BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7813

Length=766
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004234395.1|  PREDICTED: oxalate--CoA ligase-like                311   3e-99   Solanum lycopersicum
ref|XP_009596461.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         310   6e-99   Nicotiana tomentosiformis
gb|AAL29212.1|AF354454_1  putative acyl-CoA synthetase                  310   6e-99   Capsicum annuum
ref|XP_006353296.1|  PREDICTED: 4-coumarate--CoA ligase-like 10-like    307   1e-97   Solanum tuberosum [potatoes]
ref|XP_009803076.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         306   3e-97   Nicotiana sylvestris
ref|XP_009601805.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         306   3e-97   Nicotiana tomentosiformis
ref|XP_011048720.1|  PREDICTED: oxalate--CoA ligase                     304   2e-96   Populus euphratica
ref|XP_009767710.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    303   3e-96   Nicotiana sylvestris
ref|XP_010671877.1|  PREDICTED: oxalate--CoA ligase                     303   6e-96   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002322473.1|  AMP-dependent synthetase and ligase family p...    303   7e-96   Populus trichocarpa [western balsam poplar]
gb|AFN53690.1|  acyl CoA ligase                                         301   3e-95   Linum usitatissimum
gb|KDO59995.1|  hypothetical protein CISIN_1g009867mg                   295   6e-94   Citrus sinensis [apfelsine]
ref|XP_011076162.1|  PREDICTED: oxalate--CoA ligase                     296   2e-93   Sesamum indicum [beniseed]
ref|XP_006421926.1|  hypothetical protein CICLE_v10004732mg             295   2e-93   
ref|XP_012090254.1|  PREDICTED: oxalate--CoA ligase                     296   2e-93   Jatropha curcas
gb|AHM88425.1|  4CL13                                                   295   6e-93   Fraxinus mandshurica [Manchurian ash]
ref|XP_006421925.1|  hypothetical protein CICLE_v10004732mg             295   7e-93   Citrus clementina [clementine]
ref|XP_006363316.1|  PREDICTED: 4-coumarate--CoA ligase-like 10-like    293   3e-92   Solanum tuberosum [potatoes]
ref|XP_002510783.1|  AMP dependent CoA ligase, putative                 292   9e-92   Ricinus communis
gb|AFP66956.1|  acyl-CoA synthetase                                     280   3e-91   Capsicum annuum
gb|EYU25098.1|  hypothetical protein MIMGU_mgv1a003760mg                291   6e-91   Erythranthe guttata [common monkey flower]
ref|XP_004240733.1|  PREDICTED: oxalate--CoA ligase-like isoform X1     290   6e-91   Solanum lycopersicum
gb|KFK34191.1|  hypothetical protein AALP_AA5G112900                    289   8e-91   Arabis alpina [alpine rockcress]
dbj|BAO45891.1|  CoA ligase                                             289   8e-91   Acacia mangium
emb|CBI22725.3|  unnamed protein product                                289   1e-90   Vitis vinifera
ref|XP_002267459.1|  PREDICTED: oxalate--CoA ligase-like                289   1e-90   Vitis vinifera
gb|AFP49809.1|  4-hydroxycinnamoyl-CoA ligase 2                         289   2e-90   Coffea arabica [arabica coffee]
ref|XP_004298741.1|  PREDICTED: oxalate--CoA ligase                     288   3e-90   Fragaria vesca subsp. vesca
ref|XP_008238864.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    287   3e-90   
ref|XP_007038702.1|  AMP-dependent synthetase and ligase family p...    287   5e-90   
gb|AHL44979.1|  4-coumarate:coenzyme A ligase 4                         286   1e-89   Fraxinus mandshurica [Manchurian ash]
gb|KHG11636.1|  4-coumarate--CoA ligase-like 10                         285   3e-89   Gossypium arboreum [tree cotton]
gb|AGW27197.1|  4-coumarate:coenzyme A ligase 7                         285   4e-89   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006404192.1|  hypothetical protein EUTSA_v10010297mg             283   1e-88   Eutrema salsugineum [saltwater cress]
gb|EPS64224.1|  hypothetical protein M569_10556                         283   2e-88   Genlisea aurea
ref|XP_008360705.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         283   3e-88   
ref|XP_004143916.1|  PREDICTED: oxalate--CoA ligase-like                283   3e-88   Cucumis sativus [cucumbers]
gb|KJB25811.1|  hypothetical protein B456_004G210700                    280   3e-88   Gossypium raimondii
ref|XP_008365420.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         283   4e-88   
gb|KJB25812.1|  hypothetical protein B456_004G210700                    280   8e-88   Gossypium raimondii
ref|XP_010532440.1|  PREDICTED: oxalate--CoA ligase                     281   1e-87   Tarenaya hassleriana [spider flower]
ref|XP_004152384.1|  PREDICTED: oxalate--CoA ligase-like                281   2e-87   Cucumis sativus [cucumbers]
ref|XP_007211234.1|  hypothetical protein PRUPE_ppa004215mg             281   2e-87   Prunus persica
ref|XP_010273067.1|  PREDICTED: oxalate--CoA ligase                     281   2e-87   Nelumbo nucifera [Indian lotus]
ref|XP_007040198.1|  AMP-dependent synthetase and ligase family p...    280   4e-87   
gb|KJB25809.1|  hypothetical protein B456_004G210700                    280   4e-87   Gossypium raimondii
ref|XP_008437250.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         279   6e-87   Cucumis melo [Oriental melon]
ref|XP_004513742.1|  PREDICTED: 4-coumarate--CoA ligase-like 10-like    280   6e-87   Cicer arietinum [garbanzo]
ref|XP_004514748.1|  PREDICTED: 4-coumarate--CoA ligase-like 10-like    280   6e-87   Cicer arietinum [garbanzo]
ref|XP_003599556.1|  2-succinylbenzoate-CoA ligase                      278   7e-87   
ref|XP_003599555.1|  2-succinylbenzoate-CoA ligase                      278   1e-86   Medicago truncatula
ref|XP_003534000.1|  PREDICTED: 4-coumarate--CoA ligase-like 10-like    278   2e-86   Glycine max [soybeans]
ref|XP_010255419.1|  PREDICTED: oxalate--CoA ligase-like                278   2e-86   Nelumbo nucifera [Indian lotus]
ref|XP_002877640.1|  AMP-dependent synthetase and ligase family p...    277   4e-86   Arabidopsis lyrata subsp. lyrata
gb|AGA17926.1|  CCL9                                                    277   6e-86   Humulus lupulus [common hop]
ref|XP_007152259.1|  hypothetical protein PHAVU_004G114600g             274   2e-85   Phaseolus vulgaris [French bean]
ref|XP_008437021.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         275   3e-85   Cucumis melo [Oriental melon]
ref|XP_010426401.1|  PREDICTED: oxalate--CoA ligase-like                275   4e-85   Camelina sativa [gold-of-pleasure]
ref|NP_190468.1|  4-coumarate--CoA ligase-like 10                       275   4e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503546.1|  PREDICTED: oxalate--CoA ligase                     275   4e-85   Camelina sativa [gold-of-pleasure]
ref|XP_007152260.1|  hypothetical protein PHAVU_004G114600g             273   1e-84   Phaseolus vulgaris [French bean]
gb|AAM65672.1|  4-coumarate-CoA ligase-like protein                     272   4e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515235.1|  PREDICTED: oxalate--CoA ligase-like                272   4e-84   Camelina sativa [gold-of-pleasure]
gb|AFD33352.1|  acyl-activating enzyme 8                                272   5e-84   Cannabis sativa
ref|XP_006290920.1|  hypothetical protein CARUB_v10017034mg             271   1e-83   
ref|XP_009149776.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         271   1e-83   Brassica rapa
emb|CDY08099.1|  BnaA06g16270D                                          271   1e-83   Brassica napus [oilseed rape]
ref|XP_006290921.1|  hypothetical protein CARUB_v10017034mg             271   1e-83   Capsella rubella
emb|CDY69345.1|  BnaC08g48460D                                          270   3e-83   Brassica napus [oilseed rape]
gb|KCW72132.1|  hypothetical protein EUGRSUZ_E00577                     263   2e-81   Eucalyptus grandis [rose gum]
ref|XP_010055622.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         263   1e-80   Eucalyptus grandis [rose gum]
ref|XP_002272145.1|  PREDICTED: oxalate--CoA ligase                     262   3e-80   Vitis vinifera
ref|XP_007143422.1|  hypothetical protein PHAVU_007G071000g             261   4e-80   Phaseolus vulgaris [French bean]
ref|XP_012086931.1|  PREDICTED: oxalate--CoA ligase-like                261   1e-79   Jatropha curcas
ref|XP_007146896.1|  hypothetical protein PHAVU_006G079500g             258   1e-78   Phaseolus vulgaris [French bean]
ref|XP_010550769.1|  PREDICTED: LOW QUALITY PROTEIN: oxalate--CoA...    257   2e-78   Tarenaya hassleriana [spider flower]
ref|XP_011029248.1|  PREDICTED: oxalate--CoA ligase-like                254   4e-77   Populus euphratica
ref|XP_002509782.1|  AMP dependent CoA ligase, putative                 254   4e-77   
ref|XP_002298041.1|  hypothetical protein POPTR_0001s09200g             252   2e-76   
gb|AIY34664.1|  4-coumarate:CoA ligase-like protein                     248   6e-75   Ornithogalum longebracteatum [sea-onion]
ref|XP_010934751.1|  PREDICTED: oxalate--CoA ligase                     244   2e-73   Elaeis guineensis
ref|XP_008806875.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         243   4e-73   Phoenix dactylifera
ref|XP_010055629.1|  PREDICTED: uncharacterized protein LOC104443801    243   2e-71   Eucalyptus grandis [rose gum]
ref|XP_009383859.1|  PREDICTED: 4-coumarate--CoA ligase-like 10 i...    237   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386417.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         237   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383851.1|  PREDICTED: 4-coumarate--CoA ligase-like 10 i...    236   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW72146.1|  hypothetical protein EUGRSUZ_E00593                     231   8e-70   Eucalyptus grandis [rose gum]
gb|KCW72142.1|  hypothetical protein EUGRSUZ_E00586                     236   5e-69   Eucalyptus grandis [rose gum]
ref|XP_010055630.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         236   9e-69   Eucalyptus grandis [rose gum]
ref|XP_010058235.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         232   3e-67   Eucalyptus grandis [rose gum]
ref|XP_010058237.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         231   1e-66   Eucalyptus grandis [rose gum]
ref|XP_010055632.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         231   2e-66   Eucalyptus grandis [rose gum]
ref|XP_009418268.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         225   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010055627.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         216   6e-61   Eucalyptus grandis [rose gum]
gb|ABR16420.1|  unknown                                                 207   9e-60   Picea sitchensis
ref|NP_001054304.1|  Os04g0683700                                       205   2e-58   
dbj|BAK00674.1|  predicted protein                                      205   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006827678.1|  PREDICTED: oxalate--CoA ligase                     204   7e-58   Amborella trichopoda
ref|XP_010321991.1|  PREDICTED: oxalate--CoA ligase-like isoform X2     199   7e-57   Solanum lycopersicum
gb|ABR16382.1|  unknown                                                 198   1e-55   Picea sitchensis
gb|AEW67746.1|  acyl activating enzyme                                  192   2e-53   Zea mays [maize]
ref|NP_001152269.1|  LOC100285908                                       192   2e-53   
gb|EEE61933.1|  hypothetical protein OsJ_16677                          184   3e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008656972.1|  PREDICTED: 4-coumarate--CoA ligase-like 10 i...    186   2e-51   Zea mays [maize]
gb|KCW72145.1|  hypothetical protein EUGRSUZ_E00591                     185   4e-51   Eucalyptus grandis [rose gum]
ref|XP_007040199.1|  AMP-dependent synthetase and ligase family p...    181   9e-51   
ref|XP_004960018.1|  PREDICTED: 4-coumarate--CoA ligase-like 10-like    183   3e-50   Setaria italica
gb|KCW72133.1|  hypothetical protein EUGRSUZ_E00577                     180   3e-50   Eucalyptus grandis [rose gum]
gb|AFW59952.1|  putative AMP-dependent synthetase and ligase supe...    180   2e-49   
gb|KJB25810.1|  hypothetical protein B456_004G210700                    179   4e-49   Gossypium raimondii
gb|AEY64280.1|  acyl-CoA-like protein                                   178   2e-48   Zea mays [maize]
gb|KCW72143.1|  hypothetical protein EUGRSUZ_E00589                     178   2e-48   Eucalyptus grandis [rose gum]
ref|XP_006653896.1|  PREDICTED: 4-coumarate--CoA ligase-like 10-like    174   6e-47   
ref|XP_002448800.1|  hypothetical protein SORBIDRAFT_06g033410          173   2e-46   
ref|XP_001755571.1|  predicted protein                                  172   2e-46   
ref|XP_002968990.1|  hypothetical protein SELMODRAFT_170181             170   2e-45   Selaginella moellendorffii
ref|XP_008358882.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         162   3e-45   
ref|XP_002990653.1|  hypothetical protein SELMODRAFT_272150             168   1e-44   Selaginella moellendorffii
emb|CAJ41420.1|  4-coumarate-CoA ligase-like protein                    164   1e-44   Coffea arabica [arabica coffee]
ref|XP_003579506.1|  PREDICTED: oxalate--CoA ligase                     162   2e-42   Brachypodium distachyon [annual false brome]
ref|XP_008656971.1|  PREDICTED: 4-coumarate--CoA ligase-like 10 i...    157   1e-40   Zea mays [maize]
ref|XP_005644824.1|  acetyl-CoA synthetase-like protein                 155   6e-40   Coccomyxa subellipsoidea C-169
ref|XP_007038701.1|  AMP-dependent synthetase and ligase family p...    155   9e-40   
ref|XP_005845120.1|  hypothetical protein CHLNCDRAFT_48296              151   2e-38   Chlorella variabilis
ref|XP_008238891.1|  PREDICTED: LOW QUALITY PROTEIN: 4-coumarate-...    149   3e-38   Prunus mume [ume]
ref|XP_004335786.1|  Peroxisomalcoenzyme A synthetase                   136   3e-33   Acanthamoeba castellanii str. Neff
ref|XP_011398800.1|  Putative peroxisomal-coenzyme A synthetase         133   3e-31   Auxenochlorella protothecoides
gb|KIY97701.1|  hypothetical protein MNEG_10263                         124   2e-30   Monoraphidium neglectum
gb|ERZ96761.1|  hypothetical protein GLOINDRAFT_1313                    127   3e-30   
emb|CDS10983.1|  hypothetical protein LRAMOSA03247                      126   1e-29   Lichtheimia ramosa
ref|XP_001540156.1|  hypothetical protein HCAG_05623                    125   1e-29   Histoplasma capsulatum NAm1
dbj|GAD95547.1|  peroxisomal-coenzyme A synthetase                      125   1e-29   Byssochlamys spectabilis No. 5
emb|CDH60219.1|  peroxisomal-coenzyme a synthetase                      125   1e-29   Lichtheimia corymbifera JMRC:FSU:9682
dbj|GAA95375.1|  hypothetical protein E5Q_02029                         125   1e-29   Mixia osmundae IAM 14324
ref|XP_001271574.1|  coenzyme A synthetase, putative                    125   2e-29   Aspergillus clavatus NRRL 1
gb|KEI41138.1|  hypothetical protein L969DRAFT_84855                    125   2e-29   Mixia osmundae IAM 14324
ref|XP_002836834.1|  hypothetical protein                               125   2e-29   Tuber melanosporum Mel28
emb|CEL57746.1|  hypothetical protein RSOLAG1IB_02490                   125   2e-29   Rhizoctonia solani AG-1 IB
gb|KFX97912.1|  hypothetical protein V490_02562                         124   3e-29   Pseudogymnoascus sp. VKM F-3557
gb|EKG09829.1|  AMP-dependent synthetase/ligase                         124   3e-29   Macrophomina phaseolina MS6
gb|EEH08767.1|  peroxisomal-coenzyme A synthetase                       124   4e-29   Histoplasma capsulatum G186AR
ref|XP_002377177.1|  coenzyme A synthetase, putative                    124   6e-29   Aspergillus flavus NRRL3357
ref|XP_001821398.1|  peroxisomal-coenzyme A synthetase                  124   6e-29   Aspergillus oryzae RIB40
ref|XP_503878.1|  YALI0E12859p                                          124   6e-29   Yarrowia lipolytica CLIB122
gb|EER43549.1|  peroxisomal-coenzyme A synthetase                       124   7e-29   Histoplasma capsulatum H143
ref|XP_001550905.1|  hypothetical protein BC1G_10629                    124   7e-29   Botrytis cinerea B05.10
gb|KJK66995.1|  AMP-binding enzyme                                      123   7e-29   Aspergillus parasiticus SU-1
gb|EMR85781.1|  putative peroxisomal-coenzyme a synthetase protein      123   8e-29   Botrytis cinerea BcDW1
gb|ACK49088.1|  AMP-dependent synthetase and ligase                     123   9e-29   Methylocella silvestris BL2
ref|WP_041368239.1|  AMP-dependent synthetase                           123   1e-28   Methylocella silvestris
ref|XP_005708092.1|  acetolactate synthase large subunit                125   1e-28   Galdieria sulphuraria
gb|ELU41708.1|  coenzyme A synthetase, putative                         124   1e-28   Rhizoctonia solani AG-1 IA
gb|KFX96072.1|  hypothetical protein O988_05503                         122   1e-28   Pseudogymnoascus sp. VKM F-3808
gb|KFY55229.1|  hypothetical protein V497_07117                         122   1e-28   Pseudogymnoascus sp. VKM F-4516 (FW-969)
gb|KFY12038.1|  hypothetical protein V492_04139                         122   1e-28   Pseudogymnoascus sp. VKM F-4246
gb|KDE06250.1|  hypothetical protein MVLG_03409                         121   2e-28   Microbotryum lychnidis-dioicae p1A1 Lamole
gb|KFY41695.1|  hypothetical protein V494_02848                         122   3e-28   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|EPY50092.1|  acetyl-CoA ligase                                       122   3e-28   Schizosaccharomyces cryophilus OY26
ref|WP_038341089.1|  hypothetical protein                               121   4e-28   
ref|WP_025320896.1|  AMP-dependent synthetase                           121   5e-28   Granulibacter bethesdensis
ref|XP_009156087.1|  hypothetical protein HMPREF1120_03756              121   5e-28   Exophiala dermatitidis NIH/UT8656
ref|WP_025319246.1|  AMP-dependent synthetase                           121   5e-28   Granulibacter bethesdensis
ref|WP_025286306.1|  AMP-dependent synthetase                           121   5e-28   Granulibacter bethesdensis
ref|XP_007725391.1|  hypothetical protein A1O1_06322                    121   6e-28   Capronia coronata CBS 617.96
gb|ESZ97540.1|  peroxisomal-coenzyme A synthetase                       120   6e-28   Sclerotinia borealis F-4128
gb|KFY87429.1|  hypothetical protein V498_07187                         120   8e-28   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
ref|NP_588549.1|  acetyl-CoA ligase (predicted)                         120   1e-27   
ref|XP_001244677.1|  hypothetical protein CIMG_04118                    120   1e-27   Coccidioides immitis RS
ref|XP_001588125.1|  hypothetical protein SS1G_10571                    120   1e-27   Sclerotinia sclerotiorum 1980 UF-70
gb|KDN50152.1|  hypothetical protein RSAG8_01488                        120   1e-27   Rhizoctonia solani AG-8 WAC10335
gb|KFY79689.1|  hypothetical protein V499_01334                         120   2e-27   Pseudogymnoascus sp. VKM F-103
gb|KEP48067.1|  peroxisomal-coenzyme A synthetase                       120   2e-27   Rhizoctonia solani 123E
ref|XP_008076145.1|  Acetyl-CoA synthetase-like protein                 119   2e-27   Glarea lozoyensis ATCC 20868
gb|EHK99170.1|  putative peroxisomal-coenzyme A synthetase              119   2e-27   Glarea lozoyensis 74030
ref|XP_007582098.1|  putative peroxisomal-coenzyme a synthetase p...    119   2e-27   
gb|KEQ59130.1|  acetyl-CoA synthetase-like protein                      119   2e-27   Aureobasidium melanogenum CBS 110374
gb|KFZ22740.1|  hypothetical protein V502_02781                         119   2e-27   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KFY84377.1|  hypothetical protein V500_09362                         119   2e-27   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFZ18859.1|  hypothetical protein V501_00977                         119   3e-27   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KIV79392.1|  hypothetical protein PV11_06955                         119   4e-27   Exophiala sideris
ref|WP_045650501.1|  AMP-dependent synthetase                           119   4e-27   
gb|EUC66784.1|  peroxisomal-coenzyme A synthetase                       118   5e-27   Rhizoctonia solani AG-3 Rhs1AP
ref|WP_011631497.1|  AMP-dependent synthetase                           118   6e-27   Granulibacter bethesdensis
ref|XP_010760275.1|  hypothetical protein PADG_04495                    118   6e-27   Paracoccidioides brasiliensis Pb18
ref|WP_008061294.1|  AMP-dependent synthetase                           118   6e-27   Methyloversatilis universalis
gb|KEQ75144.1|  acetyl-CoA synthetase-like protein                      118   7e-27   Aureobasidium namibiae CBS 147.97
gb|EYE97890.1|  acetyl-CoA synthetase-like protein                      118   7e-27   Aspergillus ruber CBS 135680
ref|XP_007925261.1|  hypothetical protein MYCFIDRAFT_210936             118   8e-27   Pseudocercospora fijiensis CIRAD86
ref|XP_010068214.1|  PREDICTED: 4-coumarate--CoA ligase-like 10         113   1e-26   
ref|WP_019915532.1|  AMP-dependent synthetase                           117   1e-26   Methyloversatilis discipulorum
gb|KFY62248.1|  hypothetical protein V496_04674                         119   1e-26   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_011116247.1|  hypothetical protein H072_10831                    117   2e-26   
ref|XP_005712061.1|  unnamed protein product                            117   2e-26   Chondrus crispus [carageen]
ref|WP_020163214.1|  AMP-dependent synthetase                           117   2e-26   Methyloversatilis discipulorum
gb|KIW85880.1|  hypothetical protein Z517_01273                         117   2e-26   Fonsecaea pedrosoi CBS 271.37
ref|WP_018227876.1|  AMP-dependent synthetase                           116   2e-26   Methyloversatilis universalis
ref|XP_007295940.1|  peroxisomal-coenzyme A synthetase                  116   2e-26   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|EEH21927.2|  hypothetical protein PABG_04138                         116   2e-26   Paracoccidioides brasiliensis Pb03
ref|XP_009649893.1|  peroxisomal-coenzyme A synthetase                  116   3e-26   Verticillium dahliae VdLs.17
gb|EIE84401.1|  hypothetical protein RO3G_09111                         119   3e-26   Rhizopus delemar RA 99-880
gb|KEQ98157.1|  hypothetical protein AUEXF2481DRAFT_26553               116   3e-26   Aureobasidium subglaciale EXF-2481
gb|KEZ38752.1|  putative peroxisomal-coenzyme A synthetase              116   3e-26   Scedosporium apiospermum
gb|KFH45079.1|  putative peroxisomal-coenzyme A synthetase-like p...    116   4e-26   Acremonium chrysogenum ATCC 11550
ref|XP_003848177.1|  hypothetical protein MYCGRDRAFT_77337              116   4e-26   Zymoseptoria tritici IPO323
emb|CEG67836.1|  Putative YBR222Cp-like protein (Fragment)              116   4e-26   Rhizopus microsporus
ref|WP_028097565.1|  AMP-dependent synthetase                           115   4e-26   Dongia sp. URHE0060
gb|EEQ87229.1|  coenzyme A synthetase                                   115   4e-26   Blastomyces dermatitidis ER-3
ref|XP_002622738.1|  coenzyme A synthetase                              115   5e-26   Blastomyces gilchristii SLH14081
ref|XP_002790366.1|  4-coumarate-CoA ligase                             115   5e-26   Paracoccidioides lutzii Pb01
ref|XP_007778156.1|  hypothetical protein W97_02064                     115   5e-26   Coniosporium apollinis CBS 100218
gb|KJX96446.1|  peroxisomal-coenzyme a synthetase like protein          115   5e-26   Zymoseptoria brevis
gb|KIV88538.1|  hypothetical protein PV10_08214                         115   7e-26   Exophiala mesophila
gb|KEQ86365.1|  acetyl-CoA synthetase-like protein                      115   7e-26   Aureobasidium pullulans EXF-150
emb|CCX05949.1|  Similar to Putative peroxisomal-coenzyme A synth...    115   7e-26   Pyronema omphalodes CBS 100304
ref|XP_008714115.1|  hypothetical protein HMPREF1541_01533              115   8e-26   Cyphellophora europaea CBS 101466
gb|KIX04662.1|  hypothetical protein Z518_05532                         115   8e-26   Rhinocladiella mackenziei CBS 650.93
emb|CEI87857.1|  Putative YBR222Cp-like protein (Fragment)              115   9e-26   Rhizopus microsporus
gb|KHJ32714.1|  putative peroxisomal-coenzyme a synthetase              115   9e-26   Erysiphe necator
gb|ENH76437.1|  peroxisomal-coenzyme a synthetase                       114   1e-25   
emb|CAK47898.1|  unnamed protein product                                114   1e-25   Aspergillus niger
dbj|GAA82618.1|  coenzyme A synthetase                                  114   1e-25   Aspergillus kawachii IFO 4308
gb|KIW67249.1|  hypothetical protein PV04_06514                         114   1e-25   Phialophora americana
ref|XP_001401502.2|  peroxisomal-coenzyme A synthetase                  114   1e-25   Aspergillus niger CBS 513.88
gb|EPE05667.1|  peroxisomal-coenzyme a synthetase                       114   1e-25   Ophiostoma piceae UAMH 11346
gb|EKG21405.1|  AMP-dependent synthetase/ligase                         114   1e-25   Macrophomina phaseolina MS6
ref|XP_009223944.1|  peroxisomal-coenzyme A synthetase                  114   2e-25   Gaeumannomyces tritici R3-111a-1
ref|XP_007674649.1|  hypothetical protein BAUCODRAFT_67136              114   2e-25   Baudoinia panamericana UAMH 10762
ref|WP_043334885.1|  AMP-dependent synthetase                           114   2e-25   Belnapia moabensis
ref|XP_008728961.1|  hypothetical protein G647_06418                    114   3e-25   Cladophialophora carrionii CBS 160.54
ref|XP_011125061.1|  hypothetical protein AOL_s00110g69                 113   3e-25   Arthrobotrys oligospora ATCC 24927
gb|KIX94514.1|  hypothetical protein Z520_09900                         113   3e-25   Fonsecaea multimorphosa CBS 102226
ref|WP_018412030.1|  AMP-dependent synthetase                           113   4e-25   Methyloversatilis thermotolerans
ref|XP_001267342.1|  coenzyme A synthetase, putative                    113   4e-25   Aspergillus fischeri NRRL 181
gb|KIL96606.1|  hypothetical protein FAVG1_01350                        113   5e-25   Fusarium avenaceum
ref|WP_043815178.1|  AMP-dependent synthetase                           112   5e-25   Rubrivivax gelatinosus
ref|WP_008439794.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid l...    115   5e-25   
gb|EWG40839.1|  hypothetical protein FVEG_03096                         112   5e-25   Fusarium verticillioides 7600
gb|KEF56440.1|  hypothetical protein A1O9_08021                         112   6e-25   Exophiala aquamarina CBS 119918
ref|XP_011388056.1|  putative AMP-binding protein                       112   6e-25   Ustilago maydis 521
dbj|GAC96532.1|  hypothetical protein PHSY_004112                       112   7e-25   Pseudozyma hubeiensis SY62
ref|XP_662001.1|  hypothetical protein AN4397.2                         112   7e-25   Aspergillus nidulans FGSC A4
gb|EWZ36841.1|  hypothetical protein FOZG_10781                         112   7e-25   Fusarium oxysporum Fo47
ref|WP_019500419.1|  hypothetical protein                               112   7e-25   Pseudanabaena sp. PCC 6802
ref|WP_038027144.1|  AMP-dependent synthetase                           112   8e-25   
gb|KIW31802.1|  hypothetical protein PV07_03394                         112   8e-25   Cladophialophora immunda
gb|EWZ36840.1|  hypothetical protein FOZG_10781                         112   8e-25   Fusarium oxysporum Fo47
gb|KIJ54974.1|  hypothetical protein M422DRAFT_42153                    112   9e-25   Sphaerobolus stellatus SS14
gb|EXL72559.1|  hypothetical protein FOPG_11927                         112   1e-24   Fusarium oxysporum f. sp. conglutinans race 2 54008
ref|WP_034469963.1|  AMP-dependent synthetase                           112   1e-24   Afipia sp. P52-10
gb|EXA44425.1|  hypothetical protein FOVG_05866                         112   1e-24   Fusarium oxysporum f. sp. pisi HDV247
gb|EXM33237.1|  hypothetical protein FOTG_03297                         112   1e-24   Fusarium oxysporum f. sp. vasinfectum 25433
gb|EXL56304.1|  hypothetical protein FOCG_03963                         111   1e-24   Fusarium oxysporum f. sp. radicis-lycopersici 26381
emb|CCT68308.1|  probable fatty acid transporter FAT2                   112   1e-24   Fusarium fujikuroi IMI 58289
gb|KIW95047.1|  hypothetical protein Z519_03628                         112   1e-24   Cladophialophora bantiana CBS 173.52
gb|EWY90245.1|  hypothetical protein FOYG_07829                         111   1e-24   Fusarium oxysporum FOSC 3-a
gb|ENH67593.1|  Putative peroxisomal-coenzyme A synthetase              112   1e-24   Fusarium oxysporum f. sp. cubense race 1
gb|EGU79996.1|  hypothetical protein FOXB_09526                         112   1e-24   Fusarium oxysporum Fo5176
gb|KIW46874.1|  hypothetical protein PV06_02498                         112   1e-24   Exophiala oligosperma
gb|EXK38883.1|  hypothetical protein FOMG_06390                         111   1e-24   Fusarium oxysporum f. sp. melonis 26406
ref|XP_007348894.1|  hypothetical protein AURDEDRAFT_185760             114   1e-24   
ref|XP_003068268.1|  Peroxisomal-coenzyme A synthetase, putative        111   1e-24   Coccidioides posadasii C735 delta SOWgp
ref|XP_009252601.1|  hypothetical protein FPSE_01206                    111   1e-24   Fusarium pseudograminearum CS3096
gb|EPB89534.1|  hypothetical protein HMPREF1544_03618                   112   1e-24   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_011319331.1|  hypothetical protein FGSG_10362                    111   1e-24   Fusarium graminearum PH-1
gb|KIW18757.1|  hypothetical protein PV08_03046                         111   1e-24   Exophiala spinifera
gb|EIT78328.1|  acyl-CoA synthetase                                     111   1e-24   Aspergillus oryzae 3.042
ref|XP_007744305.1|  hypothetical protein A1O5_05514                    111   1e-24   Cladophialophora psammophila CBS 110553
gb|EXL56303.1|  hypothetical protein FOCG_03963                         111   2e-24   Fusarium oxysporum f. sp. radicis-lycopersici 26381
ref|WP_009855351.1|  AMP-dependent synthetase                           111   2e-24   Rubrivivax benzoatilyticus
ref|XP_003712086.1|  peroxisomal-coenzyme A synthetase                  111   2e-24   Magnaporthe oryzae 70-15
gb|EPX71741.1|  acetyl-CoA ligase                                       111   2e-24   Schizosaccharomyces octosporus yFS286
ref|XP_002172215.1|  acetyl-CoA ligase                                  111   2e-24   Schizosaccharomyces japonicus yFS275
gb|KIM92580.1|  hypothetical protein OIDMADRAFT_185101                  111   2e-24   Oidiodendron maius Zn
ref|WP_014427866.1|  AMP-dependent synthetase                           110   2e-24   Rubrivivax gelatinosus
ref|WP_019014733.1|  hypothetical protein                               110   3e-24   Elioraea tepidiphila
ref|XP_001795779.1|  hypothetical protein SNOG_05374                    110   3e-24   Parastagonospora nodorum SN15
gb|AFZ26137.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II    112   3e-24   Cylindrospermum stagnale PCC 7417
ref|XP_007758308.1|  hypothetical protein A1O7_06114                    110   4e-24   Cladophialophora yegresii CBS 114405
ref|WP_025310695.1|  AMP-dependent synthetase                           110   4e-24   Roseibacterium elongatum
ref|WP_032927827.1|  AMP-dependent synthetase                           110   4e-24   
ref|XP_003649936.1|  hypothetical protein THITE_2109085                 110   4e-24   
ref|WP_017289429.1|  hypothetical protein                               111   4e-24   
ref|WP_027285495.1|  AMP-dependent synthetase                           110   5e-24   
ref|XP_007738263.1|  hypothetical protein A1O3_09982                    110   5e-24   
ref|XP_008026575.1|  hypothetical protein SETTUDRAFT_184936             110   5e-24   
ref|WP_017485489.1|  AMP-dependent synthetase                           110   5e-24   
ref|WP_013046083.1|  AMP-dependent synthetase                           110   6e-24   
ref|XP_003662321.1|  hypothetical protein MYCTH_2091486                 110   6e-24   
ref|XP_001934725.1|  2-succinylbenzoate-CoA ligase                      109   6e-24   
gb|KDN52589.1|  putative PCS60-AMP-binding protein, peroxisomal         110   7e-24   
gb|ESY80323.1|  AMP-dependent synthetase                                109   7e-24   
emb|CCU98169.1|  unnamed protein product                                110   7e-24   
gb|ELR08549.1|  hypothetical protein GMDG_03244                         109   7e-24   
gb|EUN31188.1|  hypothetical protein COCVIDRAFT_23047                   109   7e-24   
ref|WP_031215187.1|  AMP-dependent synthetase                           109   7e-24   
ref|XP_007701652.1|  hypothetical protein COCSADRAFT_38577              109   8e-24   
ref|XP_007712049.1|  hypothetical protein COCCADRAFT_26092              109   9e-24   
ref|WP_012454005.1|  AMP-dependent synthetase                           109   9e-24   
ref|XP_003305422.1|  hypothetical protein PTT_18259                     109   9e-24   
gb|EFW19974.1|  O-succinylbenzoate-CoA ligase                           109   1e-23   
gb|ESW78027.1|  AMP-dependent synthetase                                109   1e-23   
ref|WP_041163267.1|  AMP-dependent synthetase                           108   1e-23   
gb|AGB43143.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II    108   1e-23   
ref|WP_018045826.1|  AMP-dependent synthetase                           108   2e-23   
ref|WP_044211005.1|  AMP-dependent synthetase                           109   2e-23   
gb|EDX71130.1|  AMP-binding enzyme domain protein                       109   2e-23   
ref|WP_019428000.1|  hypothetical protein                               108   2e-23   
ref|WP_041233742.1|  acyl-CoA synthetase                                108   2e-23   
ref|WP_026597414.1|  AMP-dependent synthetase                           108   2e-23   
gb|ADT92188.1|  peroxisomal-CoA synthetase                              107   2e-23   
emb|CCF53599.1|  probable PCS60-AMP-binding protein, peroxisomal        108   2e-23   
gb|KIM29193.1|  hypothetical protein M408DRAFT_120135                   108   2e-23   
ref|XP_002584867.1|  conserved hypothetical protein                     108   2e-23   
ref|XP_007282864.1|  peroxisomal-coenzyme a synthetase                  108   2e-23   
ref|WP_036229897.1|  AMP-dependent synthetase                           108   2e-23   
gb|EMD96439.1|  hypothetical protein COCHEDRAFT_1162079                 108   3e-23   
ref|WP_012177889.1|  AMP-dependent synthetase                           108   3e-23   
gb|EGD93990.1|  2-succinylbenzoate-CoA ligase                           108   3e-23   
gb|EZF33789.1|  hypothetical protein H101_02656                         108   3e-23   
gb|KFA63864.1|  hypothetical protein S40285_04462                       108   3e-23   
gb|KEY72128.1|  hypothetical protein S7711_00140                        108   3e-23   
gb|ACS39925.1|  putative acyl-coenzyme A synthetase                     108   3e-23   
ref|WP_003600055.1|  AMP-dependent synthetase                           108   3e-23   
ref|XP_003050935.1|  predicted protein                                  107   4e-23   
emb|CBQ71666.1|  probable PCS60-AMP-binding protein, peroxisomal        107   4e-23   
emb|CCG84732.1|  protein of unknown function                            107   4e-23   
gb|KIH88076.1|  peroxisomal-coenzyme A synthetase                       107   5e-23   
gb|ERT01792.1|  hypothetical protein HMPREF1624_00086                   107   6e-23   
ref|WP_042462185.1|  AMP-dependent synthetase                           107   6e-23   
ref|XP_001224646.1|  hypothetical protein CHGG_06990                    107   6e-23   
ref|XP_007686539.1|  hypothetical protein COCMIDRAFT_4089               107   6e-23   
ref|WP_027171487.1|  AMP-dependent synthetase                           107   6e-23   
ref|WP_038163491.1|  hypothetical protein                               109   6e-23   
ref|XP_006696673.1|  coenzyme A synthetase-like protein                 107   6e-23   
ref|WP_006561358.1|  AMP-dependent synthetase                           107   6e-23   
gb|EIE89706.1|  hypothetical protein RO3G_14417                         107   8e-23   
emb|CAX24567.1|  putative acyl-coenzyme A synthetase                    107   8e-23   
dbj|GAM82921.1|  hypothetical protein ANO11243_009070                   106   8e-23   
ref|WP_041358635.1|  AMP-dependent synthetase                           107   9e-23   
ref|WP_043363638.1|  AMP-dependent synthetase                           106   9e-23   
ref|WP_032918498.1|  AMP-dependent synthetase                           106   9e-23   
dbj|GAN77099.1|  fatty-acid (long-chain)--CoA ligase                    106   1e-22   
ref|WP_012253630.1|  AMP-dependent synthetase                           106   1e-22   
gb|EST07437.1|  acyl-coa synthetase                                     106   1e-22   
ref|WP_045873990.1|  acyl-CoA synthetase                                108   1e-22   
ref|WP_024275092.1|  MULTISPECIES: AMP-dependent synthetase             106   1e-22   
ref|WP_037257973.1|  AMP-dependent synthetase                           106   1e-22   
gb|EKE97806.1|  AMP-binding enzyme                                      108   1e-22   
ref|WP_044171781.1|  hypothetical protein                               108   1e-22   
dbj|GAC76407.1|  acyl-coa synthetase                                    106   1e-22   
dbj|BAQ69068.1|  short-chain-fatty-acid-CoA ligase                      106   1e-22   
emb|CCB68106.1|  putative acyl-coenzyme A synthetase                    106   1e-22   
ref|WP_008878057.1|  putative peroxisomal-coenzyme A synthetase         105   1e-22   
ref|XP_002851220.1|  peroxisomal-coenzyme A synthetase                  106   1e-22   
dbj|GAN05822.1|  peroxisomal-coenzyme A synthetase                      105   2e-22   
ref|WP_027164563.1|  AMP-dependent synthetase                           105   2e-22   
gb|KDN71821.1|  putative AMP-binding enzyme                             105   2e-22   
ref|XP_011272870.1|  peroxisomal-coenzyme A synthetase                  105   2e-22   
ref|XP_641700.1|  AMP-dependent synthetase and ligase domain-cont...    105   2e-22   
ref|WP_015950867.1|  AMP-dependent synthetase                           105   3e-22   
ref|WP_041392626.1|  AMP-dependent synthetase                           105   3e-22   
ref|WP_032904397.1|  AMP-dependent synthetase                           105   3e-22   
gb|ESY32684.1|  AMP-dependent synthetase                                105   3e-22   
gb|AFY75822.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II    105   3e-22   
ref|WP_041929652.1|  AMP-dependent synthetase                           105   3e-22   
dbj|GAK63282.1|  peroxisomal-coenzyme A synthetase                      105   3e-22   
gb|ABM95186.1|  coenzyme A synthetase-like protein                      105   4e-22   
ref|XP_007833539.1|  peroxisomal-coenzyme A synthetase                  105   4e-22   
ref|XP_003349259.1|  hypothetical protein SMAC_05543                    104   4e-22   
ref|WP_040699949.1|  AMP-dependent synthetase                           104   5e-22   
ref|XP_007913348.1|  putative peroxisomal-coenzyme a synthetase p...    104   5e-22   
gb|ETS62694.1|  hypothetical protein PaG_02429                          104   5e-22   
gb|EQB58745.1|  AMP-binding enzyme                                      104   5e-22   
gb|EFX01559.1|  peroxisomal-coenzyme A synthetase                       104   6e-22   
ref|XP_007803189.1|  hypothetical protein EPUS_06002                    105   6e-22   
ref|WP_015190685.1|  o-succinylbenzoate--CoA ligase                     104   6e-22   
gb|EFA79337.1|  AMP-dependent synthetase and ligase domain-contai...    104   7e-22   
ref|WP_012898984.1|  AMP-dependent synthetase                           104   7e-22   
ref|WP_015217542.1|  o-succinylbenzoate--CoA ligase                     103   8e-22   
emb|CEP14036.1|  hypothetical protein                                   103   9e-22   
ref|WP_027152269.1|  AMP-dependent synthetase                           103   9e-22   
ref|XP_003011162.1|  NRPS-like enzyme, putative                         103   1e-21   
ref|WP_031253288.1|  MULTISPECIES: AMP-dependent synthetase             103   1e-21   
gb|EXL98478.1|  hypothetical protein FOIG_09260                         103   1e-21   
gb|EMT63221.1|  Putative peroxisomal-coenzyme A synthetase              103   1e-21   
gb|ESY05506.1|  AMP-dependent synthetase                                103   1e-21   
ref|XP_003332958.2|  hypothetical protein PGTG_14117                    103   1e-21   
emb|CCF41703.1|  AMP-binding enzyme                                     103   1e-21   
ref|WP_007066495.1|  AMP-dependent synthetase                           103   1e-21   
ref|XP_003235544.1|  2-succinylbenzoate-CoA ligase                      103   1e-21   
gb|ESY38932.1|  AMP-dependent synthetase                                103   1e-21   
ref|WP_040970836.1|  AMP-dependent synthetase                           103   1e-21   
ref|XP_003020471.1|  NRPS-like enzyme, putative                         103   1e-21   
ref|WP_028792956.1|  AMP-dependent synthetase                           103   1e-21   
ref|XP_001214724.1|  hypothetical protein ATEG_05546                    103   1e-21   
ref|WP_031199097.1|  AMP-dependent synthetase                           102   2e-21   
ref|WP_037527467.1|  malonyl-CoA synthase                               102   2e-21   
ref|WP_027844989.1|  AMP-dependent synthetase                           102   2e-21   
ref|WP_036177542.1|  AMP-dependent synthetase                           102   2e-21   
gb|ESZ52402.1|  AMP-dependent synthetase                                102   2e-21   
dbj|GAM28696.1|  hypothetical protein SAMD00019534_118720               102   3e-21   
ref|XP_001912121.1|  hypothetical protein                               102   3e-21   
ref|WP_040584279.1|  AMP-dependent synthetase                           102   3e-21   
gb|EFQ32332.1|  AMP-binding enzyme                                      102   3e-21   
ref|WP_041334345.1|  AMP-dependent synthetase                           102   3e-21   
ref|XP_960802.3|  peroxisomal-coenzyme A synthetase                     102   3e-21   
ref|WP_031201517.1|  AMP-dependent synthetase                           102   3e-21   
gb|ABQ92680.1|  AMP-dependent synthetase and ligase                     102   3e-21   
ref|WP_031244240.1|  MULTISPECIES: AMP-dependent synthetase             102   3e-21   
ref|WP_031197938.1|  MULTISPECIES: AMP-dependent synthetase             102   3e-21   
gb|ESZ08337.1|  AMP-dependent synthetase                                102   4e-21   
gb|ESX05311.1|  AMP-dependent synthetase                                102   4e-21   
ref|WP_031194890.1|  AMP-dependent synthetase                           102   4e-21   
ref|WP_031207976.1|  AMP-dependent synthetase                           102   4e-21   
gb|ESY42230.1|  AMP-dependent synthetase                                101   4e-21   
gb|ESX28214.1|  AMP-dependent synthetase                                101   4e-21   
ref|WP_036268078.1|  hypothetical protein                               102   5e-21   
gb|AAY82855.1|  predicted acyl-CoA synthetase                           101   5e-21   
gb|ESW89542.1|  AMP-dependent synthetase                                101   5e-21   
ref|WP_032917183.1|  AMP-dependent synthetase                           101   5e-21   
ref|WP_031202616.1|  AMP-dependent synthetase                           101   5e-21   
gb|ESZ16521.1|  AMP-dependent synthetase                                101   5e-21   
ref|WP_020697605.1|  hypothetical protein                               101   6e-21   
ref|WP_023799431.1|  AMP-dependent synthetase                           101   6e-21   
ref|XP_007591504.1|  AMP-binding enzyme                                 101   7e-21   
ref|WP_019977193.1|  hypothetical protein                               101   7e-21   
emb|CDI52330.1|  probable PCS60-AMP-binding protein, peroxisomal        101   7e-21   
ref|WP_043770804.1|  AMP-dependent synthetase                           101   7e-21   
ref|WP_027050667.1|  MULTISPECIES: AMP-dependent synthetase             100   8e-21   
ref|WP_042645857.1|  AMP-dependent synthetase                           100   9e-21   
ref|WP_031262045.1|  AMP-dependent synthetase                           100   9e-21   
gb|EGZ75824.1|  peroxisomal-coenzyme A synthetase                       101   9e-21   
gb|ESY23604.1|  AMP-dependent synthetase                                100   9e-21   
ref|XP_009847554.1|  peroxisomal-coenzyme A synthetase                  101   1e-20   
gb|EMF08630.1|  coenzyme A synthetase                                   100   1e-20   
gb|ESX93416.1|  AMP-dependent synthetase                                100   1e-20   
ref|WP_020163120.1|  hypothetical protein                               101   1e-20   
ref|WP_031204058.1|  AMP-dependent synthetase                           100   1e-20   
ref|WP_031215487.1|  AMP-dependent synthetase                           100   1e-20   
gb|ESW67906.1|  AMP-dependent synthetase                                100   1e-20   
gb|KIW52816.1|  hypothetical protein PV05_08434                         100   1e-20   
gb|ESZ77168.1|  AMP-dependent synthetase                                100   2e-20   
ref|WP_011909984.1|  AMP-dependent synthetase                           100   2e-20   
ref|WP_043687069.1|  AMP-dependent synthetase                           100   2e-20   
gb|KIV99285.1|  hypothetical protein PV09_09053                         100   2e-20   
gb|EME38193.1|  hypothetical protein DOTSEDRAFT_57700                   100   2e-20   
ref|XP_752141.1|  coenzyme A synthetase                                 100   2e-20   
gb|ESX89912.1|  AMP-dependent synthetase                                100   2e-20   
ref|WP_037256587.1|  AMP-dependent synthetase                           100   2e-20   
ref|WP_031193064.1|  MULTISPECIES: AMP-dependent synthetase             100   2e-20   
gb|ABL61017.1|  acyl-CoA synthetase                                   99.8    2e-20   
ref|WP_045837469.1|  AMP-dependent synthetase                           100   2e-20   
ref|WP_022572992.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid l...  99.8    2e-20   
ref|WP_019915652.1|  hypothetical protein                               100   2e-20   
gb|ABU56819.1|  AMP-dependent synthetase and ligase                   99.8    2e-20   
emb|CCA73400.1|  probable fatty acid transporter FAT2                   100   2e-20   
ref|WP_043400054.1|  AMP-dependent synthetase                         99.8    2e-20   
ref|WP_041331555.1|  AMP-dependent synthetase                         99.8    3e-20   
ref|WP_023761343.1|  AMP-dependent synthetase                         99.4    3e-20   
ref|WP_023772111.1|  MULTISPECIES: AMP-dependent synthetase           99.4    4e-20   
ref|WP_023765425.1|  AMP-dependent synthetase                         99.4    4e-20   
ref|XP_003645394.1|  hypothetical protein Ecym_3065                   99.4    4e-20   
ref|WP_032910085.1|  AMP-dependent synthetase                         99.0    4e-20   
ref|WP_006330237.1|  putative peroxisomal-coenzyme A synthetase       99.0    4e-20   
ref|WP_041006051.1|  AMP-dependent synthetase                         99.0    4e-20   
ref|WP_040990950.1|  AMP-dependent synthetase                         99.0    5e-20   
gb|ESZ59810.1|  AMP-dependent synthetase                              99.0    5e-20   
ref|WP_041009073.1|  AMP-dependent synthetase                         98.6    5e-20   
ref|WP_008233051.1|  AMP-dependent synthetase                         98.6    6e-20   
ref|WP_040997972.1|  AMP-dependent synthetase                         98.6    6e-20   
ref|WP_011568410.1|  AMP-dependent synthetase                         98.6    7e-20   
ref|WP_035353977.1|  hypothetical protein                             98.6    8e-20   
ref|WP_041471045.1|  AMP-dependent synthetase                         95.5    9e-20   
ref|WP_027142465.1|  AMP-dependent synthetase                         98.2    9e-20   
ref|XP_006681006.1|  hypothetical protein BATDEDRAFT_13423            98.2    1e-19   
ref|WP_009192811.1|  long-chain-fatty-acid-CoA ligase                 97.4    1e-19   
ref|WP_027415354.1|  AMP-dependent synthetase                         98.2    1e-19   
ref|WP_043750038.1|  AMP-dependent synthetase                         97.8    1e-19   
ref|WP_032900113.1|  AMP-dependent synthetase                         97.8    1e-19   
gb|ACL55100.1|  AMP-dependent synthetase and ligase                   97.8    1e-19   
ref|WP_039168182.1|  AMP-dependent synthetase                         97.8    1e-19   
ref|WP_031203747.1|  AMP-dependent synthetase                         97.4    1e-19   
ref|WP_023781920.1|  AMP-dependent synthetase                         97.4    1e-19   
gb|ESZ59754.1|  AMP-dependent synthetase                              97.4    1e-19   
ref|WP_009605282.1|  AMP-dependent synthetase                         97.4    1e-19   
ref|WP_031201445.1|  MULTISPECIES: AMP-dependent synthetase           97.4    2e-19   
gb|ESX11704.1|  AMP-dependent synthetase                              97.4    2e-19   
ref|WP_019981154.1|  acyl-CoA synthetase                              97.1    2e-19   
gb|ESW68952.1|  AMP-dependent synthetase                              97.1    2e-19   
ref|XP_007876496.1|  hypothetical protein PFL1_00803                  97.1    2e-19   
gb|ACL25399.1|  AMP-dependent synthetase and ligase                   95.1    2e-19   
ref|WP_031196387.1|  MULTISPECIES: AMP-dependent synthetase           96.7    2e-19   
gb|AEH85161.1|  AMP-dependent synthetase and ligase                   96.7    2e-19   
ref|WP_013961272.1|  AMP-dependent synthetase                         96.7    3e-19   
ref|WP_041164495.1|  AMP-dependent synthetase                         96.7    3e-19   
ref|WP_040870946.1|  AMP-dependent synthetase                         96.7    3e-19   
ref|WP_027040901.1|  AMP-dependent synthetase                         96.7    3e-19   
ref|WP_027161128.1|  AMP-dependent synthetase                         96.7    3e-19   
ref|WP_031205455.1|  AMP-dependent synthetase                         96.7    3e-19   
ref|XP_003286636.1|  hypothetical protein DICPUDRAFT_97453            96.7    3e-19   



