0.0     
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         767   0.0     
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             766   0.0     
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          766   0.0     
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             761   0.0     
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    766   0.0     
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           766   0.0     
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    766   0.0     
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...    767   0.0     
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    766   0.0     
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           766   0.0     
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    766   0.0     
emb|CAC29435.1|  P-type H+-ATPase                                       766   0.0     
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                765   0.0     
ref|XP_002307856.1|  ATPase 6 family protein                            765   0.0     
gb|KJB54894.1|  hypothetical protein B456_009G053500                    765   0.0     
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         765   0.0     
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    765   0.0     
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    762   0.0     
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    766   0.0     
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     764   0.0     
ref|XP_004985855.1|  PREDICTED: plasma membrane ATPase-like             765   0.0     
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           765   0.0     
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    765   0.0     
emb|CDO98206.1|  unnamed protein product                                765   0.0     
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                765   0.0     
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...    764   0.0     
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         764   0.0     
emb|CDP14278.1|  unnamed protein product                                776   0.0     
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    764   0.0     
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                764   0.0     
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             764   0.0     
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             764   0.0     
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                     763   0.0     
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           764   0.0     
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       764   0.0     
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                     763   0.0     
dbj|BAD16689.1|  plasma membrane H+-ATPase                              764   0.0     
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           764   0.0     
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     764   0.0     
ref|NP_001234775.1|  plasma membrane ATPase 1                           764   0.0     
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                764   0.0     
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             764   0.0     
dbj|BAM20990.1|  plasma membrane H+-ATPase                              763   0.0     
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    763   0.0     
gb|EMT25011.1|  Plasma membrane ATPase                                  764   0.0     
gb|AEQ27823.1|  PM H+-ATPase L                                          763   0.0     
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type         763   0.0     
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         763   0.0     
emb|CDY45757.1|  BnaC02g42250D                                          763   0.0     
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         763   0.0     
ref|XP_007138427.1|  hypothetical protein PHAVU_009G208000g             759   0.0     
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    762   0.0     
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    762   0.0     
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             761   0.0     
gb|KEH37844.1|  plasma membrane H+-ATPase                               760   0.0     
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         762   0.0     
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like    762   0.0     
ref|XP_010227956.1|  PREDICTED: ATPase 6, plasma membrane-type-li...    758   0.0     
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like             762   0.0     
dbj|BAD16686.1|  plasma membrane H+-ATPase                              762   0.0     
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             759   0.0     
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           762   0.0     
dbj|BAA06629.1|  plasma membrane H+-ATPase                              762   0.0     
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     761   0.0     
dbj|BAM20991.1|  plasma membrane H+-ATPase                              761   0.0     
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                  759   0.0     
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 759   0.0     
ref|NP_001048395.2|  Os02g0797300                                       761   0.0     
ref|XP_011651238.1|  PREDICTED: ATPase 11, plasma membrane-type         761   0.0     
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       763   0.0     
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     760   0.0     
gb|AAV49159.1|  plasma membrane proton ATPase 5                         760   0.0     
dbj|BAK04567.1|  predicted protein                                      761   0.0     



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/484 (93%), Positives = 475/484 (98%), Gaps = 0/484 (0%)
 Frame = +1

Query  346   MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             MGDK+I+LE+IKNETVDLE+IPIEEVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKES
Sbjct  1     MGDKAISLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKES  60

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K+LKFLGFMWNPLSWVMEAAA+MAIALANG+GKPPDWQDFVGIVCLLVINSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENN  120

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTK+LRDG+WSE+EAAILVPGDI+SIKLGDIIPADARLLEGDPLKV
Sbjct  121   AGNAAAALMAGLAPKTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKV  180

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  360

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHF PFNPVDKRTALTYID+ G
Sbjct  361   HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDG  420

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             +WHR SKGAPEQIL LCNA+EDLK+KVH++IDKYAERGLRSLAVARQEVPE+TKESPG P
Sbjct  421   HWHRASKGAPEQILALCNAKEDLKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGP  480

Query  1786  WQFV  1797
             WQFV
Sbjct  481   WQFV  484



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/483 (93%), Positives = 471/483 (98%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESK
Sbjct  3     GDKGISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME+AAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDG+W+EQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVD
Sbjct  123   GNAAAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVD  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDE+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIA+GML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF K VDK+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHF PFNPVDKRTALTYID+ GN
Sbjct  363   VVLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCNAREDLK+KVHS+IDK+AERGLRSLAV RQ+VPEKTKES G+PW
Sbjct  423   WHRASKGAPEQILALCNAREDLKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/483 (93%), Positives = 471/483 (98%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESK
Sbjct  3     GDKGISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME+AAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDG+W+EQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVD
Sbjct  123   GNAAAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVD  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDE+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIA+GML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF K VDK+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHF PFNPVDKRTALTYID+ GN
Sbjct  363   VVLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCNAREDLK+KVHS+IDK+AERGLRSLAV RQ+VPEKTKES G+PW
Sbjct  423   WHRASKGAPEQILALCNAREDLKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/485 (93%), Positives = 475/485 (98%), Gaps = 1/485 (0%)
 Frame = +1

Query  346   MGDKS-ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekke  522
             MGDK+ I+LE+IKNETVDLE+IPIEEVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKE
Sbjct  1     MGDKTAISLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKE  60

Query  523   skllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEn  702
             SK+LKFLGFMWNPLSWVMEAAA+MAIALANG+GKPPDWQDFVGIVCLLVINSTISFIEEN
Sbjct  61    SKILKFLGFMWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEEN  120

Query  703   nagnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLK  882
             NAGNAAAALMAGLAPKTK+LRDG+WSE+EAAILVPGDI+SIKLGDIIPADARLLEGDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLK  180

Query  883   VDQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  1062
             VDQSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH
Sbjct  181   VDQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  1063  FQKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  1242
             FQKVLTAIGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1243  TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDK  1422
             TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+K
Sbjct  301   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEK  360

Query  1423  DQVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQ  1602
             D V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHF PFNPVDKRTALTYID+ 
Sbjct  361   DHVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSD  420

Query  1603  GNWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGS  1782
             G+WHR SKGAPEQIL LCNA+EDLK+KVH++IDKYAERGLRSLAVARQEVPE+TKESPG 
Sbjct  421   GHWHRASKGAPEQILALCNAKEDLKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGG  480

Query  1783  PWQFV  1797
             PWQFV
Sbjct  481   PWQFV  485



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/481 (93%), Positives = 468/481 (97%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I+LE+IKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+L
Sbjct  3     KAISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKIL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVME AAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEMAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+S+KLGDI+PADARLLEGDPLK+DQS
Sbjct  123   AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK+PGDEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKV
Sbjct  183   ALTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIA+GML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD++L+EVF KGVDK+ VL
Sbjct  303   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLVEVFTKGVDKEYVL  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWH
Sbjct  363   LLAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL+LCN +ED++RKVHS+IDKYAERGLRSLAVARQEVPEK+KES G PWQF
Sbjct  423   RASKGAPEQILDLCNCKEDVRRKVHSMIDKYAERGLRSLAVARQEVPEKSKESTGGPWQF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/481 (93%), Positives = 468/481 (97%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I+LE+IKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+L
Sbjct  3     KAISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKIL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVME AAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEMAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+S+KLGDI+PADARLLEGDPLK+DQS
Sbjct  123   AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK+PGDEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKV
Sbjct  183   ALTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIA+GML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD++L+EVF KGVDK+ VL
Sbjct  303   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLVEVFTKGVDKEYVL  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWH
Sbjct  363   LLAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL+LCN +ED++RKVHS+IDKYAERGLRSLAVARQEVPEK+KES G PWQF
Sbjct  423   RASKGAPEQILDLCNCKEDVRRKVHSMIDKYAERGLRSLAVARQEVPEKSKESTGGPWQF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/482 (93%), Positives = 470/482 (98%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             DK+I+LE+IKNETVDLE+IPIEEVFEQLKC+REGLTS+EGA+RLQIFGPNKLEEKKESKL
Sbjct  4     DKAISLEEIKNETVDLERIPIEEVFEQLKCTREGLTSEEGASRLQIFGPNKLEEKKESKL  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAI LANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+WSE+EAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDK LIEVFAKGV+KD V
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLIEVFAKGVEKDHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHF PFNPVDKRTALTYID+ GNW
Sbjct  364   ILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN +ED+KRKV  VIDK+AERGLRSLAVARQEVPEK+K+SPG+PWQ
Sbjct  424   HRASKGAPEQILTLCNCKEDVKRKVFGVIDKFAERGLRSLAVARQEVPEKSKDSPGAPWQ  483

Query  1792  FV  1797
             FV
Sbjct  484   FV  485



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/480 (93%), Positives = 470/480 (98%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             +I+LE+IKNETVDLE+IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LK
Sbjct  7     AISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLK  66

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVMEAAA+MAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  126

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDG+W+E+EAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  186

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVT+ PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL
Sbjct  187   LTGESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             TAIGNFCICSIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVIL  366

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
              AARASRTENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYIDA GNWHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDADGNWHR  426

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQI+ LCN R+D KRKVH++IDK+AERGLRSLAVARQEVPEKTKES G+PWQFV
Sbjct  427   ASKGAPEQIMTLCNLRDDAKRKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFV  486



>ref|XP_012075128.1| PREDICTED: plasma membrane ATPase 4 [Jatropha curcas]
 gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/481 (92%), Positives = 470/481 (98%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             KSITLE+IKNETVDLE+IPI+EVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK+L
Sbjct  3     KSITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKIL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGI+CLLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIMCLLVINSTISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDG+WSE+EAAILVPGDI+S+KLGDIIPADARLLEGDPLK+DQS
Sbjct  123   AAAALMAGLAPKTKVLRDGKWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  183   ALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLS+DK LIEVFAKGV+KD V+
Sbjct  303   GSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKALIEVFAKGVEKDHVI  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWH
Sbjct  363   LLAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL LCN R+D+K+KVH+VIDK+AERGLRSLAVARQ+VPEKTKESPG PW+F
Sbjct  423   RASKGAPEQILSLCNCRDDIKKKVHAVIDKFAERGLRSLAVARQQVPEKTKESPGGPWEF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/480 (93%), Positives = 466/480 (97%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             +ITL+QIKNETVDLE+IPIEEVF+QLKCSREGL+ DEGANRLQIFGPNKLEEKKESKLLK
Sbjct  7     AITLDQIKNETVDLERIPIEEVFQQLKCSREGLSGDEGANRLQIFGPNKLEEKKESKLLK  66

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIVCLLVINSTISFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVINSTISFIEENNAGNA  126

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDG+W+EQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  186

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLP TK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL
Sbjct  187   LTGESLPATKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             TAIGNFCICSIA+GMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAIGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGVDKD V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHVIL  366

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
              AARASRTENQDAIDAA+VGMLADPKEARAG REVHFLPFNPVDKRTALTYID  GNWHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAGAREVHFLPFNPVDKRTALTYIDDDGNWHR  426

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQI+ LCN RED K+KVHS+IDK+AERGLRSLAVARQEVPEKTKES GS WQFV
Sbjct  427   SSKGAPEQIMTLCNLREDAKKKVHSIIDKFAERGLRSLAVARQEVPEKTKESAGSAWQFV  486



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/481 (92%), Positives = 468/481 (97%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEK ESK+L
Sbjct  3     KAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKIL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAA+MAIALANGDGKPPDWQDF+GI+CLLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFIGIICLLVINSTISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+S+KLGDIIPADARLLEGDPLKVDQS
Sbjct  123   AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK+PGDEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKV
Sbjct  183   ALTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LT+IGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTSIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NL+EVFAKGVDK+ VL
Sbjct  303   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEYVL  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID   NWH
Sbjct  363   LLAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNNNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL+LCNA+ED++RKVHS++DKYAERGLRSLAVARQEVPEK+KESPG  W+F
Sbjct  423   RASKGAPEQILDLCNAKEDVRRKVHSMMDKYAERGLRSLAVARQEVPEKSKESPGGRWEF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 470/481 (98%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             KSI+LE+IKNETVDLE+IPI+EVFEQLKC+REGL+SDEG NRLQIFGPNKLEEKKESK+L
Sbjct  3     KSISLEEIKNETVDLERIPIDEVFEQLKCTREGLSSDEGTNRLQIFGPNKLEEKKESKIL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDF+GI+CLLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGDGEPPDWQDFIGIICLLVINSTISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDG+W+EQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQS
Sbjct  123   AAAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKV
Sbjct  183   ALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIA+GML E+IVMYPIQHRKYRDGI+NLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLS+DK LIEVFAKGV+KD V+
Sbjct  303   GSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKALIEVFAKGVEKDHVI  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GNWH
Sbjct  363   LLAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL LCN+REDLKRKVHSVIDK+AERGLRSLAVARQ+VPEK K+SPGSPW+F
Sbjct  423   RASKGAPEQILSLCNSREDLKRKVHSVIDKFAERGLRSLAVARQQVPEKNKDSPGSPWEF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/483 (92%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G  +I+LE+IKNETVDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK
Sbjct  3     GGSTISLEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME+AA+MAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMESAAVMAIALANGSGKPPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+L E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGILVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGVDKD 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GN
Sbjct  363   VILLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAHGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED+++KVH VIDK+AERGLRSL VARQEVPEKTKES GSPW
Sbjct  423   WHRASKGAPEQILNLCNCKEDVRKKVHFVIDKFAERGLRSLGVARQEVPEKTKESLGSPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/480 (93%), Positives = 470/480 (98%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             +I+LE+IKNETVDLE+IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LK
Sbjct  7     AISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLK  66

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLLVINSTISFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  126

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDG+W+E+EAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  186

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVT+ PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL
Sbjct  187   LTGESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             TAIGNFCICSIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVIL  366

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
              AARASRTENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYIDA GNWHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDADGNWHR  426

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQI+ LCN R+D K+KVH++IDK+AERGLRSLAVARQEVPEKTKES G+PWQFV
Sbjct  427   ASKGAPEQIMTLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFV  486



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/483 (92%), Positives = 470/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G  +I+LE+IKNETVDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK
Sbjct  3     GGSAISLEEIKNETVDLERIPIEEVFEQLKCTQEGLTSEEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIIVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVDKD 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA G 
Sbjct  363   VILLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGK  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHRVSKGAPEQIL LCN +ED++++VHSVIDK+AERGLRSLAVARQEVPEKTKESPG+PW
Sbjct  423   WHRVSKGAPEQILNLCNCKEDVRKRVHSVIDKFAERGLRSLAVARQEVPEKTKESPGTPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/483 (92%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDKSI+LE+IKNETVDLEKIPIEEVFEQLKC++EGLTS EG  RLQIFGPNKLEEKKESK
Sbjct  3     GDKSISLEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIVCLLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDIIPADARLLEGDPLKVD
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVD  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKHPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NL+EVFAKGVDK+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             VLL AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA G 
Sbjct  363   VLLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGK  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL+LC  +ED+K+K HS+IDK+AERGLRSLAV RQEVPEK+KES GSPW
Sbjct  423   WHRASKGAPEQILDLCKCKEDVKKKAHSIIDKFAERGLRSLAVGRQEVPEKSKESLGSPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>gb|KJB22048.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=951

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/479 (92%), Positives = 468/479 (98%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL+SDEG NRLQIFGPNKLEEKKESK+LKF
Sbjct  4     ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSDEGVNRLQIFGPNKLEEKKESKILKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDG+W+EQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+GML E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAIGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF K  DK+ V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDADKEHVVLL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRA  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCNA+EDLK++VHS+IDK+AERGLRSLAV+RQ+VPEKTKES G+PWQFV
Sbjct  424   SKGAPEQILALCNAKEDLKKRVHSIIDKFAERGLRSLAVSRQQVPEKTKESAGTPWQFV  482



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/483 (92%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDKSI+LE+IKNETVDLEKIPIEEVFEQLKC++EGLTS EG  RLQIFGPNKLEEKKESK
Sbjct  3     GDKSISLEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIVCLLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDIIPADARLLEGDPLKVD
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVD  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKHPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NL+EVFAKGVDK+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             VLL AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA G 
Sbjct  363   VLLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGK  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL+LC  +ED+K+K HS+IDK+AERGLRSLAV RQEVPEK+KES GSPW
Sbjct  423   WHRASKGAPEQILDLCKCKEDVKKKAHSIIDKFAERGLRSLAVGRQEVPEKSKESLGSPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/484 (92%), Positives = 468/484 (97%), Gaps = 0/484 (0%)
 Frame = +1

Query  346   MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             MG  +I+LEQIKNETVDLEK+PIEEVFEQLKC+REGL+S+EGANR+QIFGPNKLEEKKES
Sbjct  1     MGGDAISLEQIKNETVDLEKVPIEEVFEQLKCTREGLSSEEGANRIQIFGPNKLEEKKES  60

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             KLLKFLGFMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGIVCLLVINSTISFIEENN
Sbjct  61    KLLKFLGFMWNPLSWVMEAAALMAIVLANGSGQPPDWQDFVGIVCLLVINSTISFIEENN  120

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKV
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKV  180

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIAVGMLAE+IVMYPIQHRKYR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVFAKGVD++
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVDQE  360

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              VLL AARASRTENQDAIDAA+VG LADPKEARAGIREVHF PFNPVDKRTALTYID++G
Sbjct  361   HVLLLAARASRTENQDAIDAAIVGTLADPKEARAGIREVHFFPFNPVDKRTALTYIDSKG  420

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHR SKGAPEQIL LCN +ED K+ VHSVI+K+AERGLRSLAVARQEVPEK+KESPG P
Sbjct  421   NWHRASKGAPEQILTLCNCKEDFKKNVHSVINKFAERGLRSLAVARQEVPEKSKESPGGP  480

Query  1786  WQFV  1797
             WQFV
Sbjct  481   WQFV  484



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/483 (93%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGIVCLLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEAAAIMAIALANGGGQDPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD
Sbjct  123   GNAAAALMAGLAPKTKVLRDGQWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVT++PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTRNPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGML ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIE FAKGVDK+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEAFAKGVDKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             VLL AARASR ENQDAIDAA+VG LADPKEARAGIRE+HFLPFNPVDKRTALTYIDA+GN
Sbjct  363   VLLLAARASRVENQDAIDAAIVGTLADPKEARAGIRELHFLPFNPVDKRTALTYIDAEGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCNA ED KRKVH++IDK+AERGLRSLAVARQEVP K+K+SPG PW
Sbjct  423   WHRASKGAPEQILTLCNASEDFKRKVHAIIDKFAERGLRSLAVARQEVPAKSKDSPGGPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/483 (91%), Positives = 467/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+K+I+LE+IKNE VDLE++PIEEVFEQLKC+REGLTS EGANRLQIFGPNKLEEKKESK
Sbjct  3     GNKAISLEEIKNENVDLERVPIEEVFEQLKCTREGLTSQEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AA+MAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGM+ E+IVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDK+ 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID  GN
Sbjct  363   VILLAARASRTENQDAIDAAMVGMLADPKEARAGIRELHFLPFNPVDKRTALTYIDVTGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED++ KVHSVIDKYAERGLRSLAVARQEVPEK++ES G PW
Sbjct  423   WHRASKGAPEQILSLCNCKEDVRNKVHSVIDKYAERGLRSLAVARQEVPEKSRESSGGPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/484 (91%), Positives = 468/484 (97%), Gaps = 0/484 (0%)
 Frame = +1

Query  346   MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             MGDK I+LE+IKNETVDLE++PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKES
Sbjct  1     MGDKGISLEEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKES  60

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K LKFLGFMWNPLSWVME AAIMAIALANG GKPPDW+DFVGIV LL INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIVALLFINSTISFIEENN  120

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMA LAPKTKVLRDGRWSE+EAAILVPGDI+SIKLGDIIPADARLLEGDPLK+
Sbjct  121   AGNAAAALMASLAPKTKVLRDGRWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK+PGDE+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIAVG++ E+IVM+PIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGIIVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVD+D
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDRD  360

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARASRTENQDAIDAAMVGMLADPKEARAGI EVHFLPFNPVDKRTALTY+D  G
Sbjct  361   HVVLLAARASRTENQDAIDAAMVGMLADPKEARAGITEVHFLPFNPVDKRTALTYVDDHG  420

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHRVSKGAPEQI+ +CN RED+++KVH+VIDK+AERGLRSLAVARQEVPEKTKESPG P
Sbjct  421   NWHRVSKGAPEQIMNICNCREDVRKKVHTVIDKFAERGLRSLAVARQEVPEKTKESPGGP  480

Query  1786  WQFV  1797
             WQFV
Sbjct  481   WQFV  484



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/481 (92%), Positives = 468/481 (97%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEK ESKLL
Sbjct  3     KAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKLL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDF+GI+CLLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFIGIICLLVINSTISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+S+KLGDIIPADARLLEGDPLKVDQS
Sbjct  123   AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK+PGDEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKV
Sbjct  183   ALTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LT+IGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTSIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGVDK+ VL
Sbjct  303   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVL  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWH
Sbjct  363   LLAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL+LCN++ED+KRKVH++IDKYAERGLRSLAVARQEVPEK+KES G  W+F
Sbjct  423   RASKGAPEQILDLCNSKEDVKRKVHAMIDKYAERGLRSLAVARQEVPEKSKESLGGRWEF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/483 (92%), Positives = 468/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G  +I+LE+IKNETVDLEKIPIEEVF+QLKC+REGLTSDEGA+RLQIFGPNKLEEKKESK
Sbjct  3     GGTAISLEEIKNETVDLEKIPIEEVFQQLKCTREGLTSDEGAHRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSE+EAAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVT++PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGM+ E+IVMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMIVEIIVMYPIQHRIYRSGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIE+FAKGVDKD 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEIFAKGVDKDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GN
Sbjct  363   VVLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED+++KVHSVIDK+AERGLRSL VARQEVPEKTKESPG PW
Sbjct  423   WHRASKGAPEQILNLCNCKEDVRKKVHSVIDKFAERGLRSLGVARQEVPEKTKESPGRPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/483 (90%), Positives = 466/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
              +KSI+LE+IKNETVDLE+IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3     ANKSISLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAA+MAI LANGDGKPPDWQDFVGIVCLLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAALMAIGLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDG+W+EQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVT++PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVF KGVDK+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFEKGVDKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VG LADPKEARAG+ E+HFLPFNPVDKRTALTYID  GN
Sbjct  363   VMLLAARASRTENQDAIDAAIVGTLADPKEARAGVTEIHFLPFNPVDKRTALTYIDGNGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI+ LCN RED KR +H++IDK+AERGLRSLAVARQEVPEK KES GSPW
Sbjct  423   WHRASKGAPEQIMNLCNLREDTKRNIHAIIDKFAERGLRSLAVARQEVPEKNKESAGSPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/480 (92%), Positives = 469/480 (98%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             +I+LE+IKNETVDLE+IPIEEVF+QLKC+REGL+SDEGANRLQIFGPNKLEEKKESK LK
Sbjct  7     AISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKFLK  66

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLLVINSTISFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  126

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDG+W+E+EAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  186

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVT+ PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL
Sbjct  187   LTGESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             TAIGNFCICSIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVIL  366

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
              AARASRTENQDAIDAA+VGMLADPKEARA +REVHFLPFNPVDKRTALTYIDA GNWHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAAVREVHFLPFNPVDKRTALTYIDADGNWHR  426

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQI+ LCN R+D K+KVH++IDK+AERGLRSLAVARQEVPEKTKES G+PWQFV
Sbjct  427   ASKGAPEQIMTLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFV  486



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/481 (90%), Positives = 468/481 (97%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             KSI+LEQIKNETVDLE+IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKK+SK+L
Sbjct  5     KSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKDSKIL  64

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAA+MAI LANG+GKPPDWQDFVGI+CLLVINSTISFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEENNAGN  124

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQS
Sbjct  125   AAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQS  184

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVT++PGDEV+SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  185   ALTGESLPVTRNPGDEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVDK+ V+
Sbjct  305   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDKEHVM  364

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDAA+VG LADPKEARAG+RE+HFLPFNPVDKRTALTYID  GNWH
Sbjct  365   LLAARASRVENQDAIDAAIVGTLADPKEARAGVREIHFLPFNPVDKRTALTYIDGNGNWH  424

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQI++LC  RED KR +H++IDK+AERGLRSLAVARQEVPEKTKESPG+PWQF
Sbjct  425   RASKGAPEQIMDLCKLREDTKRNIHAIIDKFAERGLRSLAVARQEVPEKTKESPGAPWQF  484

Query  1795  V  1797
             V
Sbjct  485   V  485



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/480 (92%), Positives = 467/480 (97%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             SITLE+IKNETVDLE+IP+EEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK+LK
Sbjct  6     SITLEEIKNETVDLERIPVEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKILK  65

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLL+INSTISFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLLINSTISFIEENNAGNA  125

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGL PKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQSA
Sbjct  126   AAALMAGLTPKTKVLRDGQWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPV K+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL
Sbjct  186   LTGESLPVNKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             TAIGNFCICSIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVFAKGVDK+ VLL
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGVDKEHVLL  365

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
              AARASRTENQDAIDAA+VG LADPKEARAGIREVHF PFNPVDKRTALTYID+ GNWHR
Sbjct  366   LAARASRTENQDAIDAAVVGTLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHR  425

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQI+ LCN R+D K+K+H++IDK+AERGLRSLAVARQEVPEK+K+S G PWQFV
Sbjct  426   ASKGAPEQIMTLCNLRDDAKKKIHAIIDKFAERGLRSLAVARQEVPEKSKDSAGGPWQFV  485



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/481 (90%), Positives = 468/481 (97%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             KSI+LEQIKNETVDLE+IP+EEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKK+SK+L
Sbjct  5     KSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKDSKIL  64

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAA+MAI LANG+GKPPDWQDFVGI+CLLVINSTISFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEENNAGN  124

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQS
Sbjct  125   AAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQS  184

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVT++PGDEV+SGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  185   ALTGESLPVTRNPGDEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVDK+ V+
Sbjct  305   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDKEHVM  364

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDAA+VG LADPKEARAG+RE+HFLPFNPVDKRTALTYID  GNWH
Sbjct  365   LLAARASRVENQDAIDAAIVGTLADPKEARAGVREIHFLPFNPVDKRTALTYIDGNGNWH  424

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQI++LC  RED KR +H++IDK+AERGLRSLAVARQEVPEKTKESPG+PWQF
Sbjct  425   RASKGAPEQIMDLCKLREDTKRNIHAIIDKFAERGLRSLAVARQEVPEKTKESPGAPWQF  484

Query  1795  V  1797
             V
Sbjct  485   V  485



>gb|KDO67286.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=675

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/483 (89%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRWSEQ+A+ILVPGD++SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++AE+I+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN RED+++KVH+VIDK+AERGLRSL VARQE+PEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPW  482

Query  1789  QFV  1797
             Q V
Sbjct  483   QLV  485



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/481 (93%), Positives = 465/481 (97%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I+LE+IKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESK+L
Sbjct  3     KAISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKIL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+S+KLGDI+PADARLLEGDPLK+DQS
Sbjct  123   AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK+PGDEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKV
Sbjct  183   ALTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDK L+EVF KGVDK+ VL
Sbjct  303   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLVEVFVKGVDKEYVL  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L  ARASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWH
Sbjct  363   LLPARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL+LCN +ED++RKVHS+IDKYAE GLRSLAVARQEVPEK+KES G PWQF
Sbjct  423   RASKGAPEQILDLCNCKEDVRRKVHSMIDKYAEAGLRSLAVARQEVPEKSKESAGGPWQF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/484 (92%), Positives = 469/484 (97%), Gaps = 1/484 (0%)
 Frame = +1

Query  349   GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             GDK +ITLE+IKNETVDLE+IPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3     GDKGTITLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLL+INSTISFIEENN
Sbjct  63    KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENN  122

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPL V
Sbjct  123   AGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMV  182

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQ+ALTGESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  183   DQAALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  242

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243   QKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNL+EVFAKGVDKD
Sbjct  303   MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKD  362

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARA+RTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA G
Sbjct  363   HVILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANG  422

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHR SKGAPEQI+ LCN R+D K+KVH++IDK+AERGLRSLAVARQEVPEKTKES G+P
Sbjct  423   NWHRASKGAPEQIMALCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAP  482

Query  1786  WQFV  1797
             WQFV
Sbjct  483   WQFV  486



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/478 (94%), Positives = 464/478 (97%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGL+S EG  RLQIFGPNKLEEKKESK+LKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLSSREGEERLQIFGPNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ VLTA
Sbjct  183   GESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQMVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIAVGM+ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVS
Sbjct  363   ARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL+L  AR+DL++KVH+VIDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  423   KGAPEQILDLSKARDDLRKKVHAVIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/483 (91%), Positives = 472/483 (98%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNETVDLE+IP++EVFEQLKC+REGL+S EGANRLQIFGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNETVDLERIPVDEVFEQLKCTREGLSSAEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AA+MAIALANG GKPPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSE++AAILVPGDI+SIKLGDI+PADARLL+GDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEEDAAILVPGDIISIKLGDIVPADARLLDGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGM+ E+IVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDK+ 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEY  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA G+
Sbjct  363   VVLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGS  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHRVSKGAPEQI+ LCN +ED+++KVH++IDK+AERGLRSLAVARQEVPE+ KESPG+PW
Sbjct  423   WHRVSKGAPEQIVTLCNCKEDVRKKVHAIIDKFAERGLRSLAVARQEVPERHKESPGAPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/483 (92%), Positives = 468/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+L++IKNETVDLE+IPIEEVFEQLKC+REGL+  EGANRLQIFGPNKLEEKKESK
Sbjct  3     GDKAISLDEIKNETVDLERIPIEEVFEQLKCTREGLSLTEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEMAAIMAIALANGSGKPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW E++AAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWMEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGM+ E++VMY IQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMMVEIVVMYAIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDK+ 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GN
Sbjct  363   VVLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHRVSKGAPEQIL LCN +ED++ KVHSVIDK+AERGLRSLAVARQEVPEK+KESPG PW
Sbjct  423   WHRVSKGAPEQILSLCNCKEDVRNKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGRPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 467/481 (97%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGA+RLQIFGPNKLEEK ESK+L
Sbjct  3     KAISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGASRLQIFGPNKLEEKNESKIL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAA+MAIALANGDGKPPDWQDF+GI+CLLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFIGIICLLVINSTISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+S+KLGDIIPADARLLEGDPLK+DQS
Sbjct  123   AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK+PGDEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKV
Sbjct  183   ALTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIA+GML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NL+EVFAKGVDK+ VL
Sbjct  303   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEYVL  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID   NWH
Sbjct  363   LLAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNNNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL+LCNA+ED++RKVHS++DKYAERGLRSLAVAR+ VPEK+KESPG  W+F
Sbjct  423   RASKGAPEQILDLCNAKEDVRRKVHSMMDKYAERGLRSLAVARRTVPEKSKESPGGRWEF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>ref|XP_006845683.1| PREDICTED: plasma membrane ATPase 4 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/479 (91%), Positives = 461/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LEQIKNE VDLE IPIEEVFEQLKCS+EGLTSDEGANRLQIFGPNKLEEKKESK+LKF
Sbjct  3     ISLEQIKNEAVDLEHIPIEEVFEQLKCSKEGLTSDEGANRLQIFGPNKLEEKKESKILKF  62

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVME AA+MAI LANG GKPPDWQDFVGIV LLVINSTISFIEENNAGNAA
Sbjct  63    LGFMWNPLSWVMEMAALMAIVLANGQGKPPDWQDFVGIVALLVINSTISFIEENNAGNAA  122

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSAL
Sbjct  123   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  182

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  183   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  242

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+GM+ E+IVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  243   AIGNFCICSIAIGMIVEIIVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  302

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDK LIEVF KGVDK+ V+L 
Sbjct  303   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLIEVFIKGVDKEHVILL  362

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAID A+VGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  363   AARASRTENQDAIDTAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSNGNWHRA  422

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED++ KVHSVIDK+AERGLRSLAVARQEVPE+TKESPG+PWQFV
Sbjct  423   SKGAPEQILSLCNCKEDVRNKVHSVIDKFAERGLRSLAVARQEVPEQTKESPGAPWQFV  481



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/484 (91%), Positives = 469/484 (97%), Gaps = 1/484 (0%)
 Frame = +1

Query  349   GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             GDK +ITLE+IKNETVDLE+IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3     GDKGTITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLL+INSTISFIEENN
Sbjct  63    KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENN  122

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPL V
Sbjct  123   AGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMV  182

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQ+ALTGESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  183   DQAALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  242

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIA+GMLAE+IVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243   QKVLTAIGNFCICSIAIGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNL+EVFAKGVDKD
Sbjct  303   MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKD  362

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARA+RTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA G
Sbjct  363   HVILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANG  422

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHR SKGAPEQI+ LCN R+D K+KVH++IDK+AERGLRSLAVARQEVPEKTKES G+P
Sbjct  423   NWHRASKGAPEQIMSLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAP  482

Query  1786  WQFV  1797
             WQFV
Sbjct  483   WQFV  486



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/484 (91%), Positives = 469/484 (97%), Gaps = 1/484 (0%)
 Frame = +1

Query  349   GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             GDK +ITLE+I+NETVDLE+IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3     GDKGTITLEEIRNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLL+INSTISFIEENN
Sbjct  63    KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENN  122

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPL V
Sbjct  123   AGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMV  182

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQ+ALTGESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  183   DQAALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  242

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243   QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNL+EVFAKGVDKD
Sbjct  303   MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKD  362

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARA+RTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA G
Sbjct  363   HVILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDASG  422

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHR SKGAPEQI+ LCN R+D K+KVH++IDK+AERGLRSLAV+RQEVPEK+KES G+P
Sbjct  423   NWHRASKGAPEQIMSLCNLRDDAKKKVHAIIDKFAERGLRSLAVSRQEVPEKSKESAGAP  482

Query  1786  WQFV  1797
             WQFV
Sbjct  483   WQFV  486



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/484 (91%), Positives = 469/484 (97%), Gaps = 1/484 (0%)
 Frame = +1

Query  349   GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             GDK +ITLE+IKNETVDLE+IPI+EVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKES
Sbjct  3     GDKGTITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKES  62

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K LKFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLL+INSTISFIEENN
Sbjct  63    KFLKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENN  122

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPL V
Sbjct  123   AGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMV  182

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQ+ALTGESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  183   DQAALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  242

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIA+GMLAE+IVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243   QKVLTAIGNFCICSIAIGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNL+EVFAKGVDKD
Sbjct  303   MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKD  362

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARA+RTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA G
Sbjct  363   HVILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANG  422

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHR SKGAPEQI+ LCN R+D K+KVH++IDK+AERGLRSLAVARQEVPEKTKES G+P
Sbjct  423   NWHRASKGAPEQIMALCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAP  482

Query  1786  WQFV  1797
             WQFV
Sbjct  483   WQFV  486



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/478 (92%), Positives = 461/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNE VDLEKIP+EEVF+QLKC+REGLT++EG NRLQIFGPNKLEEKKESK+LKFL
Sbjct  4     SLENIKNEAVDLEKIPVEEVFQQLKCTREGLTTEEGENRLQIFGPNKLEEKKESKILKFL  63

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEA AIMAIALANG G+PPDWQDF+GIVCLLVINSTISFIEENNAGNAAA
Sbjct  64    GFMWNPLSWVMEAPAIMAIALANGGGRPPDWQDFLGIVCLLVINSTISFIEENNAGNAAA  123

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+W EQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  124   ALMAGLAPKTKVLRDGKWGEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  183

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVT+ PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTA
Sbjct  184   GESLPVTRGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTA  243

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  244   IGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  303

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD+V+L A
Sbjct  304   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDEVILLA  363

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             AR+SRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GNWHR S
Sbjct  364   ARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRAS  423

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL+LCNAR DL+ KVHSVIDKYA+RGLRSL VARQ VPEKTKESPG PWQFV
Sbjct  424   KGAPEQILDLCNARHDLRSKVHSVIDKYADRGLRSLGVARQVVPEKTKESPGGPWQFV  481



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/482 (90%), Positives = 469/482 (97%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             +K+ +LE+IKNETVDLE+IP+EEVFEQLKC++EGL+S+EGA+R+QIFGPNKLEEKKESK 
Sbjct  2     EKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKF  61

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLLVINSTISFIEENNAG
Sbjct  62    LKFLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNAG  121

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+W+E++AAILVPGDI+S+KLGDIIPADARLLEGDPLK+DQ
Sbjct  122   NAAAALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQ  181

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  182   SALTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  241

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVGM+ EL+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  242   VLTAIGNFCICSIAVGMVIELVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  301

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD V
Sbjct  302   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHV  361

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GNW
Sbjct  362   VLLAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNW  421

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL+LCNARED+K+K HS +DK+AERGLRSLAVARQ+VPEK+KESPG PW+
Sbjct  422   HRASKGAPEQILDLCNAREDVKKKTHSCMDKFAERGLRSLAVARQQVPEKSKESPGGPWE  481

Query  1792  FV  1797
             FV
Sbjct  482   FV  483



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/482 (91%), Positives = 465/482 (96%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             DK+I+LE+IKNETVDLE+IPIEEVFEQLKCSREGL+ +EGA RL+IFGPNKLEEKKESK 
Sbjct  5     DKAISLEEIKNETVDLERIPIEEVFEQLKCSREGLSGEEGAQRLEIFGPNKLEEKKESKF  64

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG  124

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+WSE++AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  185   SALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVGML E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGV+K+ V
Sbjct  305   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKEHV  364

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AAR+SRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNW
Sbjct  365   VLLAARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDGNW  424

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN +ED K+K  ++IDKYAERGLRSLAVARQEVP K+KES G PWQ
Sbjct  425   HRASKGAPEQILTLCNCKEDFKKKAFAIIDKYAERGLRSLAVARQEVPAKSKESAGGPWQ  484

Query  1792  FV  1797
             FV
Sbjct  485   FV  486



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/483 (91%), Positives = 466/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G  +I+LE+IKNETVDLE IPIEEVF+QLKC+REGLTSDEGA+RLQ+FGPNKLEEKKESK
Sbjct  3     GGTAISLEEIKNETVDLENIPIEEVFQQLKCTREGLTSDEGAHRLQLFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVME+AAIMAIALANG GKPPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW E+EAAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGM+ E+IVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMIVEIIVMYPIQHRKYRNGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGI EVHFLPFNPVDKRTALTY DA GN
Sbjct  363   VVLLAARASRTENQDAIDAAMVGMLADPKEARAGITEVHFLPFNPVDKRTALTYFDANGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED++++VH+VIDK+AERGLRSL VARQEVPEKTK+SPG+PW
Sbjct  423   WHRASKGAPEQILSLCNCKEDVRKRVHTVIDKFAERGLRSLGVARQEVPEKTKDSPGAPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/483 (91%), Positives = 468/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK I+L++IKNETVDLE++PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3     GDKPISLDEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVME AAIMAIALANGDG+PPDW+DFVGIV LL INSTISFIEENNA
Sbjct  63    LLKFLGFMWNPLSWVMEMAAIMAIALANGDGRPPDWEDFVGIVALLFINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRW+E+EAAILVPGDI+SIKLGDIIPADARLL+GDPLKVD
Sbjct  123   GNAAAALMASLAPKTKVLRDGRWTEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKVD  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDE+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++ E+IVM+PIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIIVEIIVMFPIQDRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIE+F KGVD+D 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEIFTKGVDRDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GN
Sbjct  363   VVLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHRVSKGAPEQI+ LCN RED+++KVH+VIDK+AERGLRSLAVARQEVPE+TKES G PW
Sbjct  423   WHRVSKGAPEQIMSLCNCREDVRKKVHNVIDKFAERGLRSLAVARQEVPERTKESAGGPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>gb|KDO67285.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=847

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/483 (89%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRWSEQ+A+ILVPGD++SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++AE+I+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN RED+++KVH+VIDK+AERGLRSL VARQE+PEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPW  482

Query  1789  QFV  1797
             Q V
Sbjct  483   QLV  485



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/478 (92%), Positives = 462/478 (97%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNE VDLEKIP+EEVF+QLKC+REGLT++EG NRLQIFGPNKLEEKKESK+LKFL
Sbjct  4     SLENIKNEAVDLEKIPVEEVFQQLKCTREGLTTEEGENRLQIFGPNKLEEKKESKILKFL  63

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANG G+PPDWQDF+GIVCLLVINSTISFIEENNAGNAAA
Sbjct  64    GFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFLGIVCLLVINSTISFIEENNAGNAAA  123

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+W EQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  124   ALMAGLAPKTKVLRDGKWGEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  183

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVT+ PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTA
Sbjct  184   GESLPVTRGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTA  243

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  244   IGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  303

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD+V+L A
Sbjct  304   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDEVILLA  363

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             AR+SRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GNWHR S
Sbjct  364   ARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRAS  423

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL+LCNAR DL+ KVHSVIDKYA+RGLRSL VARQ VPEKTKESPG PWQFV
Sbjct  424   KGAPEQILDLCNARHDLRSKVHSVIDKYADRGLRSLGVARQVVPEKTKESPGGPWQFV  481



>ref|XP_012076337.1| PREDICTED: plasma membrane ATPase 4 [Jatropha curcas]
 gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/479 (92%), Positives = 467/479 (97%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGL+S+EGANRLQ+FGPNKLEEKKESK+LKF
Sbjct  7     ISLEEIKNESVDLERIPIEEVFEQLKCTREGLSSEEGANRLQVFGPNKLEEKKESKILKF  66

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGIV LL INSTISFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVALLFINSTISFIEENNAGNAA  126

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRW+EQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG++ ELIVMYPIQ+RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGIIVELIVMYPIQNRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++LIEVFAKGVDK+ V+L 
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFAKGVDKEYVILL  366

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHF PFNPVDKRTALTYID+ GNWHR 
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHRA  426

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+KRKVHSVIDK+AERGLRSLAVARQEVPEKTKESPG PWQFV
Sbjct  427   SKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFV  485



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/483 (91%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    LLKFLGFMWNPLSWVMEAAAVMAIALANGGGRPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQEA+ILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQEASILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+L ELIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGILIELIVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEAR GIREVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VMLLAARASRTENQDAIDAAIVGMLADPKEARVGIREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED K++VH+VIDK+AERGLRSLAVARQ+VPEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESPGTPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/482 (91%), Positives = 464/482 (96%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             DK+I+LE+IKNETVDLE+IPIEEVFEQLKCSREGL  +EGA RL+IFGPNKLEEKKESK 
Sbjct  5     DKAISLEEIKNETVDLERIPIEEVFEQLKCSREGLNGEEGAQRLEIFGPNKLEEKKESKF  64

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG  124

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+WSE++AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  185   SALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVGML E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGV+K+ V
Sbjct  305   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKEHV  364

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AAR+SRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNW
Sbjct  365   VLLAARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDGNW  424

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN +ED K+K  ++IDKYAERGLRSLAVARQEVP K+KES G PWQ
Sbjct  425   HRASKGAPEQILTLCNCKEDFKKKAFAIIDKYAERGLRSLAVARQEVPAKSKESAGGPWQ  484

Query  1792  FV  1797
             FV
Sbjct  485   FV  486



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/482 (91%), Positives = 463/482 (96%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             +KSITLE+IKNETVDLE IP+EEVFEQLKC++EGL+ +EGANRLQIFGPNKLEEKKESKL
Sbjct  4     NKSITLEEIKNETVDLEHIPVEEVFEQLKCTKEGLSLEEGANRLQIFGPNKLEEKKESKL  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAI LANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIGLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAP+TKVLRDG+WSEQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQ
Sbjct  124   NAAAALMAGLAPETKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVT+SPG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTRSPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAM TVLSVT A
Sbjct  244   VLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMSTVLSVTTA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVDK+ V
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDKEHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASR ENQDAIDAA+VG LADPKEARAG+REVHFLPFNPVDKRTALTYID+ GNW
Sbjct  364   MLLAARASRIENQDAIDAAIVGTLADPKEARAGVREVHFLPFNPVDKRTALTYIDSNGNW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQI+ LCN RED KR +H++IDK+AERGLRSLAV+RQEVPEKTKES G PWQ
Sbjct  424   HRASKGAPEQIMNLCNLREDAKRNIHAIIDKFAERGLRSLAVSRQEVPEKTKESAGGPWQ  483

Query  1792  FV  1797
             FV
Sbjct  484   FV  485



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/482 (91%), Positives = 465/482 (96%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             D ++TLE+IKNETVDLEKIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+
Sbjct  4     DTALTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKI  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGIVCLLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAAIMAIALANGGGRGPDWQDFVGIVCLLVINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+W EQ+A+ILVPGD++S+KLGDIIPADARLLEGDPLKVDQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIA+GML E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAIGMLIEILVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVDK+ V
Sbjct  304   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASRTENQDAIDAAMVGMLADPKEARAGIRE+HF PFNPVDKRTALTYID+ GNW
Sbjct  364   ILLAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN +ED KRKV SVIDK+AERGLRSLAVARQEVPEKTKESPG+PWQ
Sbjct  424   HRASKGAPEQILTLCNCKEDFKRKVFSVIDKFAERGLRSLAVARQEVPEKTKESPGAPWQ  483

Query  1792  FV  1797
             FV
Sbjct  484   FV  485



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/483 (91%), Positives = 466/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNETVDLEK+PIEEVFEQLKC+REGL++DEG +RLQIFGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNETVDLEKVPIEEVFEQLKCTREGLSADEGESRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+  DEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNSYDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGMLAE+IVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLAEIIVMYPIQHREYRKGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF KGV+ D 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKGVEPDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             VLL AARASR ENQDAIDAA+VG LADPKEARAG++E+HF PFNPVDKRTALTYID+ GN
Sbjct  363   VLLLAARASRVENQDAIDAAIVGTLADPKEARAGVKEIHFFPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN REDLK+KVHSVIDK+AERGLRSLAVARQEVPEK+KESPGSPW
Sbjct  423   WHRASKGAPEQILTLCNCREDLKKKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGSPW  482

Query  1789  QFV  1797
             QF+
Sbjct  483   QFI  485



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/482 (90%), Positives = 467/482 (97%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             +K+ +LE+IKNETVDLE+IP+EEVFEQLKC++EGL+S+EGA+R+QIFGPNKLEEKKESK+
Sbjct  2     EKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKI  61

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLLVINSTISFIEENNAG
Sbjct  62    LKFLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNAG  121

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+W+E++AAILVPGDI+S+KLGDIIPADARLLEGDPLK+DQ
Sbjct  122   NAAAALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQ  181

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVT+ PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ 
Sbjct  182   SALTGESLPVTRHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQM  241

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVGM+ EL+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  242   VLTAIGNFCICSIAVGMVIELVVMYPIQHRGYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  301

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD V
Sbjct  302   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHV  361

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GNW
Sbjct  362   ILLAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNW  421

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQILELCNARED+K+K HS +DK+AERGLRSLAVARQ+VPEK+KESPG PW 
Sbjct  422   HRASKGAPEQILELCNAREDVKKKAHSCMDKFAERGLRSLAVARQQVPEKSKESPGGPWX  481

Query  1792  FV  1797
             FV
Sbjct  482   FV  483



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/478 (92%), Positives = 463/478 (97%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE I+NETVDLEKIP+EEVF+QLKC++EGLT+ EG NRLQIFGPNKLEEKKESK LKFL
Sbjct  11    SLEDIRNETVDLEKIPVEEVFQQLKCTKEGLTTAEGENRLQIFGPNKLEEKKESKFLKFL  70

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGIVCLLVINSTISFIEENNAGNAAA
Sbjct  71    GFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIVCLLVINSTISFIEENNAGNAAA  130

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  131   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  190

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  191   GESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  250

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIAVGM+ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  251   IGNFCICSIAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  310

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGV+KD+V+L A
Sbjct  311   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKDEVILLA  370

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASRTENQDAIDAAMVGMLADPKEARAGIREVHF PFNPVDKRTALTYIDA  NWHRVS
Sbjct  371   ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDADVNWHRVS  430

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL+LCNAR+D++ +VHSVIDK+AERGLRSLAVARQ VPEKTKES G PW+FV
Sbjct  431   KGAPEQILDLCNARQDIRNRVHSVIDKFAERGLRSLAVARQVVPEKTKESSGGPWEFV  488



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/483 (89%), Positives = 468/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK I+L++IKNE+VDLE+IPIEEVFEQLKC+R GLT++EGANRLQ+FGPNKLEEKKESK
Sbjct  3     GDKGISLDEIKNESVDLERIPIEEVFEQLKCTRAGLTTEEGANRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+ LL INSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIVLLFINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRWSEQEAAILVPGDI++IKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMANLAPKTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++ E+IVMYPIQHRKYR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIVVEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+Q
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEQ  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L+AARASRTENQDAID A+VGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID+ GN
Sbjct  363   VILYAARASRTENQDAIDTAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI+ LCN +ED+K+KVH+VIDK+AERGLRSL VARQEVPEKTKE+PG+PW
Sbjct  423   WHRASKGAPEQIITLCNCKEDVKKKVHAVIDKFAERGLRSLGVARQEVPEKTKEAPGAPW  482

Query  1789  QFV  1797
             QF+
Sbjct  483   QFI  485



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/483 (90%), Positives = 467/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    LLKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+L E+IVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED K+KVH VIDK+AERGLRSL VARQ+VPEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/483 (90%), Positives = 467/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    LLKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+L E+IVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED K+KVH VIDK+AERGLRSL VARQ+VPEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/482 (90%), Positives = 468/482 (97%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             DK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT+DEGANRLQ+FGPNKLEEKKESKL
Sbjct  4     DKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKL  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+DQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIA+G+L E+IVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ V
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASRTENQDAIDAA+VGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID+ GNW
Sbjct  364   MLLAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN +ED K++VH+VIDK+AERGLRSLAVARQ+VPEKTKES G+PWQ
Sbjct  424   HRASKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGAPWQ  483

Query  1792  FV  1797
             FV
Sbjct  484   FV  485



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/482 (90%), Positives = 462/482 (96%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             DK I+LEQIKNETVDLEKIPIEEVFEQLKC+  GLT+ EG +RLQIFGPNKLEEKKESK 
Sbjct  4     DKGISLEQIKNETVDLEKIPIEEVFEQLKCTPNGLTTQEGESRLQIFGPNKLEEKKESKF  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAI LANG+GKPPDWQDFVGIVCLLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIVLANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+WSEQEAA+LVPGDI+SIKLGDIIPADARLLEGDPLK+DQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGKWSEQEAAMLVPGDIISIKLGDIIPADARLLEGDPLKIDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+P DEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQK
Sbjct  184   SALTGESLPVTKNPSDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVGML E+IVMYPIQHRKYRDGI+NLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+K+ V
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKEHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASRTENQDAIDAA+VGML DPKEARA IREVHF PFNPVDKRTALTY+D  GNW
Sbjct  364   ILLAARASRTENQDAIDAAIVGMLGDPKEARADIREVHFFPFNPVDKRTALTYVDPAGNW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCNAR+DL++KV+++IDK+AERGLRSLAVARQEVPEKTKESPG PWQ
Sbjct  424   HRASKGAPEQILNLCNARDDLRKKVYAIIDKFAERGLRSLAVARQEVPEKTKESPGGPWQ  483

Query  1792  FV  1797
             FV
Sbjct  484   FV  485



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/478 (92%), Positives = 462/478 (97%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGLTS EG +R+QIFGPNKLEEKKESK+LKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTSQEGEDRIQIFGPNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+S+KLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ VLTA
Sbjct  183   GESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQMVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIAVGML E++VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAVGMLIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDK LIEVFAKGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKALIEVFAKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASR ENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID+ GNWHRVS
Sbjct  363   ARASRVENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL+L  AR+DL+++VH++IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  423   KGAPEQILDLSKARDDLRKRVHAIIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>gb|KDO67283.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
 gb|KDO67284.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=883

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/483 (89%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRWSEQ+A+ILVPGD++SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++AE+I+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN RED+++KVH+VIDK+AERGLRSL VARQE+PEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPW  482

Query  1789  QFV  1797
             Q V
Sbjct  483   QLV  485



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/477 (91%), Positives = 458/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IP+EEVFEQLKC+REGL+S+EG  RLQ+FGPNKLEEKKESK+LKFLG
Sbjct  4     LEEIKNEAVDLENIPMEEVFEQLKCTREGLSSEEGTQRLQVFGPNKLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDI+SIKLGDI+PADARLLEGDPLKVDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ E+IVM+PIQHRKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR SK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQI+ LCN RED+KRKVHS+IDKYAERGLRSLAVARQEVPEKTKESPG PWQFV
Sbjct  424   GAPEQIITLCNCREDMKRKVHSIIDKYAERGLRSLAVARQEVPEKTKESPGGPWQFV  480



>gb|KDO67282.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=923

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/483 (89%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRWSEQ+A+ILVPGD++SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++AE+I+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN RED+++KVH+VIDK+AERGLRSL VARQE+PEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPW  482

Query  1789  QFV  1797
             Q V
Sbjct  483   QLV  485



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/483 (89%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRWSEQ+A+ILVPGD++SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++AE+I+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN RED+++KVH+VIDK+AERGLRSL VARQE+PEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPW  482

Query  1789  QFV  1797
             Q V
Sbjct  483   QLV  485



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/483 (89%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RL +FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANG G+ PDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRWSEQ+A+ILVPGD++SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++AE+I+MYP+QHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN RED+++KVH+VIDK+AERGLRSL VARQE+PEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPW  482

Query  1789  QFV  1797
             Q V
Sbjct  483   QLV  485



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/482 (89%), Positives = 467/482 (97%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             +K+I+LE+IKNETVDLEKIP+EEVFEQLKC+REGL+SDEGA+RLQ+FGPNKLEEKKESK+
Sbjct  4     NKAISLEEIKNETVDLEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKI  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGI+ LL+INSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIIVLLLINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDGRWSEQ+AA+LVPGDI+SIKLGDI+PADARLLEGDPLK+DQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGRWSEQDAAMLVPGDIISIKLGDIVPADARLLEGDPLKIDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIA+G+  ELIVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAIGIAVELIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+K+ V
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRTLIEVFAKGVEKEHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ G W
Sbjct  364   ILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN +ED++RK H+VIDK+AERGLRSL VARQE+PE+TK+SPG+PWQ
Sbjct  424   HRASKGAPEQILNLCNCKEDVRRKAHAVIDKFAERGLRSLGVARQEIPERTKDSPGAPWQ  483

Query  1792  FV  1797
             FV
Sbjct  484   FV  485



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/482 (90%), Positives = 467/482 (97%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             DK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT+DEGANRLQ+FGPNKLEEKKESKL
Sbjct  4     DKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKL  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+DQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIA+G+L E+IVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VD+NLIEVFAKGV+K+ V
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLXVDRNLIEVFAKGVEKEHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASRTENQDAIDAA+VGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID+ GNW
Sbjct  364   MLLAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN +ED K++VH+VIDK+AERGLRSLAVARQ+VPEKTKES G+PWQ
Sbjct  424   HRASKGAPEQILTLCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGTPWQ  483

Query  1792  FV  1797
             FV
Sbjct  484   FV  485



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/483 (90%), Positives = 467/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
              DKSI LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA+RLQIFGPNKLEEKKESK
Sbjct  3     ADKSIGLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGASRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL+INSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEAAAIMAIALANGGGQPPDWQDFVGIIVLLLINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEI+AVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGM+ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVF KGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFTKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASR ENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA G 
Sbjct  363   VILLAARASRIENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGT  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED+++KVH VIDK+AERGLRSLAVARQEVPEKTK++PG+PW
Sbjct  423   WHRASKGAPEQILNLCNCKEDVRKKVHGVIDKFAERGLRSLAVARQEVPEKTKDAPGAPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/478 (92%), Positives = 460/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNE VDLEKIPIEEVF+QLKCSREGLT+ EG +RLQIFGPNKLEEKKESK LKFL
Sbjct  3     SLEDIKNENVDLEKIPIEEVFQQLKCSREGLTTREGEDRLQIFGPNKLEEKKESKFLKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLG IIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGVIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTA
Sbjct  183   GESLPVTKYPGNEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIAVGM+ E+IVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAVGMVIEIIVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGV+KDQV+LFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKDQVILFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASR ENQDAIDAAMVGMLADPKEARAGIREVHF PFNPVDKRTALTYID  G WHRVS
Sbjct  363   ARASRVENQDAIDAAMVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDGDGKWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQI++LC AR+DLKRKVH++IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  423   KGAPEQIIDLCGARDDLKRKVHAIIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/481 (91%), Positives = 463/481 (96%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K I+LE+I+NETVDLEKIPIEEVFEQLKC++EGL+S+EGANRLQIFGPNKLEEKKESK+L
Sbjct  5     KGISLEEIRNETVDLEKIPIEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESKIL  64

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGIVCLLVINSTISFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGN  124

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+S+KLGDIIPADARLLEGDPLKVDQS
Sbjct  125   AAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQS  184

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  185   ALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVF K  DKD VL
Sbjct  305   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKDGDKDHVL  364

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDAA+VG LADP+EARA I EVHFLPFNPVDKRTA+TYID+ GNWH
Sbjct  365   LLAARASRVENQDAIDAAIVGTLADPREARASITEVHFLPFNPVDKRTAITYIDSNGNWH  424

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL LCNA+ED K+KVHS+IDK+AERGLRSLAV+RQ+VPEK+KES G+PWQF
Sbjct  425   RASKGAPEQILALCNAKEDFKKKVHSIIDKFAERGLRSLAVSRQQVPEKSKESAGAPWQF  484

Query  1795  V  1797
             V
Sbjct  485   V  485



>gb|KJB55190.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=954

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/482 (89%), Positives = 468/482 (97%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             D+ I+LE+IKNE+VDLE+IPIEEVFEQLKC+R GLTS+EGANRLQ+FGPNKLEEKKESK 
Sbjct  4     DRGISLEEIKNESVDLERIPIEEVFEQLKCTRGGLTSEEGANRLQVFGPNKLEEKKESKF  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGI+ LL+INSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIIALLLINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMA LAPKTKVLRDGRWSEQ+AAILVPGDI++IKLGDI+PADARLLEGDPLK+DQ
Sbjct  124   NAAAALMANLAPKTKVLRDGRWSEQDAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGIIIEMIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ V
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L+AARASRTENQDAIDAA+VGMLADPKEARAGIRE+HFLPFNPVDKRTALTYIDA GNW
Sbjct  364   ILYAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDAAGNW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQI+ LCN +ED+K+KVH+VIDK+AERGLRSLAVARQEVPEK+K+ PG+PWQ
Sbjct  424   HRASKGAPEQIITLCNCKEDVKKKVHAVIDKFAERGLRSLAVARQEVPEKSKDGPGAPWQ  483

Query  1792  FV  1797
              +
Sbjct  484   LI  485



>pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump
 pdb|3B8C|B Chain B, Crystal Structure Of A Plasma Membrane Proton Pump
Length=885

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/478 (92%), Positives = 458/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWHRVS
Sbjct  363   AMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL +KV S+IDKYAERGLRSLAVARQ VPEKTKESPG+PW+FV
Sbjct  423   KGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV  480



>gb|KJB82762.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=758

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/483 (89%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+K I+L++IKNE+VDLE+IPIEEVFEQLKC+REGL++ EG NRLQ+FGPNKLEEKKESK
Sbjct  3     GNKGISLDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRWSEQEAAILVPGDI++IKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMANLAPKTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             +VLTAIGNFCICSIAVG++ ELIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   QVLTAIGNFCICSIAVGIVIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+Q
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEQ  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             VLL+AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ G 
Sbjct  363   VLLYAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGK  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI+ LCN + D++ KVH+VIDK+AERGLRSLAVARQEVPEKTKESPG+PW
Sbjct  423   WHRASKGAPEQIITLCNCKADVRNKVHAVIDKFAERGLRSLAVARQEVPEKTKESPGAPW  482