>ref|XP_004234395.1| PREDICTED: oxalate--CoA ligase-like [Solanum lycopersicum]
Length=523

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME+ TLTGLLKHVA  FPSRRAIS SGKFD+TH+RL  LVERAAS L +AGV+ GDV+AL
Sbjct  1    MESMTLTGLLKHVAEKFPSRRAISTSGKFDITHARLQQLVERAASHLVSAGVKHGDVIAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT+E VIMFLAVIRVRATAAPLN+AY AEEFEFYLSDSESK+L+  KEGNEAAQAAA
Sbjct  61   TFPNTIEFVIMFLAVIRVRATAAPLNSAYMAEEFEFYLSDSESKLLITAKEGNEAAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL IP +T  L  AESDI   PA PES+ ++ +E+VNDPSD+ LFLHTSGTTSRPKGVP
Sbjct  121  SKLKIPHMTVALPEAESDIVYSPAPPESNVESAAEIVNDPSDIGLFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            L+Q NL SSVNNIKSVYKL +SDSTVIVLPLFHVHGL+AG+LS
Sbjct  181  LSQLNLVSSVNNIKSVYKLCDSDSTVIVLPLFHVHGLMAGLLS  223



>ref|XP_009596461.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Nicotiana tomentosiformis]
 ref|XP_009596462.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Nicotiana tomentosiformis]
Length=524

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLTG LKH+A  FP+RRAISVSGKFD+TH+RLH L+E AAS L AAGV+P DVVALTFPN
Sbjct  6    TLTGFLKHIAAKFPTRRAISVSGKFDVTHARLHELIEHAASQLVAAGVKPRDVVALTFPN  65

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            T+ELVIMFLAVIRV ATAAPLN+AYT+EEFEFYLSDSESK+LLI KEGNEAAQAA  KL+
Sbjct  66   TIELVIMFLAVIRVGATAAPLNSAYTSEEFEFYLSDSESKLLLIAKEGNEAAQAAVTKLN  125

Query  469  IPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQF  648
            +P +  TL  ++S+++L  ++P SDS++VS++VN+PSDV+LFLHTSGTTSRPKGVPLTQ 
Sbjct  126  VPQIAVTLPHSDSNVSLIQSNPLSDSESVSKIVNEPSDVALFLHTSGTTSRPKGVPLTQH  185

Query  649  NLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            NL SSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  186  NLVSSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGLLS  224



>gb|AAL29212.1|AF354454_1 putative acyl-CoA synthetase [Capsicum annuum]
Length=523

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTG LKHVA  +PS RAISVSG+ D+TH+RL  LVERAAS + AAGV+PGDVVAL
Sbjct  1    MECLTLTGFLKHVAEKYPSHRAISVSGRLDITHARLQQLVERAASQIVAAGVKPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT+E VIMFLAVIR RATAAPLN+AY AEEFEFYLSDSESK+LL  KEGNEAAQAAA
Sbjct  61   TFPNTIEFVIMFLAVIRARATAAPLNSAYMAEEFEFYLSDSESKLLLTAKEGNEAAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL IP ++ TLS  +SD+A  PA PESD +++S++VN+PSDV LFLHTSGTTSRPKGVP
Sbjct  121  SKLKIPRISVTLSQPDSDVAFSPAPPESDLESMSKIVNEPSDVGLFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            L Q NL SSVNNIKSVYKL+++DSTVIVLPLFHVHGLIAG+LS
Sbjct  181  LAQLNLLSSVNNIKSVYKLSDTDSTVIVLPLFHVHGLIAGLLS  223



>ref|XP_006353296.1| PREDICTED: 4-coumarate--CoA ligase-like 10-like [Solanum tuberosum]
Length=523

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME+ TLTGLLKHVA  FPS  AIS+SGKF +TH+RLH LVERAAS L +AGV+ GDV+AL
Sbjct  1    MESMTLTGLLKHVAEKFPSHCAISISGKFHITHARLHELVERAASQLVSAGVKHGDVIAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT+E VIMFLAVIRVRATAAPLN+AY AEEFEFYLSDSESK+L+  KEGNEAAQAAA
Sbjct  61   TFPNTIEFVIMFLAVIRVRATAAPLNSAYMAEEFEFYLSDSESKLLITAKEGNEAAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL IP +T TL  A+SDIA  PA P+S+  + SE+VNDPSD+ LFLHTSGTTSRPKGVP
Sbjct  121  SKLKIPHITVTLPEADSDIAFSPAPPQSNLQSASEIVNDPSDIGLFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            L+Q NL SSVNNIKSVYKL  SDSTVIVLPLFHVHGL+AG+LS
Sbjct  181  LSQLNLVSSVNNIKSVYKLCHSDSTVIVLPLFHVHGLMAGLLS  223



>ref|XP_009803076.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Nicotiana sylvestris]
Length=523

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M +STLTGLLKHVA  FPS RAIS+SGKFD+TH+RL  LVERAAS L +AGV+ GDVVAL
Sbjct  1    MASSTLTGLLKHVAEKFPSHRAISISGKFDITHARLQELVERAASQLVSAGVKHGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT+E VIMFLAV RVRATAAPLN+AY AEEFEFYLSDSESK+L+  KEGNEAAQ AA
Sbjct  61   TFPNTIEFVIMFLAVTRVRATAAPLNSAYMAEEFEFYLSDSESKLLITGKEGNEAAQTAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL I  +TATL  A+S +   PA   SD ++VS++VNDPSDV LFLHTSGTTSRPKGVP
Sbjct  121  SKLKIRHITATLPQADSGVTFSPAPSGSDLESVSKIVNDPSDVGLFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLASSVNNIKSVYKL++SDSTVIVLPLFHVHGLIAG+LS
Sbjct  181  LTQLNLASSVNNIKSVYKLSDSDSTVIVLPLFHVHGLIAGLLS  223



>ref|XP_009601805.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Nicotiana tomentosiformis]
Length=523

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 174/223 (78%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M + TLTGLLKHVA  FPS RAIS+SGKFD+TH+RL  LVER AS L +AGV+ GDVVAL
Sbjct  1    MASLTLTGLLKHVAEKFPSHRAISISGKFDITHARLQELVERTASQLVSAGVKHGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIRVRATAAPLN+AY AEEFEFYLSDSESK+LL   EGNEAAQ AA
Sbjct  61   TFPNTVEFVIMFLAVIRVRATAAPLNSAYMAEEFEFYLSDSESKLLLTGNEGNEAAQTAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL I  +TATL  A+SDI   PA   SD ++VS++VNDPSDV LFLHTSGTTSRPKGVP
Sbjct  121  SKLKIRHITATLPQADSDITFSPAPSGSDLESVSKIVNDPSDVGLFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLASSVNNIKSVYKL++SDSTVIVLPLFHVHGLIAG+LS
Sbjct  181  LTQINLASSVNNIKSVYKLSDSDSTVIVLPLFHVHGLIAGLLS  223



>ref|XP_011048720.1| PREDICTED: oxalate--CoA ligase [Populus euphratica]
Length=524

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 190/216 (88%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M T TLTGLLK VAG FP+RRAISVSGK DLTH+RLH ++ERAAS L A+G++PGDVVAL
Sbjct  1    MATPTLTGLLKRVAGEFPNRRAISVSGKLDLTHARLHEIIERAASRLVASGIKPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RATAAPLNAAYT EEFEFYLSDSESK+LL  +EGN +AQAAA
Sbjct  61   TFPNTVEFVIMFLAVIRARATAAPLNAAYTTEEFEFYLSDSESKLLLTQQEGNSSAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDS-DAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            +KL IP  +ATLSGA+S++ L P   ESD  D +S+L+NDPSD++LFLHTSGTTSRPKGV
Sbjct  121  SKLKIPHASATLSGADSELNLSPGPTESDDPDLISQLINDPSDMALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NLASSVNNIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  216



>ref|XP_009767710.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
10 [Nicotiana sylvestris]
Length=524

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLTG LKH+A  FP+ RAISVSGKFD+TH+RL+ L+E AAS L AAGV P DVV+LTFPN
Sbjct  6    TLTGFLKHIAAKFPTHRAISVSGKFDVTHARLYQLIEHAASXLVAAGVNPSDVVSLTFPN  65

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            T+E VIMFLAVIRVRATAAPLN+ YT+EEFEFYLSDSE K+LLI KEGNEA +A A KL+
Sbjct  66   TIEFVIMFLAVIRVRATAAPLNSVYTSEEFEFYLSDSECKLLLIAKEGNEADEAEATKLN  125

Query  469  IPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQF  648
            IP +  TL  ++SD++L P+  +SDS++VS++VN+PSDV+LFLHTSGTTSRPKGVPLTQ 
Sbjct  126  IPQIVVTLPHSDSDVSLIPSSLQSDSESVSKIVNEPSDVALFLHTSGTTSRPKGVPLTQH  185

Query  649  NLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            NL S VNNIKSVYKLTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  186  NLVSFVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGLLS  224



>ref|XP_010671877.1| PREDICTED: oxalate--CoA ligase [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   303 bits (775),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 197/224 (88%), Gaps = 1/224 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME+ TLTGLLK++A  FPSRRAISVSGKFD++HSRLH LVE AAS L  AGV PGDVVAL
Sbjct  1    MESLTLTGLLKNIAEKFPSRRAISVSGKFDISHSRLHQLVEHAASCLLTAGVHPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT+E VIMFLAVIRVRATAAPLNAAYT+EEFEFYLSDSESK+LL   EGN+AA+ AA
Sbjct  61   TFPNTIEFVIMFLAVIRVRATAAPLNAAYTSEEFEFYLSDSESKLLLTSPEGNKAAETAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDS-DAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            +K+++P  TA+L+  +S++ L   HPESDS ++V+ L+NDPSDV+LFLHTSGTTSRPKGV
Sbjct  121  SKINLPHATASLTSPDSELTLSLTHPESDSPNSVTSLINDPSDVALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PL+QFNL SSV NIKSVY+LTESDSTVIVLPLFHVHGLIA +LS
Sbjct  181  PLSQFNLVSSVYNIKSVYRLTESDSTVIVLPLFHVHGLIAALLS  224



>ref|XP_002322473.1| AMP-dependent synthetase and ligase family protein [Populus trichocarpa]
 gb|EEF06600.1| AMP-dependent synthetase and ligase family protein [Populus trichocarpa]
Length=524

 Score =   303 bits (775),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 191/216 (88%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M T TLTGLLK VAG FP+RRA+SVSGK DLTH+RLH ++ERAAS L A+G++PGDVVAL
Sbjct  1    MATLTLTGLLKRVAGEFPNRRAVSVSGKLDLTHARLHEIIERAASRLVASGIKPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RATAAPLNAAYT EEFEFYLSDSESK+LL  +EGN +AQAAA
Sbjct  61   TFPNTVEFVIMFLAVIRARATAAPLNAAYTTEEFEFYLSDSESKLLLTAQEGNSSAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDS-DAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            +KL IP  TATLSGA+S++ L P+  ESD  + +S+L+NDPSD++LFLHTSGTTSRPKGV
Sbjct  121  SKLKIPHATATLSGADSELNLSPSPTESDDPNLISQLINDPSDMALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NLASSVNNIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  216



>gb|AFN53690.1| acyl CoA ligase [Linum usitatissimum]
Length=512

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 197/224 (88%), Gaps = 1/224 (0%)
 Frame = +1

Query  97   METS-TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVA  273
            MET+ TLTGLLK VAG FP RRA+SVSGKFDLTH+RL  LVERAAS L +AG++PGDVVA
Sbjct  1    METTQTLTGLLKRVAGEFPDRRALSVSGKFDLTHARLDELVERAASRLVSAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE V+MFLAVIR RATAAPLNAAYTAEEFEFYLSDSESK+L+  +EGN AA+AA
Sbjct  61   LTFPNTVEFVVMFLAVIRARATAAPLNAAYTAEEFEFYLSDSESKLLVTSREGNAAAEAA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL +  VTA L+G +S++ L  +  E+  +++++LVNDPSDV+LFLHTSGTTSRPKGV
Sbjct  121  ASKLQVTQVTAGLTGEDSELILSLSPSETGDNSITQLVNDPSDVALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PLTQ NLASSV NIKSVYKLTESDSTVIVLPLFHVHGL+AG+LS
Sbjct  181  PLTQLNLASSVQNIKSVYKLTESDSTVIVLPLFHVHGLLAGLLS  224



>gb|KDO59995.1| hypothetical protein CISIN_1g009867mg [Citrus sinensis]
Length=431

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TL GLL  V   F S+RA+SVSGKFDLT+SR+H LVERAAS L AAG+  GDVVAL
Sbjct  1    MEGVTLIGLLNQVIDQFSSKRALSVSGKFDLTYSRIHELVERAASRLVAAGINAGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RATAAPLNAAYT +EFEFYLSDSESK+LL P EGN AAQAAA
Sbjct  61   TFPNTVEFVIMFLAVIRARATAAPLNAAYTPDEFEFYLSDSESKLLLTPAEGNAAAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+I   TATL  A+S++ L  AH ESD++A+S+L NDPSDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLNISHATATLLDADSELTLSLAHSESDTNAISKLTNDPSDVALFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLA+SV+NIKSVYKLTESDSTVIVLPLFHVHG++AG+LS
Sbjct  181  LTQNNLAASVSNIKSVYKLTESDSTVIVLPLFHVHGMLAGLLS  223



>ref|XP_011076162.1| PREDICTED: oxalate--CoA ligase [Sesamum indicum]
Length=523

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M TSTLTGLL HVA  FPSRRAISVSGKFDLTH+RL+ LVE AA+ L AAGV+PGDVVAL
Sbjct  1    MATSTLTGLLNHVAAIFPSRRAISVSGKFDLTHARLNQLVEYAAAQLLAAGVKPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE V+MFLAVIRVRATAAPLNAAYT +EFEFYLSDSESK+LL  KEGNE AQAAA
Sbjct  61   TFPNTVEFVVMFLAVIRVRATAAPLNAAYTFDEFEFYLSDSESKLLLTSKEGNEPAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            AKL+IP ++ATL  A+SDI L P     D+D +++L NDPSD +LFLHTSGTTSRPKGVP
Sbjct  121  AKLNIPHLSATLPTADSDIILSPTQSNFDTDTLAKLTNDPSDAALFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NL SSV NIKSVYK+TESDSTVIVLPLFHVH
Sbjct  181  LTQQNLYSSVQNIKSVYKITESDSTVIVLPLFHVH  215



>ref|XP_006421926.1| hypothetical protein CICLE_v10004732mg [Citrus clementina]
 gb|ESR35166.1| hypothetical protein CICLE_v10004732mg [Citrus clementina]
Length=475

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TL GLL  V   F S+RA+SVSGKFDLT+SR+H LVERAAS L AAG+  GDVVAL
Sbjct  1    MEGVTLIGLLNQVIDQFSSKRALSVSGKFDLTYSRIHELVERAASRLVAAGINAGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RATAAPLNAAYT +EFEFYLSDSESK+LL P EGN AAQAAA
Sbjct  61   TFPNTVEFVIMFLAVIRARATAAPLNAAYTPDEFEFYLSDSESKLLLTPAEGNAAAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+I   TATL  A+S++ L  AH ESD++A+S+L NDPSDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLNISHATATLLDADSELTLSLAHSESDTNAISKLTNDPSDVALFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLA+SV+NIKSVYKLTESDSTVIVLPLFHVHG++AG+LS
Sbjct  181  LTQNNLAASVSNIKSVYKLTESDSTVIVLPLFHVHGMLAGLLS  223



>ref|XP_012090254.1| PREDICTED: oxalate--CoA ligase [Jatropha curcas]
 gb|KDP22274.1| hypothetical protein JCGZ_26105 [Jatropha curcas]
Length=521

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 198/223 (89%), Gaps = 2/223 (1%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M++ TLTGLLK++AG F +RRA+S+SGKFD+THS+LH LVERAAS L  AG++PGDVVAL
Sbjct  1    MDSLTLTGLLKNIAGEFSNRRAVSISGKFDMTHSQLHELVERAASRLVEAGIKPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT+E V+MFLAVIR RATAAPLN+AYTAEEFEFYLSDSESK+LL P EGN +AQAAA
Sbjct  61   TFPNTIEFVLMFLAVIRARATAAPLNSAYTAEEFEFYLSDSESKLLLTPPEGNSSAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+I   TA+LSG +S+I+L  + P S + ++++L N+PSDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLNIRHATASLSGTDSEISL--SLPGSGAISLAQLTNEPSDVALFLHTSGTTSRPKGVP  178

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLASSV NIK++YKLTESDSTVIVLPLFHVHGL+AG+LS
Sbjct  179  LTQLNLASSVRNIKAIYKLTESDSTVIVLPLFHVHGLVAGLLS  221



>gb|AHM88425.1| 4CL13 [Fraxinus mandshurica]
Length=523

 Score =   295 bits (755),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M T T+TGLLK VAG FP RRAISVSGKFDLTH+RLH LVERAAS L AAGV+PGDVVAL
Sbjct  1    MATLTITGLLKQVAGKFPFRRAISVSGKFDLTHARLHELVERAASRLLAAGVKPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIRVRATAAPLNAAYT +EFEFYLSDSESK+LL  KEGNE AQ+AA
Sbjct  61   TFPNTVEFVIMFLAVIRVRATAAPLNAAYTLDEFEFYLSDSESKLLLTSKEGNEPAQSAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            AKL+IP   ATL+ AES++ L     ES  D+++EL+N PSD++LFLHTSGTTSRPKGVP
Sbjct  121  AKLNIPHAKATLADAESEVTLSLTQFESSPDSLAELLNHPSDLALFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NL SSV NIKSVYKL+ESD+TVIVLPLFHVH
Sbjct  181  LTQHNLYSSVQNIKSVYKLSESDATVIVLPLFHVH  215



>ref|XP_006421925.1| hypothetical protein CICLE_v10004732mg [Citrus clementina]
 ref|XP_006490394.1| PREDICTED: 4-coumarate--CoA ligase-like 10-like [Citrus sinensis]
 gb|ESR35165.1| hypothetical protein CICLE_v10004732mg [Citrus clementina]
 gb|KDO59994.1| hypothetical protein CISIN_1g009867mg [Citrus sinensis]
Length=523

 Score =   295 bits (755),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TL GLL  V   F S+RA+SVSGKFDLT+SR+H LVERAAS L AAG+  GDVVAL
Sbjct  1    MEGVTLIGLLNQVIDQFSSKRALSVSGKFDLTYSRIHELVERAASRLVAAGINAGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RATAAPLNAAYT +EFEFYLSDSESK+LL P EGN AAQAAA
Sbjct  61   TFPNTVEFVIMFLAVIRARATAAPLNAAYTPDEFEFYLSDSESKLLLTPAEGNAAAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+I   TATL  A+S++ L  AH ESD++A+S+L NDPSDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLNISHATATLLDADSELTLSLAHSESDTNAISKLTNDPSDVALFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLA+SV+NIKSVYKLTESDSTVIVLPLFHVHG++AG+LS
Sbjct  181  LTQNNLAASVSNIKSVYKLTESDSTVIVLPLFHVHGMLAGLLS  223



>ref|XP_006363316.1| PREDICTED: 4-coumarate--CoA ligase-like 10-like [Solanum tuberosum]
Length=524

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 192/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLT LLK VA  FP+R AISVSGKF +TH RL  L+E+AAS L AAG++PGDVVALTFPN
Sbjct  6    TLTRLLKLVAEKFPTRNAISVSGKFIVTHERLQQLIEQAASQLVAAGIQPGDVVALTFPN  65

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            T+E VIMFLAVIRVRATAAPLN+AY  EEFEFYLSDSESK+LLI KEGNEAA+AAAAKL+
Sbjct  66   TIEFVIMFLAVIRVRATAAPLNSAYMPEEFEFYLSDSESKLLLIAKEGNEAAEAAAAKLN  125

Query  469  IPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQF  648
            IP +  TL  ++SD++L P+ P SD D VSE+VNDPSDV+LFLHTSGTTSRPKGVPLTQ 
Sbjct  126  IPRIKVTLPNSDSDVSLSPSSPLSDCDLVSEIVNDPSDVALFLHTSGTTSRPKGVPLTQH  185

Query  649  NLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            NL SSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  186  NLVSSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGLLS  224



>ref|XP_002510783.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF51385.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=521

 Score =   292 bits (747),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 196/223 (88%), Gaps = 2/223 (1%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M++ TLTGLLK VA  FP  RA+SVSGKFDL+HS+L+ LV++AAS L AAG++P DVVAL
Sbjct  1    MDSLTLTGLLKRVALEFPDNRAVSVSGKFDLSHSQLNELVDQAASRLVAAGIKPSDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE +I+FLAVIRVRATAAPLNAAYT EEFEFYLSDSESK+LL P EGN +AQ+AA
Sbjct  61   TFPNTVEFIILFLAVIRVRATAAPLNAAYTTEEFEFYLSDSESKLLLTPLEGNSSAQSAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP  TA L  A+S+++L  + PESD +++S+L ++PSDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLNIPHATAVLPAADSELSL--SLPESDFNSLSQLTDEPSDVALFLHTSGTTSRPKGVP  178

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLASSV NIK+VYKLTESDSTVIVLPLFHVHGL+AG+LS
Sbjct  179  LTQLNLASSVRNIKAVYKLTESDSTVIVLPLFHVHGLVAGLLS  221



>gb|AFP66956.1| acyl-CoA synthetase, partial [Capsicum annuum]
Length=205

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTG LKHVA  +PS RAISVSG+ D+TH+RL  LVERAAS + AAGV+PGDVVAL
Sbjct  1    MECLTLTGFLKHVAEKYPSHRAISVSGRLDITHARLQQLVERAASQIVAAGVKPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT+E VIMFLAVIR RATAAPLN+AY  EEFEFYLSDSESK+LL  KEGNEAAQAAA
Sbjct  61   TFPNTIEFVIMFLAVIRARATAAPLNSAYMTEEFEFYLSDSESKLLLTAKEGNEAAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL IP ++ TLS  ESD+A  PA PESD +++S++VN+PSDV LFLHTSGTTSRPKGVP
Sbjct  121  SKLKIPRISVTLSQPESDVAFSPAPPESDLESMSKIVNEPSDVGLFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDST  711
            L Q NL SSVNNIKSVYKL+++DST
Sbjct  181  LAQLNLLSSVNNIKSVYKLSDTDST  205



>gb|EYU25098.1| hypothetical protein MIMGU_mgv1a003760mg [Erythranthe guttata]
Length=565

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 193/232 (83%), Gaps = 6/232 (3%)
 Frame = +1

Query  49   TVSFIFFHEILADSLSMETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAA  228
             + F FF       L+M  STLTGLL +VAG F  R AISVSGKFDLTH++LH LV+RAA
Sbjct  31   CIRFPFFSR-----LAMGISTLTGLLDYVAGQFSDRGAISVSGKFDLTHAKLHQLVDRAA  85

Query  229  SSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESK  408
            + L +AGV PGDVVALTFPNTVE VIMFLAVIRVRATAAPLNAAYT +EFEFYLSDSESK
Sbjct  86   AKLLSAGVSPGDVVALTFPNTVEFVIMFLAVIRVRATAAPLNAAYTFDEFEFYLSDSESK  145

Query  409  MLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPES-DSDAVSELVNDPSDV  585
            +LL  KEGNE AQAAAAKL+IP ++ATL  A+SD+ L P   E+ D++++SEL NDPSDV
Sbjct  146  ILLTSKEGNEPAQAAAAKLNIPHLSATLPDADSDVVLSPTQSEADDTNSLSELTNDPSDV  205

Query  586  SLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            +LFLHTSGTTSRPKGVPLTQ NL SSV NI+SVYK+TESDSTVIVLPLFHVH
Sbjct  206  ALFLHTSGTTSRPKGVPLTQQNLYSSVRNIQSVYKITESDSTVIVLPLFHVH  257



>ref|XP_004240733.1| PREDICTED: oxalate--CoA ligase-like isoform X1 [Solanum lycopersicum]
Length=521

 Score =   290 bits (742),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  106  STLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFP  285
            +TLT LLK+VA  FP+R A+SVSG+F +TH RL  L+E+AAS L AAG++PGDVVALTFP
Sbjct  2    ATLTMLLKNVAEKFPTRNAVSVSGRFIVTHKRLQQLIEQAASLLVAAGIQPGDVVALTFP  61

Query  286  NTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKL  465
            NT+E V+MFLAVIRVRATAAPLN+AY  EEFEFYLSDSESK+LLI KEGN+AA+AAAAKL
Sbjct  62   NTIEFVVMFLAVIRVRATAAPLNSAYMPEEFEFYLSDSESKLLLIAKEGNKAAEAAAAKL  121

Query  466  SIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQ  645
            +I  +  ++  ++SD+ L  + P SD D VSE+VNDPSDV+LFLHTSGTTSRPKGVP+TQ
Sbjct  122  NITRIKVSVPSSDSDVILSLSIPLSDCDLVSEIVNDPSDVALFLHTSGTTSRPKGVPITQ  181

Query  646  FNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             NL SSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  182  HNLVSSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGLLS  221



>gb|KFK34191.1| hypothetical protein AALP_AA5G112900 [Arabis alpina]
Length=514

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLF-AAGVRPGDVVA  273
            M++ TLTGLLK VA  FP RRA+SVSGKFDL+H+RLH L+ERAAS L  AAG++PGDVVA
Sbjct  1    MDSDTLTGLLKTVAEKFPDRRALSVSGKFDLSHARLHDLIERAASRLVSAAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VI FLAVIR RAT APLNAAYTAEEFEFYLSDS+SK+LL  +EGN  AQ A
Sbjct  61   LTFPNTVEFVITFLAVIRARATVAPLNAAYTAEEFEFYLSDSDSKLLLTSQEGNGPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL+I  VTATL  A SD+AL  A  +S  ++V+ELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLNISHVTATLLDAGSDLALSVADSDSVVESVAELVNSPEDAALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PLTQ NLASSV NIKSVYKLTE+DSTVIVLPLFHVHGL+AG+LS
Sbjct  181  PLTQLNLASSVRNIKSVYKLTEADSTVIVLPLFHVHGLMAGLLS  224



>dbj|BAO45891.1| CoA ligase [Acacia mangium]
Length=513

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 192/224 (86%), Gaps = 1/224 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTGLL  +A  FPSRRAISVSGKFDLT+SRL  LVERA S L ++G+  GDVVAL
Sbjct  1    MEAPTLTGLLNQIAVEFPSRRAISVSGKFDLTYSRLLELVERATSRLVSSGINVGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDSESK+LL  +EGN AAQAAA
Sbjct  61   TFPNTVEYVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSESKLLLTSQEGNAAAQAAA  120

Query  457  aKLSIPAVTATLSGA-ESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            +KL+IP  TA+LS A +++++L     ES S++ +ELVNDPSDV+LFLHTSGTTSRPKGV
Sbjct  121  SKLNIPHATASLSKADDAEVSLSLTQNESKSESTAELVNDPSDVALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PLTQ NLA+SV NIKSVY+ TESDSTVIVLPLFHVHGLIAG+LS
Sbjct  181  PLTQHNLAASVQNIKSVYRFTESDSTVIVLPLFHVHGLIAGLLS  224



>emb|CBI22725.3| unnamed protein product [Vitis vinifera]
Length=523

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 187/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME+ TLTGLLK VAG FPSRRA+SVSGKFDLT++RLH LVE AAS + A GV+ GDVVAL
Sbjct  1    MESLTLTGLLKQVAGEFPSRRALSVSGKFDLTYARLHQLVEGAASLILAGGVKAGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIRVRATAAPLN+AYTA+EFEFYLSDSESK+LL  +EGNEAAQAAA
Sbjct  61   TFPNTVEFVIMFLAVIRVRATAAPLNSAYTADEFEFYLSDSESKLLLTSQEGNEAAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL I   TA+L+ AE+ + L   H E D  +V++LVN+PSDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLKITHATASLTEAEAQVNLSLIHSEPDPHSVAKLVNEPSDVALFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            L+Q NLASSV NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  LSQLNLASSVQNIKSVYKLTESDSTVIVLPLFHVH  215



>ref|XP_002267459.1| PREDICTED: oxalate--CoA ligase-like [Vitis vinifera]
Length=524

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 187/215 (87%), Gaps = 0/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME+ TLTGLLK VAG FPSRRA+SVSGKFDLT++RLH LVE AAS + A GV+ GDVVAL
Sbjct  2    MESLTLTGLLKQVAGEFPSRRALSVSGKFDLTYARLHQLVEGAASLILAGGVKAGDVVAL  61

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIRVRATAAPLN+AYTA+EFEFYLSDSESK+LL  +EGNEAAQAAA
Sbjct  62   TFPNTVEFVIMFLAVIRVRATAAPLNSAYTADEFEFYLSDSESKLLLTSQEGNEAAQAAA  121

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL I   TA+L+ AE+ + L   H E D  +V++LVN+PSDV+LFLHTSGTTSRPKGVP
Sbjct  122  SKLKITHATASLTEAEAQVNLSLIHSEPDPHSVAKLVNEPSDVALFLHTSGTTSRPKGVP  181

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            L+Q NLASSV NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  182  LSQLNLASSVQNIKSVYKLTESDSTVIVLPLFHVH  216



>gb|AFP49809.1| 4-hydroxycinnamoyl-CoA ligase 2 [Coffea arabica]
 emb|CDP05192.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 191/229 (83%), Gaps = 6/229 (3%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TL+GLL  VA  FPSRRAISV G+FDL+H+RLH LVER A+ L AAGV+PGDV+AL
Sbjct  1    MENLTLSGLLIKVAAKFPSRRAISVPGRFDLSHARLHQLVERTATRLVAAGVQPGDVIAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPN+VE VI FLAVIR RATAAPLN AYTA+EF+FYLSDS+SK+LL  K+G+  AQAAA
Sbjct  61   TFPNSVEFVIAFLAVIRARATAAPLNPAYTADEFQFYLSDSDSKILLTSKQGSAPAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIAL------FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTS  618
            +KL+IP VT  L  A+SD+AL      + + PE D +  S+L+NDPSD+SLFLHTSGTTS
Sbjct  121  SKLNIPHVTVALPDADSDVALSSSLSQYESDPEPDPNLSSKLINDPSDISLFLHTSGTTS  180

Query  619  RPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            RPKGVPLTQ NL SSVNNIKSVY++TESDSTVIVLPLFHVHGL+AG+LS
Sbjct  181  RPKGVPLTQLNLVSSVNNIKSVYRITESDSTVIVLPLFHVHGLLAGLLS  229



>ref|XP_004298741.1| PREDICTED: oxalate--CoA ligase [Fragaria vesca subsp. vesca]
Length=524

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 187/224 (83%), Gaps = 1/224 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME STLTGLLK VA  FP+RRAISVSGKFDLTH+RLH LVE AAS L AAGV P D +AL
Sbjct  1    MENSTLTGLLKKVASEFPNRRAISVSGKFDLTHARLHELVEYAASQLLAAGVAPHDSIAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPN++E V+MFLAVIR RATAAPLNAAYTAEEFEFYLSDSESK+L+  ++  ++A +AA
Sbjct  61   TFPNSIEYVVMFLAVIRCRATAAPLNAAYTAEEFEFYLSDSESKLLITSEKPIQSAVSAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAH-PESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
             KLSIP VTA LS    ++ L  A   E   D++S+ VNDPSDV+LFLHTSGTTSRPKGV
Sbjct  121  TKLSIPYVTAALSEGGGNVCLSSATVGEPSCDSISKFVNDPSDVALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PLTQ NLASSV NI+SVY+LTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  181  PLTQLNLASSVRNIRSVYRLTESDSTVIVLPLFHVHGLIAGLLS  224



>ref|XP_008238864.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
10 [Prunus mume]
Length=508

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 187/223 (84%), Gaps = 1/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTGLLK VA  FP+RRA+SVSGKFDLT++RL  LV+ AAS L A+G+ P D VAL
Sbjct  1    MENQTLTGLLKKVASEFPNRRAVSVSGKFDLTYARLQELVDHAASLLIASGIGPNDTVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVELV+MFLAV+R RATAAPLN AYTAEEFEFYLSDSE K+LL P+   +A +AAA
Sbjct  61   TFPNTVELVVMFLAVVRCRATAAPLNPAYTAEEFEFYLSDSEPKLLLTPEVPVQAIKAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
             KL+IP VTA L+GA S + L  A  ES  D+VS+LVND SDV+LFLHTSGTTSRPKGVP
Sbjct  121  TKLNIPHVTAKLAGATSHVTLSSAA-ESSPDSVSQLVNDASDVALFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLASSV NIKSVYKLTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  180  LTQLNLASSVQNIKSVYKLTESDSTVIVLPLFHVHGLIAGLLS  222



>ref|XP_007038702.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
 gb|EOY23203.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
Length=523

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME+ TLT LLK VAG FP R A+SV GKFD+TH +LH ++E AAS L A G+  GDVVAL
Sbjct  1    MESLTLTELLKQVAGEFPHRLAVSVPGKFDITHYKLHEVIELAASRLLANGIGAGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT+E VIMFLAVIR RATAAPLN AYT EEFEFYLSDSESK+LL   EGN +AQAAA
Sbjct  61   TFPNTIEFVIMFLAVIRARATAAPLNPAYTTEEFEFYLSDSESKLLLTSIEGNSSAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP  TATL  A+S++AL  +  +SD ++VS+L N+PSDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLNIPHATATLHDADSELALSLSQQDSDLNSVSKLTNEPSDVALFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQFNLASSV N+KSVYKLTESD+TV+VLPLFHVHGLIAG+LS
Sbjct  181  LTQFNLASSVKNVKSVYKLTESDATVLVLPLFHVHGLIAGLLS  223



>gb|AHL44979.1| 4-coumarate:coenzyme A ligase 4 [Fraxinus mandshurica]
Length=523

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M + TLTGLL  VAG FPSRRAIS SGKF+++H+RLH L+E AAS L  AGV+PGDVVAL
Sbjct  1    MASLTLTGLLNEVAGKFPSRRAISFSGKFNISHARLHELIECAASRLLDAGVKPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIRVRATAAPLNAAYT +EFEFYLSDSESK+LL  KEGN+ A+AAA
Sbjct  61   TFPNTVEFVIMFLAVIRVRATAAPLNAAYTFDEFEFYLSDSESKILLTSKEGNKPAEAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP +TATLS A  ++ L    P+S+ D+VS++VND SDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLNIPHMTATLSDANLELILSSTRPQSNPDSVSKIVNDSSDVALFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NL SSV NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  LTQHNLYSSVQNIKSVYKLTESDSTVIVLPLFHVH  215



>gb|KHG11636.1| 4-coumarate--CoA ligase-like 10 [Gossypium arboreum]
Length=522

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            MET TLTGLL   A  FP+RRA+SVSGKFDLTH++L H+++ AAS L A+G+ PGDVVAL
Sbjct  1    METVTLTGLLHKAAAEFPARRALSVSGKFDLTHAQLQHIIDHAASLLIASGIHPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVELVIMFLAVIR RATAAPLN+AYTAEEFEFYLSDSESK+LLIP EG + A+AAA
Sbjct  61   TFPNTVELVIMFLAVIRCRATAAPLNSAYTAEEFEFYLSDSESKLLLIPAEGIKPAEAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP V+A L    S I L  ++PES+ D+V++LVNDP+DVSLFLHTSGTTSRPKGVP
Sbjct  121  SKLNIPLVSAALQDENSKITL-SSNPESNIDSVNQLVNDPADVSLFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQFNL +SV NIKSVY+LTESDSTVIVLPLFHVH
Sbjct  180  LTQFNLGTSVLNIKSVYELTESDSTVIVLPLFHVH  214



>gb|AGW27197.1| 4-coumarate:coenzyme A ligase 7 [Salvia miltiorrhiza]
Length=523

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M  STLT LL HVA  FPSRRAISVSGKFDLTH+RL+ LV+ AA+ L AAGV+PGDVVAL
Sbjct  1    MAISTLTALLNHVAEKFPSRRAISVSGKFDLTHARLNQLVDHAAAQLVAAGVKPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPN VE VIMFLAVIR RATAAPLNA YT +EF+FYLSDSESK+LL  KEGNE AQAAA
Sbjct  61   TFPNAVEFVIMFLAVIRARATAAPLNATYTFDEFDFYLSDSESKLLLTSKEGNEQAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            AKL+IP ++A L   +S+I L P     D+D+V++L N+PSD +LFLHTSGTTSRPKGVP
Sbjct  121  AKLNIPHLSAALPAGDSEIVLSPTQSNVDTDSVAKLTNEPSDAALFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NL SSV NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  LTQQNLYSSVQNIKSVYKLTESDSTVIVLPLFHVH  215



>ref|XP_006404192.1| hypothetical protein EUTSA_v10010297mg [Eutrema salsugineum]
 gb|ESQ45645.1| hypothetical protein EUTSA_v10010297mg [Eutrema salsugineum]
Length=514

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 183/216 (85%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLF-AAGVRPGDVVA  273
            M++ TLTGLLK+VA  FP RRA+SVSGKFDLTH+RLH L+ERAAS L  AAG++PGDVVA
Sbjct  1    MDSDTLTGLLKNVATKFPDRRALSVSGKFDLTHARLHDLIERAASRLVSAAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDS+SK+LL  KEGN+ AQ A
Sbjct  61   LTFPNTVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTSKEGNKPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL+I  VTATL  A SD+ L  A  +S  D+ +ELVN P D SLFLHTSGTTSRPKGV
Sbjct  121  ASKLNISHVTATLLDAGSDLVLSVADSDSVVDSAAELVNSPDDASLFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NLASSV NIKSVYKL ESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLASSVRNIKSVYKLVESDSTVIVLPLFHVH  216



>gb|EPS64224.1| hypothetical protein M569_10556, partial [Genlisea aurea]
Length=513

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 182/223 (82%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M  STLTGLL  VA  FP RRA+SVSG+FDL HSRL  +VE  A  L AAGVRPGDVVAL
Sbjct  4    MANSTLTGLLNDVADKFPGRRAVSVSGEFDLKHSRLRQIVEAGADWLIAAGVRPGDVVAL  63

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPN VE V+ FL+VIRVRATAAPLNAAYT +EF++YLSDSESK L+  KEGNEAAQAAA
Sbjct  64   TFPNAVEFVVSFLSVIRVRATAAPLNAAYTFDEFQYYLSDSESKFLISSKEGNEAAQAAA  123

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            AKL+IP ++A L  A+SDI   P  PE +S AV  ++NDP DV+LFLHTSGTTSRPKGVP
Sbjct  124  AKLNIPHISAALPAADSDIVFSPLKPEIESGAVDRVINDPWDVALFLHTSGTTSRPKGVP  183

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NL  S  NIKSVYKL+E+DSTVIVLPLFHVHGLIAG++S
Sbjct  184  LTQENLYCSTQNIKSVYKLSEADSTVIVLPLFHVHGLIAGLMS  226



>ref|XP_008360705.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Malus domestica]
Length=522

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 187/223 (84%), Gaps = 1/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME+ TLT LLK VA  FP+ RA+SVSGKFDLTH+RL  LV+ AAS L A+G+ P D VAL
Sbjct  1    MESPTLTXLLKQVASGFPNHRALSVSGKFDLTHARLQELVDHAASLLIASGIAPNDTVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE V+MFLAVIR RATAAPLNA YTAEEFEFYLSDSESK+L+ P++   AAQAAA
Sbjct  61   TFPNTVEFVVMFLAVIRCRATAAPLNAVYTAEEFEFYLSDSESKLLITPEKPIHAAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP VTA LS A S + L  A  E   D+VS+LVN+PSDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLNIPHVTANLSDAASHVTLSSA-AEGSPDSVSQLVNEPSDVALFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLASSV NIKSVYKLTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  180  LTQLNLASSVQNIKSVYKLTESDSTVIVLPLFHVHGLIAGLLS  222



>ref|XP_004143916.1| PREDICTED: oxalate--CoA ligase-like [Cucumis sativus]
 gb|KGN50110.1| AMP dependent CoA ligase [Cucumis sativus]
Length=513

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 181/223 (81%), Gaps = 1/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  T TGLLK  A  FP  RA+SVSGKFDLTH RL  L+E AA+ L  AGV+ GDVVAL
Sbjct  1    MENCTFTGLLKKAASEFPRCRALSVSGKFDLTHERLQELIEHAAARLVDAGVKAGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RATAAPLN+AYTAEEFEFYLSDSESK+LL  KEG  +AQ AA
Sbjct  61   TFPNTVEYVIMFLAVIRCRATAAPLNSAYTAEEFEFYLSDSESKLLLTSKEGISSAQTAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
             KL+IP V A LS  +  I LFP+  E+ S+ V E+VNDPSD +LFLHTSGTTSRPKGVP
Sbjct  121  TKLNIPQVKANLSSGDEFIELFPSPIETGSNVV-EIVNDPSDAALFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NL +SV NIKSVYKL+ESDSTV+VLPLFHVHGL+AG+LS
Sbjct  180  LTQQNLGASVQNIKSVYKLSESDSTVLVLPLFHVHGLMAGLLS  222



>gb|KJB25811.1| hypothetical protein B456_004G210700 [Gossypium raimondii]
Length=427

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 184/215 (86%), Gaps = 1/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            MET TLTGLL   A  FP+RRA+SVSGKFDLTH++L H+++ AAS L A+G+ PGDVVAL
Sbjct  1    METVTLTGLLHKAAAEFPTRRALSVSGKFDLTHAQLQHIIDHAASLLIASGIHPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVELVIMFLAVIR RATAAPLN+AYTAEEFEFYLSDSESK+LLIP EG + A+AAA
Sbjct  61   TFPNTVELVIMFLAVIRCRATAAPLNSAYTAEEFEFYLSDSESKLLLIPAEGIKPAEAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP V+A L    S I L  ++PES+ D+V +LVNDP+DVSLFLHTSGTTSRPKGV 
Sbjct  121  SKLNIPLVSAALQDENSKITL-SSNPESNIDSVKQLVNDPADVSLFLHTSGTTSRPKGVA  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NL +SV NIKSVY+LTESDSTVIVLPLFHVH
Sbjct  180  LTQLNLGTSVLNIKSVYELTESDSTVIVLPLFHVH  214



>ref|XP_008365420.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Malus domestica]
Length=522

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 190/223 (85%), Gaps = 1/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M++ TLTGLLK VA  FP+ RA+SVSGKFDLTH+RL  LV+ AA+ L A+GV P D VAL
Sbjct  1    MKSPTLTGLLKXVAAEFPNHRALSVSGKFDLTHARLQELVDHAATLLIASGVAPNDTVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE V+MFLAVIR RATAAPLNAAYTAEEFEFYLSDSESK+L+ P+E   AA+AA+
Sbjct  61   TFPNTVEFVVMFLAVIRCRATAAPLNAAYTAEEFEFYLSDSESKLLITPEEPIHAAKAAS  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP +TA LS A S + L  A  E+  D+VS+LVNDPSDV++FLHTSGTTSRPKGVP
Sbjct  121  SKLNIPHLTANLSDAASHVTLSSA-VEASPDSVSQLVNDPSDVAIFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLASSV NIKSVY+LTESDSTV+VLPLFHVHGLIAG+LS
Sbjct  180  LTQLNLASSVQNIKSVYRLTESDSTVVVLPLFHVHGLIAGLLS  222



>gb|KJB25812.1| hypothetical protein B456_004G210700 [Gossypium raimondii]
Length=459

 Score =   280 bits (716),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 184/215 (86%), Gaps = 1/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            MET TLTGLL   A  FP+RRA+SVSGKFDLTH++L H+++ AAS L A+G+ PGDVVAL
Sbjct  1    METVTLTGLLHKAAAEFPTRRALSVSGKFDLTHAQLQHIIDHAASLLIASGIHPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVELVIMFLAVIR RATAAPLN+AYTAEEFEFYLSDSESK+LLIP EG + A+AAA
Sbjct  61   TFPNTVELVIMFLAVIRCRATAAPLNSAYTAEEFEFYLSDSESKLLLIPAEGIKPAEAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP V+A L    S I L  ++PES+ D+V +LVNDP+DVSLFLHTSGTTSRPKGV 
Sbjct  121  SKLNIPLVSAALQDENSKITL-SSNPESNIDSVKQLVNDPADVSLFLHTSGTTSRPKGVA  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NL +SV NIKSVY+LTESDSTVIVLPLFHVH
Sbjct  180  LTQLNLGTSVLNIKSVYELTESDSTVIVLPLFHVH  214



>ref|XP_010532440.1| PREDICTED: oxalate--CoA ligase [Tarenaya hassleriana]
Length=517

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 186/216 (86%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFA-AGVRPGDVVA  273
            M++ TLTGLLK VAG FP +RA+SVSGKFDLTH+RL  L+ERAAS L + AG+ PGDVVA
Sbjct  1    MDSDTLTGLLKKVAGKFPDQRALSVSGKFDLTHARLQELIERAASRLVSGAGIVPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPN VE VIMF+AVIR RATAAPLNAAYTAEEFEFYLSDS SK+L+   EGN AAQAA
Sbjct  61   LTFPNAVEFVIMFMAVIRARATAAPLNAAYTAEEFEFYLSDSGSKLLITSHEGNAAAQAA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KLSIP  TA LS A+SD++L  A+ +S  D+V+ELVNDP+DVSLFLHTSGTTSRPKGV
Sbjct  121  ASKLSIPHATAALSAADSDLSLSVANSDSVVDSVAELVNDPNDVSLFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSV NI+SVYKL+ESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLVSSVRNIRSVYKLSESDSTVIVLPLFHVH  216



>ref|XP_004152384.1| PREDICTED: oxalate--CoA ligase-like [Cucumis sativus]
 gb|KGN50294.1| hypothetical protein Csa_5G165890 [Cucumis sativus]
Length=518

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 189/222 (85%), Gaps = 3/222 (1%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TL+GLL+ VAG FP RRA+SVSGKFDL+HSRL HLV+ AAS L A G+ PGDVVAL FPN
Sbjct  6    TLSGLLQSVAGTFPDRRALSVSGKFDLSHSRLQHLVDSAASKLVAGGIEPGDVVALVFPN  65

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            TVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDSESK+L+   EGN  A+ AA+KL 
Sbjct  66   TVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSESKLLVTSIEGNSPAETAASKLK  125

Query  469  IPAVTATL--SGAESDIALFPAHPE-SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPL  639
            I  VTA+L  +GAE  ++L P++   S+  +V E++N+ SDV+LFLHTSGTTSRPKGVPL
Sbjct  126  IKHVTASLPDAGAELVLSLTPSNSNGSEYGSVLEILNEGSDVALFLHTSGTTSRPKGVPL  185

Query  640  TQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            TQFNLASSVNNIKSVY+LTESDSTVIVLPLFHVHGL+AG+LS
Sbjct  186  TQFNLASSVNNIKSVYQLTESDSTVIVLPLFHVHGLMAGLLS  227



>ref|XP_007211234.1| hypothetical protein PRUPE_ppa004215mg [Prunus persica]
 gb|EMJ12433.1| hypothetical protein PRUPE_ppa004215mg [Prunus persica]
Length=522

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/223 (74%), Positives = 186/223 (83%), Gaps = 1/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTGLLK VA  FP+ RA+SVSGKFDLTH+RL  LV+ AAS L A+G+ P D VAL
Sbjct  1    MENQTLTGLLKKVASEFPNHRALSVSGKFDLTHARLQELVDHAASLLIASGIGPNDTVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVELV++FLAVIR RATA PLNAAYTAEEFEFYLSDSESK+L+ P+    AA+AAA
Sbjct  61   TFPNTVELVVLFLAVIRCRATAVPLNAAYTAEEFEFYLSDSESKLLITPENPILAAKAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
             KL+IP VTA L+GA S + L  +  ES  D+V +LVND SDV+LFLHTSGTTSRPKGVP
Sbjct  121  TKLNIPHVTAKLAGATSHVTL-SSTAESSPDSVLQLVNDASDVALFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLASSV NIKSVYKLTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  180  LTQLNLASSVQNIKSVYKLTESDSTVIVLPLFHVHGLIAGLLS  222



>ref|XP_010273067.1| PREDICTED: oxalate--CoA ligase [Nelumbo nucifera]
Length=528

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 189/228 (83%), Gaps = 5/228 (2%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLT LLK  AG FPSRRA+SVSGK+DLTH+RL  LV++AAS L A+G+  GDVVAL
Sbjct  1    MEKLTLTSLLKQAAGKFPSRRALSVSGKYDLTHARLQQLVDQAASRLIASGINAGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT E V+MFLAVIR RATAAPLN AYT EEFEFYLSDSES +LL  +EGN++AQAAA
Sbjct  61   TFPNTAEFVVMFLAVIRARATAAPLNPAYTPEEFEFYLSDSESNLLLTSQEGNQSAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDS-----DAVSELVNDPSDVSLFLHTSGTTSR  621
            AKL+IP +T TLS  + D+ L  +  +S +     +++  +VN+ SDV+LFLHTSGTTSR
Sbjct  121  AKLNIPHITVTLSHEDEDVNLSSSSSDSKTTVSFPNSIDRIVNESSDVALFLHTSGTTSR  180

Query  622  PKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PKGVPLTQFNLASSVNNIKSVYK+TESDSTV+VLPLFHVHGL+AG+LS
Sbjct  181  PKGVPLTQFNLASSVNNIKSVYKITESDSTVLVLPLFHVHGLMAGLLS  228



>ref|XP_007040198.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
 gb|EOY24699.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
Length=522

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME+ TLTGL+K  A  FPSRRA+SVSGKFDLTH++L  L++ AAS L A+G++PGDVVAL
Sbjct  1    MESVTLTGLMKKAATEFPSRRALSVSGKFDLTHAQLQQLIDHAASLLIASGIKPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            +FPNTVE VIMFLAVIR RATAAPLN+AYT EEFEFYLSDS+SK+LL+P +G ++AQAAA
Sbjct  61   SFPNTVEFVIMFLAVIRCRATAAPLNSAYTTEEFEFYLSDSQSKLLLVPAQGIKSAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP V+ATL    S +AL  ++P+S  D+V +LVNDP+DVSLFLHTSGTTSRPKGVP
Sbjct  121  SKLNIPHVSATLQDENSKVAL-SSNPDSHLDSVHQLVNDPADVSLFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NLA+S  NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  180  LTQLNLATSTLNIKSVYKLTESDSTVIVLPLFHVH  214



>gb|KJB25809.1| hypothetical protein B456_004G210700 [Gossypium raimondii]
Length=522

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 184/215 (86%), Gaps = 1/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            MET TLTGLL   A  FP+RRA+SVSGKFDLTH++L H+++ AAS L A+G+ PGDVVAL
Sbjct  1    METVTLTGLLHKAAAEFPTRRALSVSGKFDLTHAQLQHIIDHAASLLIASGIHPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVELVIMFLAVIR RATAAPLN+AYTAEEFEFYLSDSESK+LLIP EG + A+AAA
Sbjct  61   TFPNTVELVIMFLAVIRCRATAAPLNSAYTAEEFEFYLSDSESKLLLIPAEGIKPAEAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP V+A L    S I L  ++PES+ D+V +LVNDP+DVSLFLHTSGTTSRPKGV 
Sbjct  121  SKLNIPLVSAALQDENSKITL-SSNPESNIDSVKQLVNDPADVSLFLHTSGTTSRPKGVA  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NL +SV NIKSVY+LTESDSTVIVLPLFHVH
Sbjct  180  LTQLNLGTSVLNIKSVYELTESDSTVIVLPLFHVH  214



>ref|XP_008437250.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Cucumis melo]
Length=513

 Score =   279 bits (714),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 181/223 (81%), Gaps = 1/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTGLLK  A  FP RRA+SVSGKFDLTH RL  L+E AA+ L  +GV  GDVVAL
Sbjct  1    MENCTLTGLLKKAASEFPHRRALSVSGKFDLTHERLQELIEHAAARLVDSGVNAGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TF NTVE VIMFLAVIR RATAAPLN+AYTAEEFEFYLSDSESK+LL  KEG  +AQ AA
Sbjct  61   TFLNTVEYVIMFLAVIRCRATAAPLNSAYTAEEFEFYLSDSESKLLLTSKEGISSAQTAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
             KL+IP V  +LS  +  I LFP+  E  S+ V E+VNDPSD +LFLHTSGTTSRPKGVP
Sbjct  121  TKLNIPQVKVSLSSGDEYIELFPSPIEMSSNVV-EIVNDPSDAALFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLA+SV NIKSVYKL+ESDSTV+VLPLFHVHGL+AG+LS
Sbjct  180  LTQQNLAASVQNIKSVYKLSESDSTVLVLPLFHVHGLMAGLLS  222