Query  1789  QFV  1797
             Q V
Sbjct  483   QLV  485



>gb|EYU20899.1| hypothetical protein MIMGU_mgv1a000880mg [Erythranthe guttata]
Length=952

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/482 (91%), Positives = 464/482 (96%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             DK+++LE IKNETVDLEK+PIEEVFEQLKC+REGL+SDEGANRL++FGPNKLEEKKESK+
Sbjct  2     DKALSLEGIKNETVDLEKVPIEEVFEQLKCNREGLSSDEGANRLELFGPNKLEEKKESKV  61

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNAG
Sbjct  62    LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAG  121

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQ
Sbjct  122   NAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQ  181

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  182   SALTGESLPVTKHPYNEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  241

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVGMLAE+IVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  242   VLTAIGNFCICSIAVGMLAEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMA  301

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDK+LIEVFA GVD + V
Sbjct  302   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFASGVDSEHV  361

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             LL AARASR ENQDAID A+VG L+DPKEARAG+REVHFLPFNPVDKRTALTY+D+ G W
Sbjct  362   LLLAARASRVENQDAIDGAIVGTLSDPKEARAGLREVHFLPFNPVDKRTALTYVDSDGKW  421

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN +EDLK+KVH+VIDK+AERGLRSLAVARQEVPEK+KESPGSPWQ
Sbjct  422   HRASKGAPEQILTLCNCKEDLKKKVHAVIDKFAERGLRSLAVARQEVPEKSKESPGSPWQ  481

Query  1792  FV  1797
             FV
Sbjct  482   FV  483



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/483 (90%), Positives = 467/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGLT +EGANRLQ+FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    LLKFLGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+L E+IVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED K+KVH VIDK+AERGLRSL VARQ+VPEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/479 (92%), Positives = 464/479 (97%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             ++LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRLQIFGPNKLEEKKESKLLKF
Sbjct  3     LSLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKLLKF  62

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGI+CLLVINSTISFIEENNAGNAA
Sbjct  63    LGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIICLLVINSTISFIEENNAGNAA  122

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSAL
Sbjct  123   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  182

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVT++P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  183   TGESLPVTRNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  242

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVGML EL+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  243   AIGNFCICSIAVGMLVELVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  302

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKG DK+ VLL 
Sbjct  303   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGFDKEHVLLC  362

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VG LADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  363   AARASRTENQDAIDAAIVGTLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRT  422

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +EDLK+KVH++IDK+AERGLRSL VA Q VPEK+K+S G PWQFV
Sbjct  423   SKGAPEQILTLCNCKEDLKKKVHAMIDKFAERGLRSLGVASQVVPEKSKDSAGGPWQFV  481



>gb|KJB55189.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=956

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/482 (89%), Positives = 468/482 (97%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             D+ I+LE+IKNE+VDLE+IPIEEVFEQLKC+R GLTS+EGANRLQ+FGPNKLEEKKESK 
Sbjct  4     DRGISLEEIKNESVDLERIPIEEVFEQLKCTRGGLTSEEGANRLQVFGPNKLEEKKESKF  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGI+ LL+INSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIIALLLINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMA LAPKTKVLRDGRWSEQ+AAILVPGDI++IKLGDI+PADARLLEGDPLK+DQ
Sbjct  124   NAAAALMANLAPKTKVLRDGRWSEQDAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGIIIEMIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ V
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L+AARASRTENQDAIDAA+VGMLADPKEARAGIRE+HFLPFNPVDKRTALTYIDA GNW
Sbjct  364   ILYAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDAAGNW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQI+ LCN +ED+K+KVH+VIDK+AERGLRSLAVARQEVPEK+K+ PG+PWQ
Sbjct  424   HRASKGAPEQIITLCNCKEDVKKKVHAVIDKFAERGLRSLAVARQEVPEKSKDGPGAPWQ  483

Query  1792  FV  1797
              +
Sbjct  484   LI  485



>ref|XP_010111939.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXC32057.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=928

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/483 (90%), Positives = 471/483 (98%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK ITLE+IKNE+VDLE+IP+EEVFEQLKC+R+GLTS+EGANRLQ+FGPNKLEEKKESK
Sbjct  3     GDKGITLEEIKNESVDLERIPMEEVFEQLKCTRQGLTSEEGANRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGI+ LL+INSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIIVLLLINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQ+AAILVPGDI+SIKLGDIIPADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKHPSEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEY  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID++G+
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSEGS  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI+ LCN RED+K+KVH+VIDK+AERGLRSLAVARQEVPEKTKES G+PW
Sbjct  423   WHRASKGAPEQIITLCNCREDVKKKVHAVIDKFAERGLRSLAVARQEVPEKTKESAGAPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_006282542.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
 gb|EOA15440.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
Length=948

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/478 (92%), Positives = 458/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +RLQIFGPNKLEEKKESK+LKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGDDRLQIFGPNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWHRVS
Sbjct  363   AMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL +KV S+IDKYAERGLRSLAVARQ VPEKTKESPG+PW+FV
Sbjct  423   KGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV  480



>ref|NP_001292696.1| plasma membrane ATPase 4 [Cucumis sativus]
 gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/482 (90%), Positives = 462/482 (96%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             D ++TLE+IKNETVDLEKIPIEEVFEQLKC+REGL+S EG NRLQIFGPNKLEEKKESK+
Sbjct  4     DTALTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKI  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAAIMAIALANG  + PDWQDFVGIVCLLVINSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAAIMAIALANGGNRGPDWQDFVGIVCLLVINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+W EQ+A+ILVPGD++S+KLGDIIPADARLLEGDPLKVDQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIA+GML E++VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAIGMLIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVDK+ V
Sbjct  304   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASRTENQDAIDAAMVGMLADPKEARAGIRE+HF PFNPVDKRTALTYID+ GNW
Sbjct  364   ILLAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN +ED KRKV SVIDK+AERGLRSLAV+RQEVPEK KESPG+PWQ
Sbjct  424   HRASKGAPEQILTLCNCKEDFKRKVFSVIDKFAERGLRSLAVSRQEVPEKNKESPGAPWQ  483

Query  1792  FV  1797
             FV
Sbjct  484   FV  485



>gb|KJB65971.1| hypothetical protein B456_010G123000 [Gossypium raimondii]
Length=957

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/483 (89%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+K I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGL+++EG NRLQ+FGPNKLEEKKESK
Sbjct  3     GEKGISLEEIKNESVDLERIPIEEVFEQLKCTREGLSTEEGNNRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRWSEQEAAILVPGDI++IKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMANLAPKTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++ ELIVMYPIQHRKYRDGIDN+LVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIIVELIVMYPIQHRKYRDGIDNMLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVF KGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFTKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L+A RASRTENQDAIDAA+VGMLADPKEARAG+RE+HFLPFNPVDKRTALTYID+ GN
Sbjct  363   VILYATRASRTENQDAIDAAIVGMLADPKEARAGVREIHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             W R SKGAPEQI++LC  ++D+++KVHSVIDK+AERGLRSLAVARQE+PEKTKESPGSPW
Sbjct  423   WLRASKGAPEQIIDLCKCKDDVRKKVHSVIDKFAERGLRSLAVARQEIPEKTKESPGSPW  482

Query  1789  QFV  1797
             QF+
Sbjct  483   QFI  485



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=955

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/483 (89%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G K+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLTSDEG NRLQ+FGPNKLEEKKESK
Sbjct  4     GTKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTSDEGQNRLQVFGPNKLEEKKESK  63

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVMEAAA+MAI LANGDGKPPDWQDF+GI  LL++NSTISFIEENNA
Sbjct  64    LLKFLGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFLGITVLLIVNSTISFIEENNA  123

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  124   GNAAAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKID  183

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESL VTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ
Sbjct  184   QSALTGESLAVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQ  243

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+  E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  244   KVLTAIGNFCICSIAVGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  303

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVF KGV+K+ 
Sbjct  304   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFPKGVEKEH  363

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+V MLADPKEARAG+RE+HFLPFNPVDKRTALTYID+ GN
Sbjct  364   VILLAARASRTENQDAIDAAIVNMLADPKEARAGVREIHFLPFNPVDKRTALTYIDSDGN  423

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQILELCN +ED KRKVH+VIDK+AERGLRSL VARQ++PEKTKESPG+PW
Sbjct  424   WHRASKGAPEQILELCNCKEDFKRKVHAVIDKFAERGLRSLGVARQQIPEKTKESPGAPW  483

Query  1789  QFV  1797
             QFV
Sbjct  484   QFV  486



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/484 (90%), Positives = 465/484 (96%), Gaps = 1/484 (0%)
 Frame = +1

Query  349   GD-KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             GD K+ITLE+IKNE VDLE IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKES
Sbjct  3     GDHKAITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKES  62

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K+LKFLGFMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LL INSTISFIEENN
Sbjct  63    KILKFLGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENN  122

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLK+
Sbjct  123   AGNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  182

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  183   DQSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  242

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIAVG+L ELIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243   QKVLTAIGNFCICSIAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++LIEVF KGV+K+
Sbjct  303   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKE  362

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ G
Sbjct  363   YVILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNG  422

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
              WHRVSKGAPEQIL LCN+RED++RKVH+VIDK+AERGLRSL VARQEVPEKTK+SPG P
Sbjct  423   TWHRVSKGAPEQILNLCNSREDVRRKVHAVIDKFAERGLRSLGVARQEVPEKTKDSPGGP  482

Query  1786  WQFV  1797
             WQ V
Sbjct  483   WQLV  486



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/483 (89%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE VDLE+IP++EVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNEAVDLERIPVDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAAIMAIALANGDG+PPDW+DFVGI+CLLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWEDFVGIICLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDG+W+E+EAAILVPGDI+S+KLGDIIPADARLLEGDPLK+D
Sbjct  123   GNAAAALMASLAPKTKVLRDGKWNEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDE+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGML E+IVMYPIQ RKYRDG++NLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLTEIIVMYPIQRRKYRDGVENLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVF KG+DKD 
Sbjct  303   AIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFVKGMDKDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             VLL AARASRTENQDAIDAA+VG LADPKEARAGIREVHF PFNPVDKRTALTYI+A G+
Sbjct  363   VLLLAARASRTENQDAIDAAIVGTLADPKEARAGIREVHFFPFNPVDKRTALTYIEADGS  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI+ LCN +ED K+KVH++IDK+AERGLRSL VARQEVPE TKESPG PW
Sbjct  423   WHRASKGAPEQIMTLCNLKEDAKKKVHAIIDKFAERGLRSLGVARQEVPEGTKESPGGPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_011459045.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=983

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/483 (89%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G K+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLTSDEG NRLQ+FGPNKLEEKKESK
Sbjct  4     GTKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTSDEGQNRLQVFGPNKLEEKKESK  63

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVMEAAA+MAI LANGDGKPPDWQDF+GI  LL++NSTISFIEENNA
Sbjct  64    LLKFLGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFLGITVLLIVNSTISFIEENNA  123

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  124   GNAAAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKID  183

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESL VTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ
Sbjct  184   QSALTGESLAVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQ  243

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+  E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  244   KVLTAIGNFCICSIAVGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  303

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVF KGV+K+ 
Sbjct  304   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFPKGVEKEH  363

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+V MLADPKEARAG+RE+HFLPFNPVDKRTALTYID+ GN
Sbjct  364   VILLAARASRTENQDAIDAAIVNMLADPKEARAGVREIHFLPFNPVDKRTALTYIDSDGN  423

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQILELCN +ED KRKVH+VIDK+AERGLRSL VARQ++PEKTKESPG+PW
Sbjct  424   WHRASKGAPEQILELCNCKEDFKRKVHAVIDKFAERGLRSLGVARQQIPEKTKESPGAPW  483

Query  1789  QFV  1797
             QFV
Sbjct  484   QFV  486



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/483 (90%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+K+ITLE IKNETVDLE+IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK
Sbjct  3     GNKAITLEDIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AA+MAIALANGD K PDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEMAAVMAIALANGDNKDPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIA+GM+ E+IVMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAIGMIVEIIVMYPIQHRRYRNGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD NLIEVF KG+ KD 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDNNLIEVFTKGMFKDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA  N
Sbjct  363   VILLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADDN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHRVSKGAPEQIL LCN +ED++ KVH+VIDK+AERGLRSLAVARQEVPEK KES G+PW
Sbjct  423   WHRVSKGAPEQILNLCNCKEDVRNKVHTVIDKFAERGLRSLAVARQEVPEKCKESAGTPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|NP_194748.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 sp|P19456.2|PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type; AltName: Full=Proton 
pump 2 [Arabidopsis thaliana]
 gb|AAA32751.1| H+-ATPase [Arabidopsis thaliana]
 emb|CAB52463.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 emb|CAB81012.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 gb|AAK59580.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AAN31920.1| putative H+-transporting ATPase type 2 [Arabidopsis thaliana]
 gb|AAN71968.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE85731.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=948

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/478 (92%), Positives = 458/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWHRVS
Sbjct  363   AMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL +KV S+IDKYAERGLRSLAVARQ VPEKTKESPG+PW+FV
Sbjct  423   KGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV  480



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/483 (90%), Positives = 463/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GD +I+L++IKNE VDLE+IP+EEVFEQLKC+REGL++ EG NRLQIFGPNKLEEKKESK
Sbjct  3     GDNAISLDEIKNEAVDLERIPVEEVFEQLKCTREGLSASEGENRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDG WSEQ+A+ILVPGDI+SIKLGDIIPADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGVWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPV+K+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVSKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+  E+IVM+PIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIFVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             VLL AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA G+
Sbjct  363   VLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGS  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI++LC+ RED++++ HSVIDK+AERGLRSLAVARQEVPEKTKES G PW
Sbjct  423   WHRASKGAPEQIMDLCSCREDVRKRAHSVIDKFAERGLRSLAVARQEVPEKTKESAGGPW  482

Query  1789  QFV  1797
             QF+
Sbjct  483   QFI  485



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/483 (90%), Positives = 467/483 (97%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IP+EEVFEQLKC++EGLT +EGA+RLQ+FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPVEEVFEQLKCTKEGLTGEEGASRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    LLKFLGFMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+L E+IVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GN
Sbjct  363   VMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED K+KVH VIDK+AERGLRSL VARQ+VPEKTKESPG+PW
Sbjct  423   WHRASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|NP_001190870.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 gb|AEE85732.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=981

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/478 (92%), Positives = 458/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWHRVS
Sbjct  363   AMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL +KV S+IDKYAERGLRSLAVARQ VPEKTKESPG+PW+FV
Sbjct  423   KGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV  480



>ref|XP_010451109.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=918

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/478 (92%), Positives = 458/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWHRVS
Sbjct  363   AMASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL +KV S+IDKYAERGLRSLAVARQ VPEKTKESPG+PW+FV
Sbjct  423   KGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV  480



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/478 (92%), Positives = 458/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID  GNWHRVS
Sbjct  363   AMASRVENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDGSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL +KV S+IDKYAERGLRSLAVARQ VPEKTKESPG+PW+FV
Sbjct  423   KGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV  480



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/477 (91%), Positives = 458/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE+VDLE IP+EEVFEQLKC+REGL+S+EG  RLQ+FGPNKLEEKKESK+LKFLG
Sbjct  4     LEEIKNESVDLENIPMEEVFEQLKCTREGLSSEEGTQRLQVFGPNKLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDI+SIKLGDI+PADARLLEGDPLKVDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVG FQ+VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGLFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ E+IVM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR SK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQI+ LCN RED+KRKVHS+IDKYAERGLRSLAVARQEVPEKTKESPG PWQFV
Sbjct  424   GAPEQIITLCNCREDMKRKVHSIIDKYAERGLRSLAVARQEVPEKTKESPGGPWQFV  480



>ref|XP_006412736.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
 gb|ESQ54189.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
Length=948

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/478 (92%), Positives = 458/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESK+LKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWHRVS
Sbjct  363   AMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL +KV S+IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  423   KGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/483 (90%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G++ I+LE+IKNETVDLE+IP+EEVFEQLKC+REGL+++EGANRLQIFGPNKLEEKKESK
Sbjct  3     GEQGISLEEIKNETVDLERIPVEEVFEQLKCTREGLSAEEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLR G WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVD
Sbjct  123   GNAAAALMAGLAPKTKVLRGGVWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVD  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++ E+IVM+PIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIVVEIIVMFPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVD+D 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDRDY  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             VLL AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTY+D  GN
Sbjct  363   VLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYVDGDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI++LC  RED++++ HSVIDK+AERGLRSLAVARQEVPEK+KES G PW
Sbjct  423   WHRASKGAPEQIMDLCGCREDVRKRAHSVIDKFAERGLRSLAVARQEVPEKSKESAGGPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/483 (90%), Positives = 466/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G  +I+LE+IKNETVDLEKIPIEEVFEQLKC+ +GLT++EG  RL+IFGPNKLEEKKESK
Sbjct  3     GAGAISLEEIKNETVDLEKIPIEEVFEQLKCTPKGLTTEEGNTRLEIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGI+CLLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIICLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGML E+IVMYPIQHR YR+GI+NLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLVEIIVMYPIQHRGYRNGINNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD NL+EVFAKGV+K  
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFAKGVEKPH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAG+ EVHF PFNPVDKRTALTY+D+ G+
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGVTEVHFFPFNPVDKRTALTYVDSDGS  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCNAREDLK+KVHSVIDK+AERGLRSLAVARQEVPEK+KESPG+PW
Sbjct  423   WHRASKGAPEQILALCNAREDLKKKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGAPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/478 (92%), Positives = 458/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESKLLKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID  GNWHRVS
Sbjct  363   AMASRIENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDGSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL +KV S+IDKYAERGLRSLAVARQ VPEKTKESPG+PW+FV
Sbjct  423   KGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV  480



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/478 (91%), Positives = 462/478 (97%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
              LE+IKNETVDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK+LKFL
Sbjct  4     NLEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFL  63

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
              FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAA
Sbjct  64    LFMWNPLSWVMEMAAIMAIALANGQGKPPDWQDFVGIIVLLLINSTISFIEENNAGNAAA  123

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG WSEQ+AAILVPGDI+SIKLGDI+PADARLL+GDPLK+DQSALT
Sbjct  124   ALMAGLAPKTKVLRDGSWSEQDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALT  183

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK+PGDEVF+GSTCKQGEIEAVVIATGVHTFFGKAAHLVDS NQVGHFQKVLTA
Sbjct  184   GESLPVTKNPGDEVFTGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSANQVGHFQKVLTA  243

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+G++ E+IVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  244   IGNFCICSIALGIVVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  303

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVDKD V+L A
Sbjct  304   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDKDHVVLLA  363

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASRTENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID+  NWHRVS
Sbjct  364   ARASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSNENWHRVS  423

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL LCN RED++ KVH+VIDK+AERGLRSLAVARQEVPEK+KESPG+PWQFV
Sbjct  424   KGAPEQILNLCNCREDVRNKVHNVIDKFAERGLRSLAVARQEVPEKSKESPGAPWQFV  481



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/483 (90%), Positives = 466/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G  +I+LE+IKNETVDLEKIPIEEVFEQLKC+ +GLT++EG  RL+IFGPNKLEEKKESK
Sbjct  3     GAGAISLEEIKNETVDLEKIPIEEVFEQLKCTPKGLTTEEGNTRLEIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGI+CLLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIICLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGML E+IVMYPIQHR YR+GI+NLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLVEIIVMYPIQHRGYRNGINNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD NL+EVFAKGV+K  
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFAKGVEKPH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAG+ EVHF PFNPVDKRTALTY+D+ G+
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGVTEVHFFPFNPVDKRTALTYVDSDGS  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCNAREDLK+KVHSVIDK+AERGLRSLAVARQEVPEK+KESPG+PW
Sbjct  423   WHRASKGAPEQILALCNAREDLKKKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGAPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/482 (90%), Positives = 461/482 (96%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             DK+I+LE+IKNETVDLE+IPIEEVF QLKCSREGL+S+EG  RL+IFGPNKLEEKKESK 
Sbjct  5     DKAISLEEIKNETVDLERIPIEEVFGQLKCSREGLSSEEGGQRLEIFGPNKLEEKKESKF  64

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGI+CLLVINS+ISFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGILCLLVINSSISFIEENNAG  124

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+WSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  185   SALTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIA+GML E++VMYPIQHRKYR GIDNLLVLLIGGIPIAMPTVLSVT+A
Sbjct  245   VLTAIGNFCICSIAIGMLIEIVVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVTIA  304

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+ + V
Sbjct  305   IGSHRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVENEHV  364

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AAR+SRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNW
Sbjct  365   ILLAARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNDGNW  424

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQILELCN +ED K+K  ++IDKYAERGLRSLAVARQEVPEK KES G PWQ
Sbjct  425   HRASKGAPEQILELCNCKEDFKKKAFAIIDKYAERGLRSLAVARQEVPEKAKESAGGPWQ  484

Query  1792  FV  1797
              V
Sbjct  485   LV  486



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/483 (92%), Positives = 472/483 (98%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC++EGLTS+EGANRLQIFGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNA
Sbjct  63    LLKFLGFMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDIIPADARLLEGDPLKVD
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVD  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIA+GM+ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAIGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD++LIEVFAKGVDK+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLIEVFAKGVDKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIRE+HF PFNPVDKRTALTYIDA GN
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDADGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI+ LCN +ED+++KVH VIDK+AERGLRSLAVARQEVPE+TKESPG+PW
Sbjct  423   WHRASKGAPEQIVTLCNCKEDVRKKVHMVIDKFAERGLRSLAVARQEVPERTKESPGAPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>gb|KJB82763.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=954

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/483 (89%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+K I+L++IKNE+VDLE+IPIEEVFEQLKC+REGL++ EG NRLQ+FGPNKLEEKKESK
Sbjct  3     GNKGISLDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRWSEQEAAILVPGDI++IKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMANLAPKTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             +VLTAIGNFCICSIAVG++ ELIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   QVLTAIGNFCICSIAVGIVIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+Q
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEQ  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             VLL+AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ G 
Sbjct  363   VLLYAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGK  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI+ LCN + D++ KVH+VIDK+AERGLRSLAVARQEVPEKTKESPG+PW
Sbjct  423   WHRASKGAPEQIITLCNCKADVRNKVHAVIDKFAERGLRSLAVARQEVPEKTKESPGAPW  482

Query  1789  QFV  1797
             Q V
Sbjct  483   QLV  485



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/482 (90%), Positives = 464/482 (96%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             DK+I+LE+IKNETVDLE+IP+EEVFEQLKCS+EGL+S+EGA RL+IFGPNKLEEKKESK 
Sbjct  5     DKAISLEEIKNETVDLERIPVEEVFEQLKCSKEGLSSEEGAQRLEIFGPNKLEEKKESKF  64

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAIALANG+G+PPDWQDFVGI+CLLVINSTISFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAVMAIALANGEGQPPDWQDFVGILCLLVINSTISFIEENNAG  124

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+WSE++AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  185   SALTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIA+GM+ E+IVMYPIQHRKYR GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAIGMVIEIIVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLS+DKNLIEVFAKGV+KD V
Sbjct  305   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKNLIEVFAKGVEKDHV  364

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AAR+SRTENQDAIDAAMVGMLADPKEARAGI EVHFLPFNPVDKRTALTYID+ GNW
Sbjct  365   ILLAARSSRTENQDAIDAAMVGMLADPKEARAGITEVHFLPFNPVDKRTALTYIDSDGNW  424

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL+LC  +ED K+K  ++IDKYAERGLRSLAVARQEVP KTKES G PWQ
Sbjct  425   HRASKGAPEQILDLCLCKEDFKKKAFNIIDKYAERGLRSLAVARQEVPAKTKESSGGPWQ  484

Query  1792  FV  1797
             FV
Sbjct  485   FV  486



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4 [Fragaria vesca subsp. vesca]
Length=955

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/482 (90%), Positives = 459/482 (95%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             DK+I+LE+IKNETVDLE+IPIEEVF QLKCSREGL+S EGA RL+IFGPNKLEEKKESK 
Sbjct  5     DKAISLEEIKNETVDLERIPIEEVFAQLKCSREGLSSAEGAQRLEIFGPNKLEEKKESKF  64

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG  124

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG+WSE+EAAILVPGDI+S+KLGDI+PADARLLEGDPLK+DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWSEEEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQ  184

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ 
Sbjct  185   SALTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQM  244

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIA+GML E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAIGMLIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD V
Sbjct  305   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHV  364

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASR ENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID+ GNW
Sbjct  365   VLLAARASRVENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNW  424

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL+LC  +ED K+K  ++IDKYAERGLRSLAVARQEVP K KES G PWQ
Sbjct  425   HRASKGAPEQILDLCKCKEDFKKKAFAIIDKYAERGLRSLAVARQEVPAKAKESEGGPWQ  484

Query  1792  FV  1797
              V
Sbjct  485   LV  486



>gb|KFK29576.1| h(+)-atpase 2 [Arabis alpina]
Length=948

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/478 (92%), Positives = 458/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+ IFGPNKLEEKKESK+LKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIVIFGPNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVS
Sbjct  363   AMASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL +KV S+IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  423   KGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/477 (91%), Positives = 455/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IPIEEVFEQLKC+REGL+S EG  RL+IFGPN+LEEKKESK+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDI+SIKLGDI+PADARLLEGD LKVDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDALKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSI VG+L E+IVM+PIQHRKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIGVGILVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYIDA GNWHRVSK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LC+ +EDL+RKVHS+IDKYAERGLRSLAVARQEVPEK KESPG PWQFV
Sbjct  424   GAPEQILDLCHCKEDLRRKVHSIIDKYAERGLRSLAVARQEVPEKNKESPGGPWQFV  480



>ref|NP_001292776.1| plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/477 (91%), Positives = 455/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IPIEEVFEQLKC+REGL+S EG  RL+IFGPN+LEEKKESK+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDI+SIKLGDI+PADARLLEGD LKVDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDALKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSI VG+L E+IVM+PIQHRKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIGVGILVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYIDA GNWHRVSK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LC+ +EDL+RKVHS+IDKYAERGLRSLAVARQEVPEK KESPG PWQFV
Sbjct  424   GAPEQILDLCHCKEDLRRKVHSIIDKYAERGLRSLAVARQEVPEKNKESPGGPWQFV  480



>ref|XP_011649762.1| PREDICTED: plasma membrane ATPase 4 [Cucumis sativus]
Length=955

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/484 (90%), Positives = 464/484 (96%), Gaps = 1/484 (0%)
 Frame = +1

Query  349   GD-KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             GD K+ITLE+IKNE VDLE IPIEEVFEQLKC+REGLTS+EGA+RLQ+FGPNKLEEKKES
Sbjct  3     GDHKAITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKES  62

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             KLLKFLGFMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LL INSTISFIEENN
Sbjct  63    KLLKFLGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENN  122

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLK+
Sbjct  123   AGNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  182

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  183   DQSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  242

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIAVG+L ELIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243   QKVLTAIGNFCICSIAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++LIEVF KGV+K+
Sbjct  303   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKE  362

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ G
Sbjct  363   YVILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNG  422

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
              WHRVSKGAPEQIL LCN+RED++RKVH+VIDK+AERGLRSL VARQEV EKTK+SPG P
Sbjct  423   TWHRVSKGAPEQILNLCNSREDVRRKVHAVIDKFAERGLRSLGVARQEVHEKTKDSPGGP  482

Query  1786  WQFV  1797
             WQ V
Sbjct  483   WQLV  486



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/482 (89%), Positives = 467/482 (97%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             +K+I+LE+IKNETVDLEKIP+EEVFEQLKC+REGL+SDEGA+RLQ+FGPNKLEEKKESK+
Sbjct  4     NKAISLEEIKNETVDLEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKI  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGI+ LL+INSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIIVLLLINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDGRWSEQ+AA+LVPGDI+SIKLGDI+PADARLLEGDPLK+DQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGRWSEQDAAMLVPGDIISIKLGDIVPADARLLEGDPLKIDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIA+G+  ELIVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAIGIAVELIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+K+ V
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRTLIEVFAKGVEKEHV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ G W
Sbjct  364   ILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN +ED++RK H+VIDK+AERGLRSL VARQE+PE+TK+SPG+PWQ
Sbjct  424   HRASKGAPEQILNLCNCKEDVRRKAHAVIDKFAERGLRSLGVARQEIPERTKDSPGAPWQ  483

Query  1792  FV  1797
             FV
Sbjct  484   FV  485



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/477 (91%), Positives = 458/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IPIEEVFEQLKC+REGL+S+EGA RL+IFGPNKLEEKKESK+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSNEGAQRLEIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDW+DFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDI+SIKLGDI+PADARLLEGDPLKVDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ E+IVM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LCN RED++RKVHS+IDKYAERGLRSLAVARQEVPEK+K++ G PWQFV
Sbjct  424   GAPEQILDLCNCREDMRRKVHSIIDKYAERGLRSLAVARQEVPEKSKDASGGPWQFV  480



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/481 (90%), Positives = 461/481 (96%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K +TLE+IKNE VDLE+IP+EEVFEQLKC+REGLTS+EG NRLQIFGPNKLEEKKESK+L
Sbjct  5     KGLTLEEIKNEAVDLERIPVEEVFEQLKCTREGLTSEEGQNRLQIFGPNKLEEKKESKIL  64

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAA+MAI LANGD +PPDWQDFVGIV LL INSTISFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMEAAALMAIVLANGDNRPPDWQDFVGIVALLFINSTISFIEENNAGN  124

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDIIPADARLLEGDPLKVDQS
Sbjct  125   AAAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQS  184

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTKSP DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  185   ALTGESLPVTKSPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSI VG++ ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCICSIFVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF KG+DK+QV+
Sbjct  305   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLVEVFVKGLDKEQVI  364

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASRTENQDAIDAA+VGMLADPKEARAG REVHFLPFNPVDKRTALTYIDA GNWH
Sbjct  365   LLAARASRTENQDAIDAAIVGMLADPKEARAGAREVHFLPFNPVDKRTALTYIDANGNWH  424