>ref|XP_004513742.1| PREDICTED: 4-coumarate--CoA ligase-like 10-like [Cicer arietinum]
Length=527

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 165/234 (71%), Positives = 194/234 (83%), Gaps = 11/234 (5%)
 Frame = +1

Query  97   METST-LTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVA  273
            METST LTGLL+ VA  FPSRRAISV+GKFDLTHSRLH LV+ AA+ L +AG++P DVVA
Sbjct  1    METSTTLTGLLQSVAKKFPSRRAISVAGKFDLTHSRLHELVDSAAAHLISAGIKPNDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNT+E V++FLAVIRVRATAAPLNAAYT+EEFEFYLSDSESK+LL P EGNE AQAA
Sbjct  61   LTFPNTIEYVVLFLAVIRVRATAAPLNAAYTSEEFEFYLSDSESKLLLTPSEGNEPAQAA  120

Query  454  aaKLSIPAVTATLSGAESD-----IALFPAHPESD-----SDAVSELVNDPSDVSLFLHT  603
            A+KL+IP  +A+L   E +     +      PESD      ++V+EL+N+P DV+LFLHT
Sbjct  121  ASKLNIPLGSASLIQIEGEQQQTKLKFSINQPESDLISNPVNSVTELINEPPDVALFLHT  180

Query  604  SGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            SGTTSRPKGVPL+Q NL SSV NI+SVY+L+ESDSTVIVLPLFHVHGLIAG+LS
Sbjct  181  SGTTSRPKGVPLSQHNLVSSVKNIESVYRLSESDSTVIVLPLFHVHGLIAGLLS  234



>ref|XP_004514748.1| PREDICTED: 4-coumarate--CoA ligase-like 10-like [Cicer arietinum]
Length=527

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 165/234 (71%), Positives = 194/234 (83%), Gaps = 11/234 (5%)
 Frame = +1

Query  97   METST-LTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVA  273
            METST LTGLL+ VA  FPSRRAISV+GKFDLTHSRLH LV+ AA+ L +AG++P DVVA
Sbjct  1    METSTTLTGLLQSVAKKFPSRRAISVAGKFDLTHSRLHELVDSAAAHLISAGIKPNDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNT+E V++FLAVIRVRATAAPLNAAYT+EEFEFYLSDSESK+LL P EGNE AQAA
Sbjct  61   LTFPNTIEYVVLFLAVIRVRATAAPLNAAYTSEEFEFYLSDSESKLLLTPSEGNEPAQAA  120

Query  454  aaKLSIPAVTATLSGAESD-----IALFPAHPESD-----SDAVSELVNDPSDVSLFLHT  603
            A+KL+IP  +A+L   E +     +      PESD      ++V+EL+N+P DV+LFLHT
Sbjct  121  ASKLNIPLGSASLIQIEGEQQQTKLKFSINQPESDLISNPVNSVTELINEPPDVALFLHT  180

Query  604  SGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            SGTTSRPKGVPL+Q NL SSV NI+SVY+L+ESDSTVIVLPLFHVHGLIAG+LS
Sbjct  181  SGTTSRPKGVPLSQHNLVSSVKNIESVYRLSESDSTVIVLPLFHVHGLIAGLLS  234



>ref|XP_003599556.1| 2-succinylbenzoate-CoA ligase [Medicago truncatula]
 gb|AES69807.1| long-chain acyl-CoA synthetase [Medicago truncatula]
Length=470

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 190/225 (84%), Gaps = 2/225 (1%)
 Frame = +1

Query  97   METST-LTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVA  273
            MET+T LTGLL+ VA  FPSRRAISV+GKFDLTHS+LH LVE AA+ L +AG++P DVVA
Sbjct  1    METATTLTGLLQSVAEKFPSRRAISVAGKFDLTHSQLHELVESAANHLISAGIKPNDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNT+E VIMFLAVIRVRATAAPLNAAYT+EEFEFYLSDSESK+LL P EGN  AQ A
Sbjct  61   LTFPNTIEYVIMFLAVIRVRATAAPLNAAYTSEEFEFYLSDSESKLLLTPLEGNNPAQTA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDS-DAVSELVNDPSDVSLFLHTSGTTSRPKG  630
            A KL+IP  +   +  E +  L  +  +++S ++VSEL+N+PSDV+LFLHTSGTTSRPKG
Sbjct  121  ATKLNIPLGSVCFNKTEEETKLSISLNQTESANSVSELINEPSDVALFLHTSGTTSRPKG  180

Query  631  VPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            VPL+Q NL SSV NI+SVY+L+E DSTVIVLPLFHVHGLIAG+LS
Sbjct  181  VPLSQHNLVSSVRNIESVYRLSELDSTVIVLPLFHVHGLIAGLLS  225



>ref|XP_003599555.1| 2-succinylbenzoate-CoA ligase [Medicago truncatula]
 gb|AES69806.1| long-chain acyl-CoA synthetase [Medicago truncatula]
Length=515

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 190/225 (84%), Gaps = 2/225 (1%)
 Frame = +1

Query  97   METST-LTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVA  273
            MET+T LTGLL+ VA  FPSRRAISV+GKFDLTHS+LH LVE AA+ L +AG++P DVVA
Sbjct  1    METATTLTGLLQSVAEKFPSRRAISVAGKFDLTHSQLHELVESAANHLISAGIKPNDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNT+E VIMFLAVIRVRATAAPLNAAYT+EEFEFYLSDSESK+LL P EGN  AQ A
Sbjct  61   LTFPNTIEYVIMFLAVIRVRATAAPLNAAYTSEEFEFYLSDSESKLLLTPLEGNNPAQTA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDS-DAVSELVNDPSDVSLFLHTSGTTSRPKG  630
            A KL+IP  +   +  E +  L  +  +++S ++VSEL+N+PSDV+LFLHTSGTTSRPKG
Sbjct  121  ATKLNIPLGSVCFNKTEEETKLSISLNQTESANSVSELINEPSDVALFLHTSGTTSRPKG  180

Query  631  VPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            VPL+Q NL SSV NI+SVY+L+E DSTVIVLPLFHVHGLIAG+LS
Sbjct  181  VPLSQHNLVSSVRNIESVYRLSELDSTVIVLPLFHVHGLIAGLLS  225



>ref|XP_003534000.1| PREDICTED: 4-coumarate--CoA ligase-like 10-like [Glycine max]
Length=518

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 184/223 (83%), Gaps = 4/223 (2%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLTGLL+ VA  FPSRRAISV+GKFDLTHSRLH LVE AA+ L AAG++PGDV+ALTFPN
Sbjct  6    TLTGLLRDVAAKFPSRRAISVAGKFDLTHSRLHQLVESAAARLVAAGIKPGDVIALTFPN  65

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            TVE V++FLAVIRVRATAAPLNAAYTAEEFEFYLSDSESK+LL   EGN +AQAAA+KL+
Sbjct  66   TVEFVVLFLAVIRVRATAAPLNAAYTAEEFEFYLSDSESKLLLTSAEGNNSAQAAASKLN  125

Query  469  IPAVTATLSGAESDIALFPAHPESDS----DAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            I   TA+++ AE   A              ++V  L NDP DV+LFLHTSGTTSRPKGVP
Sbjct  126  ILHSTASITQAEDKEAELSLSLSHSESESINSVESLGNDPDDVALFLHTSGTTSRPKGVP  185

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NL SSVNNIKSVY+LTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  186  LTQHNLFSSVNNIKSVYRLTESDSTVIVLPLFHVHGLIAGLLS  228



>ref|XP_010255419.1| PREDICTED: oxalate--CoA ligase-like [Nelumbo nucifera]
Length=525

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 187/230 (81%), Gaps = 12/230 (5%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTGLLK  AG FPSRRA+SVSGK+DLTH++L  L+++AA+ L  +GV+PGD+VAL
Sbjct  1    MEKVTLTGLLKQTAGKFPSRRALSVSGKYDLTHAQLQELIDQAATRLVLSGVKPGDIVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT E VIM LAVIR RATAAPLNAAYT EEFEFYLSDSESK LL  +EGN++ QAAA
Sbjct  61   TFPNTAEFVIMLLAVIRARATAAPLNAAYTPEEFEFYLSDSESKFLLTSQEGNKSVQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDA-------VSELVNDPSDVSLFLHTSGTT  615
            AKL+IP +TA L  ++ ++ L      SDS A       + E+VN+PSDV+LFLHTSGTT
Sbjct  121  AKLNIPHITAALPHSDQEVTL-----SSDSKATVPLKKSIDEIVNEPSDVALFLHTSGTT  175

Query  616  SRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            SRPKGVPLTQ NLA+SV NIKSVY +TESDSTV+VLPLFHVHGL+AG+LS
Sbjct  176  SRPKGVPLTQLNLAASVQNIKSVYNITESDSTVLVLPLFHVHGLMAGLLS  225



>ref|XP_002877640.1| AMP-dependent synthetase and ligase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH53899.1| AMP-dependent synthetase and ligase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=514

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLF-AAGVRPGDVVA  273
            M++ TLTGLL++VA  FP RRA+SVSGKFDLTH+RLH L+ERAAS L  AAG++PGDVVA
Sbjct  1    MDSDTLTGLLENVARKFPDRRALSVSGKFDLTHARLHDLIERAASRLVSAAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIR RATAAPLN+AYTAEEFEFYLSDS+SK+LL  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVIRARATAAPLNSAYTAEEFEFYLSDSDSKLLLTAKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL I  VTA+L  A SD+AL  A  +S  D+ +ELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLKISHVTASLLDAGSDLALSVADSDSVVDSATELVNHPDDGALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSV NIK+VYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLVSSVKNIKAVYKLTESDSTVIVLPLFHVH  216



>gb|AGA17926.1| CCL9 [Humulus lupulus]
Length=525

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 185/220 (84%), Gaps = 1/220 (0%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLTGLLK  A  F  RRAI VSG+F LTH+RL  +V+ AAS L A+GV  GDVVALTFPN
Sbjct  6    TLTGLLKKAAAEFSDRRAILVSGEFHLTHARLQEIVDHAASLLLASGVGHGDVVALTFPN  65

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            T+E ++MFLAVIR RA AAPLN+AYTAEEFEFYLSDSESK+L+ P +G EAA+AAA+KL+
Sbjct  66   TIEYIVMFLAVIRCRAVAAPLNSAYTAEEFEFYLSDSESKLLITPPKGIEAARAAASKLN  125

Query  469  IPAVTATLSGAESDIALFPA-HPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQ  645
            I  VTATL G +  IAL P+ + ES  DAV+EL NDPSDVSLFLHTSGTTSRPKGVPLTQ
Sbjct  126  ITHVTATLPGGDGLIALSPSPNNESSLDAVAELTNDPSDVSLFLHTSGTTSRPKGVPLTQ  185

Query  646  FNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             NLASSV NIKSVYKL+ESDSTV+VLPLFHVHG+IAG+LS
Sbjct  186  LNLASSVQNIKSVYKLSESDSTVVVLPLFHVHGMIAGLLS  225



>ref|XP_007152259.1| hypothetical protein PHAVU_004G114600g [Phaseolus vulgaris]
 gb|ESW24253.1| hypothetical protein PHAVU_004G114600g [Phaseolus vulgaris]
Length=461

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 184/226 (81%), Gaps = 3/226 (1%)
 Frame = +1

Query  97   MET-STLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVA  273
            MET +TLT +L HVA  FPS RA+SV+ KFDLTHSRL  LVE AA  L  AG++PGDVVA
Sbjct  1    METPTTLTSVLHHVAAKFPSHRALSVATKFDLTHSRLQQLVESAAQRLLLAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIRVRATAAPLNAAYTAEEFEFYLSDSESK+LL   EGN++AQAA
Sbjct  61   LTFPNTVEYVIMFLAVIRVRATAAPLNAAYTAEEFEFYLSDSESKLLLTSLEGNDSAQAA  120

Query  454  aaKLSIPAVTATLSGAESDIA--LFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPK  627
            A+KL I   TA+++ AE++ A            D+V  +VNDP DV+LFLHTSGTTSRPK
Sbjct  121  ASKLKIAHATASITKAENNEAELSLSLSQSDSVDSVESVVNDPDDVALFLHTSGTTSRPK  180

Query  628  GVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            GVPLTQ NL SSV NIKSVY+LTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  181  GVPLTQHNLLSSVQNIKSVYRLTESDSTVIVLPLFHVHGLIAGLLS  226



>ref|XP_008437021.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Cucumis melo]
Length=518

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 188/222 (85%), Gaps = 3/222 (1%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLTGLLK VA  FP RRA+SVSGKFDL+HSRL HLV+ AAS L A G++PG+VVAL FPN
Sbjct  6    TLTGLLKSVAETFPHRRALSVSGKFDLSHSRLQHLVDSAASKLAAGGIKPGEVVALVFPN  65

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            TVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDSESK+L+   EGN  A+ AA+KL 
Sbjct  66   TVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSESKLLVTSIEGNGPAETAASKLK  125

Query  469  IPAVTATL--SGAESDIALFPAHPE-SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPL  639
            I  VTA+L  +GAE  ++L  ++   S+SD+  E++N+ SDV+LFLHTSGTTSRPKGVPL
Sbjct  126  IKHVTASLPDAGAELVVSLTKSNSNGSESDSFLEVLNEGSDVALFLHTSGTTSRPKGVPL  185

Query  640  TQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            TQFNLASSVNNI SVY+LTESDSTVIVLPLFHVHGL+AG+LS
Sbjct  186  TQFNLASSVNNIISVYQLTESDSTVIVLPLFHVHGLMAGLLS  227



>ref|XP_010426401.1| PREDICTED: oxalate--CoA ligase-like [Camelina sativa]
Length=514

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLF-AAGVRPGDVVA  273
            M+  TLTGLL++VA  FP RRA+SVSGKFDLTH+RLH L+ERAAS L  AAG++PGDVVA
Sbjct  1    MDADTLTGLLENVARKFPDRRALSVSGKFDLTHARLHDLIERAASRLVPAAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDS+SK+LL  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTAKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL+I  VTATL  A +D+AL  +  +S  D+ +ELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLNISHVTATLLDAGTDLALSVSDSDSVVDSATELVNSPDDAALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSV NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLVSSVKNIKSVYKLTESDSTVIVLPLFHVH  216



>ref|NP_190468.1| 4-coumarate--CoA ligase-like 10 [Arabidopsis thaliana]
 sp|Q9SMT7.1|4CLLA_ARATH RecName: Full=Oxalate--CoA ligase; AltName: Full=4-coumarate--CoA 
ligase isoform 8; Short=At4CL8; AltName: Full=4-coumarate--CoA 
ligase-like 10; AltName: Full=Acyl-activating enzyme 
3; AltName: Full=Adenosine monophosphate binding protein 3; 
Short=AtMPBP3; AltName: Full=Oxalyl-CoA synthetase [Arabidopsis 
thaliana]
 gb|AAM28620.1|AF503762_1 adenosine monophosphate binding protein 3 AMPBP3 [Arabidopsis 
thaliana]
 emb|CAB62011.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
 gb|AAK92759.1| putative 4-coumarate-CoA ligase [Arabidopsis thaliana]
 gb|AAL32837.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
 gb|AAM51329.1| putative 4-coumarate-CoA ligase [Arabidopsis thaliana]
 gb|AAO30039.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
 gb|AEE78480.1| 4-coumarate--CoA ligase-like 10 [Arabidopsis thaliana]
Length=514

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFA-AGVRPGDVVA  273
            M++ TL+GLL++VA  FP RRA+SVSGKF+LTH+RLH L+ERAAS L + AG++PGDVVA
Sbjct  1    MDSDTLSGLLENVAKKFPDRRALSVSGKFNLTHARLHDLIERAASRLVSDAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDS+SK+LL  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTSKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL I  VTATL  A SD+ L  A  +S  D+ +ELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLKISHVTATLLDAGSDLVLSVADSDSVVDSATELVNHPDDGALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NLASSV NIK+VYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLASSVKNIKAVYKLTESDSTVIVLPLFHVH  216



>ref|XP_010503546.1| PREDICTED: oxalate--CoA ligase [Camelina sativa]
Length=514

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLF-AAGVRPGDVVA  273
            M+  TLTGLL++VA  FP RRA+SVSGKFDLTH+RLH L+ERAAS L  AAG++PGDVVA
Sbjct  1    MDADTLTGLLENVAEKFPDRRALSVSGKFDLTHARLHDLIERAASRLVSAAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDS+SK+LL  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTAKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL+I  VTATL  A +D+AL  +  +S  D+ +ELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLNISHVTATLLDAGTDLALSVSDSDSVVDSATELVNSPDDAALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSV NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLVSSVKNIKSVYKLTESDSTVIVLPLFHVH  216



>ref|XP_007152260.1| hypothetical protein PHAVU_004G114600g [Phaseolus vulgaris]
 gb|ESW24254.1| hypothetical protein PHAVU_004G114600g [Phaseolus vulgaris]
Length=516

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 184/226 (81%), Gaps = 3/226 (1%)
 Frame = +1

Query  97   MET-STLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVA  273
            MET +TLT +L HVA  FPS RA+SV+ KFDLTHSRL  LVE AA  L  AG++PGDVVA
Sbjct  1    METPTTLTSVLHHVAAKFPSHRALSVATKFDLTHSRLQQLVESAAQRLLLAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIRVRATAAPLNAAYTAEEFEFYLSDSESK+LL   EGN++AQAA
Sbjct  61   LTFPNTVEYVIMFLAVIRVRATAAPLNAAYTAEEFEFYLSDSESKLLLTSLEGNDSAQAA  120

Query  454  aaKLSIPAVTATLSGAESDIA--LFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPK  627
            A+KL I   TA+++ AE++ A            D+V  +VNDP DV+LFLHTSGTTSRPK
Sbjct  121  ASKLKIAHATASITKAENNEAELSLSLSQSDSVDSVESVVNDPDDVALFLHTSGTTSRPK  180

Query  628  GVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            GVPLTQ NL SSV NIKSVY+LTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  181  GVPLTQHNLLSSVQNIKSVYRLTESDSTVIVLPLFHVHGLIAGLLS  226



>gb|AAM65672.1| 4-coumarate-CoA ligase-like protein [Arabidopsis thaliana]
Length=514

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 181/216 (84%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFA-AGVRPGDVVA  273
            M++ TL+GLL++VA  FP RRA+SVSGKF+LTH+RLH L+ERAAS L + AG++PGDVVA
Sbjct  1    MDSDTLSGLLENVAKKFPDRRALSVSGKFNLTHARLHDLIERAASRLVSDAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDS+SK+LL  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTSKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL I  VTATL  A SD+ L  A  +S  D+ +ELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLKISHVTATLLDAVSDLVLSVADSDSVVDSATELVNHPDDGALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NLASSV NIK+VYKLTESDSTVI LPLFHVH
Sbjct  181  PLTQLNLASSVKNIKAVYKLTESDSTVIFLPLFHVH  216



>ref|XP_010515235.1| PREDICTED: oxalate--CoA ligase-like [Camelina sativa]
Length=514

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLF-AAGVRPGDVVA  273
            M+  TLTGLL++VA  FP RRA+SVSGKFDLTH+RL+ L+ERAAS L  AAG++PGDVVA
Sbjct  1    MDADTLTGLLENVARKFPDRRALSVSGKFDLTHARLNDLIERAASRLVSAAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDS+SK+LL  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTAKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL+I  +TATL  A SD+AL  +  +S  D+ +ELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLNISHITATLVDAGSDLALSVSDSDSVVDSATELVNSPDDAALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSV NIKSVYKLTE+DSTVIVLPLFHVH
Sbjct  181  PLTQLNLVSSVKNIKSVYKLTETDSTVIVLPLFHVH  216



>gb|AFD33352.1| acyl-activating enzyme 8 [Cannabis sativa]
Length=526

 Score =   272 bits (695),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 186/221 (84%), Gaps = 2/221 (1%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLTGLLK  A  FP RRAIS+SGK+ LTH+RL  +V+ AAS L A+G+  GDVVALTFPN
Sbjct  6    TLTGLLKKAAVEFPDRRAISLSGKYHLTHARLQEIVDHAASLLLASGIGHGDVVALTFPN  65

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            TVE ++MFLAVIR RA AAPLNAAYTAEEFEFYLSDSESK+L+   EG EAAQAAA+KL+
Sbjct  66   TVEYIVMFLAVIRCRAVAAPLNAAYTAEEFEFYLSDSESKLLITGPEGIEAAQAAASKLN  125

Query  469  IPAVTATLSGA-ESDIAL-FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLT  642
            I  VTATL G+ +  IAL   A+ ES  D+V+E+ NDPSDV+LFLHTSGTTSRPKGVPLT
Sbjct  126  IVRVTATLPGSGDGLIALSSSANNESSLDSVAEITNDPSDVALFLHTSGTTSRPKGVPLT  185

Query  643  QFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            Q NLASSV NIKSVYKLTESDSTV+VLPLFHVHG+IAG+LS
Sbjct  186  QLNLASSVQNIKSVYKLTESDSTVVVLPLFHVHGMIAGLLS  226



>ref|XP_006290920.1| hypothetical protein CARUB_v10017034mg [Capsella rubella]
 gb|EOA23818.1| hypothetical protein CARUB_v10017034mg [Capsella rubella]
Length=504

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLF-AAGVRPGDVVA  273
            M+  TLTGLL  VA  FP RRA+SVSGKFDLTH+RLH L+ERAAS L  AAG++PGDVVA
Sbjct  1    MDADTLTGLLTIVARKFPDRRALSVSGKFDLTHARLHDLIERAASRLVSAAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDS+SK+LL  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTSKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL+I  VTATL  A SD+ L  +  +S  D+ +ELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLNISHVTATLLDAGSDLTLSVSDSDSVVDSATELVNSPDDAALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSV NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLVSSVKNIKSVYKLTESDSTVIVLPLFHVH  216



>ref|XP_009149776.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Brassica rapa]
Length=514

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 183/216 (85%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFA-AGVRPGDVVA  273
            M++ TLTGLLK+VA  FP RRA+SVSGKFDLTH+RL+ L+ERAAS L + AG+ PGDVVA
Sbjct  1    MDSDTLTGLLKNVAEKFPDRRALSVSGKFDLTHARLNVLIERAASRLVSSAGINPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAV+R RATAAPLNAAYTAEEFEFYLSDS+SK+LL  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVLRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTSKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL+I  VTATL  A SD+AL     +S SD+ SELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLNISHVTATLLDAGSDLALSVPDSDSVSDSASELVNSPDDPALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSVNNIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLVSSVNNIKSVYKLTESDSTVIVLPLFHVH  216



>emb|CDY08099.1| BnaA06g16270D [Brassica napus]
Length=514

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 184/216 (85%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFA-AGVRPGDVVA  273
            M++ TLTGLLK+VA  FP RRA+SVSGKFDLTH+RL+ L+ERAAS L + AG+ PGDVVA
Sbjct  1    MDSDTLTGLLKNVAEKFPDRRALSVSGKFDLTHARLNVLIERAASRLVSSAGINPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAV+R RATAAPLNAAYTAEEFEFYLSDS+SK+LL  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVLRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTSKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL+I  VTATL  A SD+AL  A  +S SD+ SELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLNISHVTATLLDAGSDLALSVADSDSVSDSASELVNSPDDPALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSVNNIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLVSSVNNIKSVYKLTESDSTVIVLPLFHVH  216



>ref|XP_006290921.1| hypothetical protein CARUB_v10017034mg [Capsella rubella]
 gb|EOA23819.1| hypothetical protein CARUB_v10017034mg [Capsella rubella]
Length=514

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLF-AAGVRPGDVVA  273
            M+  TLTGLL  VA  FP RRA+SVSGKFDLTH+RLH L+ERAAS L  AAG++PGDVVA
Sbjct  1    MDADTLTGLLTIVARKFPDRRALSVSGKFDLTHARLHDLIERAASRLVSAAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDS+SK+LL  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLLTSKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL+I  VTATL  A SD+ L  +  +S  D+ +ELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLNISHVTATLLDAGSDLTLSVSDSDSVVDSATELVNSPDDAALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSV NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLVSSVKNIKSVYKLTESDSTVIVLPLFHVH  216



>emb|CDY69345.1| BnaC08g48460D [Brassica napus]
Length=514

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 183/216 (85%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLF-AAGVRPGDVVA  273
            ME+ TLTGLLK+VA  FP RRA+SVSGKFDLTH+RL+ L+E AAS L  AAG++PGDVVA
Sbjct  1    MESDTLTGLLKNVAEKFPDRRALSVSGKFDLTHARLNDLIELAASRLVSAAGIKPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPNTVE VIMFLAVIR RATAAPLNAAYTAEEFEFYLSDS+SK+L+  KEGN  AQ A
Sbjct  61   LTFPNTVEFVIMFLAVIRARATAAPLNAAYTAEEFEFYLSDSDSKLLVTSKEGNAPAQEA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL+I  VTATL  A SD+AL  A  +S SD+ SELVN P D +LFLHTSGTTSRPKGV
Sbjct  121  ASKLNISHVTATLLDAGSDLALSVADSDSVSDSASELVNSPDDPALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSV NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  181  PLTQLNLVSSVKNIKSVYKLTESDSTVIVLPLFHVH  216



>gb|KCW72132.1| hypothetical protein EUGRSUZ_E00577 [Eucalyptus grandis]
Length=450

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 172/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TL+GLL  VA +FP RRAIS  GKFDLTH+RL  LV+ A++ L  +GV  GDVVALTFPN
Sbjct  7    TLSGLLAKVASDFPDRRAISACGKFDLTHARLQELVDHASALLAVSGVGAGDVVALTFPN  66

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
             VE VIMFLAVIR RATAAPLN+AYTAEEFEFYL+DSESK+LL PKEGN+ AQ+AA+KL+
Sbjct  67   IVEFVIMFLAVIRCRATAAPLNSAYTAEEFEFYLADSESKLLLTPKEGNQPAQSAASKLN  126

Query  469  IPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQF  648
            IP VTA L    S I L     E   D +S++VN+PSDV+LFLHTSGTTSRPKGVPLTQ 
Sbjct  127  IPHVTAELHSPNSKITLSSTKVEPSVDLMSKVVNEPSDVALFLHTSGTTSRPKGVPLTQL  186

Query  649  NLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            NLASSV NIKSVYKL+E DSTVIVLPLFHVH
Sbjct  187  NLASSVQNIKSVYKLSEMDSTVIVLPLFHVH  217



>ref|XP_010055622.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Eucalyptus grandis]
 gb|KCW72131.1| hypothetical protein EUGRSUZ_E00577 [Eucalyptus grandis]
Length=525

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 172/211 (82%), Gaps = 0/211 (0%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TL+GLL  VA +FP RRAIS  GKFDLTH+RL  LV+ A++ L  +GV  GDVVALTFPN
Sbjct  7    TLSGLLAKVASDFPDRRAISACGKFDLTHARLQELVDHASALLAVSGVGAGDVVALTFPN  66

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
             VE VIMFLAVIR RATAAPLN+AYTAEEFEFYL+DSESK+LL PKEGN+ AQ+AA+KL+
Sbjct  67   IVEFVIMFLAVIRCRATAAPLNSAYTAEEFEFYLADSESKLLLTPKEGNQPAQSAASKLN  126

Query  469  IPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQF  648
            IP VTA L    S I L     E   D +S++VN+PSDV+LFLHTSGTTSRPKGVPLTQ 
Sbjct  127  IPHVTAELHSPNSKITLSSTKVEPSVDLMSKVVNEPSDVALFLHTSGTTSRPKGVPLTQL  186

Query  649  NLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            NLASSV NIKSVYKL+E DSTVIVLPLFHVH
Sbjct  187  NLASSVQNIKSVYKLSEMDSTVIVLPLFHVH  217



>ref|XP_002272145.1| PREDICTED: oxalate--CoA ligase [Vitis vinifera]
 emb|CBI34684.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = +1

Query  127  KHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVI  306
            K  A  FPSRRA+SVSGK DLTH+RL  L+++AAS L A+G+ PGDVVALTFPNT+E V+
Sbjct  13   KQKAEEFPSRRALSVSGKLDLTHARLDELIDKAASLLLASGINPGDVVALTFPNTIESVV  72

Query  307  MFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTA  486
            +FLAVIR RATAAPLN+AYT EEFEFYLSDSESK+L+  +EGN+ AQAAA+KL IP +TA
Sbjct  73   VFLAVIRCRATAAPLNSAYTTEEFEFYLSDSESKLLVTSQEGNQPAQAAASKLKIPCITA  132

Query  487  TLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSV  666
            T+S    D+ L   + +  S++++ +VNDP+DV+LFLHTSGTTSRPKGVPLTQ NLASSV
Sbjct  133  TVSDTGDDVILSDYNSDLKSNSINSIVNDPADVALFLHTSGTTSRPKGVPLTQLNLASSV  192

Query  667  NNIKSVYKLTESDSTVIVLPLFHVH  741
             NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  193  RNIKSVYKLTESDSTVIVLPLFHVH  217



>ref|XP_007143422.1| hypothetical protein PHAVU_007G071000g [Phaseolus vulgaris]
 gb|ESW15416.1| hypothetical protein PHAVU_007G071000g [Phaseolus vulgaris]
Length=515

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 184/213 (86%), Gaps = 1/213 (0%)
 Frame = +1

Query  106  STLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFP  285
            +TLTGLL  VA  F S RA+SVSGKF LTHSRLHHLVERAA+ L + G++PGDVVALTFP
Sbjct  5    TTLTGLLHRVAEIFHSHRAVSVSGKFHLTHSRLHHLVERAAARLLSTGIKPGDVVALTFP  64

Query  286  NTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKL  465
            NTVE +I FLA+IR RATAAPLNAAYTAEEFEFYLSDSESK+L+  KEGNE AQAAA+KL
Sbjct  65   NTVEFIITFLAIIRARATAAPLNAAYTAEEFEFYLSDSESKLLVTSKEGNEPAQAAASKL  124

Query  466  SIPAVTATLSGAES-DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLT  642
            SIP  TA+L  AE+ +++L  ++ ES +D++S LVND SDV+LFLHTSGTTSRPKGVPLT
Sbjct  125  SIPVSTASLDEAEAEELSLSLSYTESSTDSISGLVNDASDVALFLHTSGTTSRPKGVPLT  184

Query  643  QFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            Q NLASSV NIKSVY+LTESDSTVIVLPLFHVH
Sbjct  185  QHNLASSVENIKSVYRLTESDSTVIVLPLFHVH  217



>ref|XP_012086931.1| PREDICTED: oxalate--CoA ligase-like [Jatropha curcas]
 gb|KDP25453.1| hypothetical protein JCGZ_20609 [Jatropha curcas]
Length=523

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 175/215 (81%), Gaps = 0/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTGLLK  A  FP+ RA+SVSGK DLTH+ L  L++ AAS L AAGV PGDVVAL
Sbjct  1    MENLTLTGLLKKSAAEFPNSRALSVSGKLDLTHAELQDLIDHAASLLVAAGVAPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RATAAPLN AYTAEEFEFYLSDSESK+L+  + G ++AQAAA
Sbjct  61   TFPNTVEYVIMFLAVIRCRATAAPLNPAYTAEEFEFYLSDSESKLLITSQVGIQSAQAAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL IP V ATL      I+L   + ES  D+V+E+VND SDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLKIPHVAATLDVETKAISLSSLNTESKFDSVAEIVNDSSDVALFLHTSGTTSRPKGVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NLASSV NIKSVY+L+ESDSTV+VLPLFHVH
Sbjct  181  LTQLNLASSVLNIKSVYRLSESDSTVLVLPLFHVH  215



>ref|XP_007146896.1| hypothetical protein PHAVU_006G079500g [Phaseolus vulgaris]
 gb|ESW18890.1| hypothetical protein PHAVU_006G079500g [Phaseolus vulgaris]
Length=518

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 173/219 (79%), Gaps = 0/219 (0%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLT L++HVA  FP RRAISV+GKFDL+HSRLH L E AA+ L AAG++PGD VAL FPN
Sbjct  10   TLTSLIRHVAAKFPYRRAISVAGKFDLSHSRLHSLTESAAARLVAAGIKPGDAVALVFPN  69

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            TVE V+MFLAVIR RATAAPLN AYTAEEFEFYLSDS+SK+L+   EGN  AQAAA+KL+
Sbjct  70   TVEFVVMFLAVIRARATAAPLNPAYTAEEFEFYLSDSDSKLLVTSLEGNTPAQAAASKLN  129

Query  469  IPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQF  648
            IP   A++   E++            D+V  LVN+  DV+LFLHTSGTTSRPKGVPLTQ 
Sbjct  130  IPHSAASVIQGENEEVELSLSLSHSFDSVESLVNNADDVALFLHTSGTTSRPKGVPLTQH  189

Query  649  NLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            NL SSV NI SVY+LTESDSTVIVLPLFHVHGLIA +LS
Sbjct  190  NLFSSVRNIDSVYRLTESDSTVIVLPLFHVHGLIAALLS  228



>ref|XP_010550769.1| PREDICTED: LOW QUALITY PROTEIN: oxalate--CoA ligase [Tarenaya 
hassleriana]
Length=512

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 179/216 (83%), Gaps = 6/216 (3%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFA-AGVRPGDVVA  273
            M++ TLTGLLK VAG FP +RA+SVSGKFDLTH+RL  L+ERAAS L + AG+ PGDVVA
Sbjct  1    MDSDTLTGLLKKVAGKFPDQRALSVSGKFDLTHARLQELIERAASRLVSGAGIVPGDVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            LTFPN VE+++   +      TAAPLNAAYTAEEFEFYLSDS SK+L+   EGN AAQAA
Sbjct  61   LTFPNAVEVLVFLXS-----GTAAPLNAAYTAEEFEFYLSDSGSKLLITSHEGNAAAQAA  115

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KLSIP  TA LS A+SD++L  A+ +S  D+V+ELVNDP+DVSLFLHTSGTTSRPKGV
Sbjct  116  ASKLSIPHATAALSAADSDLSLSVANSDSVVDSVAELVNDPNDVSLFLHTSGTTSRPKGV  175

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NL SSV NI+SVYKL+ESDSTVIVLPLFHVH
Sbjct  176  PLTQLNLVSSVRNIRSVYKLSESDSTVIVLPLFHVH  211