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL LCN++ED++++VHSVIDK+AERGLRSL VARQEVPE+TKES G PWQ 
Sbjct  425   RASKGAPEQILALCNSKEDVRKRVHSVIDKFAERGLRSLGVARQEVPERTKESLGGPWQL  484

Query  1795  V  1797
             V
Sbjct  485   V  485



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/479 (90%), Positives = 467/479 (97%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGL++DEGA+RLQ+FGPNKLEEKKESK+LKF
Sbjct  7     ISLEEIKNESVDLERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKESKILKF  66

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGIV LLVINSTISFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG+ AELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGIFAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++LIEVFAKGV+K+ V+L 
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFAKGVEKEHVILL  366

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+K+KVHSVIDK+AERGLRSL VA+QEVPEK+K++ G+PWQ V
Sbjct  427   SKGAPEQILTLCNCKEDVKKKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAAGAPWQLV  485



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/483 (89%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+K+ITLE+IKNETVDLE+IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK
Sbjct  3     GNKAITLEEIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AAIMAIALANGD K PDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEMAAIMAIALANGDNKAPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIA+GM+ E+IVMYPIQ R+YR+GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAIGMIVEIIVMYPIQRRRYRNGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD NLIEVF KG+ K+ 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDNNLIEVFTKGMFKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA  N
Sbjct  363   VILLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADDN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHRVSKGAPEQIL LCN +ED++ KVH+VIDK+AERGLRSLAVARQEVPEK KES G+PW
Sbjct  423   WHRVSKGAPEQILNLCNCKEDVRNKVHTVIDKFAERGLRSLAVARQEVPEKCKESAGAPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/479 (90%), Positives = 462/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE+VDLE+IPIEEVFEQLKCSR+GLTS+EGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4     ISLEEIKNESVDLERIPIEEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRD RWSEQ+AAILVPGDI+SIKLGDIIPADARLLEGDPL VDQSAL
Sbjct  124   AALMAGLAPKTKVLRDSRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTKS  DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+G+L ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAIGILIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKG++K+ V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID++G WHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSEGKWHRA  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI+ LCN +ED+++KVHSVIDK+AERGLRSL VARQEVPEK+KESPG PWQFV
Sbjct  424   SKGAPEQIINLCNCKEDVRKKVHSVIDKFAERGLRSLGVARQEVPEKSKESPGGPWQFV  482



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/477 (91%), Positives = 456/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IPIEEVFEQLKC+REGLTSDEGA R+++FGPNKLEEKKESK+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLTSDEGARRIEVFGPNKLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDW+DFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQSVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ E+IVM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GNWHR SK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL LCN +ED+KRKVH+VIDKYAERGLRSLAVARQEVPEK+K+S G PWQFV
Sbjct  424   GAPEQILTLCNCKEDVKRKVHNVIDKYAERGLRSLAVARQEVPEKSKDSAGGPWQFV  480



>ref|NP_001292777.1| proton-exporting ATPase4 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/477 (90%), Positives = 456/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IPIEEVFEQLKC+REGL+S EG  RL+IFGPN+LEEKKESK+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AA+MAIALANG GKPPDW+DFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDIVSIKLGDI+PADARLLEGDPLKVDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ E+IVM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYIDA G+WHRVSK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGHWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LC+ +EDL+RKVH +IDKYAERGLRSLAVARQEVPE+ KESPG PWQFV
Sbjct  424   GAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPERNKESPGGPWQFV  480



>dbj|BAF03589.1| P-type H+-ATPase [Zostera marina]
Length=964

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/484 (89%), Positives = 463/484 (96%), Gaps = 0/484 (0%)
 Frame = +1

Query  346   MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             M +K I LE+IKNETVDLE+IP+EEVFEQLKCSREGL+ +EGA+RLQIFGPNKLEEKKES
Sbjct  1     MENKGINLEEIKNETVDLERIPVEEVFEQLKCSREGLSGEEGASRLQIFGPNKLEEKKES  60

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K LKFLGFMWNPLSWVME AAIMAIALANGDG+PPDWQDFVGI+ LLVINSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIIVLLVINSTISFIEENN  120

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDG+WSE+EAAILVPGDIVSIKLGDI+PADARLLEGDPLK+
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGQWSEEEAAILVPGDIVSIKLGDIVPADARLLEGDPLKI  180

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK PGDEVFSGSTCKQGEI+AVVIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKHPGDEVFSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMVIEIIVMYPIQGRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLS+DKNLIEVF KGVDK+
Sbjct  301   MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKNLIEVFCKGVDKE  360

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARASR ENQDAIDAAMVGMLADPKEAR+GI+EVHFLPFNPVDKRTALTY+DA G
Sbjct  361   HVVLLAARASRVENQDAIDAAMVGMLADPKEARSGIKEVHFLPFNPVDKRTALTYVDADG  420

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHRVSKGAPEQI++LCN +ED+KRK H+VIDK+AERGLRSLAV RQ VPEK+KES G P
Sbjct  421   NWHRVSKGAPEQIMDLCNCKEDVKRKAHNVIDKFAERGLRSLAVGRQGVPEKSKESSGGP  480

Query  1786  WQFV  1797
             WQFV
Sbjct  481   WQFV  484



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/479 (90%), Positives = 467/479 (97%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE+VDLE+IP+EEVFEQLKC+REGL++DEGA+RLQ+FGPNKLEEKKESK+LKF
Sbjct  7     ISLEEIKNESVDLERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKESKILKF  66

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAA+MAIALANGDG+PPDWQDFVGIV LLVINSTISFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG++AELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGIIAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD +LIEVFAKGV+K+ V+L 
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDTSLIEVFAKGVEKEHVMLL  366

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+K+KVHSVIDK+AERGLRSL VA+QEVPEK+K++ G+PWQ V
Sbjct  427   SKGAPEQILTLCNCKEDVKKKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAAGAPWQLV  485



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/483 (89%), Positives = 465/483 (96%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+K+ITLE+IKNETVDLE+IPIEEVFE+LKC+++GL+S+EGA+RLQIFGPNKLEEKKESK
Sbjct  3     GNKAITLEEIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AAIMAIALANGD K PDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEMAAIMAIALANGDNKAPDWQDFVGIIVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIA+GM+ E+IVMYPIQ R+YR+GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAIGMIVEIIVMYPIQRRRYRNGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD NLIEVF KG+ K+ 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDNNLIEVFTKGMFKEH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA  N
Sbjct  363   VILLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADDN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHRVSKGAPEQIL +CN +ED++ KVH+VIDK+AERGLRSLAVARQEVPEK KES G+PW
Sbjct  423   WHRVSKGAPEQILNICNCKEDVRNKVHTVIDKFAERGLRSLAVARQEVPEKCKESAGAPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/477 (90%), Positives = 456/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IPIEEVFEQLKC+REGL+S EG  RL+IFGPN+LEEKKESK+LKFLG
Sbjct  14    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  73

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AA+MAIALANG GKPPDW+DFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  74    FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  133

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDIVSIKLGDI+PADARLLEGDPLKVDQSALTG
Sbjct  134   LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTG  193

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  194   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  253

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ E+IVM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  254   GNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  313

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AA
Sbjct  314   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  373

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYIDA G+WHRVSK
Sbjct  374   RASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGHWHRVSK  433

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LC+ +EDL+RKVH +IDKYAERGLRSLAVARQEVPE+ KESPG PWQFV
Sbjct  434   GAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPERNKESPGGPWQFV  490



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/479 (90%), Positives = 460/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             ++LE+IKNE VDLEKIPI EVFEQLKC  EGLT+ EG NRLQ+FGPNKLEEKKESK+LKF
Sbjct  5     LSLEEIKNEAVDLEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKILKF  64

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG GKPPDW+DFVGI+CLLVINSTISFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVINSTISFIEENNAGNAA  124

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+S+KLGDIIPADARLLEGDPLKVDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSAL  184

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+PGDE+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDST+QVGHFQKVLT
Sbjct  185   TGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVLT  244

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+GML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIALGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             H+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD NL+EVF+KGVDK  V+L 
Sbjct  305   HKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFSKGVDKQHVILL  364

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHF PFNPVDKRTALTYID+ GNWHR 
Sbjct  365   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHRA  424

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+K+K H+VIDK+AERGLRSLAVARQEVPEK KESPGSPWQFV
Sbjct  425   SKGAPEQILTLCNCKEDVKKKAHAVIDKFAERGLRSLAVARQEVPEKRKESPGSPWQFV  483



>ref|NP_179486.1| H(+)-ATPase 1 [Arabidopsis thaliana]
 sp|P20649.3|PMA1_ARATH RecName: Full=ATPase 1, plasma membrane-type; AltName: Full=Proton 
pump 1 [Arabidopsis thaliana]
 gb|AAC09030.1| plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AAP40498.1| putative plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AEC06832.1| H(+)-ATPase 1 [Arabidopsis thaliana]
Length=949

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/477 (91%), Positives = 458/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+ IFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIVIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAA+MAIALANGD +PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAALMAIALANGDNRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G+  E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/482 (90%), Positives = 465/482 (96%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             +K ITLE+IKNE VDLE+IP+EEVFEQLKC++EGLTS+EG NRL+IFGPNKLEEKKESK+
Sbjct  4     NKGITLEEIKNEAVDLERIPVEEVFEQLKCTKEGLTSEEGENRLKIFGPNKLEEKKESKI  63

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LL INSTISFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVALLFINSTISFIEENNAG  123

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDGRW+EQ+A+ILVPGDI+SIKLGDIIPADARLLEGDPLKVDQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQ  183

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             SALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK
Sbjct  184   SALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSI VG++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIFVGIIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF KGVDK+QV
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKGVDKEQV  363

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNW
Sbjct  364   ILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNW  423

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HR SKGAPEQIL LCN++ED+++KVH+VIDK+AERGLRSLAVARQEVPEK KESPG PWQ
Sbjct  424   HRASKGAPEQILALCNSKEDVRKKVHAVIDKFAERGLRSLAVARQEVPEKMKESPGGPWQ  483

Query  1792  FV  1797
              V
Sbjct  484   LV  485



>gb|AAA32813.1| plasma membrane proton pump H+ ATPase [Arabidopsis thaliana]
Length=949

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/477 (91%), Positives = 458/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+ IFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIVIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAA+MAIALANGD +PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAALMAIALANGDNRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G+  E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/477 (91%), Positives = 455/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IPIEEVFEQLKC+REGL+S EG  RL+IFGPNKLEEKKESK+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDW+DFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDI+SIKLGDI+PADARLLEGDPLKVDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVT+ PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTRGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ E+IVM+PIQHRKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIIVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWHRVSK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LC+ +EDL+RKVH +IDKYAERGLRSLAVARQEVPEK KESPG PWQFV
Sbjct  424   GAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPEKNKESPGGPWQFV  480



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/477 (90%), Positives = 456/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IPIEEVFEQLKC+REGL+S EG  RL+IFGPN+LEEKKESK+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AA+MAIALANG GKPPDW+DFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDIVSIKLGDI+PADARLLEGDPLKVDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ E+IVM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYIDA G+WHRVSK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGHWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LC+ +EDL+RKVH +IDKYAERGLRSLAVARQEVPE+ KESPG PWQFV
Sbjct  424   GAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPERNKESPGGPWQFV  480



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/477 (91%), Positives = 460/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVFEQLKC+REGL+ DEGANRLQIFGPNKLEEKKESKLLKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFEQLKCTREGLSGDEGANRLQIFGPNKLEEKKESKLLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAI LANGDGKPPDWQDFVGI+CLL+INSTISF EENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIVLANGDGKPPDWQDFVGIICLLLINSTISFWEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSALTG
Sbjct  124   LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVT++P DEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VLTAI
Sbjct  184   ESLPVTRNPHDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVGM+ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAVGMVVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVFAKGVDK+ VLL AA
Sbjct  304   LSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGVDKEYVLLCAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAA+VG LADPKEARAGIREVHF PFNPVDKRTALT+ID++GNWHR SK
Sbjct  364   RASRTENQDAIDAAIVGTLADPKEARAGIREVHFFPFNPVDKRTALTFIDSEGNWHRASK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL LCN +ED K+KVH++IDK+AERGLRSLAVARQEVP+K+K+S G PWQFV
Sbjct  424   GAPEQILTLCNCKEDQKKKVHAIIDKFAERGLRSLAVARQEVPQKSKDSEGGPWQFV  480



>ref|XP_010669283.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669284.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
Length=952

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/478 (89%), Positives = 454/478 (95%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE+IKNE VDLEKIPIEEVFEQLKCSREGL+S+EGANRLQIFGPNKLEEK ESK LKFL
Sbjct  8     SLEEIKNENVDLEKIPIEEVFEQLKCSREGLSSEEGANRLQIFGPNKLEEKSESKFLKFL  67

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAA+MAI LANGD +PPDWQDFVGI+ LLVINSTISFIEENNAGNAAA
Sbjct  68    GFMWNPLSWVMEAAALMAIVLANGDHRPPDWQDFVGIMVLLVINSTISFIEENNAGNAAA  127

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMA LAPKTK+LRDGRWSEQEA ILVPGD++SIKLGDI+PADARLLEGDPLK+DQSALT
Sbjct  128   ALMANLAPKTKILRDGRWSEQEAQILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALT  187

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK+PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+
Sbjct  188   GESLPVTKNPGEEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTS  247

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIAVGML E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  248   IGNFCICSIAVGMLIEVVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  307

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             +LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDK L+EVFAKGV+KD V+L A
Sbjct  308   KLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKKLVEVFAKGVEKDYVILLA  367

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASR ENQDAIDAAMVGMLADPKEARAGIREVHF PFNPVDKRTALTYIDA G+WHR S
Sbjct  368   ARASRVENQDAIDAAMVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDANGDWHRAS  427

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL LC  + D+K+KVH VID YA RGLRSLAVARQEVPEKTKESPG PWQFV
Sbjct  428   KGAPEQILALCGCKADVKKKVHDVIDNYAGRGLRSLAVARQEVPEKTKESPGGPWQFV  485



>ref|XP_009109000.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
Length=947

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/479 (91%), Positives = 457/479 (95%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             ++LE IKNETVDLEKIPIEEVF+QL C+REGLT+ EG  R+QIFGPNKLEEKKESK+LKF
Sbjct  1     MSLEDIKNETVDLEKIPIEEVFQQLNCTREGLTTQEGEERIQIFGPNKLEEKKESKILKF  60

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAA
Sbjct  61    LGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAA  120

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPAD RLLEGDPLKVDQSAL
Sbjct  121   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADGRLLEGDPLKVDQSAL  180

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK PG EV+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  181   TGESLPVTKHPGQEVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  240

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  241   AIGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  300

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLF
Sbjct  301   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLF  360

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AA ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRV
Sbjct  361   AAMASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSSGNWHRV  420

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQILEL  A  DL +KV S+I+KYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  421   SKGAPEQILELAKANSDLSKKVLSIIEKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  479



>gb|AHK23067.1| plasma membrane ATPase 4 [Fagopyrum tataricum]
Length=965

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/484 (89%), Positives = 462/484 (95%), Gaps = 0/484 (0%)
 Frame = +1

Query  346   MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             M  K + LE IKNE VDLE IPIEEVFEQLKCSREGL+++EG +RL IFGPNKLEEKKES
Sbjct  1     MAAKGLNLEDIKNEAVDLEHIPIEEVFEQLKCSREGLSAEEGDSRLAIFGPNKLEEKKES  60

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K+LKFLGFMWNPLSWVMEAAAIMAIALANGD KPPDWQDF+GI+CLLVINSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAIMAIALANGDNKPPDWQDFLGIICLLVINSTISFIEENN  120

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+S+KLGDIIPADARLLEGDPLK+
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK PGDEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLV+STNQVGHF
Sbjct  181   DQSALTGESLPVTKGPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVNSTNQVGHF  240

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIA+GM  E+IVMYP QHRKYR GIDNLLVLLIGGIPIAMPTV+SVT
Sbjct  241   QKVLTAIGNFCICSIAIGMAIEVIVMYPTQHRKYRSGIDNLLVLLIGGIPIAMPTVMSVT  300

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NL+EVFAKGVD+D
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDQD  360

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID +G
Sbjct  361   YVILLAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNEG  420

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHR SKGAPEQI++LCN +ED+++KVHSVI+K+AERGLRSLAVARQEVPEK+K+SPG P
Sbjct  421   NWHRASKGAPEQIIDLCNCKEDVRKKVHSVIEKFAERGLRSLAVARQEVPEKSKDSPGGP  480

Query  1786  WQFV  1797
             WQFV
Sbjct  481   WQFV  484



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/481 (89%), Positives = 459/481 (95%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K I+LE+IKNETVDLE++PIEEVF+QLKC++EGL+S EGANRL+IFGPNKLEEKK+SK L
Sbjct  5     KGISLEEIKNETVDLERVPIEEVFQQLKCTKEGLSSGEGANRLEIFGPNKLEEKKDSKFL  64

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVME AAIMA+ALANG+GKPPDWQDFVGI+CLLVINSTISFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMELAAIMAVALANGEGKPPDWQDFVGIICLLVINSTISFIEENNAGN  124

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDG+W E+EAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQS
Sbjct  125   AAAALMAGLAPKTKVLRDGKWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQS  184

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  185   ALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCI SIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCIVSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVDKD V+
Sbjct  305   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDKDHVM  364

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYID  G WH
Sbjct  365   LLAARASRVENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDTDGIWH  424

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQI+ LC  +ED K+KVH++IDK+AERGLRSLAVARQEVPEK KES G P QF
Sbjct  425   RASKGAPEQIMILCGLKEDAKKKVHAIIDKFAERGLRSLAVARQEVPEKAKESAGGPRQF  484

Query  1795  V  1797
             V
Sbjct  485   V  485



>gb|EPS73574.1| hypothetical protein M569_01174, partial [Genlisea aurea]
Length=743

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/481 (90%), Positives = 456/481 (95%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             +SI+LE+IKNETVDLEK+PIEEVFE+L+C+REGL+S+EG  RL IFGPNKLEEKKESK+L
Sbjct  5     ESISLEEIKNETVDLEKVPIEEVFEKLRCTREGLSSEEGETRLHIFGPNKLEEKKESKIL  64

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDF+GI+CLL+INSTISFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFMGIICLLIINSTISFIEENNAGN  124

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS
Sbjct  125   AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  184

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK   DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  185   ALTGESLPVTKESYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIAVGML E+IVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCICSIAVGMLTEIIVMYPIQHREYRKGIDNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD NLIEVFAKGVD   VL
Sbjct  305   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDTNLIEVFAKGVDAAHVL  364

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASRTENQDAIDAA+VG LADPKEARAGI EVHF PFNPVDKRTALTYID+ G+WH
Sbjct  365   LLAARASRTENQDAIDAAIVGTLADPKEARAGITEVHFFPFNPVDKRTALTYIDSHGHWH  424

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL LC   ED+KR+VH VIDK+A+RGLRSLAVARQEVPEK+K+ PG+PWQF
Sbjct  425   RASKGAPEQILTLCKCSEDMKRRVHGVIDKFADRGLRSLAVARQEVPEKSKDGPGAPWQF  484

Query  1795  V  1797
             V
Sbjct  485   V  485



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/481 (90%), Positives = 456/481 (95%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I LE IKNE VDLE IPIEEVFEQLKCSREGLTS EGA+RLQIFGPNKLEEK E+K L
Sbjct  3     KAINLEDIKNEAVDLENIPIEEVFEQLKCSREGLTSQEGADRLQIFGPNKLEEKTENKFL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMA LAPK K+LRDGRWSE +AA+LVPGDI+SIKLGDI+PADARLLEGDPLKVDQS
Sbjct  123   AAAALMANLAPKCKLLRDGRWSEHDAALLVPGDIISIKLGDIVPADARLLEGDPLKVDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  183   ALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCI SIAVGM+ E+IVMYPIQ RKYR GI+NLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCIISIAVGMVIEIIVMYPIQRRKYRHGINNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGVDK+ VL
Sbjct  303   GSHRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVDKEHVL  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAID  MVGMLADPKEARAGIREVHFLPFNPV+KRTALTYID  GNWH
Sbjct  363   LLAARASRVENQDAIDTCMVGMLADPKEARAGIREVHFLPFNPVEKRTALTYIDGNGNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             RVSKGAPEQI++LCN +ED+++KVH+VI+K+AERGLRSL VARQEVPEK KESPG PWQF
Sbjct  423   RVSKGAPEQIIDLCNCKEDVRKKVHNVIEKFAERGLRSLGVARQEVPEKNKESPGGPWQF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>ref|NP_200545.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 ref|NP_001190559.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 sp|P20431.2|PMA3_ARATH RecName: Full=ATPase 3, plasma membrane-type; AltName: Full=Proton 
pump 3 [Arabidopsis thaliana]
 gb|AAA32750.1| ATPase [Arabidopsis thaliana]
 dbj|BAB09963.1| plasma membrane ATPase 3 [Arabidopsis thaliana]
 gb|AAL59975.1| putative plasma membrane proton pump ATPase 3 [Arabidopsis thaliana]
 gb|AED96889.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 gb|AED96890.1| H(+)-ATPase 3 [Arabidopsis thaliana]
Length=949

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/477 (91%), Positives = 457/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE I NE VDLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5     LEDIVNENVDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVINSTISF+EENNAGNAAAA
Sbjct  65    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFVEENNAGNAAAA  124

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  184

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLP TK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  185   ESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  244

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG+  E++VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  245   GNFCICSIAVGIAIEIVVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  304

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV+ KGV+KD+VLLFAA
Sbjct  305   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVYCKGVEKDEVLLFAA  364

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALT+ID+ GNWHRVSK
Sbjct  365   RASRVENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTFIDSNGNWHRVSK  424

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LCNAR DL+++VHS IDKYAERGLRSLAV+RQ VPEKTKES GSPW+FV
Sbjct  425   GAPEQILDLCNARADLRKRVHSTIDKYAERGLRSLAVSRQTVPEKTKESSGSPWEFV  481



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/479 (90%), Positives = 462/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEGANRL+IFGPNKLEEKKESK LKF
Sbjct  3     ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSTDEGANRLEIFGPNKLEEKKESKFLKF  62

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLLVINSTISF+EENNAGNAA
Sbjct  63    LGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFVEENNAGNAA  122

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSAL
Sbjct  123   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  182

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVT+ P DEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  183   TGESLPVTRHPYDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  242

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVGM+ E+IVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  243   AIGNFCICSIAVGMIVEIIVMYPIQHRKYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  302

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVFAKG+DKD VLL 
Sbjct  303   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGMDKDFVLLC  362

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VG LADPKEARAGI+EVHF PFNPVDKRTALT+IDA GNWHR 
Sbjct  363   AARASRTENQDAIDAAIVGTLADPKEARAGIKEVHFFPFNPVDKRTALTFIDADGNWHRA  422

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +EDLK+KVH++IDK+AERGLRSL VARQ VP+K+K+S G PW+FV
Sbjct  423   SKGAPEQILTLCNCKEDLKKKVHAIIDKFAERGLRSLGVARQVVPQKSKDSAGGPWEFV  481



>ref|NP_001105470.1| plasma-membrane H+ATPase2 [Zea mays]
 emb|CAA59800.1| H(+)-transporting ATPase [Zea mays]
Length=948

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/477 (90%), Positives = 453/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IPIEEVFEQLKC+REGL+S EG  RL+IFGPN+LEEKKESK+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALAN  GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANSGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSI VG+L E+IVM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTM IGSH+
Sbjct  244   GNFCICSIGVGILVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMPIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTEN DAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYIDA GNWHRVSK
Sbjct  364   RASRTENLDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LC+ +EDL+RKVHS+IDKYAERGLRSLAVARQEVPEK KESPG PWQFV
Sbjct  424   GAPEQILDLCHCKEDLRRKVHSIIDKYAERGLRSLAVARQEVPEKNKESPGGPWQFV  480



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/481 (89%), Positives = 458/481 (95%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I+LE I N+ +DLEKI +EEVFEQLKC++ GLTSDEGANRLQIFGPNK+EEKKESK L
Sbjct  3     KAISLEDITNKNIDLEKILVEEVFEQLKCTKXGLTSDEGANRLQIFGPNKVEEKKESKFL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAAIMAIALANGD +PPDWQDFVGI+CLLVINS ISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGDRRPPDWQDFVGIICLLVINSAISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDG+W+E++AAILVPGDI+S+KLGDIIPADARLLEGDPLKVDQS
Sbjct  123   AAAALMAGLAPKTKVLRDGKWNEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQKV
Sbjct  183   ALTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIAVGM+ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLT NKLS+DKNLIEVFAK VDKD V+
Sbjct  303   GSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTFNKLSIDKNLIEVFAKAVDKDYVI  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDAAMVGML DPKEARAGIREVHFLPF+PVDKRTALTYIDA GNWH
Sbjct  363   LLAARASRVENQDAIDAAMVGMLGDPKEARAGIREVHFLPFDPVDKRTALTYIDAAGNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQIL LCN RED+K+KVHS IDK+AERGLRSLAVARQ+VPEK+KESPG PW F
Sbjct  423   RASKGAPEQILALCNCREDVKKKVHSCIDKFAERGLRSLAVARQQVPEKSKESPGGPWXF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/483 (89%), Positives = 460/483 (95%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G K   LE IKNE+VDL +IP+EEVFE+LKC+++GL S+E A RLQ+FGPNKLEEKKESK
Sbjct  5     GAKGSGLEHIKNESVDLVRIPMEEVFEELKCTKQGLASEEAAYRLQLFGPNKLEEKKESK  64

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGIVCLL INSTISFIEENNA
Sbjct  65    FLKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIVCLLFINSTISFIEENNA  124

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+S+KLGDIIPADARLLEGDPLKVD
Sbjct  125   GNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVD  184

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGES+PV K+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  185   QSALTGESIPVNKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQ  244

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG++ ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  245   KVLTAIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  304

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLI+VFAKGVDK+ 
Sbjct  305   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIDVFAKGVDKEH  364

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHF PFNPVDKRTALTYID+ GN
Sbjct  365   VILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGN  424

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED++RKVH+VIDK+AERGLRSLAVARQEVPEK K+SPG PW
Sbjct  425   WHRASKGAPEQILNLCNCKEDVRRKVHAVIDKFAERGLRSLAVARQEVPEKNKDSPGGPW  484

Query  1789  QFV  1797
             QFV
Sbjct  485   QFV  487



>gb|AAL09726.1| AT5g57350/MJB24_16 [Arabidopsis thaliana]
Length=949

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/477 (91%), Positives = 457/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE I NE VDLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5     LEDIVNENVDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVINSTISF+EENNAGNAAAA
Sbjct  65    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFVEENNAGNAAAA  124

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  184

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLP TK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  185   ESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  244

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG+  E++VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  245   GNFCICSIAVGIAIEIVVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  304

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV+ KGV+KD+VLLFAA
Sbjct  305   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVYCKGVEKDEVLLFAA  364

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALT+ID+ GNWHRVSK
Sbjct  365   RASRVENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTFIDSNGNWHRVSK  424

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LCNAR DL+++VHS IDKYAERGLRSLAV+RQ VPEKTKES GSPW+FV
Sbjct  425   GAPEQILDLCNARADLRKRVHSTIDKYAERGLRSLAVSRQTVPEKTKESSGSPWEFV  481



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/481 (90%), Positives = 455/481 (95%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I LE IKNE VDLE IPIEEVFEQLKCSREGLTSDEGANRL +FGPNKLEEKKESK L
Sbjct  3     KAINLEDIKNEAVDLENIPIEEVFEQLKCSREGLTSDEGANRLNLFGPNKLEEKKESKFL  62

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGN  122

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMA LAPK KVLRDGRW EQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQS
Sbjct  123   AAAALMANLAPKCKVLRDGRWGEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQS  182

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTKSPGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  183   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKV  242

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCI SIAVGM+ E+IVMYPIQ R YR GI+NLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCIVSIAVGMVIEIIVMYPIQRRAYRSGINNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVDK+ VL
Sbjct  303   GSHKLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFCKGVDKEHVL  362

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAIDA MVGML+DPKEARAGIRE+HFLPFNPVDKRTALTYIDA GNWH
Sbjct  363   LLAARASRVENQDAIDACMVGMLSDPKEARAGIREIHFLPFNPVDKRTALTYIDASGNWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             RVSKGAPEQIL+L N RED+++KVH+VI+K+AERGLRSL VARQEVPEK K+SPG+PWQF
Sbjct  423   RVSKGAPEQILDLANCREDVRKKVHAVIEKFAERGLRSLGVARQEVPEKNKDSPGAPWQF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/479 (90%), Positives = 461/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             ++LE+IKNETVDLEKIPIEEVFEQLKC+REGL++DEG NRL+IFGPNKLEEKKESKLLKF
Sbjct  3     LSLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGTNRLEIFGPNKLEEKKESKLLKF  62

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG+GKPPDWQDFVGI+CLLVINSTISFIEENNAGNAA
Sbjct  63    LGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIMCLLVINSTISFIEENNAGNAA  122

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSAL
Sbjct  123   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  182

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVT++P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  183   TGESLPVTRNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  242

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+GML E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  243   AIGNFCICSIAIGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  302

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVFAKG DK+ VLL 
Sbjct  303   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGFDKENVLLC  362

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASR ENQDAIDAA+VG LADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  363   AARASRVENQDAIDAAIVGTLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRA  422

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED K+KVH++IDK+AERGLRSL VA Q VPEK+K+S G PWQFV
Sbjct  423   SKGAPEQILTLCNCKEDQKKKVHAIIDKFAERGLRSLGVASQVVPEKSKDSAGGPWQFV  481



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/479 (90%), Positives = 460/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTS+EG NRLQ+FGPNKLEEKKESK LKF
Sbjct  4     ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSEEGGNRLQVFGPNKLEEKKESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRD RWSEQ+AAILVPGDI+SIKLGDIIPADARLLEGDPL VDQSAL
Sbjct  124   AALMAGLAPKTKVLRDNRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTKSP DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKSPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG++ ELIVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGIVIELIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGV+K+ V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEAR+GIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARSGIREVHFLPFNPVDKRTALTYIDSDGNWHRA  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI+ LCN +ED++RKVH+VIDK+AERGLRSL VARQEVPEK+K+SPG PWQFV
Sbjct  424   SKGAPEQIITLCNCKEDVRRKVHAVIDKFAERGLRSLGVARQEVPEKSKDSPGGPWQFV  482



>ref|NP_001054118.1| Os04g0656100 [Oryza sativa Japonica Group]
 sp|Q7XPY2.1|PMA1_ORYSJ RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Oryza sativa Japonica Group]
 emb|CAE03410.3| OSJNBa0071I13.11 [Oryza sativa Japonica Group]
 dbj|BAF16032.1| Os04g0656100 [Oryza sativa Japonica Group]
 emb|CAH66693.1| OSIGBa0158D24.1 [Oryza sativa Indica Group]
 gb|EAY95868.1| hypothetical protein OsI_17734 [Oryza sativa Indica Group]
Length=951

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/477 (90%), Positives = 455/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+IKNE VDLE IPIEEVFEQLKC+REGL+S+EG  R+++FGPNKLEEKKESK+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSEEGNRRIEMFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDW+DFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ E+IVM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GNWHR SK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL LCN +ED+KRKVH+VIDKYAERGLRSLAVARQEVPEK+KES G PWQFV
Sbjct  424   GAPEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGPWQFV  480



>ref|XP_010443420.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/477 (92%), Positives = 455/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE I NE +DLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5     LEDIVNENIDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  124

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTG  184

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLP TK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  185   ESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  244

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ ELIVMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  245   GNFCICSIAVGIVIELIVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  304

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV A+GV+KD+VLLFAA
Sbjct  305   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKDEVLLFAA  364

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDAAMVGMLADPKEARAGIRE+HF PFNPVDKRTALTYID  GNWHRVSK
Sbjct  365   RASRVENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDGNGNWHRVSK  424

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LCNAR DL+++VHS IDKYAERGLRSLAVARQ VPEKTKES GSPW+FV
Sbjct  425   GAPEQILDLCNARPDLRKRVHSAIDKYAERGLRSLAVARQTVPEKTKESSGSPWEFV  481



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/479 (90%), Positives = 459/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLE+IP+EEVFEQLKCSREGLTS+EG+NRLQ+FGPNKLEEKKESK LKF
Sbjct  4     ISLEEIKNENVDLERIPVEEVFEQLKCSREGLTSEEGSNRLQVFGPNKLEEKKESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAALMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKT+VLRD RWSE++AAILVPGDI+SIKLGDIIPADARLLEGD L VDQSAL
Sbjct  124   AALMAGLAPKTRVLRDSRWSEEDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLP TK+P DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPATKNPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG+L ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGILIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRS  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+++K HSVIDK+AERGLRSL VARQE+PEK K+SPG+PWQFV
Sbjct  424   SKGAPEQILNLCNCKEDVRKKAHSVIDKFAERGLRSLGVARQEIPEKNKDSPGAPWQFV  482



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/479 (90%), Positives = 457/479 (95%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLE+IP+EEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEK+ESK LKF
Sbjct  4     ISLEEIKNENVDLERIPVEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKRESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIISLLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKT+VLRDGRWSE++AAILVPGDI+SIKLGDIIPADARLLEGD L VDQSAL
Sbjct  124   AALMAGLAPKTRVLRDGRWSEEDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLP TK+P DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPATKNPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG+L EL+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGILIELVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAG+REVHF PFNPVDKRTALTYIDA GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARAGVREVHFFPFNPVDKRTALTYIDADGNWHRS  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+++K HS IDK+AERGLRSL VARQE+PEK K+SPG+PWQFV
Sbjct  424   SKGAPEQILNLCNCKEDVRKKAHSTIDKFAERGLRSLGVARQEIPEKDKDSPGAPWQFV  482



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/479 (90%), Positives = 460/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTS+EGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4     ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSEEGANRLQVFGPNKLEEKKESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRD RWSEQ+AAILVPGDI+SIKLGDIIPADARLLEGDPL VDQSAL
Sbjct  124   AALMAGLAPKTKVLRDNRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTKSP DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKSPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG+  ELIVMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGIAIELIVMYPIQHRRYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGV+K+ V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEAR+G+REVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARSGVREVHFLPFNPVDKRTALTYIDSDGNWHRA  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI+ LCN +ED++RKVH+VIDK+AERGLRSL VARQEVPEK+K+SPG PWQFV
Sbjct  424   SKGAPEQIITLCNCKEDVRRKVHAVIDKFAERGLRSLGVARQEVPEKSKDSPGGPWQFV  482



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/483 (88%), Positives = 460/483 (95%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+ S++L++IK+E VDLEKIPIEEVF+ LKCSREGL+S EGANRLQIFGPNKLEEKK+SK
Sbjct  4     GNSSMSLQEIKDEKVDLEKIPIEEVFDSLKCSREGLSSAEGANRLQIFGPNKLEEKKDSK  63

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVMEAAA+MAI LANGD KPPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  64    FLKFLGFMWNPLSWVMEAAALMAIVLANGDHKPPDWQDFVGIIILLVINSTISFIEENNA  123

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDGRW EQEA+ILVPGDI+SIKLGDI+PADARLLEGD LK+D
Sbjct  124   GNAAAALMANLAPKTKVLRDGRWGEQEASILVPGDIISIKLGDIVPADARLLEGDALKID  183

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGES+PVTK+PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  184   QSALTGESMPVTKNPGEEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  243

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLT+IGNFCICSIA+GML E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  244   KVLTSIGNFCICSIAIGMLIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  303

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NL+EVFAKGV+K+ 
Sbjct  304   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLVEVFAKGVEKEY  363

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GN
Sbjct  364   VILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGN  423

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LC  +ED+K+K H VI+K+A+RGLRSLAVARQEVPEKTKESPG PW
Sbjct  424   WHRASKGAPEQILTLCRCKEDVKKKAHGVIEKFADRGLRSLAVARQEVPEKTKESPGGPW  483

Query  1789  QFV  1797
             QFV
Sbjct  484   QFV  486



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/479 (89%), Positives = 461/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE+VDLE+IPI+EVFEQLKCSR+GLTS+EGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4     ISLEEIKNESVDLERIPIDEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRD RWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPL +DQSAL
Sbjct  124   AALMAGLAPKTKVLRDSRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLSIDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTKS  DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+G+L ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAIGILVELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKG++K+ V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVMLL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ G WHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWHRA  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI+ LCN +ED+++KVH+VIDK+AERGLRSL VARQEVPE+TK+SPG PWQFV
Sbjct  424   SKGAPEQIINLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPERTKDSPGGPWQFV  482



>ref|XP_011045013.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Populus euphratica]
Length=822

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/479 (90%), Positives = 466/479 (97%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGANRLQ+FGPNKLEEKKESK+LKF
Sbjct  7     ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGANRLQVFGPNKLEEKKESKILKF  66

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LL+INSTISFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLLINSTISFIEENNAGNAA  126

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+G++ E++VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGIIIEIVVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVFAKGV+K+ V+L 
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEHVMLL  366

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRA  426

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+KRKVHSVIDK+AERGLRSL VARQEVPEK+K++PG+PWQ V
Sbjct  427   SKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLGVARQEVPEKSKDAPGAPWQLV  485



>ref|XP_010483247.1| PREDICTED: ATPase 3, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/477 (91%), Positives = 455/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE I NE +DLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5     LENIVNENIDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  124

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTG  184

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLP TK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VLTAI
Sbjct  185   ESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAI  244

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG++ ELIVMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  245   GNFCICSIAVGIVIELIVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  304

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV A+GV+KD+VLLFAA
Sbjct  305   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKDEVLLFAA  364

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDAAMVGMLADPKEARAGIRE+HF PFNPVDKRTALTYID+ GNWHRVSK
Sbjct  365   RASRVENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHRVSK  424

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LCNAR DL+++VHS IDKYAERGLRSLAVARQ VPEKTKES GSPW+FV
Sbjct  425   GAPEQILDLCNARPDLRKRVHSAIDKYAERGLRSLAVARQTVPEKTKESSGSPWEFV  481



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/483 (90%), Positives = 460/483 (95%), Gaps = 3/483 (1%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNETVDLEK+PIEEVFEQLKC+REGL+S+EGANRLQIFGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNETVDLEKVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+SIKLGD       LLEGDPLKVD
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGD---XXXXLLEGDPLKVD  179

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+  DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  180   QSALTGESLPVTKNNYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  239

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGMLAE+IVMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  240   KVLTAIGNFCICSIAVGMLAEIIVMYPIQRREYRKGIDNLLVLLIGGIPIAMPTVLSVTM  299

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVFAKGVD D 
Sbjct  300   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVDPDH  359

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             VLL AARASR ENQDAIDAA+VG LADPKEARAGI+EVHF PFNPVDKRTALTYID+ GN
Sbjct  360   VLLLAARASRIENQDAIDAAIVGTLADPKEARAGIKEVHFFPFNPVDKRTALTYIDSNGN  419

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +EDLK+KVHSVIDK+AERGLRSLAVARQEVPEK+K++PG PW
Sbjct  420   WHRASKGAPEQILSLCNCKEDLKKKVHSVIDKFAERGLRSLAVARQEVPEKSKDAPGGPW  479

Query  1789  QFV  1797
             QFV
Sbjct  480   QFV  482



>emb|CDY67153.1| BnaAnng23670D [Brassica napus]
Length=918

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/478 (90%), Positives = 456/478 (95%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKC++EGLT+ EG  R+QIFGPNKLEEKKESK+LKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEERIQIFGPNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPAD RLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADCRLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVT+ PG EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTRHPGQEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             +L+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   KLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNP DKRTALTYID+ GNWHRVS
Sbjct  363   AMASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDSSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL ++V ++IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  423   KGAPEQILELAKANNDLSKRVLNIIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_006282289.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
 gb|EOA15187.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
Length=949

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/477 (91%), Positives = 455/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE I NE VDLEKIPIEEVF+QLKC+REGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5     LEDIVNENVDLEKIPIEEVFQQLKCTREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  124

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  184

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLP TK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  185   ESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  244

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG+  EL+VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  245   GNFCICSIAVGLAIELVVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  304

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV A+GV+KD+V+LFAA
Sbjct  305   LSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKDEVVLFAA  364

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDAAMVGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID  GNWHRVSK
Sbjct  365   RASRVENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDGNGNWHRVSK  424

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LCNAR DL+++VHS IDKYAERGLRSLAVARQ VPEKTKES G PW+FV
Sbjct  425   GAPEQILDLCNARPDLRKRVHSAIDKYAERGLRSLAVARQTVPEKTKESSGGPWEFV  481



>ref|NP_001292679.1| plasma membrane ATPase 4 [Cucumis sativus]
 gb|ABW25091.1| plasma membrane proton pump [Cucumis sativus]
Length=953

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/479 (90%), Positives = 457/479 (95%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             ++LE+IKNETVDLEKIPI EVFEQLKC  EGLT+ EG NRLQ+FGPNKLEEKKESK+LKF
Sbjct  5     LSLEEIKNETVDLEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKILKF  64

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG GKPPDW+DFVGI+CLLVINSTISFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVINSTISFIEENNAGNAA  124

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVS+KLGDIIPADARLLEGDPLKVDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSVKLGDIIPADARLLEGDPLKVDQSAL  184

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+PGDE+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDST+QVGHFQKVLT
Sbjct  185   TGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVLT  244

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+GML E+I M PIQHRKYRDGIDNL VLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIALGMLIEIIGMCPIQHRKYRDGIDNLFVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             H+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD NL+EVFAKGVDK  V+L 
Sbjct  305   HKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFAKGVDKQHVILL  364

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHF PFNPVDKRTALTYID+ GNWHR 
Sbjct  365   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHRA  424

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+K+K H+VIDK+AERGLRSLAV RQEVPEK KESPGSPWQFV
Sbjct  425   SKGAPEQILTLCNCKEDVKKKAHAVIDKFAERGLRSLAVGRQEVPEKRKESPGSPWQFV  483



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/479 (90%), Positives = 459/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLE+IP++EVFEQLKCSREGLTSDEGA+RLQ+FGPNKLEEKKESKLLKF
Sbjct  4     ISLEEIKNENVDLERIPVDEVFEQLKCSREGLTSDEGASRLQVFGPNKLEEKKESKLLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+ LLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIVLLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDIIPADARLLEGD L VDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLP TK P DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPATKKPHDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG++ ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGIVIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDK GTLTLNKLSVDKNL+EVFAKGV+KD V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKAGTLTLNKLSVDKNLVEVFAKGVEKDYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRS  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED++++ H+ IDK+AERGLRSL VARQEVPE+TKES G+PWQFV
Sbjct  424   SKGAPEQILNLCNCKEDVRKRAHATIDKFAERGLRSLGVARQEVPERTKESLGAPWQFV  482



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/479 (90%), Positives = 458/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLEKIP+EEVFE LKCSR GLTSDEGA+RLQ+FGPNKLEEKKESKLLKF
Sbjct  4     ISLEEIKNENVDLEKIPVEEVFESLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKLLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRW+EQ+AAILVPGDI+SIKLGDIIPADARLLEGD L VDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+P +EVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKNPSEEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG++ ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRS  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED++++VH  IDK+AERGLRSL VARQEVPEK K+SPG+PWQFV
Sbjct  424   SKGAPEQILNLCNCKEDVRKRVHGTIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQFV  482



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/479 (90%), Positives = 458/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4     ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKKESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDIIPADARLLEGDPL VDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTKS  DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+G+  ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAIGIAIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGV+K+ V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEAR+GIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARSGIREVHFLPFNPVDKRTALTYIDSDGNWHRS  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI+ LCN +ED+++KVH+VIDK+AERGLRSL VARQEVPEK+K+  G PWQFV
Sbjct  424   SKGAPEQIITLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPEKSKDGAGGPWQFV  482



>ref|XP_009128001.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
 emb|CDY28167.1| BnaA01g06820D [Brassica napus]
Length=948

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/478 (90%), Positives = 456/478 (95%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKC++EGLT+ EG  R+QIFGPNKLEEKKESK+LKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEERIQIFGPNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPAD RLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADCRLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVT+ PG EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTRHPGQEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             +L+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   KLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNP DKRTALTYID+ GNWHRVS
Sbjct  363   AMASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDSSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL ++V ++IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  423   KGAPEQILELAKANNDLSKRVLNIIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/483 (88%), Positives = 460/483 (95%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+ +LE++KNETVDLEKIPIEEVFEQLKC++EGLTS EGA+RLQIFGPNKLEEKKESK
Sbjct  3     GDKASSLEELKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGADRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVME AAIMAIALANG G+ PDWQDF+GI  LLVINSTISFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEMAAIMAIALANGGGRAPDWQDFLGIAILLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPK KVLRDG W+EQ+AAILVPGDI+SIKLGDIIPAD+RLLEGDPLK+D
Sbjct  123   GNAAAALMARLAPKAKVLRDGTWAEQDAAILVPGDIISIKLGDIIPADSRLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PG  V+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIA G++ E+IVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIATGIVIEIIVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD 
Sbjct  303   AIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGMLADPKEARAGI+EVHFLPFNPVDKRTALTY+DA GN
Sbjct  363   VVLLAARASRTENQDAIDAAMVGMLADPKEARAGIQEVHFLPFNPVDKRTALTYVDANGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI+ LC+ +ED++++VH+VIDK+AERGLRSLAVARQEVPE+TKES G+PW
Sbjct  423   WHRASKGAPEQIMSLCSCKEDVRKRVHAVIDKFAERGLRSLAVARQEVPERTKESAGTPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/486 (88%), Positives = 459/486 (94%), Gaps = 5/486 (1%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K I LE+IKNE VDLE+IP+EEVFEQLKC++EGL++ EGA+RL+IFGPNKLEEKKESK L
Sbjct  5     KGIPLEEIKNENVDLERIPVEEVFEQLKCTKEGLSTQEGASRLEIFGPNKLEEKKESKFL  64

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVME+AAIMAIALANGDGKPPDWQDFVGI+CLLVINSTISF+EENNAGN
Sbjct  65    KFLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIICLLVINSTISFVEENNAGN  124

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDG+W E+EAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQS
Sbjct  125   AAAALMAGLAPKTKVLRDGKWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQS  184

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHT-----FFGKAAHLVDSTNQVG  1059
             ALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHT     FFGKAAHLVDSTNQVG
Sbjct  185   ALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTTGVHTFFGKAAHLVDSTNQVG  244

Query  1060  HFQKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLS  1239
             HFQKVLTAIGNFCI SIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLS
Sbjct  245   HFQKVLTAIGNFCIVSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLS  304

Query  1240  VTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVD  1419
             VTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF KGVD
Sbjct  305   VTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVD  364

Query  1420  KDQVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA  1599
             KD V+L AARASR ENQDAIDAA+VGMLADPKEARAG+REVHFLPFNPVDKRTALTYID 
Sbjct  365   KDHVMLLAARASRVENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDT  424

Query  1600  QGNWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPG  1779
              G WHR SKGAPEQI+ LC  +ED K+KVH++IDK+AERGLRSLAVARQEVPEK KES G
Sbjct  425   DGIWHRASKGAPEQIMILCGLKEDAKKKVHAIIDKFAERGLRSLAVARQEVPEKAKESAG  484

Query  1780  SPWQFV  1797
              PW+FV
Sbjct  485   GPWEFV  490



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/479 (90%), Positives = 458/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLEKIP+EEVFE LKCSR GLTSDEGA+RLQ+FGPNKLEEKKESKLLKF
Sbjct  4     ISLEEIKNENVDLEKIPVEEVFESLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKLLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRW+EQ+AAILVPGDI+SIKLGDIIPADARLLEGD L VDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+P +EVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKNPSEEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG++ ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRS  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED++++VH  IDK+AERGLRSL VARQEVPEK K+SPG+PWQFV
Sbjct  424   SKGAPEQILNLCNCKEDVRKRVHGTIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQFV  482



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/485 (90%), Positives = 458/485 (94%), Gaps = 1/485 (0%)
 Frame = +1

Query  346   MGDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekke  522
             M +K SI+LE+IKNETVDLEKIPIEEVFE L+C+REGL+S+EG  RLQIFGPNKLEEKKE
Sbjct  1     MAEKASISLEEIKNETVDLEKIPIEEVFENLRCTREGLSSEEGETRLQIFGPNKLEEKKE  60

Query  523   skllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEn  702
             SK+LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLL+INSTISFIEEN
Sbjct  61    SKILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIICLLLINSTISFIEEN  120

Query  703   nagnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLK  882
             NAGNAAAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDIIPADARLLEGD LK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDSLK  180

Query  883   VDQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  1062
             VDQSALTGESLPVTK   DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH
Sbjct  181   VDQSALTGESLPVTKDAHDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  1063  FQKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  1242
             FQKVLTAIGNFCICSIAVGML E++VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAVGMLTEILVMYPIQHREYRKGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1243  TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDK  1422
             TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD NLIEVFAKGVD 
Sbjct  301   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLIEVFAKGVDP  360

Query  1423  DQVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQ  1602
               VLL AARASR ENQDAIDAA+VG LADPKEARAGI EVHF PFNPVDKRTALTYID+ 
Sbjct  361   PHVLLLAARASRVENQDAIDAAIVGTLADPKEARAGITEVHFFPFNPVDKRTALTYIDSH  420

Query  1603  GNWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGS  1782
             G+WHR SKGAPEQIL LCN  ED+KRKVHSVIDK+AERGLRSLAVARQEVPEK+KES G+
Sbjct  421   GHWHRASKGAPEQILTLCNCNEDMKRKVHSVIDKFAERGLRSLAVARQEVPEKSKESHGA  480

Query  1783  PWQFV  1797
             PWQF+
Sbjct  481   PWQFI  485



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/479 (90%), Positives = 457/479 (95%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLEKIP+EEVFE LKCS  GLTSDEGANRLQ+FGPNKLEEKKESKLLKF
Sbjct  4     ISLEEIKNENVDLEKIPVEEVFESLKCSTAGLTSDEGANRLQVFGPNKLEEKKESKLLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRW+EQ+AAILVPGDI+SIKLGDIIPADARLLEGD L VDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+P +EVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKNPSEEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG++ ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRS  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED++++VH  IDK+AERGLRSL VARQEVPEK K+SPG+PWQFV
Sbjct  424   SKGAPEQILNLCNCKEDVRKRVHGTIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQFV  482



>gb|EAZ32257.1| hypothetical protein OsJ_16461 [Oryza sativa Japonica Group]
Length=951

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/476 (90%), Positives = 454/476 (95%), Gaps = 0/476 (0%)
 Frame = +1

Query  370   EQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGF  549
             ++I+NE VDLE IPIEEVFEQLKC+REGL+S+EG  R+++FGPNKLEEKKESK+LKFLGF
Sbjct  5     QEIQNEAVDLENIPIEEVFEQLKCTREGLSSEEGNRRIEMFGPNKLEEKKESKILKFLGF  64

Query  550   MWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaal  729
             MWNPLSWVME AAIMAIALANG GKPPDW+DFVGI+ LLVINSTISFIEENNAGNAAAAL
Sbjct  65    MWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAAL  124

Query  730   maglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGE  909
             MA LAPKTKVLRDGRW EQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSALTGE
Sbjct  125   MANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGE  184

Query  910   SLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIG  1089
             SLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VLTAIG
Sbjct  185   SLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAIG  244

Query  1090  NFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  1269
             NFCICSIAVG++ E+IVM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+L
Sbjct  245   NFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKL  304

Query  1270  SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAAR  1449
             SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AAR
Sbjct  305   SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLLLAAR  364

Query  1450  ASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKG  1629
             ASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDA GNWHR SKG
Sbjct  365   ASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASKG  424

Query  1630  APEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             APEQIL LCN +ED+KRKVH+VIDKYAERGLRSLAVARQEVPEK+KES G PWQFV
Sbjct  425   APEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGPWQFV  480



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/485 (89%), Positives = 463/485 (95%), Gaps = 2/485 (0%)
 Frame = +1

Query  349   GDK-SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             GDK SI+L+QIKNETVDLE+IPIEEVFEQLKC+REGL+S EG NR+QIFGPNKLEEKKES
Sbjct  4     GDKGSISLDQIKNETVDLERIPIEEVFEQLKCTREGLSSTEGENRIQIFGPNKLEEKKES  63

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K LKFLGFMWNPLSWVMEAAA+MAIALANG+G+PPDWQDFVGI+CLLVINSTISFIEENN
Sbjct  64    KFLKFLGFMWNPLSWVMEAAALMAIALANGEGQPPDWQDFVGIICLLVINSTISFIEENN  123

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPL V
Sbjct  124   AGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMV  183

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQ+ALTGESLPVT+ PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHF
Sbjct  184   DQAALTGESLPVTRHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHF  243

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             Q VL AIGNFCICSIAVGMLAE+IVMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  244   QTVLRAIGNFCICSIAVGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  303

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSH+L+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVF KGVDK+
Sbjct  304   MAIGSHKLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFVKGVDKE  363

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQ-  1602
              V+L AARA+RTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTY+D   
Sbjct  364   HVMLLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYVDNND  423

Query  1603  GNWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGS  1782
             G+WHR SKGAPEQI+ LCN RED K+KVH++I+K+AERGLRSL VARQ+VPEKTKES G+
Sbjct  424   GSWHRASKGAPEQIMNLCNLREDEKKKVHAIIEKFAERGLRSLGVARQKVPEKTKESAGA  483

Query  1783  PWQFV  1797
             PWQFV
Sbjct  484   PWQFV  488



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/479 (89%), Positives = 460/479 (96%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLE+IP+EEVFEQLKCSR GLTSDEGA+RLQ+FGPNKLEEKKESK+LKF
Sbjct  4     ISLEEIKNENVDLERIPVEEVFEQLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKVLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LL+INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLIINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRW+EQ+AAILVPGDIVSIKLGDIIPADARLLEGD L VDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWTEQDAAILVPGDIVSIKLGDIIPADARLLEGDALSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLP TK+P DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPATKNPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVG++ ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKG++KD V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGIEKDFVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ G+WHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGSWHRS  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED++++VH VIDK+AERGLRSL VA+Q+VPEK K+SPG+PWQFV
Sbjct  424   SKGAPEQILNLCNCKEDVRKRVHGVIDKFAERGLRSLGVAKQDVPEKNKDSPGAPWQFV  482



>ref|XP_010489446.1| PREDICTED: ATPase 1, plasma membrane-type [Camelina sativa]
Length=949

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/477 (92%), Positives = 461/477 (97%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/479 (90%), Positives = 466/479 (97%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGANRLQ+FGPNKLEEKKESK+LKF
Sbjct  7     ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGANRLQVFGPNKLEEKKESKILKF  66

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LL+INSTISFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLLINSTISFIEENNAGNAA  126

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+G++ E++VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGIIIEIVVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVFAKGV+K+ V+L 
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEHVMLL  366

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRA  426

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+KRKVHSVIDK+AERGLRSL VARQEVPEK+K++PG+PWQ V
Sbjct  427   SKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLGVARQEVPEKSKDAPGAPWQLV  485



>ref|XP_010452018.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/477 (91%), Positives = 453/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE I NE +DLEKIPIEEVF+QLKCSREGL+  EG NRLQIFGPNKLEEKKESKLLKFLG
Sbjct  5     LEDIVNENIDLEKIPIEEVFQQLKCSREGLSGAEGENRLQIFGPNKLEEKKESKLLKFLG  64

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  124

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALTG  184

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLP TK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VLTAI
Sbjct  185   ESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAI  244

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVG+  EL+VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  245   GNFCICSIAVGIFIELVVMYPIQGRHYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  304

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV A+GV+KD+VLLFAA
Sbjct  305   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKDEVLLFAA  364

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDAAMVGMLADPKEARAGIRE+HF PFNPVDKRTALTYID+ GNWHRVSK
Sbjct  365   RASRVENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHRVSK  424

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LCNAR DL+++VHS IDKYAERGLRSLAVARQ VPEKTKES GS W+FV
Sbjct  425   GAPEQILDLCNARPDLRKRVHSAIDKYAERGLRSLAVARQTVPEKTKESSGSAWEFV  481



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/479 (88%), Positives = 454/479 (95%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LEQIKNETVDLE IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKESKLLKF
Sbjct  4     ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKESKLLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLK+DQSAL
Sbjct  124   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLT
Sbjct  184   TGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVGML E+IVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVF K +DKD VLL+
Sbjct  304   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKDMDKDTVLLY  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             +ARASR ENQDAIDA++VGMLADPKEARAGI+E+HFLPFNPVDKRTA+TYID+ G WHR 
Sbjct  364   SARASRVENQDAIDASIVGMLADPKEARAGIQEIHFLPFNPVDKRTAITYIDSNGKWHRA  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI++LCN ++D K+KVH +IDK+A+RGLRSL VARQE+PE  KES G PWQF+
Sbjct  424   SKGAPEQIIDLCNLKDDAKKKVHEMIDKFADRGLRSLGVARQEIPEANKESAGGPWQFM  482



>dbj|BAJ34124.1| unnamed protein product [Thellungiella halophila]
Length=948

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/478 (92%), Positives = 458/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEKIPIEEVF+QLKCSREGLT+ EG +R+QIFGPNKLEEKKESK+LKFL
Sbjct  3     SLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWHRVS
Sbjct  363   AMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILEL  A  DL +KV S+IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  423   KGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_003580730.1| PREDICTED: plasma membrane ATPase [Brachypodium distachyon]
Length=951

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/477 (89%), Positives = 454/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+I+NE VDLE IPIEEVFEQLKC+REGLTSDEGA R+ IFG NKLEEKKESK+LKFLG
Sbjct  4     LEEIRNEAVDLENIPIEEVFEQLKCTREGLTSDEGAQRVTIFGLNKLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG+GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGEGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEA+ILVPGDIVSIKLGDI+PADARLLEGDPLK+DQS LTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSGLTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCI SIAVG++ E+IVM+PIQ RKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCIVSIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGVDK+ VLL AA
Sbjct  304   LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNP DKRTALTYIDA+GNWHR SK
Sbjct  364   RASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQI+ LCN +ED+KRKVHSVI+KYAERGLRSLAVARQEVPEK+K+SPG PWQF+
Sbjct  424   GAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSPGGPWQFI  480



>ref|XP_006296920.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
 gb|EOA29818.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
Length=949

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/477 (92%), Positives = 460/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_010414918.1| PREDICTED: ATPase 1, plasma membrane-type-like isoform X2 [Camelina 
sativa]
Length=949

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/477 (92%), Positives = 460/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/479 (90%), Positives = 456/479 (95%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLE+IPIEEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4     ISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKKESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDII ADARLLEGDPL VDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIAADARLLEGDPLSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTKS  DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+G+  ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAIGIAIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEM GMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGV+K+ V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMDGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEAR+GIREVHFLPFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLADPKEARSGIREVHFLPFNPVDKRTALTYIDSDGNWHRS  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI+ LCN +ED+++KVH+VIDK+AERGLRSL VARQEVPEK+K+  G PWQFV
Sbjct  424   SKGAPEQIITLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPEKSKDGAGGPWQFV  482



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/483 (89%), Positives = 459/483 (95%), Gaps = 11/483 (2%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    LLKFLGFMWNPLSWVMEAAAVMAIALANGGGRPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQEA+ILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQEASILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P +EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPSEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+L ELIVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGILIELIVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLS           GV+K+ 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLS-----------GVEKEH  351

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GN
Sbjct  352   VMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGN  411

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED K++VH+VIDK+AERGLRSLAVARQ+VPEKTKESPG+PW
Sbjct  412   WHRASKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESPGTPW  471