>ref|XP_011029248.1| PREDICTED: oxalate--CoA ligase-like [Populus euphratica]
Length=522

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 172/215 (80%), Gaps = 1/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME+ TLT LL   A +FP+RRAIS+SG  DLTH++L  +V+ AAS L +AG+ PGDVVAL
Sbjct  1    MESLTLTALLNKSAKDFPNRRAISLSGSLDLTHAQLQQIVDHAASLLISAGINPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT+E V+MFLAVIR RATAAPLN AYTAEEFEFYLSDSESK+L++P+E    A  AA
Sbjct  61   TFPNTIEFVVMFLAVIRCRATAAPLNQAYTAEEFEFYLSDSESKLLIMPQEPILPALTAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL IP VT+TL      + L     ES  DAV ++VND SDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLKIPHVTSTLDFQSKRVTL-STESESVPDAVDDVVNDSSDVALFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NLASSV NIKSVYKLTESDSTV+VLPLFHVH
Sbjct  180  LTQLNLASSVLNIKSVYKLTESDSTVLVLPLFHVH  214



>ref|XP_002509782.1| AMP dependent CoA ligase, putative [Ricinus communis]
 gb|EEF51169.1| AMP dependent CoA ligase, putative [Ricinus communis]
Length=522

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 175/215 (81%), Gaps = 1/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            MET TLTGLLK  A  FP+ RAI VS K DLTHS+L HL++ AAS L A+GV PG VVAL
Sbjct  1    METLTLTGLLKKSAAEFPNNRAIHVSRKLDLTHSQLQHLIDHAASLLVASGVSPGHVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RA AAPLN AYTAEEFEFYLSDSESK+L+  +EG ++AQ +A
Sbjct  61   TFPNTVEYVIMFLAVIRCRAIAAPLNPAYTAEEFEFYLSDSESKLLITSQEGIQSAQTSA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL+IP VTATL      I+L  A    D ++V+EL+N+ SDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLNIPHVTATLHIETKTISLSNA-INLDDNSVTELINESSDVALFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NLASSV NIKSVY+L+ESD+TV+VLPLFHVH
Sbjct  180  LTQLNLASSVLNIKSVYRLSESDATVLVLPLFHVH  214



>ref|XP_002298041.1| hypothetical protein POPTR_0001s09200g [Populus trichocarpa]
 gb|EEE82846.1| hypothetical protein POPTR_0001s09200g [Populus trichocarpa]
Length=522

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 172/215 (80%), Gaps = 1/215 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME+ TLT LL   A +FP+RRAIS+SG+ DLTH++L  +V+ AAS L +AG+ PGDVVAL
Sbjct  1    MESLTLTALLNKSAKDFPNRRAISLSGRLDLTHAQLQQIVDHAASLLISAGINPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNT+E V+MFLAVIR RATAAPLN AYTAEEFEFYLSDS SK+L++P+E    A  AA
Sbjct  61   TFPNTIEFVVMFLAVIRCRATAAPLNQAYTAEEFEFYLSDSGSKLLIMPQEPILPALTAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            +KL IP VT+TL   +S         ES  DAV ++VND SDV+LFLHTSGTTSRPKGVP
Sbjct  121  SKLKIPHVTSTLD-IQSKRVTLSTESESVPDAVDDVVNDSSDVALFLHTSGTTSRPKGVP  179

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            LTQ NLASSV NIKSVYKLTESDSTV+VLPLFHVH
Sbjct  180  LTQLNLASSVLNIKSVYKLTESDSTVLVLPLFHVH  214



>gb|AIY34664.1| 4-coumarate:CoA ligase-like protein [Ornithogalum saundersiae]
Length=521

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 175/224 (78%), Gaps = 1/224 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTG LK  A +F SRRA+ V GKFDL+H +LH L+E AA+ L AAGV PGDVV L
Sbjct  1    MEGLTLTGTLKKSAADFGSRRALLVPGKFDLSHKQLHDLIESAAAHLVAAGVTPGDVVGL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RATAAP N+AYT EEFEFYLSDSESK+L+   EGN AA+AAA
Sbjct  61   TFPNTVEYVIMFLAVIRARATAAPFNSAYTQEEFEFYLSDSESKVLITNPEGNPAAEAAA  120

Query  457  aKLSIPAVTATLSGAE-SDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            AK+ I   TA L       I+L      + S++V++L N P DV+LFLHTSGTTSRPKGV
Sbjct  121  AKIGIGRATAELKDETFVRISLPKLSDRAGSESVADLRNVPDDVALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PLTQ NLA+SV NI+SVY+L+E D+TV+VLPLFHVHGLIAG+LS
Sbjct  181  PLTQQNLAASVRNIRSVYRLSEVDATVMVLPLFHVHGLIAGLLS  224



>ref|XP_010934751.1| PREDICTED: oxalate--CoA ligase [Elaeis guineensis]
Length=520

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 175/216 (81%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTG+L   AG FPS+RA+SV GK +LTH+RL  L++ AA+ L ++GVRP DVVAL
Sbjct  1    MEGITLTGVLAEAAGEFPSQRALSVPGKIELTHARLRDLIDSAAAHLVSSGVRPADVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVELVIMFLAVIR RA AAPLN AYT EEFEFYL+DSE+K+L+   EGN AA +AA
Sbjct  61   TFPNTVELVIMFLAVIRARAVAAPLNPAYTQEEFEFYLTDSEAKVLITNSEGNAAAASAA  120

Query  457  aKLSIPAVTATLSGAESDIAL-FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            AKL IP  TA L      + +  P  P+S +D+VS ++N+P+DV+LFLHTSGTTSRPKGV
Sbjct  121  AKLQIPHSTAALPDPAGPVQISLPHRPDSIADSVSAIINEPADVALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NLA+SVNNI+SVY+LTE+DSTVIVLPLFHVH
Sbjct  181  PLTQQNLAASVNNIRSVYRLTETDSTVIVLPLFHVH  216



>ref|XP_008806875.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Phoenix dactylifera]
Length=521

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 174/216 (81%), Gaps = 1/216 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME   LTGLL   AG F SRRA+SV GK ++TH+RL  L++ AA+ L ++GVRP DVVAL
Sbjct  1    MEGIALTGLLAKAAGEFHSRRALSVPGKLEITHARLRDLIDSAAAYLVSSGVRPADVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VIMFLAVIR RA AAPLN+AYT EEFEFYLSDSESK+L+   EGN AA+AAA
Sbjct  61   TFPNTVEFVIMFLAVIRARAVAAPLNSAYTQEEFEFYLSDSESKVLITNSEGNAAAEAAA  120

Query  457  aKLSIPAVTATLSGAESDIAL-FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            AKL IP  TA L      + +  P  P+S +D+VS ++N+P+DV+LFLHTSGTTSRPKGV
Sbjct  121  AKLQIPHATAALPDPAGPVQISLPRRPDSIADSVSAIINEPADVALFLHTSGTTSRPKGV  180

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PLTQ NLA+SVNNI+SVY+LTE+DSTVIVLPLFHVH
Sbjct  181  PLTQLNLAASVNNIRSVYRLTETDSTVIVLPLFHVH  216



>ref|XP_010055629.1| PREDICTED: uncharacterized protein LOC104443801 [Eucalyptus grandis]
 gb|KCW72141.1| hypothetical protein EUGRSUZ_E00583 [Eucalyptus grandis]
Length=731

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 170/219 (78%), Gaps = 0/219 (0%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLTGLL+  A +FP  RA+S  G+ DLTH++L  LV+RAA+ L A+G+  GDVVAL FPN
Sbjct  5    TLTGLLQKAASDFPDGRAVSACGELDLTHAQLQELVDRAAALLVASGIGAGDVVALAFPN  64

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            T+E VI+ LAVIR +ATAAPL+   TA+EFEFYLSD+E K+LL P+E N+ AQ+AA+KL+
Sbjct  65   TIEFVILLLAVIRCQATAAPLDPICTAKEFEFYLSDTEPKLLLTPQERNQRAQSAASKLN  124

Query  469  IPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQF  648
            IP VTA    A+S I L     E   + + ++VNDPSDV+LFLH S TTSRPK + LTQ 
Sbjct  125  IPHVTAKFHSADSRITLSSTDIEPSLELMFKVVNDPSDVALFLHPSSTTSRPKRMLLTQG  184

Query  649  NLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            NLASSV NIK VYKLTESDSTVIVLPLFHVHGL+AG+LS
Sbjct  185  NLASSVQNIKRVYKLTESDSTVIVLPLFHVHGLVAGLLS  223



>ref|XP_009383859.1| PREDICTED: 4-coumarate--CoA ligase-like 10 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 176/227 (78%), Gaps = 4/227 (2%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTG+L+  AG FPSRRAISV G+ DL+H RLH LV+ AA+ L AAGV PGDV+AL
Sbjct  1    MEGLTLTGVLRKAAGEFPSRRAISVPGRLDLSHERLHQLVDDAAARLAAAGVSPGDVIAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
             FPNTVELVI+FLAVIR RA  APLN+AYT +EF FYLSD E+K+L+   EGN AA+AAA
Sbjct  61   AFPNTVELVIVFLAVIRARAVVAPLNSAYTEDEFVFYLSDLETKLLVTNAEGNAAAEAAA  120

Query  457  aKLSIPAVTATLSGAESDIAL-FPAHPESDSDAVSEL---VNDPSDVSLFLHTSGTTSRP  624
            A+L IP   A+L  A   + L  P    +   AV+ L   VNDPSDV+LFLHTSGTTSRP
Sbjct  121  AQLGIPRAAASLRDASGTLELSLPDGATTADVAVTPLAGRVNDPSDVALFLHTSGTTSRP  180

Query  625  KGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            KGVPLTQ NLA+SV NI+S Y+LTESDSTVIVLPLFHVHGL+A +LS
Sbjct  181  KGVPLTQLNLAASVTNIRSAYRLTESDSTVIVLPLFHVHGLVAALLS  227



>ref|XP_009386417.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Musa acuminata subsp. 
malaccensis]
Length=524

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 179/223 (80%), Gaps = 3/223 (1%)
 Frame = +1

Query  106  STLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFP  285
            +TLTGLL+  AG+FPSRRAI+V G+ +LTH+RLH LV+ AA+ L AAGVRPGDVVAL FP
Sbjct  5    TTLTGLLRKAAGDFPSRRAITVPGRHELTHARLHQLVDAAAARLAAAGVRPGDVVALAFP  64

Query  286  NTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKL  465
            NTVELVI+FLAV+R RA AAPLN AYT +EF FYLSDSES +LL   EGN AA+AAAA+L
Sbjct  65   NTVELVIVFLAVLRTRAVAAPLNPAYTRDEFVFYLSDSESILLLTNAEGNAAAEAAAAQL  124

Query  466  SIPAVTATLSGAES--DIALFPAHPESDSDA-VSELVNDPSDVSLFLHTSGTTSRPKGVP  636
             IP   A+L       ++ L    P ++  A V+  VNDPSDV+LFLHTSGTTSRPKGVP
Sbjct  125  GIPRAAASLRDPSGLLELTLPGDRPAAEGVAPVAGRVNDPSDVALFLHTSGTTSRPKGVP  184

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ NLA+SV NI+SVY+L+ESDSTVIVLPLFHVHGL+A +LS
Sbjct  185  LTQLNLAASVTNIRSVYRLSESDSTVIVLPLFHVHGLVAALLS  227



>ref|XP_009383851.1| PREDICTED: 4-coumarate--CoA ligase-like 10 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=566

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 176/227 (78%), Gaps = 4/227 (2%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTG+L+  AG FPSRRAISV G+ DL+H RLH LV+ AA+ L AAGV PGDV+AL
Sbjct  1    MEGLTLTGVLRKAAGEFPSRRAISVPGRLDLSHERLHQLVDDAAARLAAAGVSPGDVIAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
             FPNTVELVI+FLAVIR RA  APLN+AYT +EF FYLSD E+K+L+   EGN AA+AAA
Sbjct  61   AFPNTVELVIVFLAVIRARAVVAPLNSAYTEDEFVFYLSDLETKLLVTNAEGNAAAEAAA  120

Query  457  aKLSIPAVTATLSGAESDIAL-FPAHPESDSDAVSEL---VNDPSDVSLFLHTSGTTSRP  624
            A+L IP   A+L  A   + L  P    +   AV+ L   VNDPSDV+LFLHTSGTTSRP
Sbjct  121  AQLGIPRAAASLRDASGTLELSLPDGATTADVAVTPLAGRVNDPSDVALFLHTSGTTSRP  180

Query  625  KGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            KGVPLTQ NLA+SV NI+S Y+LTESDSTVIVLPLFHVHGL+A +LS
Sbjct  181  KGVPLTQLNLAASVTNIRSAYRLTESDSTVIVLPLFHVHGLVAALLS  227



>gb|KCW72146.1| hypothetical protein EUGRSUZ_E00593, partial [Eucalyptus grandis]
Length=397

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 169/222 (76%), Gaps = 0/222 (0%)
 Frame = +1

Query  100  ETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALT  279
            E  TLTGLLK  A +FP RRA+S  GKF LTH++L  LV+ AA+ L A+G+  G+VVAL 
Sbjct  3    EELTLTGLLKKAAQDFPDRRAVSACGKFGLTHAQLRELVDHAAALLAASGIVAGNVVALA  62

Query  280  FPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaa  459
            FPNT+E VI+FLAV+R RATAAPL+  YTA+EF+FYLS S SK LLIP+EGN  A++AA+
Sbjct  63   FPNTIEFVILFLAVMRCRATAAPLDPIYTAKEFKFYLSHSRSKFLLIPQEGNLRARSAAS  122

Query  460  KLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPL  639
            +L+IP +TA L  A S I L     E   D++S++VNDPSD++L LH+S  T  PK + L
Sbjct  123  ELNIPRLTAKLHSANSRITLSSTDVEPSLDSMSKVVNDPSDIALLLHSSSATGCPKRMLL  182

Query  640  TQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            TQ NLASSV NIK  ++LTESDSTVIVLPLFHVH L+AG+LS
Sbjct  183  TQRNLASSVRNIKWEFELTESDSTVIVLPLFHVHSLVAGLLS  224



>gb|KCW72142.1| hypothetical protein EUGRSUZ_E00586 [Eucalyptus grandis]
Length=659

 Score =   236 bits (602),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 169/222 (76%), Gaps = 0/222 (0%)
 Frame = +1

Query  100  ETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALT  279
            E   LTGLLK VA +FP R A+S  G+ DLTH++L  LV+  A+ L A+GV  GDV+AL 
Sbjct  3    EELALTGLLKKVASDFPDRTAVSTCGEVDLTHAQLQKLVDHTATLLAASGVGAGDVIALA  62

Query  280  FPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaa  459
            FPNTVE VI+FLAVIR RATAAPLN  YTA+EFEFYLS S SK+LL P+E N+ AQ AA+
Sbjct  63   FPNTVEFVILFLAVIRCRATAAPLNPIYTAKEFEFYLSYSGSKLLLTPQEENQRAQDAAS  122

Query  460  KLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPL  639
            KL+IP +TA L  A+S I L     +    ++S++VNDPSDV+L LHTSGT S PK + L
Sbjct  123  KLNIPRLTAKLHSADSRITLSSTGIKPSLVSMSKVVNDPSDVALLLHTSGTVSHPKRLLL  182

Query  640  TQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            TQ NLASSV NIK VYKLTESDSTVIVLPLF VHGL+AG+LS
Sbjct  183  TQRNLASSVQNIKWVYKLTESDSTVIVLPLFRVHGLVAGLLS  224



>ref|XP_010055630.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Eucalyptus grandis]
Length=710

 Score =   236 bits (602),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 169/222 (76%), Gaps = 0/222 (0%)
 Frame = +1

Query  100  ETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALT  279
            E   LTGLLK VA +FP R A+S  G+ DLTH++L  LV+  A+ L A+GV  GDV+AL 
Sbjct  3    EELALTGLLKKVASDFPDRTAVSTCGEVDLTHAQLQKLVDHTATLLAASGVGAGDVIALA  62

Query  280  FPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaa  459
            FPNTVE VI+FLAVIR RATAAPLN  YTA+EFEFYLS S SK+LL P+E N+ AQ AA+
Sbjct  63   FPNTVEFVILFLAVIRCRATAAPLNPIYTAKEFEFYLSYSGSKLLLTPQEENQRAQDAAS  122

Query  460  KLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPL  639
            KL+IP +TA L  A+S I L     +    ++S++VNDPSDV+L LHTSGT S PK + L
Sbjct  123  KLNIPRLTAKLHSADSRITLSSTGIKPSLVSMSKVVNDPSDVALLLHTSGTVSHPKRLLL  182

Query  640  TQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            TQ NLASSV NIK VYKLTESDSTVIVLPLF VHGL+AG+LS
Sbjct  183  TQRNLASSVQNIKWVYKLTESDSTVIVLPLFRVHGLVAGLLS  224



>ref|XP_010058235.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Eucalyptus grandis]
Length=709

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 167/219 (76%), Gaps = 0/219 (0%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLTGLLK  A +FP  RA+S  G+FDLTH+RL  LV+ AA+ L A+ +  GD+VAL FPN
Sbjct  5    TLTGLLKKAAWDFPDGRAVSACGEFDLTHARLQELVDHAAALLAASNIGAGDMVALAFPN  64

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            T+E VI+FLAVIR RATAAPL+  YTA+EF+FYLSD++ K+L+ P EGN+ AQ+AA+ L+
Sbjct  65   TIEFVILFLAVIRCRATAAPLSPIYTAKEFKFYLSDTKPKLLVTPHEGNQRAQSAASNLN  124

Query  469  IPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQF  648
            I  +T  L  A S I L     E   D +S++VNDPSDV+LFLHT GTTSR K + LTQ 
Sbjct  125  IRCLTTKLRSANSKITLSSNDKEQSLDLMSKVVNDPSDVALFLHTPGTTSRRKRMQLTQR  184

Query  649  NLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            +LASSV NIK  ++LTESDS+VIVLPLF VHGL+AG+LS
Sbjct  185  HLASSVRNIKREFELTESDSSVIVLPLFKVHGLVAGLLS  223



>ref|XP_010058237.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Eucalyptus grandis]
Length=779

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 166/219 (76%), Gaps = 0/219 (0%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLTGLLK  A +FP  RA+S  G+FDLTH+RL  LV+ AA+ L A  +  GDVVAL FPN
Sbjct  5    TLTGLLKKAAWDFPDGRAVSACGEFDLTHARLQELVDHAAALLAACNIGAGDVVALAFPN  64

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            T+E VI+FLAVIR RATAAPLN  YTA+EF+FYLSD++ K+L+ P EGN+ AQ+AA+ L+
Sbjct  65   TIEFVILFLAVIRCRATAAPLNPIYTAKEFKFYLSDTKPKLLVTPHEGNQRAQSAASNLN  124

Query  469  IPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQF  648
            I  +T  L  A S I L     E   D +S++VNDPSDV+LFLHT GTTS  K + LTQ 
Sbjct  125  IRCLTTKLRSANSKITLSSNDKEQSLDLMSKVVNDPSDVALFLHTPGTTSSRKRMQLTQR  184

Query  649  NLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            +LASSV NIK  ++LTESDSTVIVLPLF+VHGL+AG+LS
Sbjct  185  HLASSVRNIKREFELTESDSTVIVLPLFNVHGLVAGLLS  223



>ref|XP_010055632.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Eucalyptus grandis]
Length=781

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 169/222 (76%), Gaps = 0/222 (0%)
 Frame = +1

Query  100  ETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALT  279
            E  TLTGLLK  A +FP RRA+S  GKF LTH++L  LV+ AA+ L A+G+  G+VVAL 
Sbjct  3    EELTLTGLLKKAAQDFPDRRAVSACGKFGLTHAQLRELVDHAAALLAASGIVAGNVVALA  62

Query  280  FPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaa  459
            FPNT+E VI+FLAV+R RATAAPL+  YTA+EF+FYLS S SK LLIP+EGN  A++AA+
Sbjct  63   FPNTIEFVILFLAVMRCRATAAPLDPIYTAKEFKFYLSHSRSKFLLIPQEGNLRARSAAS  122

Query  460  KLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPL  639
            +L+IP +TA L  A S I L     E   D++S++VNDPSD++L LH+S  T  PK + L
Sbjct  123  ELNIPRLTAKLHSANSRITLSSTDVEPSLDSMSKVVNDPSDIALLLHSSSATGCPKRMLL  182

Query  640  TQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            TQ NLASSV NIK  ++LTESDSTVIVLPLFHVH L+AG+LS
Sbjct  183  TQRNLASSVRNIKWEFELTESDSTVIVLPLFHVHSLVAGLLS  224



>ref|XP_009418268.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Musa acuminata subsp. 
malaccensis]
Length=524

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 182/227 (80%), Gaps = 4/227 (2%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTG+L+  AG+FPSRRAIS+SG+ +L+++RLH LV+ AA+ L  AGV PGDVVAL
Sbjct  1    MEGLTLTGVLRKAAGDFPSRRAISISGRLELSYARLHQLVDAAAACLADAGVLPGDVVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
             FPNTVELVI+FLAVIR RA AAPLN AYT EEF FYLSDSESK+L+I  EGN AA+AAA
Sbjct  61   AFPNTVELVIVFLAVIRARAVAAPLNPAYTKEEFAFYLSDSESKLLVINAEGNAAAEAAA  120

Query  457  aKLSIPAVTATLSGAESDIAL-FPAHP-ESDSDA--VSELVNDPSDVSLFLHTSGTTSRP  624
            A+L IP   A+L  A   + L  PA    +D  A  +   VNDPSDV+LFLHTSG+TSRP
Sbjct  121  AELGIPRSAASLPDASGTLELSLPAGSTAADGTALPLDTRVNDPSDVALFLHTSGSTSRP  180

Query  625  KGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            KGVPLTQFNLA+SV NI+SVY+L+E+DSTVIVLPLFHVHGL+A +LS
Sbjct  181  KGVPLTQFNLAASVKNIRSVYRLSETDSTVIVLPLFHVHGLVATLLS  227



>ref|XP_010055627.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Eucalyptus grandis]
 gb|KCW72138.1| hypothetical protein EUGRSUZ_E00581 [Eucalyptus grandis]
Length=781

 Score =   216 bits (549),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 162/223 (73%), Gaps = 0/223 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTGL+K VA   P + A+SV GK +LT++ L   V+ AA+ L  +GV  GD+VAL
Sbjct  1    MEVRTLTGLMKMVASTSPDQIAVSVRGKIELTYAHLRERVDEAAALLVFSGVEAGDIVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVE VI+ LAVIR RA  APLN  YTAE F F LS+S SK+LL P+EGN+ AQ AA
Sbjct  61   TFPNTVEFVILLLAVIRCRAIVAPLNPTYTAERFGFCLSNSGSKLLLTPQEGNQQAQFAA  120

Query  457  aKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVP  636
            + L+IP +TA L  A+S I L   + E   D + ++VN+PSDV+LFLHTS   S P  V 
Sbjct  121  SMLNIPHLTAKLHSAKSKITLSSINIEPSLDLMCKVVNEPSDVALFLHTSSNMSHPIPVL  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            LTQ +LASSV NIK VYKLT SDSTVIVLP+F+V+GL+AG+LS
Sbjct  181  LTQHDLASSVQNIKRVYKLTNSDSTVIVLPMFNVYGLVAGLLS  223



>gb|ABR16420.1| unknown [Picea sitchensis]
Length=455

 Score =   207 bits (526),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 159/235 (68%), Gaps = 23/235 (10%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            +LT LL   A  FP+++AI+VSGK+ LTHS+L   V   A+ L A GV  GDVVAL FPN
Sbjct  26   SLTSLLCKSAEEFPNQKAITVSGKYQLTHSQLQATVNACAARLKAVGVGHGDVVALAFPN  85

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            ++E V++F+AVIR R  AAPLNAAYTAEEFEFYL+DS+SK+LL+P EGN AA+ A  K+ 
Sbjct  86   SIEFVVLFMAVIRARGVAAPLNAAYTAEEFEFYLADSKSKLLLLPAEGNTAAETAVTKIG  145

Query  469  IPAVTATLS----------------GAESDIALFPAHPESDSDAVSELVNDPSDVSLFLH  600
            +P      S                G + D+ L     E   D     ++D  D++LFLH
Sbjct  146  LPVAKCQFSLLSDGGGSFEFVSESPGFDLDLGLSKDEAEDSCD-----IHD--DMALFLH  198

Query  601  TSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            TSGTTSRPKGVPLTQ NLA+S  +IK  Y+L+ SD+TVI LPLFHVHGL+AG+LS
Sbjct  199  TSGTTSRPKGVPLTQLNLAASTLHIKDTYELSSSDTTVITLPLFHVHGLVAGLLS  253



>ref|NP_001054304.1| Os04g0683700 [Oryza sativa Japonica Group]
 emb|CAE03444.1| OSJNBa0088H09.2 [Oryza sativa Japonica Group]
 emb|CAH68285.1| H0306F12.7 [Oryza sativa Indica Group]
 dbj|BAF16218.1| Os04g0683700 [Oryza sativa Japonica Group]
 gb|EAY96101.1| hypothetical protein OsI_17978 [Oryza sativa Indica Group]
Length=518

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 170/224 (76%), Gaps = 2/224 (1%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVVA  273
            MET TLT LLK     FPSRRA++V GK DL+H+ L  LV+ AA+ L A  GV PG VVA
Sbjct  1    METPTLTTLLKAAVATFPSRRALAVPGKVDLSHAALDALVDAAAARLAADAGVLPGHVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            L FPNTVELVIMFLAVIR RA AAPLN AYT EEFEFYLSDS +++L+   EGN AAQAA
Sbjct  61   LAFPNTVELVIMFLAVIRARAVAAPLNPAYTQEEFEFYLSDSGARLLITNPEGNVAAQAA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL +   TA+L  A   + L      S + A  +  NDPSDV+LFLHTSGTTSRPKGV
Sbjct  121  ASKLGLAHTTASLKDAAGQVHLAGFP-ASAAAAAKDFANDPSDVALFLHTSGTTSRPKGV  179

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PLTQ NLA+SV NI++VY+LTE+D+TVIVLPLFHVHGL+ G+L+
Sbjct  180  PLTQRNLAASVQNIRAVYRLTEADATVIVLPLFHVHGLLCGLLA  223



>dbj|BAK00674.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93231.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 141/233 (61%), Positives = 166/233 (71%), Gaps = 10/233 (4%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA--GVRPGDVV  270
            ME  TLT LLK  A  FP RRAI+V GK DLTH+ L  LV+ AA  L A   G+RPG  V
Sbjct  1    MEALTLTSLLKAAAAAFPDRRAIAVHGKIDLTHAALDALVDAAAERLAAGPDGLRPGQTV  60

Query  271  ALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqa  450
            AL FPNTVELV+MFLAVIR R  AAPLN AYT EEFEFYLSDS +++L+   +GN  AQA
Sbjct  61   ALCFPNTVELVVMFLAVIRARGVAAPLNPAYTQEEFEFYLSDSGARLLVTGADGNAPAQA  120

Query  451  aaaKLSIPA-VTATLSGAESDIAL--FPA----HPESDSDAVS-ELVNDPSDVSLFLHTS  606
            AAAKL++P  V ATL+ A   + L   P     HP   +  V  E  N+PSDV+LFLHTS
Sbjct  121  AAAKLALPHAVAATLTDAAGPLGLAGLPDTQDDHPAPQNGTVHHENENEPSDVALFLHTS  180

Query  607  GTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            GTTSRPKGVPLTQ NLA+SV NI+ VY+  E+D+TV+ LPLFHVHGL+  +LS
Sbjct  181  GTTSRPKGVPLTQRNLAASVQNIRGVYRFVETDATVVTLPLFHVHGLMCALLS  233



>ref|XP_006827678.1| PREDICTED: oxalate--CoA ligase [Amborella trichopoda]
 gb|ERM95094.1| hypothetical protein AMTR_s00009p00255790 [Amborella trichopoda]
Length=538

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 163/227 (72%), Gaps = 3/227 (1%)
 Frame = +1

Query  88   SLSMETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDV  267
            S S    TLTGLLK  A     R A+ VSGKF+++H RL  LV   A  L  +GV+ GDV
Sbjct  11   SQSHGDRTLTGLLKKSAVENHDRTALIVSGKFEISHGRLQELVNEVAVILEDSGVKHGDV  70

Query  268  VALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaq  447
            VALTFPNTVE VI FLA I+    AAPLN+AYT+EEFEFYLSDS++K+LL+P +GN++A+
Sbjct  71   VALTFPNTVEFVICFLAAIQAGTVAAPLNSAYTSEEFEFYLSDSKAKLLLLPFDGNKSAE  130

Query  448  aaaaKLSIP-AVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRP  624
            AAA+KL++P A T +L+ + + +A   +   S+ +    + N   DV+LFLHTSGTTSRP
Sbjct  131  AAASKLNLPFANTESLTDSSNGLAF--SGLNSNPNPAPSVQNKGDDVALFLHTSGTTSRP  188

Query  625  KGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            KGVPLTQ NLA+SV NI+ VY L+  D TV+VLPLFHVHGL+  +L 
Sbjct  189  KGVPLTQRNLAASVENIRGVYDLSRDDRTVVVLPLFHVHGLMCSLLG  235



>ref|XP_010321991.1| PREDICTED: oxalate--CoA ligase-like isoform X2 [Solanum lycopersicum]
Length=453

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  307  MFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTA  486
            MFLAVIRVRATAAPLN+AY  EEFEFYLSDSESK+LLI KEGN+AA+AAAAKL+I  +  
Sbjct  1    MFLAVIRVRATAAPLNSAYMPEEFEFYLSDSESKLLLIAKEGNKAAEAAAAKLNITRIKV  60

Query  487  TLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSV  666
            ++  ++SD+ L  + P SD D VSE+VNDPSDV+LFLHTSGTTSRPKGVP+TQ NL SSV
Sbjct  61   SVPSSDSDVILSLSIPLSDCDLVSEIVNDPSDVALFLHTSGTTSRPKGVPITQHNLVSSV  120

Query  667  NNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            NNIKSVYKLTESDSTVIVLPLFHVHGLIAG+LS
Sbjct  121  NNIKSVYKLTESDSTVIVLPLFHVHGLIAGLLS  153



>gb|ABR16382.1| unknown [Picea sitchensis]
Length=536

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 156/226 (69%), Gaps = 7/226 (3%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TLT LL +    FP  +A+ VSGKF++T++ L  LV R A+ L  AG+  GDVVALTFPN
Sbjct  11   TLTALLNNACHEFPQHKAVIVSGKFEVTYAELQRLVNRCAAKLRNAGIGSGDVVALTFPN  70

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
            ++E VI+FLAVIR RA AAPLN+ YT EEFEFYL DS SKML++P EG  +A+ AA KL 
Sbjct  71   SIEFVIVFLAVIRARAVAAPLNSTYTEEEFEFYLEDSGSKMLIVPTEGYSSAERAATKLG  130

Query  469  IPAVTATLSGAESDIALFPAHPESD------SDAVSEL-VNDPSDVSLFLHTSGTTSRPK  627
            +    +         A    HP S+      S+ VSE  +N   D +LFLHTSGTTSRPK
Sbjct  131  LSVAASQFCLDTDRNATVEFHPRSNFVASEGSEEVSETELNLEDDKALFLHTSGTTSRPK  190

Query  628  GVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            GVPLTQ NLA+S  +IK VY+L+ SD TVIVLPLFHVHGL+A +LS
Sbjct  191  GVPLTQLNLAASTQHIKDVYELSPSDLTVIVLPLFHVHGLLAALLS  236



>gb|AEW67746.1| acyl activating enzyme [Zea mays]
Length=523

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 166/225 (74%), Gaps = 8/225 (4%)
 Frame = +1

Query  94   SMETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVV  270
            + E +TLT LLK  A  FP+RRA++V G+ +LTH+ L  LV+ AA+ L A  GV PG VV
Sbjct  5    TTEATTLTVLLKEAAAAFPTRRAVAVPGRLELTHAALDALVDAAAARLAADAGVLPGHVV  64

Query  271  ALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqa  450
            AL+FPNTVELVIMFLAVIR R  AAPLN AYT EEFEFYLSDSE+++L+   EGN AAQA
Sbjct  65   ALSFPNTVELVIMFLAVIRARGVAAPLNPAYTQEEFEFYLSDSEARLLVTNAEGNAAAQA  124

Query  451  aaaKLSIPAVTATLSGAESDIAL--FPAH-PESDSDAVSELV----NDPSDVSLFLHTSG  609
            AAAKL +   TA+L  A   + L   P H PE+ S           NDPSDV+LFLHTSG
Sbjct  125  AAAKLGLAHATASLHDAAGPVHLAGLPVHAPENGSHGGGAAGSLSPNDPSDVALFLHTSG  184

Query  610  TTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHG  744
            TTSRPKGVPL Q NLA+SV NI+SVY+L E+D+TV+VLPLFHVHG
Sbjct  185  TTSRPKGVPLKQRNLAASVRNIRSVYRLAETDATVVVLPLFHVHG  229



>ref|NP_001152269.1| LOC100285908 [Zea mays]
 gb|ACG46715.1| peroxisomal-coenzyme A synthetase [Zea mays]
 gb|AEW67745.1| acyl activating enzyme [Zea mays]
Length=527

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 166/225 (74%), Gaps = 8/225 (4%)
 Frame = +1

Query  94   SMETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVV  270
            + E +TLT LLK  A  FP+RRA++V G+ +LTH+ L  LV+ AA+ L A  GV PG VV
Sbjct  5    TTEATTLTVLLKEAAAAFPTRRAVAVPGRLELTHAALDALVDAAAARLAADAGVLPGHVV  64

Query  271  ALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqa  450
            AL+FPNTVELVIMFLAVIR R  AAPLN AYT EEFEFYLSDSE+++L+   EGN AAQA
Sbjct  65   ALSFPNTVELVIMFLAVIRARGVAAPLNPAYTQEEFEFYLSDSEARLLVTNAEGNAAAQA  124

Query  451  aaaKLSIPAVTATLSGAESDIAL--FPAH-PESDSDAVSELV----NDPSDVSLFLHTSG  609
            AAAKL +   TA+L  A   + L   P H PE+ S           NDPSDV+LFLHTSG
Sbjct  125  AAAKLGLAHATASLHDAAGPVHLAGLPVHAPENGSHGGGAAGSLSPNDPSDVALFLHTSG  184

Query  610  TTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHG  744
            TTSRPKGVPL Q NLA+SV NI+SVY+L E+D+TV+VLPLFHVHG
Sbjct  185  TTSRPKGVPLKQRNLAASVRNIRSVYRLAETDATVVVLPLFHVHG  229