Query  1789  QFV  1797
             QFV
Sbjct  472   QFV  474



>ref|XP_010467735.1| PREDICTED: ATPase 1, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/477 (92%), Positives = 460/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_002886251.1| hypothetical protein ARALYDRAFT_480836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62510.1| hypothetical protein ARALYDRAFT_480836 [Arabidopsis lyrata subsp. 
lyrata]
Length=949

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/477 (92%), Positives = 459/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+ LKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQSLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>emb|CDY25913.1| BnaC09g32850D [Brassica napus]
Length=952

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/478 (90%), Positives = 457/478 (96%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  7     SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  66

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIVCLLVINSTISF EENNAGNAAA
Sbjct  67    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVINSTISFWEENNAGNAAA  126

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALT
Sbjct  127   ALMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALT  186

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLP TK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  187   GESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  246

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCI SIAVG++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  247   IGNFCIISIAVGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  306

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             +LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV A+GV+K++VLL A
Sbjct  307   KLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKEEVLLLA  366

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASRTENQDAIDAAMVGMLADPKEARAGIREVHF PFNPVDKRTALTYID  G+WHRVS
Sbjct  367   ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDGNGDWHRVS  426

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL+LCNAR DL+++VHS IDKYAERGLRSLAVARQ VPE+TKESPG PW+FV
Sbjct  427   KGAPEQILDLCNARADLRKRVHSAIDKYAERGLRSLAVARQTVPERTKESPGGPWEFV  484



>ref|XP_010414912.1| PREDICTED: ATPase 1, plasma membrane-type-like isoform X1 [Camelina 
sativa]
Length=980

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/477 (92%), Positives = 460/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/479 (88%), Positives = 456/479 (95%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLE+IP+EEVFEQLKCS+EGL+SDEGANRLQ+FGPNKLEEKKESK LKF
Sbjct  4     ISLEEIKNENVDLERIPVEEVFEQLKCSKEGLSSDEGANRLQVFGPNKLEEKKESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIISLLVINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKT+VLRDGRWSE++ AILVPGDI+SIKLGDIIPADARLLEGD L VDQSAL
Sbjct  124   AALMAGLAPKTRVLRDGRWSEEDTAILVPGDIISIKLGDIIPADARLLEGDALSVDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLP TK+P DE FSGST K+GEIEAVVIATGVHTFFGKAAHLVD+TNQVGHFQKVLT
Sbjct  184   TGESLPATKNPSDESFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+G+L EL+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIALGILIELVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAK V+KD V+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKNVEKDYVILL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLA+PKEARAG+RE+HF PFNPVDKRTALTYID+ GNWHR 
Sbjct  364   AARASRTENQDAIDAAIVGMLANPKEARAGVREIHFFPFNPVDKRTALTYIDSDGNWHRS  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+++K HSVIDK+AERGLRSL VARQEVPEK K+SPG+PWQFV
Sbjct  424   SKGAPEQILNLCNCKEDVRKKAHSVIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQFV  482



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/479 (90%), Positives = 464/479 (97%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE+VDLE+IPIEEVFEQLKCSREGLTSDEGA RLQ+FGPNKLEEKKESK+LKF
Sbjct  7     ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGATRLQVFGPNKLEEKKESKILKF  66

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAA+MAI LANGDG+PPDWQDFVGIV LLVINSTISFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+G++ E++VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGIIIEIVVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVFAKGV+K+ V+L 
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEHVMLL  366

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID  GNWHR 
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHRA  426

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQIL LCN +ED+KRKVHSVIDK+AERGLRSL VA+QEVPEK+K++PG+PWQ V
Sbjct  427   SKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAPGAPWQLV  485



>emb|CDX72218.1| BnaC07g42400D [Brassica napus]
Length=911

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/478 (90%), Positives = 454/478 (95%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEK+PIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFL
Sbjct  3     SLENIKNETVDLEKVPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG  VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E++VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEILVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             +L+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   KLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNP DKRTALTYID+ GNWHRVS
Sbjct  363   AMASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDSSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILELC A  DL ++V  +I+KYAERGLRSLAV+RQ VPEKTKESPG  W+FV
Sbjct  423   KGAPEQILELCKASNDLSKRVLDIIEKYAERGLRSLAVSRQTVPEKTKESPGGRWEFV  480



>ref|XP_009112568.1| PREDICTED: ATPase 1, plasma membrane-type [Brassica rapa]
 emb|CDY30294.1| BnaA09g09830D [Brassica napus]
Length=949

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/477 (92%), Positives = 460/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV   +DKYAERGLRSLAVARQ VPEKTKESPG+PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVFGCMDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV  480



>sp|P83970.1|PMA1_WHEAT RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Triticum aestivum]
 gb|AAS55889.1| plasma membrane H+-ATPase [Triticum aestivum]
Length=951

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/477 (89%), Positives = 454/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+I+NE VDLE IPIEEVFEQLKC+R+GLTSDEGA R++IFG NKLEEKKESK+LKFLG
Sbjct  4     LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEA+ILVPGDIVSIKLGDI+PADARLLEGDPLK+DQS LTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSGLTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCI SIAVG++ E+IVM+PIQ RKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCIVSIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGVDK+ VLL AA
Sbjct  304   LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNP DKRTALTYIDA+GNWHR SK
Sbjct  364   RASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQI+ LCN +ED+KRKVHSVI+KYAERGLRSLAVARQEVPEK+K+SPG PWQF+
Sbjct  424   GAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSPGGPWQFI  480



>gb|EMT26270.1| Plasma membrane ATPase [Aegilops tauschii]
Length=951

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/477 (89%), Positives = 454/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+I+NE VDLE IPIEEVFEQLKC+R+GLTSDEGA R++IFG NKLEEKKESK+LKFLG
Sbjct  4     LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEA+ILVPGDIVSIKLGDI+PADARLLEGDPLK+DQS LTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSGLTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCI SIAVG++ E+IVM+PIQ RKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCIVSIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGVDK+ VLL AA
Sbjct  304   LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNP DKRTALTYIDA+GNWHR SK
Sbjct  364   RASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQI+ LCN +ED+KRKVHSVI+KYAERGLRSLAVARQEVPEK+K+SPG PWQF+
Sbjct  424   GAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSPGGPWQFI  480



>ref|XP_006409094.1| hypothetical protein EUTSA_v10022531mg [Eutrema salsugineum]
 gb|ESQ50547.1| hypothetical protein EUTSA_v10022531mg [Eutrema salsugineum]
Length=949

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/477 (92%), Positives = 459/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKES G PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESSGGPWEFV  480



>emb|CDX82608.1| BnaC07g02580D [Brassica napus]
Length=949

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/477 (91%), Positives = 458/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV   +DKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVFGCMDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/479 (89%), Positives = 451/479 (94%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LEQIKNETVDLE IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKE KLLKF
Sbjct  4     ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLK+DQSAL
Sbjct  124   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLP TK+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLT
Sbjct  184   TGESLPATKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVGML E+IVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIE+FAK  DKD VLL+
Sbjct  304   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIELFAKDTDKDTVLLY  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASR ENQDAIDA++VGMLADPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G WHR 
Sbjct  364   AARASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHRA  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI++LCN +ED ++KVH +IDK+A+RGLRSLAVA QEVPE  KES G PWQF+
Sbjct  424   SKGAPEQIVDLCNLKEDAEKKVHEMIDKFADRGLRSLAVACQEVPEANKESAGGPWQFM  482



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/479 (89%), Positives = 451/479 (94%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LEQIKNETVDLE IP+EEVFEQLKCSREGLTS EG  RLQIFGPNKLEEKKE KLLKF
Sbjct  4     ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLK+DQSAL
Sbjct  124   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLP TK+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLT
Sbjct  184   TGESLPATKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIAVGML E+IVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIE+FAK  DKD VLL+
Sbjct  304   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIELFAKDTDKDTVLLY  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASR ENQDAIDA++VGMLADPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G WHR 
Sbjct  364   AARASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHRA  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI++LCN +ED ++KVH +IDK+A+RGLRSLAVA QEVPE  KES G PWQF+
Sbjct  424   SKGAPEQIVDLCNLKEDAEKKVHEMIDKFADRGLRSLAVACQEVPEANKESAGGPWQFM  482



>gb|KCW81010.1| hypothetical protein EUGRSUZ_C023861, partial [Eucalyptus grandis]
Length=935

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/466 (91%), Positives = 447/466 (96%), Gaps = 0/466 (0%)
 Frame = +1

Query  400   EKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVME  579
             EKIPIEEVFEQLKC+  GLT+ EG +RLQIFGPNKLEEKKESK LKFLGFMWNPLSWVME
Sbjct  1     EKIPIEEVFEQLKCTPNGLTTQEGESRLQIFGPNKLEEKKESKFLKFLGFMWNPLSWVME  60

Query  580   aaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalmaglaPKTKV  759
             AAA+MAI LANG+GKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAALMAGLAPKTKV
Sbjct  61    AAALMAIVLANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAALMAGLAPKTKV  120

Query  760   LRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKSPGD  939
             LRDG+WSEQEAA+LVPGDI+SIKLGDIIPADARLLEGDPLK+DQSALTGESLPVTK+P D
Sbjct  121   LRDGKWSEQEAAMLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPSD  180

Query  940   EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVG  1119
             EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAIGNFCICSIAVG
Sbjct  181   EVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICSIAVG  240

Query  1120  MLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  1299
             ML E+IVMYPIQHRKYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM
Sbjct  241   MLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  300

Query  1300  TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARASRTENQDAI  1479
             TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+K+ V+L AARASRTENQDAI
Sbjct  301   TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKEHVILLAARASRTENQDAI  360

Query  1480  DAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAPEQILELCN  1659
             DAA+VGML DPKEARA IREVHF PFNPVDKRTALTY+D  GNWHR SKGAPEQIL LCN
Sbjct  361   DAAIVGMLGDPKEARADIREVHFFPFNPVDKRTALTYVDPAGNWHRASKGAPEQILNLCN  420

Query  1660  AREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             AR+DL++KV+++IDK+AERGLRSLAVARQEVPEKTKESPG PWQFV
Sbjct  421   ARDDLRKKVYAIIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFV  466



>ref|XP_009137897.1| PREDICTED: ATPase 2, plasma membrane-type-like isoform X2 [Brassica 
rapa]
Length=948

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/478 (90%), Positives = 454/478 (95%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEK+PIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFL
Sbjct  3     SLENIKNETVDLEKVPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG  VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E++VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEILVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             +L+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   KLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNP DKRTALTYID+ GNWHRVS
Sbjct  363   AMASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDSSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILELC A  DL ++V  +I+KYAERGLRSLAV+RQ VPEKTKES GS W+FV
Sbjct  423   KGAPEQILELCKASNDLSKRVLDIIEKYAERGLRSLAVSRQTVPEKTKESLGSRWEFV  480



>ref|XP_009120261.1| PREDICTED: ATPase 3, plasma membrane-type [Brassica rapa]
Length=952

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/478 (90%), Positives = 456/478 (95%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  7     SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  66

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIVCLLVINSTISF EENNAGNAAA
Sbjct  67    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVINSTISFWEENNAGNAAA  126

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALT
Sbjct  127   ALMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALT  186

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLP TK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  187   GESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  246

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCI SIAVG++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  247   IGNFCIISIAVGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  306

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             +LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV A+GV+K++VLL A
Sbjct  307   KLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKEEVLLLA  366

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASRTENQDAIDAAMVGMLADPKEARAGIREVHF PFNPVDKRTALTYID  G+WHRVS
Sbjct  367   ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDGNGDWHRVS  426

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL+LCNAR DL+++VHS IDKYAERGLRSLAVARQ VPE+TKES G PW+FV
Sbjct  427   KGAPEQILDLCNARADLRKRVHSAIDKYAERGLRSLAVARQTVPERTKESSGGPWEFV  484



>gb|KFK40274.1| hypothetical protein AALP_AA3G353600 [Arabis alpina]
Length=949

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/477 (91%), Positives = 455/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG  R+ IFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEERIVIFGPNKLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAI LANGD +PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIVLANGDNRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTY+D  GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYVDGDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>ref|XP_006848755.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/481 (87%), Positives = 456/481 (95%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I+LE+IKNE +DLE+IPIEEVFE LKCS+EGL+S+EG  RLQIFGPNKLEEKKESK+L
Sbjct  5     KAISLEEIKNEAIDLERIPIEEVFELLKCSKEGLSSEEGEQRLQIFGPNKLEEKKESKVL  64

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVME AA+MAI LANG GKPPDWQDFVGIV LL+INSTISFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMEVAALMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGN  124

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGD++SIKLGDI+PADARLL GDPLK+DQS
Sbjct  125   AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDVISIKLGDIVPADARLLVGDPLKIDQS  184

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  185   ALTGESLPVTKHPGEEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIA+GML E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCICSIALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVD+D+V+
Sbjct  305   GSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDRDKVV  364

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAID A+V MLADP+EARAGI+EVHFLPFNPVDKRTA+TYI++ G+WH
Sbjct  365   LLAARASRVENQDAIDTAIVNMLADPQEARAGIQEVHFLPFNPVDKRTAITYIESDGSWH  424

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQI++LCN RED ++KVHS+IDKYA+RGLRSLAVARQ VPE TKES G PW+F
Sbjct  425   RASKGAPEQIVDLCNLREDARKKVHSIIDKYADRGLRSLAVARQVVPEATKESAGRPWEF  484

Query  1795  V  1797
             V
Sbjct  485   V  485



>dbj|BAJ33915.1| unnamed protein product [Thellungiella halophila]
Length=949

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/477 (92%), Positives = 459/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTC+QGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCEQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV S IDKYAERGLRSLAVARQ VPEKTKES G PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESSGGPWEFV  480



>emb|CDX72217.1| BnaC07g42390D [Brassica napus]
Length=910

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/477 (90%), Positives = 453/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFLG
Sbjct  3     LEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFLG  62

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  63    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  122

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  123   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  182

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG  VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  183   ESLPVTKHPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  242

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  243   GNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  302

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  303   LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  362

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGML+DPKEARAGIREVHFLPFNP DKRTALTYID+ GNWHRVSK
Sbjct  363   MASRIENQDAIDAAMVGMLSDPKEARAGIREVHFLPFNPTDKRTALTYIDSSGNWHRVSK  422

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQILELC A  DL ++V  +I+KYAERGLRSLAV+RQ VPEKTKES GS W+FV
Sbjct  423   GAPEQILELCKASNDLSKRVLDIIEKYAERGLRSLAVSRQTVPEKTKESLGSRWEFV  479



>emb|CDY51650.1| BnaAnng10900D [Brassica napus]
Length=910

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/477 (90%), Positives = 453/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFLG
Sbjct  3     LEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFLG  62

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  63    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  122

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  123   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  182

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG  VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  183   ESLPVTKHPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  242

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  243   GNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  302

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  303   LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  362

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGML+DPKEARAGIREVHFLPFNP DKRTALTYID+ GNWHRVSK
Sbjct  363   MASRIENQDAIDAAMVGMLSDPKEARAGIREVHFLPFNPTDKRTALTYIDSSGNWHRVSK  422

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQILELC A  DL ++V  +I+KYAERGLRSLAV+RQ VPEKTKES GS W+FV
Sbjct  423   GAPEQILELCKASNDLSKRVLDIIEKYAERGLRSLAVSRQTVPEKTKESLGSRWEFV  479



>emb|CDY47940.1| BnaA02g08160D [Brassica napus]
 emb|CDY42259.1| BnaC02g11560D [Brassica napus]
Length=951

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/478 (90%), Positives = 456/478 (95%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  6     SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  65

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIVCLLVINSTISF EENNAGNAAA
Sbjct  66    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVINSTISFWEENNAGNAAA  125

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALT
Sbjct  126   ALMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALT  185

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLP TK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTA
Sbjct  186   GESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTA  245

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCI SIAVG++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  246   IGNFCIISIAVGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  305

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             +LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV A+GV+K++VLL A
Sbjct  306   KLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKEEVLLLA  365

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASRTENQDAIDAAMVGMLADPKEARAGIRE+HF PFNPVDKRTALTYID  G+WHRVS
Sbjct  366   ARASRTENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDGNGDWHRVS  425

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL+LCNAR DL+++VHS IDKYAERGLRSLAVARQ VPEKTKES G PW+FV
Sbjct  426   KGAPEQILDLCNARADLRKRVHSAIDKYAERGLRSLAVARQTVPEKTKESSGGPWEFV  483



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/483 (88%), Positives = 458/483 (95%), Gaps = 11/483 (2%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+I+LE+IKNE+VDLE+IPIEEVFEQLKC+REGLT DEGANRLQ+FGPNKLEEKKESK
Sbjct  3     GDKAISLEEIKNESVDLERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGIV LLVINSTISFIEENNA
Sbjct  63    LLKFLGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQ+A+ILVPGDI+SIKLGD            PLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDX-----------PLKID  171

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  172   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  231

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVG+L ELIVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  232   KVLTAIGNFCICSIAVGILIELIVMYPIQKRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  291

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ 
Sbjct  292   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEH  351

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GN
Sbjct  352   VMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGN  411

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQIL LCN +ED K++VH+VIDK+AERGLRSLAVARQ+VPEKTKESPG+PW
Sbjct  412   WHRASKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESPGTPW  471

Query  1789  QFV  1797
             QFV
Sbjct  472   QFV  474



>ref|XP_009137896.1| PREDICTED: ATPase 2, plasma membrane-type-like isoform X1 [Brassica 
rapa]
Length=976

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/478 (90%), Positives = 454/478 (95%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNETVDLEK+PIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFL
Sbjct  3     SLENIKNETVDLEKVPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFL  62

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  122

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  182

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK PG  VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  183   GESLPVTKHPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIA+GM+ E++VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAIGMVIEILVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             +L+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFA
Sbjct  303   KLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFA  362

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             A ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNP DKRTALTYID+ GNWHRVS
Sbjct  363   AMASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDSSGNWHRVS  422

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQILELC A  DL ++V  +I+KYAERGLRSLAV+RQ VPEKTKES GS W+FV
Sbjct  423   KGAPEQILELCKASNDLSKRVLDIIEKYAERGLRSLAVSRQTVPEKTKESLGSRWEFV  480



>emb|CDY38294.1| BnaA10g11420D [Brassica napus]
Length=952

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/478 (89%), Positives = 456/478 (95%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE IKNE VDLEKIPIEEVF+QLKCSR+GL+  EG +RLQ+FGPNKLEEKKESK+LKFL
Sbjct  7     SLEDIKNENVDLEKIPIEEVFQQLKCSRDGLSGAEGESRLQLFGPNKLEEKKESKILKFL  66

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIVCLLVINSTISF EENNAGNAAA
Sbjct  67    GFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVINSTISFWEENNAGNAAA  126

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSEQEA+ILVPGDIVSIKLGDIIPADARLLEGD LKVDQSALT
Sbjct  127   ALMAGLAPKTKVLRDGKWSEQEASILVPGDIVSIKLGDIIPADARLLEGDALKVDQSALT  186

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLP TK PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  187   GESLPATKGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  246

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCI SIAVG++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  247   IGNFCIISIAVGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  306

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             +LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV A+GV+K++VLL A
Sbjct  307   KLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKEEVLLLA  366

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASRTENQDAIDAAMVGMLADPKEARAGIRE+HF PFNPVDKRTALTYID  G+WHRVS
Sbjct  367   ARASRTENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDGNGDWHRVS  426

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQIL+LCNAR DL++++HS IDKYAERGLRSLAVARQ VPE+TKES G PW+FV
Sbjct  427   KGAPEQILDLCNARADLRKRIHSAIDKYAERGLRSLAVARQTVPERTKESSGGPWEFV  484



>ref|XP_009137895.1| PREDICTED: ATPase 2, plasma membrane-type-like [Brassica rapa]
Length=947

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/477 (90%), Positives = 453/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFLG
Sbjct  3     LEDIKNETVDLEKIPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFLG  62

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  63    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  122

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  123   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  182

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG  VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  183   ESLPVTKHPGQGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  242

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+GM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  243   GNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  302

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  303   LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  362

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGML+DPKEARAGIREVHFLPFNP DKRTALTYID+ GNWHRVSK
Sbjct  363   MASRIENQDAIDAAMVGMLSDPKEARAGIREVHFLPFNPTDKRTALTYIDSSGNWHRVSK  422

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQILELC A  DL ++V  +I+KYAERGLRSLAV+RQ VPEKTKES GS W+FV
Sbjct  423   GAPEQILELCKASNDLSKRVLDIIEKYAERGLRSLAVSRQTVPEKTKESLGSRWEFV  479



>emb|CDY64741.1| BnaCnng44750D [Brassica napus]
Length=949

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/477 (91%), Positives = 459/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG +R+QIFGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV   +DKYAERGLRSLAVARQ VPEKTKES G+PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVFGCMDKYAERGLRSLAVARQVVPEKTKESLGAPWEFV  480



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/480 (87%), Positives = 457/480 (95%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             S++L+ IKNETVDLE+IPI+EVFEQLKC+REGL++ EG NR+QIFGPNKLEEKKESK LK
Sbjct  8     SLSLDNIKNETVDLERIPIDEVFEQLKCTREGLSTAEGENRIQIFGPNKLEEKKESKFLK  67

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVMEAAA+MAIALANGD +PPDW+DFVGI+CLLVINSTISFIEENNAGNA
Sbjct  68    FLGFMWNPLSWVMEAAAVMAIALANGDRQPPDWEDFVGIICLLVINSTISFIEENNAGNA  127

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPL VDQ+A
Sbjct  128   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQAA  187

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVT+ PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQ VL
Sbjct  188   LTGESLPVTRHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQIVL  247

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
              +IGNFCICSIAVGM+ E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  248   KSIGNFCICSIAVGMVVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  307

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SH+L+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGVDK+ V+L
Sbjct  308   SHKLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVDKEHVIL  367

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
              AARA+RTENQDAIDAA+VGMLADPKEARAGIREVHF PFNPVDKRTALTY+D  G+WHR
Sbjct  368   LAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYVDGDGSWHR  427

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQI+ LCN ++D K+KVH++I+K+AERGLRSL VARQEVPEKTKES G+PWQFV
Sbjct  428   ASKGAPEQIMNLCNLKDDAKKKVHAIIEKFAERGLRSLGVARQEVPEKTKESAGAPWQFV  487



>ref|XP_011625062.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Amborella trichopoda]
Length=979

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/481 (87%), Positives = 456/481 (95%), Gaps = 0/481 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I+LE+IKNE +DLE+IPIEEVFE LKCS+EGL+S+EG  RLQIFGPNKLEEKKESK+L
Sbjct  5     KAISLEEIKNEAIDLERIPIEEVFELLKCSKEGLSSEEGEQRLQIFGPNKLEEKKESKVL  64

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVME AA+MAI LANG GKPPDWQDFVGIV LL+INSTISFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMEVAALMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGN  124

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGD++SIKLGDI+PADARLL GDPLK+DQS
Sbjct  125   AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDVISIKLGDIVPADARLLVGDPLKIDQS  184

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  185   ALTGESLPVTKHPGEEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIA+GML E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCICSIALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVD+D+V+
Sbjct  305   GSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDRDKVV  364

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAID A+V MLADP+EARAGI+EVHFLPFNPVDKRTA+TYI++ G+WH
Sbjct  365   LLAARASRVENQDAIDTAIVNMLADPQEARAGIQEVHFLPFNPVDKRTAITYIESDGSWH  424

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQI++LCN RED ++KVHS+IDKYA+RGLRSLAVARQ VPE TKES G PW+F
Sbjct  425   RASKGAPEQIVDLCNLREDARKKVHSIIDKYADRGLRSLAVARQVVPEATKESAGRPWEF  484

Query  1795  V  1797
             V
Sbjct  485   V  485



>gb|KFK27283.1| h(+)-atpase 3 [Arabis alpina]
Length=951

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/477 (89%), Positives = 452/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE I NE VDLEKIPIEEVF+ LKCSREGL+  +G NRLQ+FGPNKLEEKKESKLLKFLG
Sbjct  7     LEDIMNEKVDLEKIPIEEVFQSLKCSREGLSGADGENRLQLFGPNKLEEKKESKLLKFLG  66

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGIV LL+INSTISFIEENNAGNAAAA
Sbjct  67    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  126

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+W+EQEA+ILVPGDI+SIKLGDIIPADARLLEGD LKVDQSALTG
Sbjct  127   LMAGLAPKTKVLRDGKWTEQEASILVPGDIISIKLGDIIPADARLLEGDALKVDQSALTG  186

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLP TK PG+EVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI
Sbjct  187   ESLPATKGPGEEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  246

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCI SIA+G+  EL+VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  247   GNFCIVSIAIGIAIELVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHK  306

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             L+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEV AKGV+KD+VLLFAA
Sbjct  307   LAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCAKGVEKDEVLLFAA  366

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDAAMVGMLADPKEARAGIRE+HF PFNPVDKRTALTYID  GNWHRVSK
Sbjct  367   RASRVENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDGNGNWHRVSK  426

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LCNAR DL+++VHS I+KYAERGLRSLAVARQ VPEKTKES G PW+FV
Sbjct  427   GAPEQILDLCNARADLRKRVHSAIEKYAERGLRSLAVARQTVPEKTKESSGGPWEFV  483



>gb|AAB35314.2| plasma membrane H(+)-ATPase precursor [Vicia faba]
Length=956

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/481 (88%), Positives = 457/481 (95%), Gaps = 1/481 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             +I+LEQIKNE+VDLEKIPIEEVF QLKC+REGL+S EG +R+QIFGPNKLEEKKESK LK
Sbjct  3     AISLEQIKNESVDLEKIPIEEVFAQLKCTREGLSSTEGESRIQIFGPNKLEEKKESKFLK  62

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVMEAAA+MAIALANG G+PPDWQDFVGIVCLLVINSTISFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAVMAIALANGGGQPPDWQDFVGIVCLLVINSTISFIEENNAGNA  122

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQ+A
Sbjct  123   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQAA  182

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVT+ PG EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD+TN VGHFQ VL
Sbjct  183   LTGESLPVTRHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNNVGHFQMVL  242

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
              +IGNFCICSIAVGMLAE+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   KSIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVF KG+DK+ V+L
Sbjct  303   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFIKGMDKEHVIL  362

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQ-GNWH  1614
              AARA+RTENQDAIDAA+VGMLADPKEARA I EVHFLPFNP DKRTALTYID + G WH
Sbjct  363   LAARAARTENQDAIDAAIVGMLADPKEARAEITEVHFLPFNPNDKRTALTYIDNKDGTWH  422

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQF  1794
             R SKGAPEQI+ELCN RED ++K+HS+I+K+AERGLRSL VARQEVPEKTKES G+PWQF
Sbjct  423   RASKGAPEQIIELCNMREDAQKKIHSMIEKFAERGLRSLGVARQEVPEKTKESAGAPWQF  482

Query  1795  V  1797
             V
Sbjct  483   V  483



>gb|EMS60594.1| Plasma membrane ATPase [Triticum urartu]
Length=953

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/479 (89%), Positives = 454/479 (95%), Gaps = 2/479 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+I+NE VDLE IPIEEVFEQLKC+R+GLTSDEGA R++IFG NKLEEKKESK+LKFLG
Sbjct  4     LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQEA+ILVPGDIVSIKLGDI+PADARLLEGDPLK+DQS LTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSGLTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCI SIAVG++ E+IVM+PIQ RKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCIVSIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGVDK+ VLL AA
Sbjct  304   LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNP DKRTALTYIDA+GNWHR SK
Sbjct  364   RASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQ--EVPEKTKESPGSPWQFV  1797
             GAPEQI+ LCN +ED+KRKVHSVI+KYAERGLRSLAVARQ  EVPEK+K+SPG PWQF+
Sbjct  424   GAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQWLEVPEKSKDSPGGPWQFI  482



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/483 (87%), Positives = 459/483 (95%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+KSI+LE+IKNE VDLE+IP++EVFEQLKC++EGLT++EG  RLQIFGPNKLEEKKESK
Sbjct  3     GNKSISLEEIKNENVDLERIPVQEVFEQLKCTKEGLTTEEGEQRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AAIMAIALANG GKPPD+QDFVGIV LL INSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEIAAIMAIALANGGGKPPDYQDFVGIVVLLFINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDGRW+EQEAAILVPGD++SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIA+GML E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVF K +DKD 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKNMDKDT  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASR ENQDAIDA++VGMLADPKEARAGI+E+HFLPFNPV+KRTA+TYID+ GN
Sbjct  363   VVLIAARASRVENQDAIDASIVGMLADPKEARAGIKEIHFLPFNPVEKRTAITYIDSDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI++LCN   + K KVHS+IDK+A+RGLRSL VA+Q VPEK+KES G+PW
Sbjct  423   WHRASKGAPEQIIDLCNLNNEAKNKVHSMIDKFADRGLRSLGVAQQMVPEKSKESAGAPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_009102205.1| PREDICTED: ATPase 1, plasma membrane-type [Brassica rapa]
Length=949

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/477 (91%), Positives = 456/477 (96%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNETVDLEKIPIEEVF+QLKC+REGLT+ EG  R+Q+FGPNKLEEKKESK+LKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEERIQLFGPNKLEEKKESKILKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PG EVFSGSTCKQGEIEAVVIATG HTFFGK AHLVDSTNQVGHFQKVLT+I
Sbjct  184   ESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGGHTFFGKTAHLVDSTNQVGHFQKVLTSI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAIGIVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSK
Sbjct  364   MASRIENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+L NAR DL++KV   +DKYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  424   GAPEQILDLANARPDLRKKVFGCMDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  480



>gb|KEH39757.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=820

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/467 (90%), Positives = 449/467 (96%), Gaps = 0/467 (0%)
 Frame = +1

Query  397   LEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  576
             LE+IPI+EVFEQLKCSR+GLTS+EGANRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVM
Sbjct  19    LERIPIDEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVM  78

Query  577   EaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalmaglaPKTK  756
             EAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMAGLAPKTK
Sbjct  79    EAAAIMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGNAAAALMAGLAPKTK  138

Query  757   VLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKSPG  936
             VLRD RWSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPL +DQSALTGESLPVTKS  
Sbjct  139   VLRDSRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLSIDQSALTGESLPVTKSSS  198

Query  937   DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAV  1116
             DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIA+
Sbjct  199   DEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAI  258

Query  1117  GMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKR  1296
             G+L ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKR
Sbjct  259   GILVELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKR  318

Query  1297  MTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARASRTENQDA  1476
             MTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKG++K+ V+L AARASRTENQDA
Sbjct  319   MTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVMLLAARASRTENQDA  378

Query  1477  IDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAPEQILELC  1656
             IDAA+VGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ G WHR SKGAPEQI+ LC
Sbjct  379   IDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWHRASKGAPEQIINLC  438

Query  1657  NAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             N +ED+++KVH+VIDK+AERGLRSL VARQEVPE+TK+SPG PWQFV
Sbjct  439   NCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPERTKDSPGGPWQFV  485



>gb|AAV71150.1| plasma membrane H+-ATPase [Triticum aestivum]
Length=951

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/477 (88%), Positives = 452/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE+I+NE VDLE IPIEEVFEQLKC+R+GLTSDEGA R++IFG NKLEEKKESK+LKFLG
Sbjct  4     LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG  63

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMA LAPKTKVLRDGRW EQ A+ILVPGDIVSIKLGDI+PADARLLEGDPLK+DQS LTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQGASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSGLTG  183

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGV TFFGKAAHLVDSTNQVGHFQ+VLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVRTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCI SIAVG++ E+IVM+PIQ RKYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCIVSIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLSVDKNL+EVFAKGVDK+ VLL AA
Sbjct  304   LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAA  363

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDA MVGMLADPKEARAGIREVHFLPFNP DKRTALTYIDA+GNWHR SK
Sbjct  364   RASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASK  423

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQI+ LCN +ED+KRKVHSVI+KYAERGLRSLAVARQEVPEK+K+SPG PWQF+
Sbjct  424   GAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSPGGPWQFI  480



>emb|CDY14186.1| BnaA08g13170D [Brassica napus]
Length=939

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/466 (91%), Positives = 445/466 (95%), Gaps = 0/466 (0%)
 Frame = +1

Query  400   EKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVME  579
             EKIPIEEVF+QL C+REGLT+ EG  R+QIFGPNKLEEKKESK+LKFLGFMWNPLSWVME
Sbjct  6     EKIPIEEVFQQLNCTREGLTTQEGEERIQIFGPNKLEEKKESKILKFLGFMWNPLSWVME  65

Query  580   aaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalmaglaPKTKV  759
             AAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAALMAGLAPKTKV
Sbjct  66    AAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAALMAGLAPKTKV  125

Query  760   LRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKSPGD  939
             LRDG+WSEQEAAILVPGDIVSIKLGDIIPAD RLLEGDPLKVDQSALTGESLPVTK PG 
Sbjct  126   LRDGKWSEQEAAILVPGDIVSIKLGDIIPADGRLLEGDPLKVDQSALTGESLPVTKHPGQ  185

Query  940   EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVG  1119
             EV+SGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIA+G
Sbjct  186   EVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAIG  245

Query  1120  MLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  1299
             M+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM
Sbjct  246   MVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  305

Query  1300  TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARASRTENQDAI  1479
             TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA ASR ENQDAI
Sbjct  306   TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRIENQDAI  365

Query  1480  DAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAPEQILELCN  1659
             DAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYID+ GNWHRVSKGAPEQILEL  
Sbjct  366   DAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSSGNWHRVSKGAPEQILELAK  425

Query  1660  AREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             A  DL +KV S+I+KYAERGLRSLAVARQ VPEKTKESPG PW+FV
Sbjct  426   ANSDLSKKVLSIIEKYAERGLRSLAVARQVVPEKTKESPGGPWEFV  471



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/470 (90%), Positives = 452/470 (96%), Gaps = 4/470 (1%)
 Frame = +1

Query  400   EKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVME  579
             E+IPIEEVFEQLKC+REGLT+DEGANRLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVME
Sbjct  10    ERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVME  69

Query  580   aaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalmaglaPKTKV  759
             AAA+MAI LANGDG+PPDWQDFVGIV LLVINSTISFIEENNAGNAAAALMAGLAPKTKV
Sbjct  70    AAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAALMAGLAPKTKV  129

Query  760   LRDGRWSEQEAAILVPGDIVSIKLGDIIPADA----RLLEGDPLKVDQSALTGESLPVTK  927
             LRDGRW+EQ+A+ILVPGDI+SIKLGDI+PADA    RLLEGDPLK+DQSALTGESLPVTK
Sbjct  130   LRDGRWTEQDASILVPGDIISIKLGDIVPADAPADARLLEGDPLKIDQSALTGESLPVTK  189

Query  928   SPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  1107
             +P DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS
Sbjct  190   NPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICS  249

Query  1108  IAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  1287
             IA+G+L E+IVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI
Sbjct  250   IALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAI  309

Query  1288  TKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARASRTEN  1467
             TKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVFAKGV+K+ V+L AARASRTEN
Sbjct  310   TKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVMLLAARASRTEN  369

Query  1468  QDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAPEQIL  1647
             QDAIDAA+VGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID+ GNWHR SKGAPEQIL
Sbjct  370   QDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQIL  429

Query  1648  ELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              LCN +ED K++VH+VIDK+AERGLRSLAVARQ+VPEKTKES G+PWQFV
Sbjct  430   ALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGAPWQFV  479



>ref|XP_011625063.1| PREDICTED: plasma membrane ATPase 4 isoform X3 [Amborella trichopoda]
Length=956

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/483 (87%), Positives = 456/483 (94%), Gaps = 2/483 (0%)
 Frame = +1

Query  355   KSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskll  534
             K+I+LE+IKNE +DLE+IPIEEVFE LKCS+EGL+S+EG  RLQIFGPNKLEEKKESK+L
Sbjct  5     KAISLEEIKNEAIDLERIPIEEVFELLKCSKEGLSSEEGEQRLQIFGPNKLEEKKESKVL  64

Query  535   kFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagn  714
             KFLGFMWNPLSWVME AA+MAI LANG GKPPDWQDFVGIV LL+INSTISFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMEVAALMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGN  124

Query  715   aaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQS  894
             AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGD++SIKLGDI+PADARLL GDPLK+DQS
Sbjct  125   AAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDVISIKLGDIVPADARLLVGDPLKIDQS  184

Query  895   ALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  1074
             ALTGESLPVTK PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKV
Sbjct  185   ALTGESLPVTKHPGEEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  1075  LTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1254
             LTAIGNFCICSIA+GML E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCICSIALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  1255  GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVL  1434
             GSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVD+D+V+
Sbjct  305   GSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDRDKVV  364

Query  1435  LFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWH  1614
             L AARASR ENQDAID A+V MLADP+EARAGI+EVHFLPFNPVDKRTA+TYI++ G+WH
Sbjct  365   LLAARASRVENQDAIDTAIVNMLADPQEARAGIQEVHFLPFNPVDKRTAITYIESDGSWH  424

Query  1615  RVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQ--EVPEKTKESPGSPW  1788
             R SKGAPEQI++LCN RED ++KVHS+IDKYA+RGLRSLAVARQ   VPE TKES G PW
Sbjct  425   RASKGAPEQIVDLCNLREDARKKVHSIIDKYADRGLRSLAVARQVIVVPEATKESAGRPW  484

Query  1789  QFV  1797
             +FV
Sbjct  485   EFV  487



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/480 (87%), Positives = 453/480 (94%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             SI+LE+IKNETVDLE+IP+EEVF QLKC++EGLT+ EG  RLQIFGPNKLEEKKESK LK
Sbjct  4     SISLEEIKNETVDLERIPVEEVFTQLKCTKEGLTTAEGEQRLQIFGPNKLEEKKESKFLK  63

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGI+ LL+INSTISFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIMVLLIINSTISFIEENNAGNA  123

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  124   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVTK+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQ VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQIVL  243

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             TAIGNFCICSIA+GML E++VMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMLVEVVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVFAK  DKD VLL
Sbjct  304   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDTDKDGVLL  363

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
             +AARASR ENQDAIDA +VGMLADPKEARAGI+EVHFLPFNPV+KRTA TYID+ G WHR
Sbjct  364   YAARASRVENQDAIDACIVGMLADPKEARAGIQEVHFLPFNPVEKRTANTYIDSNGKWHR  423

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQI++LCN +ED+KRKVH +IDK+A+RGLRSL VARQ+VPE +KES G PW+F+
Sbjct  424   ASKGAPEQIIDLCNLKEDVKRKVHEIIDKFADRGLRSLGVARQQVPEASKESTGGPWEFM  483



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/479 (87%), Positives = 451/479 (94%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LEQIKNETVDLE IP++EVFEQLKCSREGLTS +G  RLQIFGPNKLEEKKESKLLKF
Sbjct  4     ISLEQIKNETVDLENIPVDEVFEQLKCSREGLTSADGEQRLQIFGPNKLEEKKESKLLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSAL
Sbjct  124   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLT
Sbjct  184   TGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSI VGML E+++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIGVGMLIEILIMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVF K +D+D V+L+
Sbjct  304   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLNVDKNLIEVFVKDMDRDTVVLY  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASR ENQDAIDA++V MLADPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G WHR 
Sbjct  364   AARASRVENQDAIDASVVAMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSDGRWHRA  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI++LCN +ED K KVH +IDK+A+RGLRSL VARQEVPE  K+S G PWQF+
Sbjct  424   SKGAPEQIIDLCNLKEDAKNKVHDMIDKFADRGLRSLGVARQEVPEADKDSAGGPWQFM  482



>ref|XP_010932230.1| PREDICTED: plasma membrane ATPase 4 [Elaeis guineensis]
Length=953

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/479 (86%), Positives = 456/479 (95%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+LE+IKNE VDLE+IPI+EVFEQLKCSREGL++ EG  RL+IFGPNKLEEKKESK+LKF
Sbjct  4     ISLEEIKNENVDLERIPIDEVFEQLKCSREGLSTAEGEQRLKIFGPNKLEEKKESKVLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVME AAIMAIALANG GKPPDWQDFVGIV LL+INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEIAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDIIPADARLL+GDPLK+DQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+PGDE+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT
Sbjct  184   TGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSI +GML E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIGLGMLVEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKN+IE+F K +DKD V+L+
Sbjct  304   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNMIEIFVKDIDKDTVVLY  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             +ARASR ENQDAIDA++VGMLADPKEARAGI+EVHFLPFNPVDKRTA+TY D+ G WHR+
Sbjct  364   SARASRVENQDAIDASVVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYTDSAGKWHRI  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI+ELCN RED K+++H++IDK+A+RGLRSL VA+QEVPE  KESPG PWQF+
Sbjct  424   SKGAPEQIIELCNMREDSKKRIHAIIDKFADRGLRSLGVAKQEVPEANKESPGGPWQFI  482



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/474 (88%), Positives = 449/474 (95%), Gaps = 0/474 (0%)
 Frame = +1

Query  376   IKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMW  555
             ++  +  +E+IP+EEVFEQLKCSR GLTSDEGANRLQ+FGPNKLEEK+ESK LKFLGFMW
Sbjct  8     VQRNSCVIERIPVEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKRESKFLKFLGFMW  67

Query  556   NPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalma  735
             NPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMA
Sbjct  68    NPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIISLLVINSTISFIEENNAGNAAAALMA  127

Query  736   glaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESL  915
             GLAPKT+VLRDGRWSE++AAILVPGDI+SIKLGDIIPADARLLEGD L VDQSALTGESL
Sbjct  128   GLAPKTRVLRDGRWSEEDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSALTGESL  187

Query  916   PVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNF  1095
             P TK+P DEVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNF
Sbjct  188   PATKNPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNF  247

Query  1096  CICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQ  1275
             CICSIAVG+L EL+VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQ
Sbjct  248   CICSIAVGILIELVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQ  307

Query  1276  QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARAS  1455
             QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGV+KD V+L AARAS
Sbjct  308   QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILLAARAS  367

Query  1456  RTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAP  1635
             RTENQDAIDAA+VGMLADPKEARAG+REVHF PFNPVDKRTALTYIDA GNWHR SKGAP
Sbjct  368   RTENQDAIDAAIVGMLADPKEARAGVREVHFFPFNPVDKRTALTYIDADGNWHRSSKGAP  427

Query  1636  EQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             EQIL LCN +ED+++K HS IDK+AERGLRSL VARQE+PEK K+SPG+PWQFV
Sbjct  428   EQILNLCNCKEDVRKKAHSTIDKFAERGLRSLGVARQEIPEKDKDSPGAPWQFV  481



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/483 (86%), Positives = 453/483 (94%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+ +I+LEQIKNE VDLE+IP+EEVF QLKC+REGLT  EG  RLQIFGPNKLEEK+ESK
Sbjct  6     GNGTISLEQIKNEAVDLERIPVEEVFAQLKCTREGLTDAEGEQRLQIFGPNKLEEKQESK  65

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             LLKFLGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGIV LL+INSTISFIEENNA
Sbjct  66    LLKFLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNA  125

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRD +WSEQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+D
Sbjct  126   GNAAAALMAGLAPKTKVLRDAKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKID  185

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQ
Sbjct  186   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQ  245

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGML E++VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  246   KVLTAIGNFCICSIAVGMLIEIVVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  305

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEV+    DKD 
Sbjct  306   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVYVNDFDKDT  365

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+LFAA ASR ENQDAIDAA+VGMLADPKEARAGI+EVHFLPFNPVDKRTA+TYID+ GN
Sbjct  366   VVLFAAMASRVENQDAIDAAIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGN  425

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI++LCN ++D K+KVHS+IDK+A+RGLR+L VARQEVPE +KES G PW
Sbjct  426   WHRSSKGAPEQIIDLCNLKDDAKKKVHSMIDKFADRGLRALGVARQEVPEASKESAGGPW  485

Query  1789  QFV  1797
             QF+
Sbjct  486   QFI  488



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/480 (86%), Positives = 449/480 (94%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             SI+LE+IKNETVDLE+IP++EVF QLKC++EGLT+ EG  RLQIFGPNKLEEK ESK LK
Sbjct  7     SISLEEIKNETVDLERIPVDEVFAQLKCTKEGLTAAEGEKRLQIFGPNKLEEKTESKFLK  66

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVME AAIMAI +ANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEIAAIMAIVMANGGGKPPDWQDFVGIMVLLVINSTISFIEENNAGNA  126

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDG+WSEQEA ILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWSEQEACILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  186

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVTK+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVL
Sbjct  187   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  246

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             TAIGNFCICSIAVGM  E++VMYPIQHRKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMFVEIVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVF K  DKD VLL
Sbjct  307   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFGKDADKDAVLL  366

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
             +AARASR ENQDAIDA +VGMLADPKEARAGI+EVHFLPFNPVDKRTA TYID+ G WHR
Sbjct  367   YAARASRVENQDAIDACIVGMLADPKEARAGIQEVHFLPFNPVDKRTANTYIDSNGKWHR  426

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQI++LCN +ED K+KVH +IDK+A+RGLRSL VARQ+VPE +KES G PW+F+
Sbjct  427   ASKGAPEQIIDLCNLKEDTKKKVHEIIDKFADRGLRSLGVARQQVPEASKESAGGPWEFM  486



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/483 (86%), Positives = 456/483 (94%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G+K+I+LE+IKNE VDLE+IP+EEVFEQLKC+R+GLT++EG  RLQIFGPNKLEEKKESK
Sbjct  3     GNKNISLEEIKNENVDLERIPVEEVFEQLKCTRQGLTTEEGEQRLQIFGPNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AA+MAI LANG G+PPD+QDFVGIV LL+INSTISFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEIAALMAIGLANGGGEPPDYQDFVGIVVLLIINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKT+VLRDG+W+EQEAAILVPGD++SIKLGDI+PADARLLEGDPLK+D
Sbjct  123   GNAAAALMAGLAPKTRVLRDGKWTEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIAVGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK++IEVF K +D+D 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVKDMDRDT  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASR ENQDAIDA++VGMLADPKEARAGI EVHFLPFNPV+KRTA+TYID+ G+
Sbjct  363   VVLIAARASRVENQDAIDASIVGMLADPKEARAGITEVHFLPFNPVEKRTAITYIDSDGH  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI++LC    + K KVH++IDK+A+RGLRSL VARQ VPEK KES G PW
Sbjct  423   WHRASKGAPEQIIDLCKMSNEAKSKVHAIIDKFADRGLRSLGVARQTVPEKNKESAGGPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/484 (85%), Positives = 457/484 (94%), Gaps = 0/484 (0%)
 Frame = +1

Query  346   MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             +G KS++LE IKNE+VDLEK+P+ EVFE LKC++EGLT++EG +RLQIFGPNKLEEK ES
Sbjct  8     VGTKSVSLEDIKNESVDLEKVPVSEVFEHLKCNQEGLTAEEGEDRLQIFGPNKLEEKTES  67

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K LKFLGFMWNPLSWVME AAIMAI LANG G+PPDWQDFVGIV LL+INSTISFIEENN
Sbjct  68    KFLKFLGFMWNPLSWVMEIAAIMAIVLANGGGEPPDWQDFVGIVVLLIINSTISFIEENN  127

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLK+
Sbjct  128   AGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  187

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK+PGDE+FSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHF
Sbjct  188   DQSALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHF  247

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIA GML E+IVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  248   QKVLTAIGNFCICSIAFGMLVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  307

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DKD
Sbjct  308   MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKDMDKD  367

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L+AARASR ENQDAIDA +VGMLADPKEARAGI+E+HFLPFNPV+KRTA+TY+D++G
Sbjct  368   TVVLYAARASRVENQDAIDACIVGMLADPKEARAGIQELHFLPFNPVEKRTAITYVDSKG  427

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
              WHR SKGAPEQI++LCN +ED ++KVH++I K+A+RGLR+L VARQEVPE +KES G+P
Sbjct  428   KWHRASKGAPEQIIDLCNMKEDARKKVHAMIGKFADRGLRALGVARQEVPEASKESAGAP  487

Query  1786  WQFV  1797
             WQF+
Sbjct  488   WQFM  491



>gb|KHM99449.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=940

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/466 (90%), Positives = 447/466 (96%), Gaps = 0/466 (0%)
 Frame = +1

Query  400   EKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVME  579
             E+IPIEEVFEQLKCSR GLTS+EG NRLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVME
Sbjct  6     ERIPIEEVFEQLKCSRAGLTSEEGGNRLQVFGPNKLEEKKESKFLKFLGFMWNPLSWVME  65

Query  580   aaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalmaglaPKTKV  759
             AAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMAGLAPKTKV
Sbjct  66    AAAIMAIALANGGGRPPDWQDFVGIIALLVINSTISFIEENNAGNAAAALMAGLAPKTKV  125

Query  760   LRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKSPGD  939
             LRD RWSEQ+AAILVPGDI+SIKLGDIIPADARLLEGDPL VDQSALTGESLPVTKSP D
Sbjct  126   LRDNRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQSALTGESLPVTKSPSD  185

Query  940   EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVG  1119
             EVFSGST K+GEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVG
Sbjct  186   EVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVG  245

Query  1120  MLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  1299
             +  ELIVMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM
Sbjct  246   IAIELIVMYPIQHRRYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  305

Query  1300  TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARASRTENQDAI  1479
             TAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGV+K+ V+L AARASRTENQDAI
Sbjct  306   TAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVILLAARASRTENQDAI  365

Query  1480  DAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAPEQILELCN  1659
             DAA+VGMLADPKEAR+G+REVHFLPFNPVDKRTALTYID+ GNWHR SKGAPEQI+ LCN
Sbjct  366   DAAIVGMLADPKEARSGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQIITLCN  425

Query  1660  AREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              +ED++RKVH+VIDK+AERGLRSL VARQEVPEK+K+SPG PWQFV
Sbjct  426   CKEDVRRKVHAVIDKFAERGLRSLGVARQEVPEKSKDSPGGPWQFV  471



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/462 (90%), Positives = 445/462 (96%), Gaps = 0/462 (0%)
 Frame = +1

Query  412   IEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVMEaaai  591
             +EEVFE+LKC+++GL S+E A RLQ+FGPNKLEEKKESK LKFLGFMWNPLSWVMEAAAI
Sbjct  1     MEEVFEELKCTKQGLASEEAAYRLQLFGPNKLEEKKESKFLKFLGFMWNPLSWVMEAAAI  60

Query  592   maialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalmaglaPKTKVLRDG  771
             MAIALANG G+PPDWQDFVGIVCLL INSTISFIEENNAGNAAAALMAGLAPKTKVLRDG
Sbjct  61    MAIALANGGGRPPDWQDFVGIVCLLFINSTISFIEENNAGNAAAALMAGLAPKTKVLRDG  120

Query  772   RWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKSPGDEVFS  951
             RWSEQEAAILVPGDI+S+KLGDIIPADARLLEGDPLKVDQSALTGES+PV K+PGDEVFS
Sbjct  121   RWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTGESIPVNKNPGDEVFS  180

Query  952   GSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGMLAE  1131
             GSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVG++ E
Sbjct  181   GSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGIIIE  240

Query  1132  LIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIE  1311
             LIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIE
Sbjct  241   LIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIE  300

Query  1312  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARASRTENQDAIDAAM  1491
             EMAGMDVLCSDKTGTLTLNKL+VD+NLI+VFAKGVDK+ V+L AARASRTENQDAIDAA+
Sbjct  301   EMAGMDVLCSDKTGTLTLNKLTVDRNLIDVFAKGVDKEHVILLAARASRTENQDAIDAAI  360

Query  1492  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAPEQILELCNARED  1671
             VGMLADPKEARAGIREVHF PFNPVDKRTALTYID+ GNWHR SKGAPEQIL LCN +ED
Sbjct  361   VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHRASKGAPEQILNLCNCKED  420

Query  1672  LKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             ++RKVH+VIDK+AERGLRSLAVARQEVPEK K+SPG PWQFV
Sbjct  421   VRRKVHAVIDKFAERGLRSLAVARQEVPEKNKDSPGGPWQFV  462



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/483 (87%), Positives = 461/483 (95%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             GDK+ +LE ++NE VDLE+IPIEEVFEQL+C++EGLTS+EGANR+QIFG NKLEEKKESK
Sbjct  3     GDKASSLEDLRNEAVDLERIPIEEVFEQLQCTKEGLTSEEGANRIQIFGQNKLEEKKESK  62

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
             +LKFLGFMWNPLSWVME AAIMAIALANG GKPPDW+DFVGIV LLVINSTISFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIVILLVINSTISFIEENNA  122

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMA LAPKTKVLRDG W EQ+AAILVPGDI+SIKLGDIIPADARLLEGDPLK+D
Sbjct  123   GNAAAALMARLAPKTKVLRDGTWCEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKID  182

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK+PGDEV+SGSTCKQGEIEAVVIATGVH+FFGKAAHLVDSTNQVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVYSGSTCKQGEIEAVVIATGVHSFFGKAAHLVDSTNQVGHFQ  242

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLT+IGNFCICSIA+G++ E+IVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTSIGNFCICSIAIGIVIEIIVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDK+LIEVFAKGVDKD 
Sbjct  303   AIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFAKGVDKDH  362

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L AARASRTENQDAIDAAMVGML+DPKEARAGIREVHF PFNPVDKRTALTY+D  GN
Sbjct  363   VVLLAARASRTENQDAIDAAMVGMLSDPKEARAGIREVHFFPFNPVDKRTALTYVDEDGN  422

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             W+RVSKGAPEQI+ LCN +ED++++VH+VIDK+AERGLRSL VARQEVPE++KES G PW
Sbjct  423   WNRVSKGAPEQIMNLCNCKEDVRKRVHTVIDKFAERGLRSLGVARQEVPERSKESHGGPW  482

Query  1789  QFV  1797
             QFV
Sbjct  483   QFV  485



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/477 (87%), Positives = 448/477 (94%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LEQIKNE+VDLE IP+EEVF QLKCSREGLTS EG  RLQIFG NKLEEK+E K+LKFLG
Sbjct  5     LEQIKNESVDLESIPVEEVFAQLKCSREGLTSAEGEQRLQIFGLNKLEEKQECKVLKFLG  64

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANG G+PPDWQDFVGIV LL+INSTISFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEIAAIMAIALANGGGEPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  124

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSALTG
Sbjct  125   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  184

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVTK PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  185   ESLPVTKHPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  244

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIAVGML E+IVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  245   GNFCICSIAVGMLIEVIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  304

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF  G+DKD V+L+AA
Sbjct  305   LSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVSGLDKDSVVLYAA  364

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
              ASR ENQDAIDA++VGMLADPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G WHR SK
Sbjct  365   MASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHRSSK  424

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQI++LCN ++D K+KVH++IDK+AERGLR+L VARQEVPE  KES G PWQF+
Sbjct  425   GAPEQIIDLCNMKDDAKKKVHAMIDKFAERGLRALGVARQEVPEANKESAGDPWQFI  481



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/484 (86%), Positives = 449/484 (93%), Gaps = 0/484 (0%)
 Frame = +1

Query  346   MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             M    I+LEQIKNE++DLE+IP+EEVFEQLKC+REGL++ EG  RLQIFG NKLEEKKES
Sbjct  1     MASGDISLEQIKNESIDLERIPVEEVFEQLKCTREGLSTTEGGRRLQIFGLNKLEEKKES  60

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K LKFLGFMWNPLSWVMEAAA+MAIALANG GKPPDWQDFVGIV LL+INSTISFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIVTLLIINSTISFIEENN  120

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDG+W+EQEAAILVPGD+VSIKLGDI+PADARLLEGDPLK+
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGKWNEQEAAILVPGDVVSIKLGDIVPADARLLEGDPLKI  180

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK+PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIA+GML E++VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMLVEIVVMYPIQHRSYRAGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDK+LIEVF K  DKD
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKDADKD  360

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L AARASR ENQDAIDA++VG LADPKEARAGI EVHFLPFNPVDKRTA+TY+D  G
Sbjct  361   TVMLLAARASRVENQDAIDASIVGTLADPKEARAGITEVHFLPFNPVDKRTAITYLDGNG  420

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHR SKGAPEQI++LCN R + K+K HS ID +A RGLRSLAVARQ VPEKTKES G P
Sbjct  421   NWHRCSKGAPEQIMDLCNLRGEAKKKAHSFIDNFAARGLRSLAVARQMVPEKTKESAGGP  480

Query  1786  WQFV  1797
             W+FV
Sbjct  481   WEFV  484



>emb|CAD29313.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=948

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/467 (90%), Positives = 443/467 (95%), Gaps = 0/467 (0%)
 Frame = +1

Query  397   LEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVM  576
             +E IPIEEVFEQLKC+REGL+S+EG  R+++FGPNKLEEKKESK+LKFLGFMWNPLSWVM
Sbjct  11    IENIPIEEVFEQLKCTREGLSSEEGNRRIEMFGPNKLEEKKESKILKFLGFMWNPLSWVM  70

Query  577   EaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalmaglaPKTK  756
             E AAIMAIALANG GKPPDW+DFVGI+ LLVINSTISFIEENNAGNAAAALMA LAPKTK
Sbjct  71    EMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAALMANLAPKTK  130

Query  757   VLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKSPG  936
             VLRDGRW EQEAAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSALTGESLPVTK+PG
Sbjct  131   VLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPG  190

Query  937   DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAV  1116
             DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ VLTAIGNFCICSIAV
Sbjct  191   DEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAIGNFCICSIAV  250

Query  1117  GMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKR  1296
             G++ E+IVM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAITKR
Sbjct  251   GIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAITKR  310

Query  1297  MTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARASRTENQDA  1476
             MTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGVDKD VLL AARA RTE QDA
Sbjct  311   MTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLLLAARAFRTETQDA  370

Query  1477  IDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAPEQILELC  1656
             IDAAMVGMLADPKEARAGIREVHFLPFNPVDK TALTYIDA GNWHR SKGAPEQIL LC
Sbjct  371   IDAAMVGMLADPKEARAGIREVHFLPFNPVDKGTALTYIDADGNWHRASKGAPEQILTLC  430

Query  1657  NAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             N +ED+KRKVH+VIDKYAERGLRSLAVARQEVPEK+KES G PWQFV
Sbjct  431   NCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGPWQFV  477



>ref|XP_012067540.1| PREDICTED: ATPase 9, plasma membrane-type [Jatropha curcas]
 gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/484 (86%), Positives = 453/484 (94%), Gaps = 0/484 (0%)
 Frame = +1

Query  346   MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             M  K+I+LE+IKNE VDLE+IP+EEVF+QL+C+REGL+S+EG  RLQIFGPNKLEEKKE+
Sbjct  1     MATKNISLEEIKNENVDLERIPVEEVFQQLQCTREGLSSEEGQKRLQIFGPNKLEEKKEN  60

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             KLLKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDF GIV LL+INSTISFIEENN
Sbjct  61    KLLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFTGIVVLLIINSTISFIEENN  120

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDGRWSEQEA ILVPGDIVSIKLGDI+PADARLLEGDPLK+
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGRWSEQEAEILVPGDIVSIKLGDIVPADARLLEGDPLKI  180

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQ+ALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN  GHF
Sbjct  181   DQAALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNEGHF  240

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSI VGM+ E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIFVGMVVEIIVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K VDKD
Sbjct  301   MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKDVDKD  360

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L  ARASR ENQDAIDA +VGML DPKEARAGI EVHFLPFNPV+KRTA+TYID+ G
Sbjct  361   TVILLGARASRVENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSDG  420

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHR+SKGAPEQI+ELCN ++D K+K  ++IDK+A+RGLRSLAV RQ VPEK KESPGSP
Sbjct  421   NWHRISKGAPEQIIELCNLKDDAKKKALAIIDKFADRGLRSLAVGRQTVPEKNKESPGSP  480

Query  1786  WQFV  1797
             WQFV
Sbjct  481   WQFV  484



>ref|XP_008367709.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=956

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/466 (89%), Positives = 447/466 (96%), Gaps = 0/466 (0%)
 Frame = +1