>gb|EEE61933.1| hypothetical protein OsJ_16677 [Oryza sativa Japonica Group]
Length=231

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 158/211 (75%), Gaps = 2/211 (1%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVVA  273
            MET TLT LLK     FPSRRA++V GK DL+H+ L  LV+ AA+ L A  GV PG VVA
Sbjct  1    METPTLTTLLKAAVATFPSRRALAVPGKVDLSHAALDALVDAAAARLAADAGVLPGHVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            L FPNTVELVIMFLAVIR RA AAPLN AYT EEFEFYLSDS +++L+   EGN AAQAA
Sbjct  61   LAFPNTVELVIMFLAVIRARAVAAPLNPAYTQEEFEFYLSDSGARLLITNPEGNVAAQAA  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A+KL +   TA+L  A   + L      S + A  +  NDPSDV+LFLHTSGTTSRPKGV
Sbjct  121  ASKLGLAHTTASLKDAAGQVHLAGFP-ASAAAAAKDFANDPSDVALFLHTSGTTSRPKGV  179

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLP  726
            PLTQ NLA+SV NI++VY+LTE+D+TVIVLP
Sbjct  180  PLTQRNLAASVQNIRAVYRLTEADATVIVLP  210



>ref|XP_008656972.1| PREDICTED: 4-coumarate--CoA ligase-like 10 isoform X2 [Zea mays]
Length=527

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 152/214 (71%), Gaps = 8/214 (4%)
 Frame = +1

Query  127  KHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVVALTFPNTVELV  303
            K  A  FP+ RA++V G+ +LTH+ L  LV+ AA+ L A  GV PG VVAL+FPNTVELV
Sbjct  14   KEAAAAFPTHRAVAVPGRLELTHAALDALVDAAAARLAADAGVLPGHVVALSFPNTVELV  73

Query  304  IMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVT  483
            +MFLAVIR R  AAPLN AYT EEFEFYLSDSE+++L+   EGN AAQA AAKL +    
Sbjct  74   VMFLAVIRARGVAAPLNPAYTQEEFEFYLSDSEARLLVTNAEGNAAAQATAAKLGLAHAA  133

Query  484  ATLSGAESDIAL----FPAHPESDSDAVSELV---NDPSDVSLFLHTSGTTSRPKGVPLT  642
            A+L  A   + L     PA         +      NDPSDV+LFLHTSGTTSRPKGVPL 
Sbjct  134  ASLHDAAGPVHLAGLPVPALENGSHGGGAAGSLSPNDPSDVALFLHTSGTTSRPKGVPLK  193

Query  643  QFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHG  744
            Q NLA+SV NI+SVY+L E+D+TV+VLPLFHVHG
Sbjct  194  QRNLAASVQNIRSVYRLAETDATVVVLPLFHVHG  227



>gb|KCW72145.1| hypothetical protein EUGRSUZ_E00591 [Eucalyptus grandis]
Length=510

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 141/222 (64%), Gaps = 21/222 (9%)
 Frame = +1

Query  100  ETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALT  279
            E   LTG L   A  FP R A+S   +FDLTH+RL  LV+ AA  L A+G+   D V L 
Sbjct  3    EELALTGPLNKAASEFPGRIAVSACREFDLTHARLQELVDHAAVLLTASGIGAADDVVLA  62

Query  280  FPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaa  459
            FPNTVE VI+FLAVIR RATAA LN  YT ++F+FYLS+SE K+LL P++GN  A + A+
Sbjct  63   FPNTVEFVILFLAVIRCRATAATLNPIYTVKQFKFYLSNSEPKLLLTPQKGNRRAHSTAS  122

Query  460  KLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPL  639
            KL+IP +TA L    S I L     E   D +S++VNDPSD                   
Sbjct  123  KLNIPHMTAKLHSTGSRITLSSTDVEPSLDLMSKVVNDPSDR------------------  164

Query  640  TQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
               NLASSV NIK VYKLTE DSTVIVLPLFHVH L+AG+LS
Sbjct  165  ---NLASSVQNIKRVYKLTEPDSTVIVLPLFHVHSLVAGLLS  203



>ref|XP_007040199.1| AMP-dependent synthetase and ligase family protein isoform 2 
[Theobroma cacao]
 gb|EOY24700.1| AMP-dependent synthetase and ligase family protein isoform 2 
[Theobroma cacao]
Length=376

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = +1

Query  307  MFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTA  486
            MFLAVIR RATAAPLN+AYT EEFEFYLSDS+SK+LL+P +G ++AQAAA+KL+IP V+A
Sbjct  1    MFLAVIRCRATAAPLNSAYTTEEFEFYLSDSQSKLLLVPAQGIKSAQAAASKLNIPHVSA  60

Query  487  TLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSV  666
            TL    S +AL  ++P+S  D+V +LVNDP+DVSLFLHTSGTTSRPKGVPLTQ NLA+S 
Sbjct  61   TLQDENSKVAL-SSNPDSHLDSVHQLVNDPADVSLFLHTSGTTSRPKGVPLTQLNLATST  119

Query  667  NNIKSVYKLTESDSTVIVLPLFHVH  741
             NIKSVYKLTESDSTVIVLPLFHVH
Sbjct  120  LNIKSVYKLTESDSTVIVLPLFHVH  144



>ref|XP_004960018.1| PREDICTED: 4-coumarate--CoA ligase-like 10-like [Setaria italica]
Length=528

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 154/211 (73%), Gaps = 18/211 (9%)
 Frame = +1

Query  145  FPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVVALTFPNTVELVIMFLAV  321
            FPSRRA++V GK +LTH+ L  LV+ AA+ L A  GVRPG VVAL+FPNTVELVIMFLAV
Sbjct  19   FPSRRAVTVPGKLELTHAALDALVDAAAARLAADAGVRPGHVVALSFPNTVELVIMFLAV  78

Query  322  IRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGA  501
            IR RA AAPLN AYT EEFEFYLSDSES++LL   EGN AAQAAAAKL +P   ATL  A
Sbjct  79   IRARAVAAPLNPAYTQEEFEFYLSDSESRLLLTNAEGNPAAQAAAAKLGLPHAAATLKDA  138

Query  502  ESDIALFPA-----------HPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQF  648
               + L              H E D        N+ SDV+LFLHTSGTTSRPKGVPLTQ 
Sbjct  139  AGPVHLHGLAAANAANGNGFHQEKDDH------NEASDVALFLHTSGTTSRPKGVPLTQA  192

Query  649  NLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            NLA+SV NI+SVY+L E+D+TV+VLPLFHVH
Sbjct  193  NLAASVGNIRSVYRLAETDATVVVLPLFHVH  223



>gb|KCW72133.1| hypothetical protein EUGRSUZ_E00577 [Eucalyptus grandis]
Length=378

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +1

Query  307  MFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTA  486
            MFLAVIR RATAAPLN+AYTAEEFEFYL+DSESK+LL PKEGN+ AQ+AA+KL+IP VTA
Sbjct  1    MFLAVIRCRATAAPLNSAYTAEEFEFYLADSESKLLLTPKEGNQPAQSAASKLNIPHVTA  60

Query  487  TLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSV  666
             L    S I L     E   D +S++VN+PSDV+LFLHTSGTTSRPKGVPLTQ NLASSV
Sbjct  61   ELHSPNSKITLSSTKVEPSVDLMSKVVNEPSDVALFLHTSGTTSRPKGVPLTQLNLASSV  120

Query  667  NNIKSVYKLTESDSTVIVLPLFHVH  741
             NIKSVYKL+E DSTVIVLPLFHVH
Sbjct  121  QNIKSVYKLSEMDSTVIVLPLFHVH  145



>gb|AFW59952.1| putative AMP-dependent synthetase and ligase superfamily protein 
[Zea mays]
Length=497

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 158/214 (74%), Gaps = 8/214 (4%)
 Frame = +1

Query  127  KHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVVALTFPNTVELV  303
            K  A  FP+RRA++V G+ +LTH+ L  LV+ AA+ L A  GV PG VVAL+FPNTVELV
Sbjct  16   KEAAAAFPTRRAVAVPGRLELTHAALDALVDAAAARLAADAGVLPGHVVALSFPNTVELV  75

Query  304  IMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVT  483
            IMFLAVIR R  AAPLN AYT EEFEFYLSDSE+++L+   EGN AAQAAAAKL +    
Sbjct  76   IMFLAVIRARGVAAPLNPAYTQEEFEFYLSDSEARLLVTNAEGNAAAQAAAAKLGLAHAA  135

Query  484  ATLSGAESDIAL--FPAH-PESDSDAVSELV----NDPSDVSLFLHTSGTTSRPKGVPLT  642
            A+L  A   + L   PAH PE+ S           NDPSDV+LFLHTSGTTSRPKGVPL 
Sbjct  136  ASLHDAAGPVHLAGLPAHAPENGSHGGGAAGSLSPNDPSDVALFLHTSGTTSRPKGVPLK  195

Query  643  QFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHG  744
            Q NLA+SV NI+SVY+L E+D+TV+VLPLFHVHG
Sbjct  196  QRNLAASVRNIRSVYRLAETDATVVVLPLFHVHG  229



>gb|KJB25810.1| hypothetical protein B456_004G210700 [Gossypium raimondii]
Length=452

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = +1

Query  307  MFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTA  486
            MFLAVIR RATAAPLN+AYTAEEFEFYLSDSESK+LLIP EG + A+AAA+KL+IP V+A
Sbjct  1    MFLAVIRCRATAAPLNSAYTAEEFEFYLSDSESKLLLIPAEGIKPAEAAASKLNIPLVSA  60

Query  487  TLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSV  666
             L    S I L  ++PES+ D+V +LVNDP+DVSLFLHTSGTTSRPKGV LTQ NL +SV
Sbjct  61   ALQDENSKITL-SSNPESNIDSVKQLVNDPADVSLFLHTSGTTSRPKGVALTQLNLGTSV  119

Query  667  NNIKSVYKLTESDSTVIVLPLFHVH  741
             NIKSVY+LTESDSTVIVLPLFHVH
Sbjct  120  LNIKSVYELTESDSTVIVLPLFHVH  144



>gb|AEY64280.1| acyl-CoA-like protein [Zea mays]
Length=527

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 157/214 (73%), Gaps = 8/214 (4%)
 Frame = +1

Query  127  KHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVVALTFPNTVELV  303
            K  A  FP+RRA++V G+ +LTH+ L  LV+ AA+ L A  GV PG VVAL+FPNTVELV
Sbjct  16   KEAAAAFPTRRAVAVPGRLELTHAALDALVDAAAARLAADAGVLPGHVVALSFPNTVELV  75

Query  304  IMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVT  483
            IMFLAVIR R  AAPLN AYT EEFEFYLSDSE+++L+   EGN AAQAAAAKL +    
Sbjct  76   IMFLAVIRARGVAAPLNPAYTQEEFEFYLSDSEARLLVTDAEGNAAAQAAAAKLGLAHAA  135

Query  484  ATLSGAESDIAL--FPAH-PESDSDAVSELV----NDPSDVSLFLHTSGTTSRPKGVPLT  642
            A+L  A   + L   P H PE+ S           NDPSDV+LFLHTSGTTSRPKGVPL 
Sbjct  136  ASLHDAAGPVHLAGLPVHAPENGSHGGGAAGSLSPNDPSDVALFLHTSGTTSRPKGVPLK  195

Query  643  QFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHG  744
            Q NLA+SV NI+SVY+L E+D+TV+VLPLFHVHG
Sbjct  196  QRNLAASVRNIRSVYRLAETDATVVVLPLFHVHG  229



>gb|KCW72143.1| hypothetical protein EUGRSUZ_E00589 [Eucalyptus grandis]
Length=510

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 140/222 (63%), Gaps = 21/222 (9%)
 Frame = +1

Query  100  ETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALT  279
            E   LTGLL   A  F  R A+S    FDLTH+RL  LV+ AA  L A+G+   D V L 
Sbjct  3    EELALTGLLNKAASEFHGRIAVSACRDFDLTHARLQELVDHAAVLLTASGIGAADDVVLA  62

Query  280  FPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaa  459
            FPNTVE VI+FLAVIR RATAAPLN  YT ++F+FYLS+SE K+LL P++GN  A +AA+
Sbjct  63   FPNTVEFVILFLAVIRCRATAAPLNPIYTVKQFKFYLSNSEPKLLLTPQKGNRRAHSAAS  122

Query  460  KLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPL  639
            KL+IP +TA L    S I L     E   D +S++VNDPSD                   
Sbjct  123  KLNIPHMTAELHSTGSRITLSSTDVELSLDLMSKVVNDPSDR------------------  164

Query  640  TQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
               NL SSV NIK VYKLTE DSTVIVLPLFHVH L+AG+ S
Sbjct  165  ---NLTSSVQNIKRVYKLTEPDSTVIVLPLFHVHSLVAGLSS  203



>ref|XP_006653896.1| PREDICTED: 4-coumarate--CoA ligase-like 10-like [Oryza brachyantha]
Length=480

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 157/212 (74%), Gaps = 10/212 (5%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVVA  273
            MET TLT LLK    +FPSRRAI+V GK +L+H+ L  LV+ AA+ L A  GV PG VVA
Sbjct  1    METPTLTTLLKAAVASFPSRRAIAVPGKLELSHAALDALVDAAAARLAADAGVLPGHVVA  60

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            L FPNTVELVIMFLAVIR RA AAPLN AYT EEFEFYLSDS +++L+   EGN AAQAA
Sbjct  61   LAFPNTVELVIMFLAVIRARAVAAPLNPAYTQEEFEFYLSDSGARLLITNAEGNVAAQAA  120

Query  454  aaKLSIPAVTATLSGA-ESDIALFPAHPESDSDAVSE---LVNDPSDVSLFLHTSGTTSR  621
            A+KL +   TA    A +  ++ FP+     S AV +     N+PSDV+LFLHTSGTTSR
Sbjct  121  ASKLGLTHTTALKDAAGQVHLSAFPS-----SGAVQDHPGFANEPSDVALFLHTSGTTSR  175

Query  622  PKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
            PKGVPL+Q NLA+SV NI+SVY+LTE+D+T I
Sbjct  176  PKGVPLSQRNLAASVQNIRSVYRLTETDATAI  207



>ref|XP_002448800.1| hypothetical protein SORBIDRAFT_06g033410 [Sorghum bicolor]
 gb|EES13128.1| hypothetical protein SORBIDRAFT_06g033410 [Sorghum bicolor]
Length=513

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 163/217 (75%), Gaps = 10/217 (5%)
 Frame = +1

Query  106  STLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVVALTF  282
            +TLT LLK  A  FP+RRA++V GK +LTH+ L  LV+ AA+ L    GV PG VVAL F
Sbjct  3    TTLTALLKEAAAAFPARRAVAVPGKLELTHAALDALVDAAAARLAVDAGVLPGHVVALAF  62

Query  283  PNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaK  462
            PNTVELVIMFLAVIR RA AAPLN AYT EEFEFYLSDSE+++L+   EGN AAQAAAAK
Sbjct  63   PNTVELVIMFLAVIRARAVAAPLNPAYTQEEFEFYLSDSEARLLITNAEGNAAAQAAAAK  122

Query  463  LSIPAVTATLSGAESDIAL--FP-AHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            L +    ATL  A   + L   P A   S +D      NDPSDV+LFLHTSGTTSRPKGV
Sbjct  123  LGLVHAAATLHDAAGPVHLAGLPLALAGSPND------NDPSDVALFLHTSGTTSRPKGV  176

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHG  744
            PLTQ NLA+SV NI+SVY+L+ESD+TV+VLPLFHVHG
Sbjct  177  PLTQRNLAASVRNIRSVYRLSESDATVVVLPLFHVHG  213



>ref|XP_001755571.1| predicted protein [Physcomitrella patens]
 gb|EDQ79631.1| predicted protein [Physcomitrella patens]
Length=515

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 144/227 (63%), Gaps = 7/227 (3%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M   TL  LL + A     +  +  SG   LTH  L   +++ A  L   GV+PG++V+L
Sbjct  1    MGRVTLIELLDNSAAEHGEQPGLITSGSLQLTHKELQDAIDKTAIQLRRIGVKPGNLVSL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIP-KEGNEaaqaa  453
             FPNT+E V+ F+AV RVRA AAPLN+AYT +EF+FYL D+ S +LL+P  EGN+AA+AA
Sbjct  61   AFPNTLEFVVAFIAVTRVRAIAAPLNSAYTEDEFKFYLEDANSTLLLVPGAEGNKAAEAA  120

Query  454  aaKLSIPAVTATLSGAES---DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRP  624
            +  L +P          S   +I L P     D         D  D +LFLHTSGTTSRP
Sbjct  121  SKTLGLPIAGVHWEKGSSSGDEIVLTPKDKVEDGAGPKP---DEGDEALFLHTSGTTSRP  177

Query  625  KGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            KGVPLTQ NLASS+ NI + Y+LT SD T+IV+PLFHVHGL+A +LS
Sbjct  178  KGVPLTQKNLASSIKNIIATYELTPSDRTLIVMPLFHVHGLMAALLS  224



>ref|XP_002968990.1| hypothetical protein SELMODRAFT_170181 [Selaginella moellendorffii]
 gb|EFJ30106.1| hypothetical protein SELMODRAFT_170181 [Selaginella moellendorffii]
Length=531

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 150/228 (66%), Gaps = 10/228 (4%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TL  LL   A   P   A+  SG   LTH+ L   + R AS L   G+ PGD+V+L FPN
Sbjct  12   TLIELLVDGASLEPDSDALIASGGPRLTHAELQAAILRTASKLKRTGLNPGDLVSLAFPN  71

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK-EGNEaaqaaaaKL  465
            T+E V++FLAV ++R  AAPLN+AYT EEF F + D+ S +LLIP  EGN++A+ AA +L
Sbjct  72   TIEFVVVFLAVAKLRCVAAPLNSAYTPEEFRFSMQDAGSSLLLIPGLEGNKSAEEAADQL  131

Query  466  SIPAVTATLSGAESDIALF--PAHPES--DSDAVSELVNDP----SDVSLFLHTSGTTSR  621
             +P V     G E +  L      P++  + ++  E ++ P    SDV+LFLHTSGTTSR
Sbjct  132  GLP-VAGIHWGKEEETGLLIVEVTPKNRLELNSEKEDLDLPHPVGSDVALFLHTSGTTSR  190

Query  622  PKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PKGVPLTQFNLASSV NI   Y+L+ +D TV+VLPLFHVHGL+  +LS
Sbjct  191  PKGVPLTQFNLASSVKNIVGTYELSVTDKTVVVLPLFHVHGLMCSLLS  238



>ref|XP_008358882.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Malus domestica]
Length=221

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  307  MFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTA  486
            MFL VIR +ATAA LNAAYT EE EF LSDSESK+L++ +E    AQAAA+KL+IP VT 
Sbjct  1    MFLTVIRCQATAALLNAAYTVEELEFNLSDSESKLLIMLEEPIHTAQAAASKLNIPHVTT  60

Query  487  TLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSV  666
             LS   + + L  A  +   D VS+LVND SD++LFLHTSGTTSRPK VPLTQ NLASSV
Sbjct  61   NLSATANPVTLSSA-AKGIPDLVSQLVNDLSDMALFLHTSGTTSRPKKVPLTQLNLASSV  119

Query  667  NNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             NIKSVYK+TESDSTVIVLPLFHVH LI G+LS
Sbjct  120  QNIKSVYKITESDSTVIVLPLFHVHRLITGLLS  152



>ref|XP_002990653.1| hypothetical protein SELMODRAFT_272150 [Selaginella moellendorffii]
 gb|EFJ08285.1| hypothetical protein SELMODRAFT_272150 [Selaginella moellendorffii]
Length=531

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 150/228 (66%), Gaps = 10/228 (4%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            TL  LL   A   P   A+  SG   LTH+ L   + R AS L   G+ PGD+V+L FPN
Sbjct  12   TLIELLVDGASLEPDSDALIASGGPRLTHAELQAAILRTASKLKRTGLNPGDLVSLAFPN  71

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK-EGNEaaqaaaaKL  465
            T+E V++FLAV ++R  AAPLN+AYT EEF F + D+ S +LL+P  EGN++A+ AA +L
Sbjct  72   TIEFVVVFLAVAKLRCVAAPLNSAYTPEEFRFSMQDAGSSLLLVPGLEGNKSAEEAADQL  131

Query  466  SIPAVTATLSGAESDIA--LFPAHPES--DSDAVSELVNDP----SDVSLFLHTSGTTSR  621
             +P V     G E +    +    P++  + ++  E ++ P    SDV+LFLHTSGTTSR
Sbjct  132  GLP-VAGIHWGKEEETGFLIVEVTPKNRLELNSEKEDLDLPHPVGSDVTLFLHTSGTTSR  190

Query  622  PKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PKGVPLTQFNLASSV NI   Y+L+ +D TV+VLPLFHVHGL+  +LS
Sbjct  191  PKGVPLTQFNLASSVKNIVGTYELSVTDKTVVVLPLFHVHGLMCSLLS  238



>emb|CAJ41420.1| 4-coumarate-CoA ligase-like protein [Coffea arabica]
Length=353

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 108/131 (82%), Gaps = 6/131 (5%)
 Frame = +1

Query  391  SDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIAL------FPAHPESDSDA  552
            SDS+SK+LL  K+G+  AQAAA+KL+IP VT  L  A+SD+AL      + + PE D + 
Sbjct  1    SDSDSKILLTSKQGSAPAQAAASKLNIPHVTVALPDADSDVALSSSLSQYESDPEPDPNL  60

Query  553  VSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLF  732
             S+L+NDPSD+SLFLHTSGTTSRPKGVPLTQ NL SSVNNIKSVY++TESDSTVIVLPLF
Sbjct  61   SSKLINDPSDISLFLHTSGTTSRPKGVPLTQLNLVSSVNNIKSVYRITESDSTVIVLPLF  120

Query  733  HVHGLIAGMLS  765
            HVHGL+AG+LS
Sbjct  121  HVHGLLAGLLS  131



>ref|XP_003579506.1| PREDICTED: oxalate--CoA ligase [Brachypodium distachyon]
Length=543

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 161/220 (73%), Gaps = 8/220 (4%)
 Frame = +1

Query  106  STLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVVALTF  282
            +TLT  LK  A  FPSRRA++V GK DLTH+ L  LV+ AA+ L A  GVR G  VAL F
Sbjct  7    TTLTAQLKAAAAAFPSRRAVAVPGKADLTHAALDALVDAAAARLAARAGVRLGHTVALCF  66

Query  283  PNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIP-KEGNEaaqaaaa  459
            PNTVELVIMFLAVIR RA AAPLN AYT EEFEFYLSDS + +LL      N AA+AAAA
Sbjct  67   PNTVELVIMFLAVIRARAVAAPLNPAYTQEEFEFYLSDSGAGLLLTDLSAANPAAEAAAA  126

Query  460  KLSIPAVTATLSGAESDIALFPAHPESDSDAVS----ELV--NDPSDVSLFLHTSGTTSR  621
            KL++P   A+L  + S        PE ++  ++    +L+  N+ SDV+LFLHTSGTTSR
Sbjct  127  KLNLPHSAASLQSSSSPSISLTNLPEDNTTDITAGDEKLLGPNEASDVALFLHTSGTTSR  186

Query  622  PKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVH  741
            PKGVPLTQ NLA++V NI++VYKLTESD+TV+VLPLFHVH
Sbjct  187  PKGVPLTQRNLAATVRNIRAVYKLTESDATVVVLPLFHVH  226



>ref|XP_008656971.1| PREDICTED: 4-coumarate--CoA ligase-like 10 isoform X1 [Zea mays]
 gb|AFW84273.1| putative AMP-dependent synthetase and ligase superfamily protein 
[Zea mays]
Length=503

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 133/214 (62%), Gaps = 32/214 (15%)
 Frame = +1

Query  127  KHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAA-GVRPGDVVALTFPNTVELV  303
            K  A  FP+ RA++V G+ +LTH+ L  LV+ AA+ L A  GV PG VVAL+FPNTVE  
Sbjct  14   KEAAAAFPTHRAVAVPGRLELTHAALDALVDAAAARLAADAGVLPGHVVALSFPNTVE--  71

Query  304  IMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVT  483
                                  EEFEFYLSDSE+++L+   EGN AAQA AAKL +    
Sbjct  72   ----------------------EEFEFYLSDSEARLLVTNAEGNAAAQATAAKLGLAHAA  109

Query  484  ATLSGAESDIAL----FPAHPESDSDAVSELV---NDPSDVSLFLHTSGTTSRPKGVPLT  642
            A+L  A   + L     PA         +      NDPSDV+LFLHTSGTTSRPKGVPL 
Sbjct  110  ASLHDAAGPVHLAGLPVPALENGSHGGGAAGSLSPNDPSDVALFLHTSGTTSRPKGVPLK  169

Query  643  QFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHG  744
            Q NLA+SV NI+SVY+L E+D+TV+VLPLFHVHG
Sbjct  170  QRNLAASVQNIRSVYRLAETDATVVVLPLFHVHG  203



>ref|XP_005644824.1| acetyl-CoA synthetase-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20280.1| acetyl-CoA synthetase-like protein [Coccomyxa subellipsoidea 
C-169]
Length=550

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 143/224 (64%), Gaps = 7/224 (3%)
 Frame = +1

Query  115  TGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTV  294
            T LL  + G+  +       G   LT S+L   V   A  L  +G+RPGD V++   NTV
Sbjct  5    TSLLDTLHGHPDAVAIFCAGGGPRLTRSQLRKQVIGVAIKLRKSGIRPGDAVSIADTNTV  64

Query  295  ELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIP  474
            + V+ FL V   RA AAPLN+ YTA+EF+FY+ D+ SK+LL+P  GN+ A++AA+  +IP
Sbjct  65   DFVVAFLGVTYARAVAAPLNSNYTADEFKFYMQDAASKLLLVPVRGNKEAESAASSCNIP  124

Query  475  AVTATLSGAESDIALFPAHPESD-----SDAVSELVNDP--SDVSLFLHTSGTTSRPKGV  633
              + ++S  +  ++        D       A +EL + P   DV+LFLHTSGTTSRPKGV
Sbjct  125  VASVSVSWTDGGLSTVLTRKSGDLSFDTRGARAELEDPPRGDDVALFLHTSGTTSRPKGV  184

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PLT  NLA+S+ NI + Y+LT SD +++V+PLFHVHGL+AG+L+
Sbjct  185  PLTHANLAASLANIVATYELTPSDRSLLVMPLFHVHGLMAGLLA  228



>ref|XP_007038701.1| AMP-dependent synthetase and ligase family protein, putative 
[Theobroma cacao]
 gb|EOY23202.1| AMP-dependent synthetase and ligase family protein, putative 
[Theobroma cacao]
Length=560

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 129/206 (63%), Gaps = 30/206 (15%)
 Frame = +1

Query  148  PSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIR  327
            PS  ++S+SGKFD+THSRL  LVE AAS L  AG   GDVVAL F NT+E VIMFLA+ R
Sbjct  93   PSPASLSISGKFDITHSRLQELVEHAASRLVTAGFGRGDVVALAFLNTIEFVIMFLAITR  152

Query  328  VRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAES  507
             RATAAPLN AYT EEFEFY+SDSESK+LL P+ GN                       +
Sbjct  153  ARATAAPLNPAYTTEEFEFYVSDSESKLLLTPQNGN---------------------TSA  191

Query  508  DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVY  687
              A   A P S   +++ L           H+S T   P+GVPLTQ N+ SSV N  SVY
Sbjct  192  QAAASNAQPRSAYSSMTRLT---------WHSSSTLLAPQGVPLTQLNIVSSVKNTISVY  242

Query  688  KLTESDSTVIVLPLFHVHGLIAGMLS  765
            K TESDS+++V PLFHVHGL+ G+LS
Sbjct  243  KFTESDSSLLVPPLFHVHGLLTGLLS  268



>ref|XP_005845120.1| hypothetical protein CHLNCDRAFT_48296 [Chlorella variabilis]
 gb|EFN53018.1| hypothetical protein CHLNCDRAFT_48296 [Chlorella variabilis]
Length=530

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 129/201 (64%), Gaps = 10/201 (5%)
 Frame = +1

Query  190  THSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayta  369
            T ++L  L  + AS+L AAG+ PGDVV +  PNTVE V+ F+     RA AAPLN  Y  
Sbjct  30   TRAQLRLLCAQFASTLRAAGISPGDVVTIAEPNTVEFVVAFIGTTLARALAAPLNQNYKT  89

Query  370  EEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIALF------PAH  531
            EEF++Y+ D+ SK+L++   GN AA+AA     I A+T T  GA S  A         A 
Sbjct  90   EEFQYYMEDARSKLLVVGPGGNSAAEAAGGPTCI-ALTVTPPGAGSSAAPMLSIQSKTAG  148

Query  532  PESDSDAVSELVNDP---SDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTES  702
             E+ +   +E V DP    DV+LFLHTSGTTSRPKGVPLT  NL +S++NI   Y+   +
Sbjct  149  FEAVAAPATEQVQDPPLPDDVALFLHTSGTTSRPKGVPLTHANLVASLDNIAQTYEFVPA  208

Query  703  DSTVIVLPLFHVHGLIAGMLS  765
            D +++V+PLFHVHGL+AG+LS
Sbjct  209  DRSLLVMPLFHVHGLMAGLLS  229



>ref|XP_008238891.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 
10 [Prunus mume]
Length=428

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ME  TLTGLLK VA  FP+RRA+SVSGKFDLTH+RL  LV+ AAS L A+G+ P D VAL
Sbjct  1    MENQTLTGLLKKVASEFPNRRALSVSGKFDLTHARLQELVDHAASHLIASGIGPNDTVAL  60

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaa  456
            TFPNTVELV+MFLAVIR RATAAPLN AYTAEEFEFYLSDSESK+L+ P+   +A +AAA
Sbjct  61   TFPNTVELVVMFLAVIRCRATAAPLNPAYTAEEFEFYLSDSESKLLITPEVPIQAVKAAA  120

Query  457  aKLSI  471
             KL+I
Sbjct  121  TKLNI  125



>ref|XP_004335786.1| Peroxisomalcoenzyme A synthetase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR13773.1| Peroxisomalcoenzyme A synthetase [Acanthamoeba castellanii str. 
Neff]
Length=533

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 120/198 (61%), Gaps = 8/198 (4%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            LT+++L H V  A  +L AAG+  GDVVA+  PN +E V+ +LA    R+ AAPLN  Y 
Sbjct  38   LTYAQLAHEVSHARDALSAAGLGRGDVVAMVLPNCLEFVVCWLATTNGRSIAAPLNPDYR  97

Query  367  aEEFEFYLSDSESKMLLIPKEGNEaaqaaaaK-LSIPA----VTATLSGAESDIALFPAH  531
             +EF+FYL D+E+K +++P+ G  A    AA+ L +P          S     + L    
Sbjct  98   LDEFKFYLEDTEAKAVIVPRGGRAAVAVEAAQQLRVPVWETWAEVDASSGRVRVGLESVE  157

Query  532  PESDSDA-VSEL--VNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTES  702
            P     A  SEL    +P DV+LFLHTSGTT RPKGVPLT  NL +++ NI   Y+LT  
Sbjct  158  PLPVRRATASELRVAPEPEDVALFLHTSGTTGRPKGVPLTYRNLVTNLRNISRHYRLTPD  217

Query  703  DSTVIVLPLFHVHGLIAG  756
            D ++IV+PLFHVHGLI G
Sbjct  218  DRSLIVMPLFHVHGLIGG  235



>ref|XP_011398800.1| Putative peroxisomal-coenzyme A synthetase [Auxenochlorella protothecoides]
 gb|AHA86561.1| lipid metabolism related protein [Auxenochlorella protothecoides]
 gb|KFM25904.1| Putative peroxisomal-coenzyme A synthetase [Auxenochlorella protothecoides]
Length=972

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 131/231 (57%), Gaps = 15/231 (6%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISV-SGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVA  273
            M  STL  +L    G  P   AI V SG   LT  +   L  + A SL A+GV+P D+V 
Sbjct  1    MSGSTLLDVL----GGSPDSPAIVVGSGGQKLTRGQFLELATQFAQSLRASGVQPSDLVT  56

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            +   NT+E  + FL     RA AAPLN  Y  EEF++Y  D+ S ++++   GN  A+AA
Sbjct  57   IVDSNTLEFAVAFLGTTLARAVAAPLNQNYHEEEFKYYQEDAGSTLVVVGASGNRGAEAA  116

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESD----SDAVSELVNDP---SDVSLFLHTSGT  612
                  PA+  TL  A     L  A    +    +    E + DP    DV+LFLHTSGT
Sbjct  117  GVA---PAIGVTLDFASGAPVLQLASRVGEFALKTAPAGEALADPPRGDDVALFLHTSGT  173

Query  613  TSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            TSRPKGVPLT  NL +S+ NI+  Y+ TE+D +++ +PLFHVHGL+AG L+
Sbjct  174  TSRPKGVPLTHANLTASLENIRQTYEFTEADVSLLAMPLFHVHGLMAGWLA  224



>gb|KIY97701.1| hypothetical protein MNEG_10263 [Monoraphidium neglectum]
Length=242

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 112/178 (63%), Gaps = 20/178 (11%)
 Frame = +1

Query  286  NTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKL  465
            NTVE +I FLAV + RA AAPLNA Y  +EF +YL D++SK+L++P  GN  A+ AAA L
Sbjct  3    NTVEFIIAFLAVTQARAVAAPLNAGYKKDEFTWYLEDAQSKLLILPPAGNANAEGAAATL  62

Query  466  SIPAVTATLSGAESDIALFPAHPESDSDAVS------------------ELVNDPSDVSL  591
            SIP  T  L  A+  +A+    P  D ++ +                       PSDV+L
Sbjct  63   SIPVATVQL--ADGALAVNDRSPAGDDNSSALRLTSPAASAAAAAADAAPPSPQPSDVAL  120

Query  592  FLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            FLHTSGTTS+PKGVPLT  N+A+S+ NI + Y+LT  D + +V+PLFHVHGL+AG  +
Sbjct  121  FLHTSGTTSKPKGVPLTHANIAASLANIAATYELTSHDVSYMVMPLFHVHGLMAGTFA  178



>gb|ERZ96761.1| hypothetical protein GLOINDRAFT_1313 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX68728.1| acetate--CoA ligase 1 [Rhizophagus irregularis DAOM 197198w]
Length=510

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 114/198 (58%), Gaps = 3/198 (2%)
 Frame = +1