Query  400   EKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVME  579
             E+IP+EEVFEQLKC++EGLT +EGA+RLQ+FGPNKLEEKKESKLLKFLGFMWNPLSWVME
Sbjct  22    ERIPVEEVFEQLKCTKEGLTGEEGASRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVME  81

Query  580   aaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalmaglaPKTKV  759
             AAA+MAIALANG GKPPDWQDFVGIV LLVINSTISFIEENNAGNAAAALMAGLAPKTKV
Sbjct  82    AAALMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAALMAGLAPKTKV  141

Query  760   LRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKSPGD  939
             LRDGRW EQ+A+ILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSALTGESLPVTK+P D
Sbjct  142   LRDGRWXEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPSD  201

Query  940   EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVG  1119
             EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVD TNQVGHFQKVLTAIGNFCICSIA G
Sbjct  202   EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDXTNQVGHFQKVLTAIGNFCICSIAXG  261

Query  1120  MLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  1299
             +L E+IVMYPIQ RKYR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM
Sbjct  262   ILIEIIVMYPIQXRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  321

Query  1300  TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARASRTENQDAI  1479
             TAIEEMAGMDVLCSDKTGTLTLNKL VD+NLIEVFAKGV+K+ V+L AARASRTENQDAI
Sbjct  322   TAIEEMAGMDVLCSDKTGTLTLNKLXVDRNLIEVFAKGVEKEHVMLLAARASRTENQDAI  381

Query  1480  DAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAPEQILELCN  1659
             DAA+VGMLADPKEARAGIRE+HFLPFNPVDKRTALTYID+ GNWHR SKGAPEQIL LCN
Sbjct  382   DAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCN  441

Query  1660  AREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              +ED K++VH+VIDK+AERGLRSLAVARQ+VPEKTKES G+PWQFV
Sbjct  442   CKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGTPWQFV  487



>gb|EPS63245.1| hypothetical protein M569_11541, partial [Genlisea aurea]
Length=935

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/466 (90%), Positives = 442/466 (95%), Gaps = 0/466 (0%)
 Frame = +1

Query  400   EKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVME  579
             EKIP+EEVFEQLKC+  GLTS EG +RLQIFGPNKLEEKKESK+LKFLGFMWNPLSWVME
Sbjct  1     EKIPVEEVFEQLKCTAAGLTSAEGESRLQIFGPNKLEEKKESKILKFLGFMWNPLSWVME  60

Query  580   aaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalmaglaPKTKV  759
             +AAIMAIALANG GKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAALMAGLAPKTKV
Sbjct  61    SAAIMAIALANGSGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAALMAGLAPKTKV  120

Query  760   LRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKSPGD  939
             LRDG+W+EQEAAILVPGDI+SIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK PGD
Sbjct  121   LRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKDPGD  180

Query  940   EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVG  1119
             EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDST+QVGHFQKVLTAIGNFCI SIA+G
Sbjct  181   EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVLTAIGNFCIISIAIG  240

Query  1120  MLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  1299
             MLAE+IVMYPIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+LSQQGAITKRM
Sbjct  241   MLAEIIVMYPIQRRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLSQQGAITKRM  300

Query  1300  TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARASRTENQDAI  1479
             TAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF+KGV  D VLL AARASRTENQDAI
Sbjct  301   TAIEEMAGMDVLCSDKTGTLTLNKLTVDKALIEVFSKGVHPDHVLLLAARASRTENQDAI  360

Query  1480  DAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAPEQILELCN  1659
             DAA+VG LADPKEARAGIREVHF PFNPVDKRTALTYID+ G WHR SKGAPEQIL LCN
Sbjct  361   DAAIVGTLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGKWHRSSKGAPEQILTLCN  420

Query  1660  AREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              +ED K+KVH VIDK+AERGLRSLAVA QEVPE+TKESPG+PWQFV
Sbjct  421   CKEDFKKKVHGVIDKFAERGLRSLAVACQEVPERTKESPGAPWQFV  466



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/480 (86%), Positives = 452/480 (94%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             +++LE+IKNE+VDLE+IPIEEVFEQLKC+++GLTS+EG +RLQIFG NKLEEKKESK+LK
Sbjct  4     TMSLEEIKNESVDLERIPIEEVFEQLKCTKDGLTSEEGEHRLQIFGHNKLEEKKESKILK  63

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVME AAIMAI LANG GKPPDWQDFVGI  LL+INSTISFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNA  123

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDG+WSEQEAAILVPGD++SIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             TAIGNFCICSIAVGML E++VMYPIQ RKYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMLVEIVVMYPIQQRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF K +DKD V+L
Sbjct  304   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDMDKDSVVL  363

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
              AARASR ENQDAIDA++VGML DPKEARAGI EVHFLPFNPVDKRTA+TYIDA G+WHR
Sbjct  364   LAARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHR  423

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQI++LC  + D+K K HS+ID YA+RGLRSLAVARQ +PEKTKES G PW+FV
Sbjct  424   CSKGAPEQIIDLCELKGDVKDKAHSIIDNYADRGLRSLAVARQTIPEKTKESAGKPWEFV  483



>ref|XP_004498580.1| PREDICTED: plasma membrane ATPase-like [Cicer arietinum]
Length=952

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/480 (87%), Positives = 452/480 (94%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             SI+LEQ+KNE ++L++IP+EEVFEQLKCSR+GLTS+EG+ RLQ FGPNKLEEKKESK LK
Sbjct  3     SISLEQLKNENINLDQIPLEEVFEQLKCSRQGLTSEEGSKRLQSFGPNKLEEKKESKFLK  62

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVMEAAAIMAIALANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGNA  122

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDG+W EQ+AAILVPGDI+SIKLGDIIPADARLLEGDPL VDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGKWGEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQSA  182

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVTK P +EVFSGST K+GEIEAVV ATGVHTFFGKAAHLVDSTNQVGHFQKVL
Sbjct  183   LTGESLPVTKYPTEEVFSGSTVKKGEIEAVVYATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             T+IGNFCICSIA+G+L ELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TSIGNFCICSIAIGILIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVFAKGVDKD V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVDKDFVIL  362

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
              AARASR ENQDAIDAA+VGML+DP+EARAGI  VHFLPFNPVDKRTALTYID+ G WHR
Sbjct  363   LAARASRIENQDAIDAAIVGMLSDPQEARAGINGVHFLPFNPVDKRTALTYIDSDGYWHR  422

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQIL LCN +E +K++VH  IDK+A+RGLRSL VA QEVPE+TK+SPGSPWQFV
Sbjct  423   SSKGAPEQILNLCNCKEGVKKRVHEAIDKFAQRGLRSLGVACQEVPERTKDSPGSPWQFV  482



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/477 (89%), Positives = 455/477 (95%), Gaps = 0/477 (0%)
 Frame = +1

Query  367   LEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLG  546
             LE IKNE+VDLE+IPIEEVFEQL+C+REGLTS+EG NRLQIFG NKLEEKKESK LKFLG
Sbjct  11    LEGIKNESVDLERIPIEEVFEQLRCTREGLTSNEGENRLQIFGFNKLEEKKESKFLKFLG  70

Query  547   FMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaa  726
             FMWNPLSWVME AAIMAIALANGD KPPDWQDF+GIV LLVINSTISF+EENNAGNAAAA
Sbjct  71    FMWNPLSWVMEIAAIMAIALANGDNKPPDWQDFLGIVVLLVINSTISFVEENNAGNAAAA  130

Query  727   lmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTG  906
             LMAGLAPKTKVLRDGRW EQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQSALTG
Sbjct  131   LMAGLAPKTKVLRDGRWQEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  190

Query  907   ESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  1086
             ESLPVT++PG+EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLTAI
Sbjct  191   ESLPVTRNPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  250

Query  1087  GNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1266
             GNFCICSIA+G++ E+IVMYPIQHRKYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  251   GNFCICSIAIGIVIEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGSHR  310

Query  1267  LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAA  1446
             LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF K VDKD V+L AA
Sbjct  311   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKDHVVLLAA  370

Query  1447  RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSK  1626
             RASR ENQDAIDAA+VGMLADPKEARAG+ EVHFLPFNPV+KRTALTY+DA G WHR SK
Sbjct  371   RASRVENQDAIDAAIVGMLADPKEARAGVTEVHFLPFNPVEKRTALTYVDAHGKWHRASK  430

Query  1627  GAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             GAPEQIL+LC+ +ED++ KVHSVIDK+AERGLRSLAVARQEVPE+TKES G+PWQFV
Sbjct  431   GAPEQILDLCHCKEDVRNKVHSVIDKFAERGLRSLAVARQEVPERTKESGGTPWQFV  487



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/479 (86%), Positives = 450/479 (94%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+L++IKNE +DLE+IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKF
Sbjct  4     ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAI LANG G+PPDWQDFVGI  LL+INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRW E+EAAILVPGD++S+KLGDIIPADARLLEGDPLK+DQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWCEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK+ GDEVFSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTKNSGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+GM+ E++VMYPIQHR+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIALGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK++IEVF + VDKD ++L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVLL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
              ARASR ENQDAIDA +VGML DPKEAR GI+EVHFLPFNPVDKRTA+TYID  GNWHRV
Sbjct  364   GARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITYIDNDGNWHRV  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI+ELC+ R+D+K+K HS+IDK+A+RGLRSLAV RQ VPEKTKES G PWQFV
Sbjct  424   SKGAPEQIIELCDLRDDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFV  482



>ref|XP_010033995.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=931

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/484 (85%), Positives = 453/484 (94%), Gaps = 0/484 (0%)
 Frame = +1

Query  346   MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             M +++ +LE+I+NE VDLE+IP++EVFEQLKCSR+GL+++E   RL +FGPNKLEEKKES
Sbjct  1     MVNQNNSLEEIRNENVDLERIPVDEVFEQLKCSRDGLSTEEAQRRLPLFGPNKLEEKKES  60

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K+LKFLGFMWNPLSWVME AAIMAIALANG G+PPDWQDF GI+ LL+INSTISFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMEMAAIMAIALANGGGRPPDWQDFTGIIALLIINSTISFIEENN  120

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAA ALMAGLAPKTKVLRDG+WSE+EAAILVPGD++SIKLGDIIPADARLLEGDPLK+
Sbjct  121   AGNAAQALMAGLAPKTKVLRDGKWSEEEAAILVPGDVISIKLGDIIPADARLLEGDPLKI  180

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGV TFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVRTFFGKAAHLVDSTNQVGHF  240

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVLTAIGNFCICSIAVGM  E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVFAK VDKD
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKD  360

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
              V+L  ARASR ENQDAIDA +VGMLADPKEARA I EVHFLPFNPVDKRTA+TY+D+ G
Sbjct  361   GVILLGARASRVENQDAIDACIVGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNG  420

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             NWHRVSKGAPEQI++LC  R+D+K+KVH +IDK+A+RGLRSLAVA+Q VPEKTK+S G P
Sbjct  421   NWHRVSKGAPEQIIDLCKVRQDVKKKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEP  480

Query  1786  WQFV  1797
             WQFV
Sbjct  481   WQFV  484



>ref|XP_009398632.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=952

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/482 (87%), Positives = 451/482 (94%), Gaps = 0/482 (0%)
 Frame = +1

Query  352   DKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskl  531
             D +I+LE IKNETVDLE++PIEEVFEQLKC+++GLT+ EG  RLQIFGPNKLEEKKESK+
Sbjct  2     DGNISLEAIKNETVDLERVPIEEVFEQLKCTKDGLTTGEGDKRLQIFGPNKLEEKKESKV  61

Query  532   lkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnag  711
             LKFLGFMWNPLSWVME AAIMAIALANG G+PPDWQDFVGI+ LL+INSTISFIEENNAG
Sbjct  62    LKFLGFMWNPLSWVMEMAAIMAIALANGGGQPPDWQDFVGIIVLLLINSTISFIEENNAG  121

Query  712   naaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQ  891
             NAAAALMAGLAPKTKVLRDG WSEQ+AAILVPGDI+SIKLGDI+PADARLLEGDPLK+DQ
Sbjct  122   NAAAALMAGLAPKTKVLRDGHWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  181

Query  892   SALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  1071
             S+LTGES+PVTK PG+EVFSGSTCKQGEIEAVVIATGVHTF GKAAHLV+STN+VGHFQK
Sbjct  182   SSLTGESIPVTKFPGEEVFSGSTCKQGEIEAVVIATGVHTFLGKAAHLVESTNEVGHFQK  241

Query  1072  VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1251
             VLTAIGNFCICSIAVG++ E++VMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  242   VLTAIGNFCICSIAVGIVIEVVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  301

Query  1252  IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQV  1431
             IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVF + VDK+ V
Sbjct  302   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVRDVDKEHV  361

Query  1432  LLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNW  1611
             +L AARASR ENQDAIDAAM+  L DPKEARAGI EVHFLPFNPVDKRTALTYID  GNW
Sbjct  362   VLLAARASRIENQDAIDAAMIRTLGDPKEARAGITEVHFLPFNPVDKRTALTYIDLDGNW  421

Query  1612  HRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQ  1791
             HRVSKGAPEQIL LCN  ED++ KVH VIDK+AERGLRSLAVARQEVPEK+K+  G PWQ
Sbjct  422   HRVSKGAPEQILNLCNCNEDIRNKVHYVIDKFAERGLRSLAVARQEVPEKSKDRAGGPWQ  481

Query  1792  FV  1797
             FV
Sbjct  482   FV  483



>ref|XP_009399554.1| PREDICTED: plasma membrane ATPase isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/483 (85%), Positives = 450/483 (93%), Gaps = 0/483 (0%)
 Frame = +1

Query  349   GDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkesk  528
             G  SI+LE+I+NETVDLE IP+EEVF QLKCS+EGLT+ EG  RL IFG NKLEEKKESK
Sbjct  5     GYGSISLEEIRNETVDLESIPVEEVFTQLKCSQEGLTTAEGEQRLHIFGLNKLEEKKESK  64

Query  529   llkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnna  708
              LKFLGFMWNPLSWVME AAIMAI L NG G+PPDWQDF+GIV LL+INSTISFIEENNA
Sbjct  65    FLKFLGFMWNPLSWVMEIAAIMAIVLDNGGGEPPDWQDFIGIVVLLIINSTISFIEENNA  124

Query  709   gnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVD  888
             GNAAAALMAGLAPKTKVLRDG+WSEQEAAILVPGDI+SIKLGDIIPADARLLEGDPLK+D
Sbjct  125   GNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKID  184

Query  889   QSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  1068
             QSALTGESLPVTK PG+EVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTN VGHFQ
Sbjct  185   QSALTGESLPVTKMPGNEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQ  244

Query  1069  KVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1248
             KVLTAIGNFCICSIA+GM+ E+IVMYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  245   KVLTAIGNFCICSIAMGMIIEIIVMYPVQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  304

Query  1249  AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQ  1428
             AIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD+NLIEVF  G+D+D 
Sbjct  305   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFVNGLDRDT  364

Query  1429  VLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGN  1608
             V+L+AARASR ENQDAIDA++VGMLA+PKEARAGI EVHFLPFNPVDKRTA+TYID+ G 
Sbjct  365   VVLYAARASRVENQDAIDASIVGMLAEPKEARAGIEEVHFLPFNPVDKRTAITYIDSDGK  424

Query  1609  WHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPW  1788
             WHR SKGAPEQI++LCN ++D K+KVH++IDK+AERGLR+L VARQEVPE TK S G PW
Sbjct  425   WHRSSKGAPEQIIDLCNLKDDTKKKVHAMIDKFAERGLRALGVARQEVPEATKASAGDPW  484

Query  1789  QFV  1797
             QF+
Sbjct  485   QFM  487



>ref|XP_010033994.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW53878.1| hypothetical protein EUGRSUZ_J03094 [Eucalyptus grandis]
Length=929

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/478 (86%), Positives = 449/478 (94%), Gaps = 0/478 (0%)
 Frame = +1

Query  364   TLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFL  543
             +LE+I+NE VDLE+IP++EVFEQLKCSR+GL+++E   RL +FGPNKLEEKKESK+LKFL
Sbjct  5     SLEEIRNENVDLERIPVDEVFEQLKCSRDGLSTEEAQRRLPLFGPNKLEEKKESKVLKFL  64

Query  544   GFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaa  723
             GFMWNPLSWVME AAIMAIALANG G+PPDWQDF GI+ LL+INSTISFIEENNAGNAA 
Sbjct  65    GFMWNPLSWVMEMAAIMAIALANGGGRPPDWQDFTGIIALLIINSTISFIEENNAGNAAQ  124

Query  724   almaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  903
             ALMAGLAPKTKVLRDG+WSE+EAAILVPGD++SIKLGDIIPADARLLEGDPLK+DQSALT
Sbjct  125   ALMAGLAPKTKVLRDGKWSEEEAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALT  184

Query  904   GESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  1083
             GESLPVTK+PGDEVFSGSTCKQGEIEAVVIATGV TFFGKAAHLVDSTNQVGHFQKVLTA
Sbjct  185   GESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVRTFFGKAAHLVDSTNQVGHFQKVLTA  244

Query  1084  IGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1263
             IGNFCICSIAVGM  E+IVMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  245   IGNFCICSIAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  304

Query  1264  RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFA  1443
             RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVFAK VDKD V+L  
Sbjct  305   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKDGVILLG  364

Query  1444  ARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVS  1623
             ARASR ENQDAIDA +VGMLADPKEARA I EVHFLPFNPVDKRTA+TY+D+ GNWHRVS
Sbjct  365   ARASRVENQDAIDACIVGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNGNWHRVS  424

Query  1624  KGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             KGAPEQI++LC  R+D+K+KVH +IDK+A+RGLRSLAVA+Q VPEKTK+S G PWQFV
Sbjct  425   KGAPEQIIDLCKVRQDVKKKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEPWQFV  482



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis sativus]
Length=951

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/479 (85%), Positives = 450/479 (94%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+L++IKNE +DLE+IP+EEVFEQLKCSREGL+S+EG  RLQ+FGPNKLEEKKESK LKF
Sbjct  4     ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAI LANG G+PPDWQDFVGI  LL+INSTISFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIINSTISFIEENNAGNAA  123

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMAGLAPKTKVLRDGRW E+EAAILVPGD++S+KLGDIIPADARLLEGDPLK+DQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWCEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSAL  183

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVT+S GDEVFSGST KQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT
Sbjct  184   TGESLPVTRSSGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSIA+GM+ E++VMYPIQHR+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAMGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK++IEVF + VDKD ++L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVLL  363

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
              ARASR ENQDAIDA +VGML DPKEAR GI+EVHFLPFNPVDKRTA+T+ID  G+WHRV
Sbjct  364   GARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDGSWHRV  423

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI+ELC+ RED+K+K HS+IDK+A+RGLRSLAV RQ VPEKTKES G PWQFV
Sbjct  424   SKGAPEQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFV  482



>ref|XP_009392149.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=951

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/480 (86%), Positives = 453/480 (94%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             +I+LE+IKN+ VDLE IP+ EVFEQLKC R GLT+ EG NR++IFG NKLEEKKESK+LK
Sbjct  4     AISLEEIKNDAVDLEHIPVGEVFEQLKCDRNGLTNVEGENRIKIFGLNKLEEKKESKVLK  63

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVME+AAIMAIALANG GKPPDWQDF+GI+ LL+INSTISFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFIGIISLLIINSTISFIEENNAGNA  123

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPKTKVLRDGRWSEQ+AAILVPGDI+SIKLGDIIPADARLL+GDPLK+DQSA
Sbjct  124   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSA  183

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVT++PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVL
Sbjct  184   LTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             TAIGNFCICSIAVGM  E++VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMAIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+NLIEVF + VD++ V+L
Sbjct  304   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFERDVDREAVIL  363

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
              AARA+R ENQDAIDAA+VGMLADPKEARAGI EVHFLPFNPVDKRTA+TY+D+ GNWHR
Sbjct  364   HAARAARVENQDAIDAAIVGMLADPKEARAGIDEVHFLPFNPVDKRTAITYVDSFGNWHR  423

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQI+ELCN RED K+KVH+VIDK+A+RGLRSLAVARQE+PEK KES G PWQF+
Sbjct  424   SSKGAPEQIVELCNMREDAKKKVHAVIDKFADRGLRSLAVARQEIPEKRKESAGGPWQFM  483



>emb|CDY51651.1| BnaAnng10910D [Brassica napus]
Length=899

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/466 (90%), Positives = 443/466 (95%), Gaps = 0/466 (0%)
 Frame = +1

Query  400   EKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkFLGFMWNPLSWVME  579
             EKIPIEEVF+QLKC++EGLT+ EG  R+QIFG NKLEEKKESK+LKFLGFMWNPLSWVME
Sbjct  3     EKIPIEEVFQQLKCTKEGLTTQEGEARVQIFGLNKLEEKKESKILKFLGFMWNPLSWVME  62

Query  580   aaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaaaalmaglaPKTKV  759
             AAAIMAIALANGDG+PPDWQDFVGI+CLLVINSTISFIEENNAGNAAAALMAGLAPKTKV
Sbjct  63    AAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAALMAGLAPKTKV  122

Query  760   LRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKSPGD  939
             LRDG+WSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTK PG 
Sbjct  123   LRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKHPGQ  182

Query  940   EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVG  1119
              VFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIA+G
Sbjct  183   GVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAIG  242

Query  1120  MLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  1299
             M+ E++VMYPIQ RKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH+L+QQGAITKRM
Sbjct  243   MVIEILVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHKLAQQGAITKRM  302

Query  1300  TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLFAARASRTENQDAI  1479
             TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNL+EVF KGV+KDQVLLFAA ASR ENQDAI
Sbjct  303   TAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRIENQDAI  362

Query  1480  DAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRVSKGAPEQILELCN  1659
             DAAMVGMLADPKEARAGIREVHFLPFNP DKRTALTYID+ GNWHRVSKGAPEQILELC 
Sbjct  363   DAAMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDSSGNWHRVSKGAPEQILELCK  422

Query  1660  AREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             A  DL ++V  +I+KYAERGLRSLAV+RQ VPEKTKES GS W+FV
Sbjct  423   ASNDLSKRVLDIIEKYAERGLRSLAVSRQTVPEKTKESLGSRWEFV  468



>ref|XP_010533093.1| PREDICTED: ATPase 6, plasma membrane-type [Tarenaya hassleriana]
Length=949

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/479 (86%), Positives = 445/479 (93%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+ E+IK E VDLEKIPIEEVF+QLKCSREGL+S+EG  RLQIFGPNKLEEK E+K LKF
Sbjct  5     ISWEEIKRENVDLEKIPIEEVFQQLKCSREGLSSEEGRKRLQIFGPNKLEEKTENKFLKF  64

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGI+CLL+INSTISFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIICLLIINSTISFIEENNAGNAA  124

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMA LAPKTKVLRDG W EQEA ILVPGD+VSIKLGDIIPADARLLEGDPLK+DQSAL
Sbjct  125   AALMANLAPKTKVLRDGMWGEQEAEILVPGDLVSIKLGDIIPADARLLEGDPLKIDQSAL  184

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLP TK PGDEVFSGSTCKQGE+EAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT
Sbjct  185   TGESLPATKHPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             +IGNFCICSI VGML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   SIGNFCICSIGVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKNLIEVFAK VDKD V+L 
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKNVDKDTVILL  364

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             +ARASRTENQDAIDA++V ML DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G+WHR 
Sbjct  365   SARASRTENQDAIDASIVNMLGDPKEARAGIKEVHFLPFNPVDKRTAITYIDSNGDWHRC  424

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI++LC  + + +++ H +IDK+A+RGLRSL V+RQ VPEK KES GSPW+FV
Sbjct  425   SKGAPEQIIDLCALKGEARKRAHEIIDKFADRGLRSLGVSRQTVPEKDKESEGSPWEFV  483



>ref|XP_006848753.2| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase [Amborella 
trichopoda]
Length=953

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/484 (85%), Positives = 446/484 (92%), Gaps = 0/484 (0%)
 Frame = +1

Query  346   MGDKSITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkes  525
             M D   T  Q     VDLE+IPIEEVFE LKC++EGL+S+EG  RLQIFGPNKLEEKKE 
Sbjct  1     MADDEGTALQDILHAVDLEQIPIEEVFEHLKCTKEGLSSEEGEQRLQIFGPNKLEEKKEG  60

Query  526   kllkFLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnn  705
             K+LKFLGFMWNPLSWVME AA++AIALANG GKPPDWQDFVGIV LL+INSTISFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEVAALIAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENN  120

Query  706   agnaaaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKV  885
             AGNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGD++SIKLGDI+PADARLL GDPLK+
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDVISIKLGDIVPADARLLVGDPLKI  180

Query  886   DQSALTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  1065
             DQSALTGESLPVTK PGDEVFSGSTCKQGEIEA+VIATGVHTFFGKAAHLVDSTNQVGHF
Sbjct  181   DQSALTGESLPVTKHPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  1066  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  1245
             QKVL AIGNFCICSIA+GML E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLAAIGNFCICSIALGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1246  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  1425
             MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK +IEVF K VD+D
Sbjct  301   MAIGSHRLSKQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMIEVFTKDVDRD  360

Query  1426  QVLLFAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQG  1605
             + +L AARASR ENQDAID A+V MLADPKEARAGI+EVHFLPFNPVDKRTA+TYI++ G
Sbjct  361   KAVLLAARASRVENQDAIDTAIVSMLADPKEARAGIQEVHFLPFNPVDKRTAITYIESDG  420

Query  1606  NWHRVSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSP  1785
             +WHR SKGAPEQI++LCN RED + KVHS+IDKYA+RGLRSLAVARQEVPE TKES G P
Sbjct  421   SWHRASKGAPEQIVDLCNLREDARNKVHSIIDKYADRGLRSLAVARQEVPEATKESAGGP  480

Query  1786  WQFV  1797
             W+FV
Sbjct  481   WEFV  484



>emb|CDY69631.1| BnaCnng64550D, partial [Brassica napus]
Length=524

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/479 (84%), Positives = 440/479 (92%), Gaps = 0/479 (0%)
 Frame = +1

Query  361   ITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllkF  540
             I+ ++IKNE VDLE+IP+EEVF+QLKC++EGL+SDEG  RL+IFG NKLEEK E+K LKF
Sbjct  5     ISWDEIKNENVDLERIPVEEVFKQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKF  64

Query  541   LGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagnaa  720
             LGFMWNPLSWVME+AAIMAI LANG GKPPDWQDF+GI+ LLVINSTISFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAA  124

Query  721   aalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  900
             AALMA LAPKTKVLRDG+W EQ+A+ILVPGD++S+KLGDI+PADARLLEGDPLK+DQSAL
Sbjct  125   AALMANLAPKTKVLRDGKWGEQDASILVPGDLISVKLGDIVPADARLLEGDPLKIDQSAL  184

Query  901   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  1080
             TGESLPVTK PGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTN VGHFQKVLT
Sbjct  185   TGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  1081  AIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1260
             AIGNFCICSI +GML E++VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIGIGMLIEIVVMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1261  HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLLF  1440
             HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDK+LIEVF   +D D V+L 
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPSNLDTDAVVLM  364

Query  1441  AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHRV  1620
             AARASR ENQDAIDA++VGML DPKEAR GI+EVHFLPFNPVDKRTA+TYID  G WHR 
Sbjct  365   AARASRIENQDAIDASIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITYIDENGEWHRS  424

Query  1621  SKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
             SKGAPEQI+ELCN + + +RK H VID +AERGLRSL VA+Q VPEK+KES GSPW+FV
Sbjct  425   SKGAPEQIIELCNLQGEARRKAHEVIDGFAERGLRSLGVAQQTVPEKSKESDGSPWEFV  483



>gb|KEH39753.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/480 (86%), Positives = 449/480 (94%), Gaps = 0/480 (0%)
 Frame = +1

Query  358   SITLEQIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNkleekkeskllk  537
             SI LEQ+KNE V+LE++PIEEVF+ LKCSR+GLTS+EGA+RLQ+FGPNKLEEK E+K LK
Sbjct  3     SINLEQMKNEDVNLERVPIEEVFDHLKCSRQGLTSEEGASRLQVFGPNKLEEKSENKFLK  62

Query  538   FLGFMWNPLSWVMEaaaimaialaNGDGKPPDWQDFVGIVCLLVINSTISFIEEnnagna  717
             FLGFMWNPLSWVMEAAAIMAIALANGDG+PPDWQDFVGI+ LLVINSTISFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIALLVINSTISFIEENNAGNA  122

Query  718   aaalmaglaPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  897
             AAALMAGLAPK KVLRDG+WSEQ+AAILVPGDI+SIKLGDIIPADARLLEGD L VDQSA
Sbjct  123   AAALMAGLAPKAKVLRDGKWSEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQSA  182

Query  898   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  1077
             LTGESLPVTK    EVFSGST K+GEIEA+V ATGVHTFFGKAAHLVDSTNQVGHFQ+VL
Sbjct  183   LTGESLPVTKYATQEVFSGSTVKKGEIEAIVYATGVHTFFGKAAHLVDSTNQVGHFQQVL  242

Query  1078  TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  1257
             TAIGNFCICSIAVG+L E+IVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAVGILIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  1258  SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDQVLL  1437
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVD NLIEVF++G+DKD V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDTNLIEVFSRGMDKDFVIL  362

Query  1438  FAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAQGNWHR  1617
              AARASR ENQDAID A+VGML DP EARAGI EVHFLPFNPVDKRTALTYID+ GNWHR
Sbjct  363   LAARASRVENQDAIDTAIVGMLPDPLEARAGINEVHFLPFNPVDKRTALTYIDSDGNWHR  422

Query  1618  VSKGAPEQILELCNAREDLKRKVHSVIDKYAERGLRSLAVARQEVPEKTKESPGSPWQFV  1797
              SKGAPEQILELCN +E++ ++ H+VID++AERGLRSL VA QEVPE+TK+SPG+PWQFV
Sbjct  423   SSKGAPEQILELCNCKENVSKRAHAVIDRFAERGLRSLGVAYQEVPERTKDSPGAPWQFV  482



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5851646567995