Query  181  FDLTHSRLHHLVERAASSLF-AAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplna  357
             +L++ +L+  ++     +     ++P D + +  PN++E  I FLA+  +R  AAPLN 
Sbjct  24   LELSYRQLYEQIKSVQQQIIEKCDIKPQDAITIVLPNSLEFTITFLALTLLRNIAAPLNP  83

Query  358  aytaEEFEFYLSDSESKMLLIPKEG-NEaaqaaaaKLSIPAVTATLSGAESDIAL-FPAH  531
             Y   EF+FY+ DS+SK++++PK   N+   A  A  +  AV   +S       +    H
Sbjct  84   NYAENEFKFYIDDSKSKVMIVPKGWVNQNKPAVRAARAFNAVIFEISWDNHSHQINLDIH  143

Query  532  PESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
              +           P DV+L LHTSGTT RPKGVPLT  N+ +++NNI   YKL  SD T
Sbjct  144  GNAKGGNFKTRDPHPPDVALLLHTSGTTGRPKGVPLTHRNITTTMNNIIRTYKLVPSDRT  203

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGLI GMLS
Sbjct  204  LLVMPLFHVHGLIGGMLS  221



>emb|CDS10983.1| hypothetical protein LRAMOSA03247 [Absidia idahoensis var. thermophila]
Length=522

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 121/196 (62%), Gaps = 16/196 (8%)
 Frame = +1

Query  196  SRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEE  375
            ++LH LV          G+ PGD VA+++ N++E V+ FLA   +R  +APLN  YT +E
Sbjct  46   AKLHQLV---------PGLAPGDAVAISYLNSLEFVVSFLATGFLRLVSAPLNPNYTEDE  96

Query  376  FEFYLSDSESKMLLIP----KEGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESD  543
            F FYL DS++K++++P     +    A  AA K     +  + +G E  + + P   ++ 
Sbjct  97   FNFYLEDSKAKVMILPPGSLNDPKNPAVRAAQKQGTAILELSWNGQEIQV-VAPGGKKAT  155

Query  544  SDAVS--ELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
            + A S       P DV+L LHTSGTT RPKGVPL+  NLA+S++NI   Y+LT +D T++
Sbjct  156  ATASSCPAFNPQPDDVALLLHTSGTTGRPKGVPLSHLNLATSMHNIIGTYELTPADRTLL  215

Query  718  VLPLFHVHGLIAGMLS  765
            V+PLFHVHGL+ G+L+
Sbjct  216  VMPLFHVHGLVCGLLA  231



>ref|XP_001540156.1| hypothetical protein HCAG_05623 [Histoplasma capsulatum NAm1]
 gb|EDN09124.1| hypothetical protein HCAG_05623 [Histoplasma capsulatum NAm1]
Length=496

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 116/208 (56%), Gaps = 6/208 (3%)
 Frame = +1

Query  160  AISVSGK---FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRV  330
            AI V GK     +++ RL   V    + L   G+ PG  V++  PN+ E ++ FLAV   
Sbjct  15   AIIVPGKPNPLTISYQRLRSDVNSFQAKLAKLGISPGAAVSIALPNSYEFIVSFLAVSWQ  74

Query  331  RataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGA  501
            RA AAPLN AY  EEFEFY+ D  S + LIPK     +  A  AA K S        +G 
Sbjct  75   RAIAAPLNPAYKQEEFEFYIDDLSSALTLIPKGSFAKDGPAVRAARKYSAAIAECYWNGV  134

Query  502  ESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKS  681
            +  + +      +    + +    P D++L LHTSGTT RPK VPLT  NL  ++ NI+ 
Sbjct  135  DVVLDVREYGKFAGKCDLKKETAQPDDIALVLHTSGTTGRPKAVPLTHRNLTRTMRNIQM  194

Query  682  VYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             Y LTE D T++++PLFHVHGL+AG L+
Sbjct  195  TYDLTEKDRTLLIMPLFHVHGLLAGFLA  222



>dbj|GAD95547.1| peroxisomal-coenzyme A synthetase [Byssochlamys spectabilis No. 
5]
Length=513

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 110/196 (56%), Gaps = 3/196 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++ +L+  V    + L   G+RPGD V++  PN+ E ++ FLA    R  AAPLN AY 
Sbjct  28   VSYKQLNSAVATFQAKLAKLGIRPGDAVSIALPNSYEFIVSFLAASWQRGIAAPLNPAYK  87

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             EEFEFY+ D  S + L+P+   E +  A  AA K          +G E  + +  A   
Sbjct  88   QEEFEFYIDDLSSALALVPQGSFEKDGPAVRAARKYQAAIAECYWNGKEVVLDVKDAGKL  147

Query  538  SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
            +           P D++L LHTSGTT RPK VPLT  NL  ++ NIK+ Y LT  D T++
Sbjct  148  ASKSNQKIETAQPDDIALVLHTSGTTGRPKAVPLTHRNLTRTMKNIKATYNLTPKDRTML  207

Query  718  VLPLFHVHGLIAGMLS  765
            V+PLFHVHGL+A  L+
Sbjct  208  VMPLFHVHGLLAAFLA  223



>emb|CDH60219.1| peroxisomal-coenzyme a synthetase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=522

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 119/195 (61%), Gaps = 14/195 (7%)
 Frame = +1

Query  196  SRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEE  375
            ++LH LV          G+ PGD VA+++ N++E V+ FLA   +R  +APLN  YT +E
Sbjct  46   AKLHQLV---------PGLAPGDAVAISYLNSLEFVVSFLATGFLRLVSAPLNPNYTEDE  96

Query  376  FEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATL----SGAESDIALFPAHPESD  543
            F FYL DS++K++++P       +  A + +    TA L    +G E ++        + 
Sbjct  97   FNFYLEDSKAKVMILPPGSANDPKNPAVRAAHKQGTAVLELSWNGREIEVVAPGGKKATA  156

Query  544  SDAVSELVN-DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIV  720
            + + S   N  P DV+L LHTSGTT RPKGVPL+  NLA+S++NI   Y+LT  D T++V
Sbjct  157  TASSSPAFNPQPDDVALLLHTSGTTGRPKGVPLSHLNLATSMHNIIGTYELTPVDRTLLV  216

Query  721  LPLFHVHGLIAGMLS  765
            +PLFHVHGL+ G+L+
Sbjct  217  MPLFHVHGLVCGLLA  231



>dbj|GAA95375.1| hypothetical protein E5Q_02029 [Mixia osmundae IAM 14324]
Length=517

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 126/213 (59%), Gaps = 15/213 (7%)
 Frame = +1

Query  154  RRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            R A  V+ +  ++H  L  L+    S L  AG +PGDV++++  N+++ VI FLAV   R
Sbjct  20   RSATGVNAR-TVSHHELAELITSFQSQLSGAGTQPGDVISMSLINSLDFVIAFLAVGLNR  78

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAE  504
            + AAPLN AY   E +FYL D++S++L++P    + N  A  AA  L+   +  ++    
Sbjct  79   SIAAPLNPAYKTSEVDFYLQDTKSRLLIVPAGAIQANTEAVQAARALATKVLEVSV----  134

Query  505  SDIALFPAHPESDSD------AVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSV  666
             D+   P      SD      A +  V    DV+L LHTSGTT RPK VPLT  NL +++
Sbjct  135  -DLRRQPLRVALTSDGKPVPSASAAAVPKDDDVALILHTSGTTGRPKAVPLTHRNLLTTM  193

Query  667  NNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            +NIK  Y LTE+D + +V+PLFHVHGL+AG L+
Sbjct  194  SNIKRTYALTEADRSYLVMPLFHVHGLLAGFLA  226



>ref|XP_001271574.1| coenzyme A synthetase, putative [Aspergillus clavatus NRRL 1]
 gb|EAW10148.1| coenzyme A synthetase, putative [Aspergillus clavatus NRRL 1]
Length=512

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 110/198 (56%), Gaps = 3/198 (2%)
 Frame = +1

Query  181  FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaa  360
            F +++ +LH  V    + L   GV  G  V+L   N+ E ++ FLA    R+ AAPLN A
Sbjct  26   FSVSYQQLHTHVADFQAKLARLGVGHGAAVSLALANSYEFIVSFLAASWQRSIAAPLNPA  85

Query  361  ytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAH  531
            Y   EFEFY+ D  S ++LIP+     N  A  A  K +         G E  + +    
Sbjct  86   YKQHEFEFYIDDLSSTLVLIPRGTYAQNGPAVRAGRKYNAAIAECYWDGKEVVLDVKEQG  145

Query  532  PESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
              S    V  L   P D++L LHTSGTT RPK VPLT  NL +S+NNI++ YKLT  D T
Sbjct  146  KLSGKGDVGMLQAQPDDIALVLHTSGTTGRPKAVPLTHKNLTTSMNNIRATYKLTPEDRT  205

Query  712  VIVLPLFHVHGLIAGMLS  765
             +V+PLFHVHGL+AG L+
Sbjct  206  YLVMPLFHVHGLLAGFLA  223



>gb|KEI41138.1| hypothetical protein L969DRAFT_84855 [Mixia osmundae IAM 14324]
Length=544

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 126/213 (59%), Gaps = 15/213 (7%)
 Frame = +1

Query  154  RRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            R A  V+ +  ++H  L  L+    S L  AG +PGDV++++  N+++ VI FLAV   R
Sbjct  20   RSATGVNAR-TVSHHELAELITSFQSQLSGAGTQPGDVISMSLINSLDFVIAFLAVGLNR  78

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAE  504
            + AAPLN AY   E +FYL D++S++L++P    + N  A  AA  L+   +  ++    
Sbjct  79   SIAAPLNPAYKTSEVDFYLQDTKSRLLIVPAGAIQANTEAVQAARALATKVLEVSV----  134

Query  505  SDIALFPAHPESDSD------AVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSV  666
             D+   P      SD      A +  V    DV+L LHTSGTT RPK VPLT  NL +++
Sbjct  135  -DLRRQPLRVALTSDGKPVPSASAAAVPKDDDVALILHTSGTTGRPKAVPLTHRNLLTTM  193

Query  667  NNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            +NIK  Y LTE+D + +V+PLFHVHGL+AG L+
Sbjct  194  SNIKRTYALTEADRSYLVMPLFHVHGLLAGFLA  226



>ref|XP_002836834.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81025.1| unnamed protein product [Tuber melanosporum]
Length=512

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 108/196 (55%), Gaps = 3/196 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  L+     +L A G+ P   V++T PN +E ++ FLA    R  AAPLN AY 
Sbjct  26   ISYPTLQSLISNFQKNLAAIGITPQSPVSITLPNNLEFIVSFLATAAQRGIAAPLNPAYK  85

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
              EFEF++ D +SK++++P+        A  AA K  +            ++ L      
Sbjct  86   QGEFEFFIGDVKSKLVVVPRGAVSAGAPAVLAARKFGVAVTEVWWDDQRGEVCLELLEKG  145

Query  538  SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
               D V     +P DV+L LHTSGTT RPK VPLT  NLA ++ NI   YKLT  D T +
Sbjct  146  GLEDGVKVEGAEPEDVALVLHTSGTTGRPKAVPLTHKNLARTMGNIVQTYKLTREDKTYL  205

Query  718  VLPLFHVHGLIAGMLS  765
            V+PLFHVHGL+AG L+
Sbjct  206  VMPLFHVHGLLAGFLA  221



>emb|CEL57746.1| hypothetical protein RSOLAG1IB_02490 [Rhizoctonia solani AG-1 
IB]
Length=526

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 123/205 (60%), Gaps = 8/205 (4%)
 Frame = +1

Query  172  SGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataapl  351
            S + D+T+S L  LV    + L   GV  GD+VA++  N++E V+ FLA    RA +APL
Sbjct  27   SPQVDITYSELRSLVLELRNLLRNEGVAGGDIVAMSLVNSLEFVVGFLATGAARAISAPL  86

Query  352  naaytaEEFEFYLSDSESKMLLIPKEGNEaa---qaaaaKLSIPAVTATLSGAESDIAL-  519
            N AY+  EF FYL D++ +++L+P++ ++ A     +A K ++ A+   +      + L 
Sbjct  87   NPAYSVTEFNFYLEDTKPRIVLLPRDSSKTAPLALESAKKCNVNALELWIQAGRPHVKLV  146

Query  520  FPAHPESDSDAVSELVNDP---SDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYK  690
            F A  +  S   S L N+P    DV+L LHTSGTT RPK VPLT  NL  +  NI   YK
Sbjct  147  FEATKKGKSPNQS-LENEPPHGDDVALVLHTSGTTGRPKSVPLTHANLLRTTANIARTYK  205

Query  691  LTESDSTVIVLPLFHVHGLIAGMLS  765
            LT  D + +V+PLFHVHGL+ G+LS
Sbjct  206  LTPQDRSYLVMPLFHVHGLLCGLLS  230



>gb|KFX97912.1| hypothetical protein V490_02562 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=517

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  LV    S L   G+ P   V++  PNT+E ++ FLA    RA AAPLN+AY 
Sbjct  29   VSYGELTRLVSSFQSRLAQLGITPQSAVSIALPNTIEFIVSFLASSWQRAIAAPLNSAYK  88

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             EEFEFY+ D +S + L+PK     N  A  AA K           G + ++ L      
Sbjct  89   QEEFEFYIDDLKSALALVPKGEFAKNGPAVRAARKYQAAIAECYWDGKKREVVLDVKDQG  148

Query  538  SDSDAVSELVN--DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
                   + V    P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ YKL+ +D T
Sbjct  149  KLKGKGGQNVEKAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQATYKLSPADRT  208

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGL+AG L+
Sbjct  209  MLVMPLFHVHGLLAGFLA  226



>gb|EKG09829.1| AMP-dependent synthetase/ligase [Macrophomina phaseolina MS6]
Length=534

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 117/204 (57%), Gaps = 10/204 (5%)
 Frame = +1

Query  172  SGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataapl  351
            SG + ++H  L   V     +L A G+  G  VA + PN++EL++ F A   +RA AAPL
Sbjct  24   SGGW-ISHRDLARRVREFQLNLAAIGITHGSRVAFSLPNSLELIVAFFASTCMRAVAAPL  82

Query  352  naaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALF  522
            N  Y   EFEFYL D  + +LL+P    + N  A  AA    +     + +G E    +F
Sbjct  83   NFDYKQSEFEFYLQDLNASVLLVPWGSIDKNIDAVRAARACGVSVAEVSFNGGE---IVF  139

Query  523  PAHPESDSDAVS---ELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKL  693
             A  ++    VS   EL   P D++L LHTSGTT RPK VPLT  N+  S+ N+++ YKL
Sbjct  140  SAPTKTTVGGVSRLNELQAQPDDIALILHTSGTTGRPKAVPLTHRNITQSIKNVQATYKL  199

Query  694  TESDSTVIVLPLFHVHGLIAGMLS  765
               D  ++V+PLFH+HGL+AGML+
Sbjct  200  GPRDRGLLVMPLFHIHGLVAGMLT  223



>gb|EEH08767.1| peroxisomal-coenzyme A synthetase [Histoplasma capsulatum G186AR]
Length=513

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 115/208 (55%), Gaps = 6/208 (3%)
 Frame = +1

Query  160  AISVSGK---FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRV  330
            AI V GK     +++ RL   V    + L   G+ PG  V++  PN+ E ++ FLA    
Sbjct  15   AIIVPGKPNPLTISYQRLRSDVNSFQAKLAKLGISPGVAVSIALPNSYEFIVSFLAASWQ  74

Query  331  RataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGA  501
            RA AAPLN AY  EEFEFY+ D  S + LIPK     +  A  AA K S        +G 
Sbjct  75   RAIAAPLNPAYKQEEFEFYIDDLSSALTLIPKGSFAKDGPAVRAARKYSAAIAECYWNGV  134

Query  502  ESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKS  681
            +  + +      +    + +    P D++L LHTSGTT RPK VPLT  NL  ++ NI+ 
Sbjct  135  DVVLDVREYGKLAGKCDLKKETAQPDDIALVLHTSGTTGRPKAVPLTHRNLTRTMRNIQM  194

Query  682  VYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             Y LTE D T++V+PLFHVHGL+AG L+
Sbjct  195  TYDLTEKDRTLLVMPLFHVHGLLAGFLA  222



>ref|XP_002377177.1| coenzyme A synthetase, putative [Aspergillus flavus NRRL3357]
 gb|EED53931.1| coenzyme A synthetase, putative [Aspergillus flavus NRRL3357]
Length=516

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 112/207 (54%), Gaps = 3/207 (1%)
 Frame = +1

Query  154  RRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            +R   +S    +T+ +LH  V    + L   GV  G  V+L   N+ E ++ FL     R
Sbjct  21   KRQTPLSPNLSITYQQLHAHVAEFQAKLAKLGVGHGGAVSLALANSYEFIVGFLGASWQR  80

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAE  504
            A AAPLN AY  EEFEFY+ D  S ++LIPK     N  A  A  K +        +G E
Sbjct  81   AIAAPLNPAYKQEEFEFYIDDLSSTLVLIPKGSYAQNGPAVRAGRKYNAAIAECYWNGTE  140

Query  505  SDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSV  684
              + +      + S  V+     P DV+L LHTSGTT RPK VPLT  NL +++ NI+  
Sbjct  141  VVLDVKEQGKLAGSAGVTVGQAQPDDVALVLHTSGTTGRPKAVPLTHKNLTTTMRNIRDT  200

Query  685  YKLTESDSTVIVLPLFHVHGLIAGMLS  765
            YKLT  D T +V+PLFHVHGL+A  L+
Sbjct  201  YKLTPKDRTYLVMPLFHVHGLLAAFLA  227



>ref|XP_001821398.1| peroxisomal-coenzyme A synthetase [Aspergillus oryzae RIB40]
 dbj|BAE59396.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=516

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 112/207 (54%), Gaps = 3/207 (1%)
 Frame = +1

Query  154  RRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            +R   +S    +T+ +LH  V    + L   GV  G  V+L   N+ E ++ FL     R
Sbjct  21   KRQTPLSPNLSITYQQLHAHVAEFQAKLAKLGVGHGGAVSLALANSYEFIVGFLGASWQR  80

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAE  504
            A AAPLN AY  EEFEFY+ D  S ++LIPK     N  A  A  K +        +G E
Sbjct  81   AIAAPLNPAYKQEEFEFYIDDLSSTLVLIPKGSYAQNGPAVRAGRKYNAAIAECYWNGTE  140

Query  505  SDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSV  684
              + +      + S  V+     P DV+L LHTSGTT RPK VPLT  NL +++ NI+  
Sbjct  141  VVLDVKEQGKLAGSAGVTVGQAQPDDVALVLHTSGTTGRPKAVPLTHKNLTTTMRNIRDT  200

Query  685  YKLTESDSTVIVLPLFHVHGLIAGMLS  765
            YKLT  D T +V+PLFHVHGL+A  L+
Sbjct  201  YKLTPKDRTYLVMPLFHVHGLLAAFLA  227



>ref|XP_503878.1| YALI0E12859p [Yarrowia lipolytica]
 emb|CAG79471.1| YALI0E12859p [Yarrowia lipolytica CLIB122]
Length=583

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 116/209 (56%), Gaps = 9/209 (4%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
             I + G  +LT+S+   L+      L   G+ P   V++  PN++E  + FLAV   R  
Sbjct  90   GIFIPGAQELTYSQFFDLIGDFQKQLAQVGLPPQSAVSIAIPNSLEFAVTFLAVTFSRYI  149

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKEG-NEaaqaaaaKLSIPAVTATLSGAES---  507
            AAPLN+AY   EFEFY+ D +SK++L+PK    +   +  A  +  A  A +   +    
Sbjct  150  AAPLNSAYKKSEFEFYIDDLKSKLVLVPKGAVAQNLASVQAARTFNAAIAEVYWDDQKKR  209

Query  508  ---DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIK  678
               DI   P +P        E+   P DV+L LHTSGTT RPK VPLTQ NL  +++NI 
Sbjct  210  IVMDIKEGPTNPPVAVPTPDEV--SPEDVALVLHTSGTTGRPKAVPLTQRNLCRTMHNIV  267

Query  679  SVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
              YKLT  D+T +V+PLFHVHGL+   L+
Sbjct  268  DTYKLTSKDTTYLVMPLFHVHGLLCAFLA  296



>gb|EER43549.1| peroxisomal-coenzyme A synthetase [Histoplasma capsulatum H143]
 gb|EGC42076.1| peroxisomal CoA synthetase [Histoplasma capsulatum H88]
Length=513

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 115/208 (55%), Gaps = 6/208 (3%)
 Frame = +1

Query  160  AISVSGK---FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRV  330
            AI V GK     +++ RL   V    + L   G+ PG  V++  PN+ E ++ FLA    
Sbjct  15   AIIVPGKPNPLTISYQRLRSDVNSLQAKLAKLGISPGAAVSIALPNSYEFIVSFLAASWQ  74

Query  331  RataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGA  501
            RA AAPLN AY  EEFEFY+ D  S + LIPK     +  A  AA K S        +G 
Sbjct  75   RAIAAPLNPAYKQEEFEFYIDDLSSALTLIPKGSFAKDGPAVRAARKYSAAIAECYWNGV  134

Query  502  ESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKS  681
            +  + +      +    + +    P D++L LHTSGTT +PK VPLT  NL  ++ NI+ 
Sbjct  135  DVVLDVREYGKLAGKCDLKKETAQPDDIALVLHTSGTTGKPKAVPLTHRNLTRTMRNIQM  194

Query  682  VYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             Y LTE D T++V+PLFHVHGL+AG L+
Sbjct  195  TYDLTEKDRTLLVMPLFHVHGLLAGFLA  222



>ref|XP_001550905.1| hypothetical protein BC1G_10629 [Botrytis cinerea B05.10]
 emb|CCD46848.1| similar to peroxisomal-coenzyme A synthetase [Botrytis cinerea 
T4]
Length=513

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 118/209 (56%), Gaps = 9/209 (4%)
 Frame = +1

Query  160  AISVSGK--FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            AI V GK    +T+ +L   +      L   GV P   V++  PNT E +I FLA    R
Sbjct  18   AIIVPGKQPLTITYKQLTAEISSFQKKLAKLGVTPQAAVSIALPNTYEFIIAFLAASWQR  77

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEa---aqaaaaKLSIPAVTATLSGAE  504
              AAPLN+AY  EEFEFY+ D  S + L+PK+  +    A  AA K +        +G+E
Sbjct  78   GIAAPLNSAYKQEEFEFYIDDLSSAVALVPKDSFQKDGPAVRAARKYNAAIAECYWNGSE  137

Query  505  S--DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIK  678
               D+          +  V +    P DV+L LHTSGTT RPK VPLT  NL +++ NI+
Sbjct  138  VVLDVKDEGKLKGKGNQKVEQA--QPDDVALVLHTSGTTGRPKAVPLTHRNLTTTMKNIQ  195

Query  679  SVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            + YKLT +D T++V+PLFHVHGL+AG L+
Sbjct  196  ATYKLTPADRTMLVMPLFHVHGLLAGFLA  224



>gb|KJK66995.1| AMP-binding enzyme [Aspergillus parasiticus SU-1]
Length=516

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 112/207 (54%), Gaps = 3/207 (1%)
 Frame = +1

Query  154  RRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            +R   +S    +T+ +LH  V    + L   GV  G  V+L   N+ E ++ FL     R
Sbjct  21   KRQTPLSPTLSITYQQLHAHVAEFQAKLAKLGVGHGSAVSLALANSYEFIVGFLGASWQR  80

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAE  504
            A AAPLN AY  EEFEFY+ D  S ++LIPK     N  A  A  K +        +G E
Sbjct  81   AIAAPLNPAYKQEEFEFYIDDLSSTLVLIPKGSYAQNGPAVRAGRKYNAAIAECYWNGTE  140

Query  505  SDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSV  684
              + +      + S  V+     P DV+L LHTSGTT RPK VPLT  NL +++ NI+  
Sbjct  141  VVLDVKEQGKLAGSAGVTVEQAQPDDVALVLHTSGTTGRPKAVPLTHKNLTTTMRNIRDT  200

Query  685  YKLTESDSTVIVLPLFHVHGLIAGMLS  765
            YKLT  D T +V+PLFHVHGL+A  L+
Sbjct  201  YKLTPKDRTYLVMPLFHVHGLLAAFLA  227



>gb|EMR85781.1| putative peroxisomal-coenzyme a synthetase protein [Botrytis 
cinerea BcDW1]
Length=513

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 118/209 (56%), Gaps = 9/209 (4%)
 Frame = +1

Query  160  AISVSGK--FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            AI V GK    +T+ +L   +      L   GV P   V++  PNT E +I FLA    R
Sbjct  18   AIIVPGKQPLTITYKQLTAEISSFQKKLAKLGVTPQAAVSIALPNTYEFIIAFLAASWQR  77

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAE  504
              AAPLN+AY  EEFEFY+ D  S + L+PK   + +  A  AA K +        +G+E
Sbjct  78   GIAAPLNSAYKQEEFEFYIDDLSSAVALVPKDSFQKDGPAVRAARKYNAAIAECYWNGSE  137

Query  505  S--DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIK  678
               D+          +  V +    P DV+L LHTSGTT RPK VPLT  NL +++ NI+
Sbjct  138  VVLDVKDEGKLKGKGNQKVEQA--QPDDVALVLHTSGTTGRPKAVPLTHRNLTTTMKNIQ  195

Query  679  SVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            + YKLT +D T++V+PLFHVHGL+AG L+
Sbjct  196  ATYKLTPADRTMLVMPLFHVHGLLAGFLA  224



>gb|ACK49088.1| AMP-dependent synthetase and ligase [Methylocella silvestris 
BL2]
Length=512

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 117/202 (58%), Gaps = 2/202 (1%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            AI+ S    LT   L  LV    +SL   G+   D VA+  PN  E+   F+A I   +T
Sbjct  27   AIAASNAAPLTFDGLRALVAETIASLNGLGIGRNDRVAIVLPNGPEMATAFIA-IASGST  85

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIAL  519
            +APLN +Y  +EFEFY+SD  +K L++       A  AA KL+IP VT T   A+     
Sbjct  86   SAPLNPSYKMDEFEFYMSDLNAKALVVEAGSTSPAIEAAKKLNIPLVTLTPD-AKRGAGY  144

Query  520  FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTE  699
            F    E++  A      +P D++L LHTSGTTSRPK VPLTQ N+A S  NI +  + +E
Sbjct  145  FTLSGEANGTAALPGRAEPDDIALILHTSGTTSRPKIVPLTQANVAKSATNIAATVEFSE  204

Query  700  SDSTVIVLPLFHVHGLIAGMLS  765
             D  + ++PLFH+HGLIAG+L+
Sbjct  205  KDRGLNIMPLFHIHGLIAGILA  226



>ref|WP_041368239.1| AMP-dependent synthetase [Methylocella silvestris]
Length=505

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 117/202 (58%), Gaps = 2/202 (1%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            AI+ S    LT   L  LV    +SL   G+   D VA+  PN  E+   F+A I   +T
Sbjct  20   AIAASNAAPLTFDGLRALVAETIASLNGLGIGRNDRVAIVLPNGPEMATAFIA-IASGST  78

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIAL  519
            +APLN +Y  +EFEFY+SD  +K L++       A  AA KL+IP VT T   A+     
Sbjct  79   SAPLNPSYKMDEFEFYMSDLNAKALVVEAGSTSPAIEAAKKLNIPLVTLTPD-AKRGAGY  137

Query  520  FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTE  699
            F    E++  A      +P D++L LHTSGTTSRPK VPLTQ N+A S  NI +  + +E
Sbjct  138  FTLSGEANGTAALPGRAEPDDIALILHTSGTTSRPKIVPLTQANVAKSATNIAATVEFSE  197

Query  700  SDSTVIVLPLFHVHGLIAGMLS  765
             D  + ++PLFH+HGLIAG+L+
Sbjct  198  KDRGLNIMPLFHIHGLIAGILA  219



>ref|XP_005708092.1| acetolactate synthase large subunit [Galdieria sulphuraria]
 gb|EME31572.1| acetolactate synthase large subunit [Galdieria sulphuraria]
Length=1099

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 129/209 (62%), Gaps = 10/209 (5%)
 Frame = +1

Query  160  AISVSGKFD-LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRa  336
            A+ ++G  + L++S+L   V R    +     + GDV++L  PN+VE V+ FLAV    A
Sbjct  20   AVGIAGTDNILSYSQLRDSVARVCEEITKV-TQKGDVISLILPNSVEFVVSFLAVTWAGA  78

Query  337  taaplnaaytaEEFEFYLSDSESK-MLLIPKEGNEaaqaaaaKLSIPAVTATLSGAES-D  510
             AAPLN AY  +EF FYL D+ +K +++I  + ++ A  AA  L +P  + +   A S D
Sbjct  79   IAAPLNEAYRKDEFLFYLQDAGAKAIIVIQDQASKEALDAAESLKLPIWSLSKFIANSRD  138

Query  511  IALFPAHPESDSDAVSELVND----PSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIK  678
            I++    P S  +            P DV+LFLHTSGTTS+PKGVPLT  NL +S+ NI 
Sbjct  139  ISI--QIPSSQWNGAQSTTGSSRALPDDVALFLHTSGTTSKPKGVPLTHKNLMTSIRNIS  196

Query  679  SVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
              Y+L++SD T++V+PLFHVHGL+A +LS
Sbjct  197  KTYELSDSDVTLLVMPLFHVHGLMAALLS  225



>gb|ELU41708.1| coenzyme A synthetase, putative [Rhizoctonia solani AG-1 IA]
Length=605

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 121/206 (59%), Gaps = 6/206 (3%)
 Frame = +1

Query  166  SVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataa  345
            S S + D+T+S L  LV    + L   GV  GD+VA++  N++E V+ FLA    RA +A
Sbjct  26   SGSPQVDVTYSELRVLVLELRNLLRNEGVAAGDIVAMSLVNSLEFVVGFLATGAARAISA  85

Query  346  plnaaytaEEFEFYLSDSESKMLLIPKEGNEaa---qaaaaKLSIPAVTATLSGAESDIA  516
            PLN AY+  EF FYL D++ +++L+P++ ++ A     +A K ++ A+   +      + 
Sbjct  86   PLNPAYSVSEFNFYLEDTKPRVVLLPRDSSKTAPLALESARKCNVNALELWIQAGRPYVK  145

Query  517  LFPAHPESDSDAVSELVNDP---SDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVY  687
            L     +S       L N+P    DV+L LHTSGTT RPK VPLT  NL  +  NI   Y
Sbjct  146  LVFEAIKSGKTVKQSLDNEPPHGDDVALVLHTSGTTGRPKSVPLTHANLLRTTTNIIHTY  205

Query  688  KLTESDSTVIVLPLFHVHGLIAGMLS  765
            KLT  D + +V+PLFHVHGL+ G+LS
Sbjct  206  KLTPKDRSYLVMPLFHVHGLLCGLLS  231



>gb|KFX96072.1| hypothetical protein O988_05503 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=517

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  LV    S L   G+ P   V++  PNT+E ++ FLA    RA AAPLN+AY 
Sbjct  29   VSYGELTRLVSSFQSRLAQLGITPQSAVSIALPNTIEFIVSFLASSWQRAIAAPLNSAYK  88

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             EEFEFY+ D +S + L+PK     N  A  AA K           G + ++ L      
Sbjct  89   QEEFEFYIDDLKSALALVPKGEFAKNGPAVRAARKYQAAIAECYWDGKKREVVLDVKDQG  148

Query  538  SDSDAVSELVN--DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
                   + V    P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+L+ +D T
Sbjct  149  KLKGKGGQNVEKAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQATYELSPADRT  208

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGL+AG L+
Sbjct  209  MLVMPLFHVHGLLAGFLA  226



>gb|KFY55229.1| hypothetical protein V497_07117 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=517

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 112/198 (57%), Gaps = 5/198 (3%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  LV    S L   G+ P   V++  PNT+E ++ FLA    RA AAPLN+AY 
Sbjct  29   VSYGELTRLVSSFQSRLAQLGITPQSAVSIALPNTIEFIVSFLASSWQRAIAAPLNSAYK  88

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             EEFEFY+ D +S + L+PK     N  A  AA K           G + ++ L      
Sbjct  89   QEEFEFYIDDLKSALALVPKGEFAKNGPAVRAARKYQAAIAECYWDGKKREVVLDVKDQG  148

Query  538  SDSDAVSELVN--DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
                   + V    P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+L+ +D T
Sbjct  149  KLKGKGGQNVEKAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQATYELSPADRT  208

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGL+AG L+
Sbjct  209  MLVMPLFHVHGLLAGFLA  226



>gb|KFY12038.1| hypothetical protein V492_04139 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=517

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  LV    S L   G+ P   V++  PNT+E ++ FLA    RA AAPLN+AY 
Sbjct  29   VSYGELTSLVSSFQSRLAQLGITPQSAVSIALPNTIEFIVSFLASSWQRAIAAPLNSAYK  88

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             EEFEFY+ D +S + L+PK   E +  A  AA K           G + ++ L      
Sbjct  89   QEEFEFYIDDLKSALALVPKGEFEKDGPAVRAARKYQAAIAECYWDGNKREVVLDVKDQG  148

Query  538  SDSDAVSELVN--DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
                   + V    P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+L+ +D T
Sbjct  149  KLKGKGGQKVERAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQATYELSPADRT  208

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGL+AG L+
Sbjct  209  MLVMPLFHVHGLLAGFLA  226



>gb|KDE06250.1| hypothetical protein MVLG_03409 [Microbotryum violaceum p1A1 
Lamole]
Length=361

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 109/184 (59%), Gaps = 12/184 (7%)
 Frame = +1

Query  238  FAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLL  417
            ++ G++ GDVV+++  N  E  I FL V   R  AAPLN  Y   E  FYL D++S++LL
Sbjct  52   WSGGLKAGDVVSMSLINGPEFAIAFLGVGSHRCVAAPLNPTYNPSEVAFYLEDTQSRLLL  111

Query  418  IPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPS---  579
            +P    + N +A  AA+KL++P    +  G    + L     + DS    + +       
Sbjct  112  VPSGAIKANHSAVQAASKLNVPIAEISFDGKNVSLHL----EKKDSTGGGKKIEGSGQPR  167

Query  580  --DVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIA  753
              DV+L LHTSGTT RPK VPLT  NLA+++ NI + YKLT  D T +V+PLFHVHGL+A
Sbjct  168  EDDVALVLHTSGTTGRPKAVPLTHLNLATTMQNIVNTYKLTARDRTYLVMPLFHVHGLLA  227

Query  754  GMLS  765
            G L+
Sbjct  228  GFLA  231



>gb|KFY41695.1| hypothetical protein V494_02848 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=517

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 113/198 (57%), Gaps = 5/198 (3%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  LV    S L   G+ P   V++  PNT+E ++ FLA    RA AAPLN+AY 
Sbjct  29   VSYGELTRLVSSFQSRLAQLGITPQSAVSIALPNTIEFIVSFLASSWQRAIAAPLNSAYK  88

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             EEFEFY+ D +S + L+PK     +  A  AA K           G++ ++ L      
Sbjct  89   QEEFEFYIDDLKSALALVPKGEFAKDGPAVRAARKYQAAIAECYWDGSKREVVLDVKDQG  148

Query  538  SDSDAVSELVN--DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
                   + V    P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+L+ +D T
Sbjct  149  KLKGKGGQKVEKAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQATYELSPADRT  208

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGL+AG L+
Sbjct  209  MLVMPLFHVHGLLAGFLA  226



>gb|EPY50092.1| acetyl-CoA ligase [Schizosaccharomyces cryophilus OY26]
Length=512

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/226 (37%), Positives = 122/226 (54%), Gaps = 6/226 (3%)
 Frame = +1

Query  97   METSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            M T+TL   L+   G+  +R  ++ S   +L++S L   +      + + G++  D V +
Sbjct  1    MSTATLYTALR---GDAHARALVAPSVSAELSYSELRVAIMDLQRQIASLGIKANDPVNI  57

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaq  447
              PN +E V+ F AV   RA   PLN+ Y   EFEFY+ D +SK++L+ K   E N  A 
Sbjct  58   AVPNGLEFVVSFYAVSWQRAVCGPLNSNYKQSEFEFYIDDLKSKLVLVNKGSIEANTPAV  117

Query  448  aaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPK  627
             AA KLS+             + +        S      +  P D++L LHTSGTT RPK
Sbjct  118  RAAKKLSVTVAEFAWCPESRLVKIVRVEGSKSSSPQPLALPHPDDITLVLHTSGTTGRPK  177

Query  628  GVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             VPLT  NL  S+ NI + Y+L+  D++ +V+PLFHVHGL+ G+LS
Sbjct  178  VVPLTHRNLCRSIQNISASYRLSSRDTSYVVMPLFHVHGLLCGLLS  223



>ref|WP_038341089.1| hypothetical protein, partial [delta proteobacterium PSCGC 5451]
Length=424

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 115/206 (56%), Gaps = 2/206 (1%)
 Frame = +1

Query  148  PSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIR  327
            P+  AIS  G+  L +SRL+  ++  A    + G  P D +A+  PN  E+ + FLAV  
Sbjct  10   PAANAISAPGRTPLIYSRLYTFIDEIAEQFNSFGFLPSDRIAIVVPNGPEMAVAFLAVSS  69

Query  328  VRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAES  507
              AT+APLN  Y   EF FY SD  +K L++      AA +AA   +IP +  T    E 
Sbjct  70   C-ATSAPLNCGYRESEFNFYFSDLNAKALIVQSGIESAASSAALARNIPIIELT-PRIED  127

Query  508  DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVY  687
               +F    E  S  V +    P DV+L LHTSGTTSRPK VPLTQ NL  S  NI+   
Sbjct  128  GAGIFMLSSEKASQIVDKEFAQPEDVALVLHTSGTTSRPKLVPLTQANLCHSAQNIQVAL  187

Query  688  KLTESDSTVIVLPLFHVHGLIAGMLS  765
            KL++ D  + V+PLFH+HGL+  +LS
Sbjct  188  KLSQDDYCLNVMPLFHIHGLVGVLLS  213



>ref|WP_025320896.1| AMP-dependent synthetase [Granulibacter bethesdensis]
 gb|AHJ66825.1| Acyl-CoA synthetase family protein [Granulibacter bethesdensis 
CGDNIH4]
Length=511

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 127/223 (57%), Gaps = 11/223 (5%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            T+ GLL   A + P   AI   G+  LT++ L  L  R A +L  AG+  GD VA+  PN
Sbjct  8    TIQGLLTRGAADAP---AIGAPGRTALTYAGLRTLAARTAETLGKAGIGRGDRVAIVLPN  64

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
              E+   F+AV    AT APLN AY  EEF+FYLSD  +K L+I +     A+  AA+ S
Sbjct  65   GPEMAASFIAVAHA-ATTAPLNPAYKEEEFDFYLSDLNAKALVIQRGMESPARIVAARRS  123

Query  469  IPAVT---ATLSGAESDIALFPAHPESDSDAVSEL-VNDPSDVSLFLHTSGTTSRPKGVP  636
            IP +       SGA  D +L  A PE  S   S   +    D++L LHTSGTTSRPK VP
Sbjct  124  IPVIELDPIEASGA-GDFSL--ALPEGLSGEPSTAGIPQAEDIALVLHTSGTTSRPKIVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            L Q N+++S  +I     LT SD  + ++PLFH+HGLIA  LS
Sbjct  181  LRQVNVSASAIHIAETLALTPSDVCLNIMPLFHIHGLIAATLS  223



>ref|XP_009156087.1| hypothetical protein HMPREF1120_03756 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY55626.1| hypothetical protein HMPREF1120_03756 [Exophiala dermatitidis 
NIH/UT8656]
Length=517

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 110/186 (59%), Gaps = 11/186 (6%)
 Frame = +1

Query  229  SSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESK  408
            + L   G+R GD V++  PN+ E ++ FLA    RA AAPLN AY  +EFEFY+ D  S 
Sbjct  44   AKLAGLGIRTGDAVSIALPNSYEFIVSFLATSWQRAIAAPLNPAYKQDEFEFYIEDLSSA  103

Query  409  MLLIP-----KEGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVND  573
            ++++P     KEG     A   K +I      L G  S + L        ++A S+ V  
Sbjct  104  VVILPRGLYAKEGPAVRAARKYKAAI--AECYLEG--SQLVLEVKEQGRLANAQSQRVAQ  159

Query  574  --PSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGL  747
              P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+LT  D T++V+PLFHVHGL
Sbjct  160  AQPEDVALVLHTSGTTGRPKAVPLTHRNLTRTMLNIQNTYELTSKDRTMLVMPLFHVHGL  219

Query  748  IAGMLS  765
            +AG L+
Sbjct  220  LAGFLA  225



>ref|WP_025319246.1| AMP-dependent synthetase [Granulibacter bethesdensis]
 gb|AHJ69494.1| Acyl-CoA synthetase family protein [Granulibacter bethesdensis 
CGDNIH2]
Length=511

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 127/223 (57%), Gaps = 11/223 (5%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            T+ GLL   A + P   AI   G+  LT++ L  L  R A +L  AG+  GD VA+  PN
Sbjct  8    TIQGLLTRGAADAP---AIGAPGRTALTYAGLRTLAARTAETLGKAGIGRGDRVAIVLPN  64

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
              E+   F+AV    AT APLN AY  EEF+FYLSD  +K L+I +     A+  AA+ S
Sbjct  65   GPEMAASFIAVAHA-ATTAPLNPAYKEEEFDFYLSDLNAKALVIQRGMESPARIVAARRS  123

Query  469  IPAVT---ATLSGAESDIALFPAHPESDSDAVSEL-VNDPSDVSLFLHTSGTTSRPKGVP  636
            IP +       SGA  D +L  A PE  S   S   +    D++L LHTSGTTSRPK VP
Sbjct  124  IPVIELDPIEASGA-GDFSL--ALPEGLSGEPSTAGIPQAEDIALVLHTSGTTSRPKIVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            L Q N+++S  +I     LT SD  + ++PLFH+HGLIA  LS
Sbjct  181  LRQVNVSASAIHIAETLALTPSDVCLNIMPLFHIHGLIAATLS  223



>ref|WP_025286306.1| AMP-dependent synthetase [Granulibacter bethesdensis]
 gb|AHJ62610.1| Acyl-CoA synthetase family protein [Granulibacter bethesdensis 
CGDNIH3]
Length=511

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 127/223 (57%), Gaps = 11/223 (5%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            T+ GLL   A + P   AI   G+  LT++ L  L  R A +L  AG+  GD VA+  PN
Sbjct  8    TIQGLLTRGAADAP---AIGAPGRTALTYAGLRTLAARTAETLGKAGIGRGDRVAIVLPN  64

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
              E+   F+AV    AT APLN AY  EEF+FYLSD  +K L+I +     A+  AA+ S
Sbjct  65   GPEMAASFIAVAHA-ATTAPLNPAYKEEEFDFYLSDLNAKALVIQRGMESPARIVAARRS  123

Query  469  IPAVT---ATLSGAESDIALFPAHPESDSDAVSEL-VNDPSDVSLFLHTSGTTSRPKGVP  636
            IP +       SGA  D +L  A PE  S   S   +    D++L LHTSGTTSRPK VP
Sbjct  124  IPVIELDPIEASGA-GDFSL--ALPEGLSGEPSTAGIPQAEDIALVLHTSGTTSRPKIVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            L Q N+++S  +I     LT SD  + ++PLFH+HGLIA  LS
Sbjct  181  LRQVNVSASAIHIAETLALTPSDVCLNIMPLFHIHGLIAATLS  223



>ref|XP_007725391.1| hypothetical protein A1O1_06322 [Capronia coronata CBS 617.96]
 gb|EXJ85953.1| hypothetical protein A1O1_06322 [Capronia coronata CBS 617.96]
Length=517

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 115/204 (56%), Gaps = 19/204 (9%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++ +L   +      L   G+R GD V+++ PN+ E ++ FLA    R  AAPLN AY 
Sbjct  30   ISYQQLTQDILDFQKKLAQLGIRNGDAVSISLPNSYEFIVSFLAASWQRGIAAPLNPAYK  89

Query  367  aEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTAT--LSGAESDIALFPAHPES  540
             +EFEFY+ D  S ++++P+   E         +IPAV A+   + A ++  L  +    
Sbjct  90   QDEFEFYIEDLSSAVVIVPRGSYEK--------NIPAVRASRKYNAAIAECYLKGSRLVL  141

Query  541  DSDAVSELVN---------DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKL  693
            D     +L            P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+L
Sbjct  142  DVKEQGKLAQRQSQTTSHAQPEDVALVLHTSGTTGRPKAVPLTHRNLTRTMQNIQNTYEL  201

Query  694  TESDSTVIVLPLFHVHGLIAGMLS  765
            T  D T++V+PLFHVHGL+AG L+
Sbjct  202  TPKDRTMLVMPLFHVHGLLAGFLA  225



>gb|ESZ97540.1| peroxisomal-coenzyme A synthetase [Sclerotinia borealis F-4157]
Length=513

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 116/209 (56%), Gaps = 9/209 (4%)
 Frame = +1

Query  160  AISVSGK--FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            AI + GK    +T+ +L   +      L   GV P   V++  PNT E ++ FLA    R
Sbjct  18   AIIIPGKQPLTITYKQLSAEIYSFQKKLAKLGVTPQAAVSIALPNTYEFIVAFLAASWQR  77

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEa---aqaaaaKLSIPAVTATLSGAE  504
              AAPLN++Y  EEFEFY+ D  S + L+PK+  +    A  AA K +        +G E
Sbjct  78   GIAAPLNSSYKQEEFEFYIDDLSSAVALVPKDSFQKDGPAVRAARKYNAAIAECYWNGRE  137

Query  505  S--DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIK  678
               D+          +  V +    P DV+L LHTSGTT RPK VPLT  NL  ++ NI+
Sbjct  138  VVLDVKDEGKLKGKGNQKVEQA--QPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQ  195

Query  679  SVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            + YKLT +D T++V+PLFHVHGL+AG L+
Sbjct  196  TTYKLTPADRTMLVMPLFHVHGLLAGFLA  224



>gb|KFY87429.1| hypothetical protein V498_07187 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=536

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 81/205 (40%), Positives = 115/205 (56%), Gaps = 19/205 (9%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  LV    S L   G+ P   V++  PNT+E ++ FLA    RA AAPLN+AY 
Sbjct  28   VSYGELTRLVSSFQSRLAKLGITPQSAVSIALPNTIEFIVSFLASSWQRAIAAPLNSAYK  87

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             EEFEFY+ D +S + L+PK     +  A  AA K           G + ++ L      
Sbjct  88   QEEFEFYIDDLKSALALVPKGEFAKDGPAVRAARKYQAAIAECYWDGNKREVVL------  141

Query  538  SDSDAVSELVN---------DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYK  690
             D   + +L+           P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+
Sbjct  142  -DVKDLGKLMGKGGQYVETAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQATYE  200

Query  691  LTESDSTVIVLPLFHVHGLIAGMLS  765
            L+ +D T++V+PLFHVHGL+AG L+
Sbjct  201  LSPADRTMLVMPLFHVHGLLAGFLA  225



>ref|NP_588549.1| acetyl-CoA ligase (predicted) [Schizosaccharomyces pombe 972h-]
 sp|O74976.1|FAT2_SCHPO RecName: Full=Putative peroxisomal-coenzyme A synthetase [Schizosaccharomyces 
pombe 972h-]
 emb|CAA19311.1| acetyl-CoA ligase (predicted) [Schizosaccharomyces pombe]
Length=512

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 125/230 (54%), Gaps = 19/230 (8%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            + T L   + G+  +R  ++ S   +L+ S L   +      + + G++ GD V +  PN
Sbjct  2    SFTTLYSAIQGDASARALVAPSLNAELSFSELRIAIMDLQRQIASLGIKVGDPVNIAIPN  61

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
             +E V+ F AV   RA   PLN+ Y   EFEFY+ D +SK++++P EG+          +
Sbjct  62   GLEFVVAFYAVSWQRAICGPLNSNYKQSEFEFYIDDLKSKLVIVP-EGS-------VAAN  113

Query  469  IPAVTAT--LSGAESDIALFPA-------HPESDSDAVSELVN--DPSDVSLFLHTSGTT  615
             PAV A   LS A +++A  P        H E       + +    P DV L LHTSGTT
Sbjct  114  TPAVRAAKKLSVAVAELAWCPKSRLVRIVHFEGAKINAPQPLGLPQPDDVMLVLHTSGTT  173

Query  616  SRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             RPK VPLT  NL  S++NI + Y+L   D++ +V+PLFHVHGL+ G+LS
Sbjct  174  GRPKVVPLTHKNLCRSIHNITTSYRLDPRDTSYVVMPLFHVHGLLCGLLS  223



>ref|XP_001244677.1| hypothetical protein CIMG_04118 [Coccidioides immitis RS]
 gb|EAS33094.1| coenzyme A synthetase [Coccidioides immitis RS]
Length=514

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 117/208 (56%), Gaps = 6/208 (3%)
 Frame = +1

Query  160  AISVSGKFD---LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRV  330
            AI + GK D   +++ RLH  +    S L   G+ P   V++  PN+ E ++ FLA    
Sbjct  16   AIIIPGKPDALTISYERLHADILAFQSKLARLGITPASAVSIALPNSYEFIVSFLATSWQ  75

Query  331  RataaplnaaytaEEFEFYLSDSESKMLLIPKE--GNEaaqaaaaKLSIPAVTATLSGAE  504
            RA AAPLN AY  +EFEFY+ D  S + L+P+   G +     AA+    A+       +
Sbjct  76   RAIAAPLNPAYKQDEFEFYIGDLSSALALVPEGSYGQDGPAVRAARKYNAAIAECYWNGK  135

Query  505  SDIALFPAHPE-SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKS  681
              +     H + +  +  +     P D++L LHTSGTT RPK VPLT  NL  ++ NI++
Sbjct  136  QVVLDIKEHGKLAGRENQNVETAQPDDIALVLHTSGTTGRPKAVPLTHRNLTKTMRNIQA  195

Query  682  VYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             Y LTE+D T++V+PLFHVHGL+A  L+
Sbjct  196  TYSLTENDRTLLVMPLFHVHGLLAAFLA  223



>ref|XP_001588125.1| hypothetical protein SS1G_10571 [Sclerotinia sclerotiorum 1980]
 gb|EDN94697.1| hypothetical protein SS1G_10571 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=513

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 114/209 (55%), Gaps = 9/209 (4%)
 Frame = +1

Query  160  AISVSGK--FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            AI + GK    +T+ +L   +      L   GV P   V+L  PNT E ++ FLA    R
Sbjct  18   AIIIPGKRPLTITYKQLSAEISSFQKKLAKLGVTPRAAVSLALPNTYEFIVAFLATSWQR  77

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEa---aqaaaaKLSIPAVTATLSGAE  504
              AAPLN++Y  EEFEFY+ D  S + L+PK+  +    A  AA K +        +G E
Sbjct  78   GVAAPLNSSYKQEEFEFYIDDLSSAVTLVPKDSFQKDGPAVRAARKYNAAIAECYWNGKE  137

Query  505  S--DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIK  678
               DI          +  V +    P DV+L LHTSGTT RPK VPLT  NL  ++ NI+
Sbjct  138  VVLDIKEEGKLKGKGNQKVEQA--QPDDVALILHTSGTTGRPKAVPLTHKNLTRTMKNIQ  195

Query  679  SVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            + Y LT  D T++V+PLFHVHGL+AG L+
Sbjct  196  ATYNLTPVDRTMLVMPLFHVHGLLAGFLA  224



>gb|KDN50152.1| hypothetical protein RSAG8_01488, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=527

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 123/207 (59%), Gaps = 8/207 (4%)
 Frame = +1

Query  166  SVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataa  345
            S S + D+T+S L  LV    + L   GV  GDVVA++  N++E V+ FLA    RA +A
Sbjct  26   SGSPQLDVTYSELRGLVLELRNLLRDEGVAAGDVVAMSLVNSLEFVVGFLATGAARAISA  85

Query  346  plnaaytaEEFEFYLSDSESKMLLIPKEGNEaa---qaaaaKLSIPAVTATLSGAESDIA  516
            PLN AY+  EF FYL D++ +++L+P++ ++ A     +A K ++ A+   +      + 
Sbjct  86   PLNPAYSVPEFTFYLEDTKPRVVLLPRDSSKTAPLALESAKKCNVNALELWIQAGRPHVK  145

Query  517  -LFPAHPESDSDAVSELVNDP---SDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSV  684
             +F A  E  +     L ++P    DV+L LHTSGTT RPK VPLT  NL  +  NI   
Sbjct  146  TVFKAGQEGKAPR-QRLEHEPPHGDDVALVLHTSGTTGRPKSVPLTHANLLRTTVNIIQT  204

Query  685  YKLTESDSTVIVLPLFHVHGLIAGMLS  765
            YKLT  D + +V+PLFHVHGL+ G+LS
Sbjct  205  YKLTPEDRSYLVMPLFHVHGLLCGLLS  231



>gb|KFY79689.1| hypothetical protein V499_01334 [Pseudogymnoascus pannorum VKM 
F-103]
Length=517

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 111/198 (56%), Gaps = 5/198 (3%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  LV    S L   G+ P   V++  PNT+E ++ FLA    RA AAPLN+AY 
Sbjct  29   ISYGELTRLVSSFQSRLAQLGITPQSAVSIALPNTIEFIVSFLASSWQRAIAAPLNSAYK  88

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             EEFEFY+ D +S + L+PK     +  A  AA K           G + ++ L      
Sbjct  89   QEEFEFYIDDLKSALALVPKGEFAKDGPAVRAARKYQAAIAECYWDGNKREVVLDVKDQG  148

Query  538  SDSDAVSELVN--DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
                     V    P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+L+ +D T
Sbjct  149  KLKGKGGRNVEKAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQATYELSPADRT  208

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGL+AG L+
Sbjct  209  MLVMPLFHVHGLLAGFLA  226



>gb|KEP48067.1| peroxisomal-coenzyme A synthetase [Rhizoctonia solani 123E]
Length=527

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 122/207 (59%), Gaps = 8/207 (4%)
 Frame = +1

Query  166  SVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataa  345
            S S + D+T+S+L  LV    + L   GV  GDVVA+   N +E V+ FLA    RA +A
Sbjct  26   SGSSQTDVTYSQLRGLVLELRNLLRDEGVAAGDVVAMGLVNCLEFVVGFLATGAARAISA  85

Query  346  plnaaytaEEFEFYLSDSESKMLLIPKEGNEaa---qaaaaKLSIPAVTATLSGAESDI-  513
            PLN AY+  EF FYL D++ +++L+P+  ++ A     +A K ++ A+   + G +  I 
Sbjct  86   PLNPAYSVPEFNFYLEDTKPRVVLLPRNSSKTAPLALESAKKCNVNALELWVQGGKPHIK  145

Query  514  ALFPAHPESDSDAVSELVNDP---SDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSV  684
            ++F A  E  +     L  +P    DV+L LHTSGTT RPK VPLT  NL  +  NI   
Sbjct  146  SVFMAKQEEKAPN-QRLEYEPPHGDDVALVLHTSGTTGRPKSVPLTHANLLRTTVNIIQT  204

Query  685  YKLTESDSTVIVLPLFHVHGLIAGMLS  765
            YKL   D + +V+PLFHVHGL+ G+LS
Sbjct  205  YKLAPEDRSYLVMPLFHVHGLLCGLLS  231



>ref|XP_008076145.1| Acetyl-CoA synthetase-like protein [Glarea lozoyensis ATCC 20868]
 gb|EPE36830.1| Acetyl-CoA synthetase-like protein [Glarea lozoyensis ATCC 20868]
Length=515

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 115/209 (55%), Gaps = 9/209 (4%)
 Frame = +1

Query  160  AISVSGKFDLT--HSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            AI + GK  LT  +  L   +      L   GV P   V++  PNT E ++ FLA    R
Sbjct  18   AIIIPGKQPLTISYQNLSAEILSFQKKLAKLGVTPEAAVSIALPNTYEFIVAFLASAWQR  77

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAE  504
              AAPLNAAY  EEFEFY+ D +S + L+PK   E + AA  AA K          +G E
Sbjct  78   GIAAPLNAAYKQEEFEFYIDDLKSAVALVPKGSFEKDGAAVKAARKYKAAIAECYWNGQE  137

Query  505  S--DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIK  678
               D+          +  V +    P DV+L LHTSGTT RPK VPLT  NL  ++ NIK
Sbjct  138  VVLDVKDEGKLKGKGNQKVEQA--QPDDVALVLHTSGTTGRPKAVPLTHKNLTRTMKNIK  195

Query  679  SVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
              Y+L+ +D T++V+PLFHVHGL+AG L+
Sbjct  196  DTYQLSPADRTMLVMPLFHVHGLLAGFLA  224



>gb|EHK99170.1| putative peroxisomal-coenzyme A synthetase [Glarea lozoyensis 
74030]
Length=494

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 115/209 (55%), Gaps = 9/209 (4%)
 Frame = +1

Query  160  AISVSGKFDLT--HSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            AI + GK  LT  +  L   +      L   GV P   V++  PNT E ++ FLA    R
Sbjct  18   AIIIPGKQPLTISYQNLSAEILSFQKKLAKLGVTPEAAVSIALPNTYEFIVAFLASAWQR  77

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAE  504
              AAPLNAAY  EEFEFY+ D +S + L+PK   E + AA  AA K          +G E
Sbjct  78   GIAAPLNAAYKQEEFEFYIDDLKSAVALVPKGSFEKDGAAVKAARKYKAAIAECYWNGQE  137

Query  505  S--DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIK  678
               D+          +  V +    P DV+L LHTSGTT RPK VPLT  NL  ++ NIK
Sbjct  138  VVLDVKDEGKLKGKGNQKVEQA--QPDDVALVLHTSGTTGRPKAVPLTHKNLTRTMKNIK  195

Query  679  SVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
              Y+L+ +D T++V+PLFHVHGL+AG L+
Sbjct  196  DTYQLSPADRTMLVMPLFHVHGLLAGFLA  224



>ref|XP_007582098.1| putative peroxisomal-coenzyme a synthetase protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD50427.1| putative peroxisomal-coenzyme a synthetase protein [Neofusicoccum 
parvum UCRNP2]
Length=515

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 113/209 (54%), Gaps = 9/209 (4%)
 Frame = +1

Query  160  AISVSGKFDLT--HSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            A+ V GK  LT  + +L   V      L A G+ PG  V++  PN+ E ++ FLA    R
Sbjct  17   AVIVPGKPALTVSYQQLSADVASFQKKLAALGITPGSAVSIALPNSYEFIVSFLAASWQR  76

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAE  504
              AAPLN AY   EFEFY+ D  S + L+PK     +  A  AA K          +G E
Sbjct  77   GIAAPLNPAYKQNEFEFYIDDLSSAVALVPKGQFAQDSPAVRAARKYQAAIAECYWNGKE  136

Query  505  S--DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIK  678
               D+          S  V +    P DV+L LHTSGTT RPK VPLT  NL  ++ NI+
Sbjct  137  VVLDVKDIGKLKGKGSQKVEQA--QPEDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQ  194

Query  679  SVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            + Y+L+  D T++V+PLFHVHGL+AG L+
Sbjct  195  ATYQLSPQDRTMLVMPLFHVHGLLAGFLA  223



>gb|KEQ59130.1| acetyl-CoA synthetase-like protein [Aureobasidium melanogenum 
CBS 110374]
Length=512

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 116/205 (57%), Gaps = 3/205 (1%)
 Frame = +1

Query  160  AISVSGKFDLT--HSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            AI V GK  LT  + +L   +      L   G+ PG  V++  PNT   ++ FLA    R
Sbjct  16   AIIVPGKQPLTVSYEQLTADILSFQEKLAKLGITPGSAVSIALPNTYPFIVAFLATAWQR  75

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPKE-GNEaaqaaaaKLSIPAVTATLSGAESD  510
            A AAPLN AY   EFEFY+ D +S ++L+P+   +  A  AA K +        +G E  
Sbjct  76   AIAAPLNPAYKQSEFEFYIDDLKSALVLVPQGLADGPAVKAATKYNAAVAECYWNGKEVV  135

Query  511  IALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYK  690
            + +            S     P DV+L LHTSGTT RPK VPL+  NL  +++NIK+ Y+
Sbjct  136  LDIKDEGKLKGKGNKSIEYAQPDDVALVLHTSGTTGRPKAVPLSHKNLTRTMSNIKATYE  195

Query  691  LTESDSTVIVLPLFHVHGLIAGMLS  765
            LT++D T++V+PLFHVHGL+AG L+
Sbjct  196  LTKNDRTMLVMPLFHVHGLLAGFLA  220



>gb|KFZ22740.1| hypothetical protein V502_02781 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=517

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 110/198 (56%), Gaps = 5/198 (3%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  LV    S L   G+ P   V++  PNT+E ++ FLA    RA AAPLN+AY 
Sbjct  29   ISYGELTRLVSSFQSRLAQLGITPQSAVSIALPNTIEFIVSFLASSWQRAIAAPLNSAYK  88

Query  367  aEEFEFYLSDSESKMLLIPK-----EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAH  531
             EEFEFY+ D +S + L+PK     +G     A   + +I          E  + +    
Sbjct  89   QEEFEFYIDDLKSALALVPKGEFAKDGPAVRAARKYQAAIAECYWDEKRREVVLDVKDQG  148

Query  532  PESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
                    +     P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+L+ +D T
Sbjct  149  KLKGKGGRNVETAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQATYELSPADRT  208

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGL+AG L+
Sbjct  209  MLVMPLFHVHGLLAGFLA  226



>gb|KFY84377.1| hypothetical protein V500_09362 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=517

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 110/198 (56%), Gaps = 5/198 (3%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  LV    S L   G+ P   V++  PNT+E ++ FLA    R+ AAPLN+AY 
Sbjct  29   ISYGELTRLVSSFQSRLAQLGITPQSAVSIALPNTIEFIVSFLASSWQRSIAAPLNSAYK  88

Query  367  aEEFEFYLSDSESKMLLIPK-----EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAH  531
             EEFEFY+ D +S + L+PK     +G     A   + +I          E  + +    
Sbjct  89   QEEFEFYIDDLKSALALVPKGEFAKDGPAVRAAKKYQAAIAECYWDEKRREVVLDVKDQG  148

Query  532  PESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
                    +     P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+L+ +D T
Sbjct  149  KLKGKGGRNVETAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQATYELSPADRT  208

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGL+AG L+
Sbjct  209  MLVMPLFHVHGLLAGFLA  226



>gb|KFZ18859.1| hypothetical protein V501_00977 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=517

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 111/198 (56%), Gaps = 5/198 (3%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L  LV    S L   G+ P   V++  PNT+E ++ FLA    RA AAPLN+AY 
Sbjct  29   ISYGELIRLVSSFQSRLAQLGITPQSAVSIALPNTIEFIVSFLASSWQRAIAAPLNSAYK  88

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             EEFEFY+ D +S + L+PK     +  A  AA K           G + ++ L      
Sbjct  89   QEEFEFYIDDLKSALALVPKGEFAKDGPAVRAARKYQAAIAECYWDGNKREVVLDVKDQG  148

Query  538  SDSDAVSELVN--DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
                     V    P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+L+ +D T
Sbjct  149  KLKGKGGRNVEKAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKNIQATYELSPADRT  208

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGL+AG L+
Sbjct  209  MLVMPLFHVHGLLAGFLA  226



>gb|KIV79392.1| hypothetical protein PV11_06955 [Exophiala sideris]
Length=517

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 113/196 (58%), Gaps = 3/196 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++S+L   +    S L   G++  D V++  PN+ E V+ FLA    RA AAPLN AY 
Sbjct  30   VSYSQLTRDILEFQSKLAQLGIKHADAVSIALPNSYEFVVAFLATSYQRAIAAPLNPAYK  89

Query  367  aEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
              EFEFY+ D  S ++L+P+     +  A  +A K         L G+   + +      
Sbjct  90   QSEFEFYIEDLSSSVVLVPRGAYAKDGPAVKSARKFEAAIAECYLDGSRPVLEVKEKGKL  149

Query  538  SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
            + ++A       P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+LT SD T++
Sbjct  150  AGAEAQRVSHAQPEDVALVLHTSGTTGRPKAVPLTHRNLTRTMQNIQNTYELTTSDRTML  209

Query  718  VLPLFHVHGLIAGMLS  765
            V+PLFHVHGL+AG L+
Sbjct  210  VMPLFHVHGLLAGFLA  225



>ref|WP_045650501.1| AMP-dependent synthetase [Hoeflea sp. BRH_c9]
 gb|KJS08388.1| AMP-dependent synthetase [Hoeflea sp. BRH_c9]
Length=509

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 114/204 (56%), Gaps = 11/204 (5%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            AI   G+  LT+  L  L    A+ L AAG+  GD VA+  PN  E+   F+ + +  A 
Sbjct  18   AIGAPGRAWLTYGGLRALAIDVAAQLRAAGIGSGDRVAIVLPNGPEMATAFVTIAQA-AI  76

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPK--EGNEaaqaaaaKLSIPAVTATLSGAESDI  513
             APLN AY  EEFEFYL D ++K L++P+  +G   A A    ++I  +++T        
Sbjct  77   TAPLNPAYRQEEFEFYLDDLKAKALVVPEAYDGPALAAAEKFGMTILRLSSTPDAPAGQF  136

Query  514  ALFPAH--PESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVY  687
            +L      P  DSD        P D++L LHTSGTTSRPK VPL Q N+A+S  NIK   
Sbjct  137  SLAGGSGAPAPDSDP------GPDDIALILHTSGTTSRPKIVPLLQSNVAASAQNIKVTL  190

Query  688  KLTESDSTVIVLPLFHVHGLIAGM  759
             LT  D  + V+PLFH+HGLIA +
Sbjct  191  ALTPDDRCLNVMPLFHIHGLIAAV  214



>gb|EUC66784.1| peroxisomal-coenzyme A synthetase [Rhizoctonia solani AG-3 Rhs1AP]
Length=527

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 122/207 (59%), Gaps = 8/207 (4%)
 Frame = +1

Query  166  SVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataa  345
            S S + D+T+S+L  LV    + L   GV  GDVVA+   N +E V+ FLA    RA +A
Sbjct  26   SGSSQTDVTYSQLRGLVLELRNLLRDEGVAAGDVVAMGLVNCLEFVVGFLATGAARAISA  85

Query  346  plnaaytaEEFEFYLSDSESKMLLIPKEGNEaa---qaaaaKLSIPAVTATLSGAESDI-  513
            PLN AY+  EF FYL D++ +++L+P+  ++ A     +A K ++ A+   + G +  I 
Sbjct  86   PLNPAYSVPEFNFYLEDTKPRVVLLPRNSSKTAPLALESAKKCNVNALELWVQGGKPHIK  145

Query  514  ALFPAHPESDSDAVSELVNDP---SDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSV  684
            ++F A  E  +     L  +P    DV+L LHTSGTT RPK VPLT  NL  +  NI   
Sbjct  146  SVFMAKQEEKAPN-QRLEYEPPHGDDVALVLHTSGTTGRPKSVPLTHANLLRTTVNIIQT  204

Query  685  YKLTESDSTVIVLPLFHVHGLIAGMLS  765
            Y+L   D + +V+PLFHVHGL+ G+LS
Sbjct  205  YQLAPEDRSYLVMPLFHVHGLLCGLLS  231



>ref|WP_011631497.1| AMP-dependent synthetase [Granulibacter bethesdensis]
 gb|ABI61688.1| acyl-CoA synthetase family protein [Granulibacter bethesdensis 
CGDNIH1]
Length=511

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 126/223 (57%), Gaps = 11/223 (5%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPN  288
            T+ GLL   A + P   AI   G+  LT++ L  L  R   +L  AG+  GD VA+  PN
Sbjct  8    TIQGLLTRGAADAP---AIGAPGRTALTYAGLRTLAARTTETLGKAGIGRGDRVAIVLPN  64

Query  289  TVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLS  468
              E+   F+AV    AT APLN AY  EEF+FYLSD  +K L+I +     A+  AA+ S
Sbjct  65   GPEMAASFIAVAHA-ATTAPLNPAYKEEEFDFYLSDLNAKALVIQRGMESPARIVAARRS  123

Query  469  IPAVT---ATLSGAESDIALFPAHPESDSDAVSEL-VNDPSDVSLFLHTSGTTSRPKGVP  636
            IP +       SGA  D +L  A PE  S   S   +    D++L LHTSGTTSRPK VP
Sbjct  124  IPVIELDPIEASGA-GDFSL--ALPEGLSGEPSTAGIPQAEDIALVLHTSGTTSRPKIVP  180

Query  637  LTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            L Q N+++S  +I     LT +D  + ++PLFH+HGLIA  LS
Sbjct  181  LRQVNVSASAIHIAETLALTPNDVCLNIMPLFHIHGLIAATLS  223



>ref|XP_010760275.1| hypothetical protein PADG_04495 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH48416.1| hypothetical protein PADG_04495 [Paracoccidioides brasiliensis 
Pb18]
Length=512

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 117/211 (55%), Gaps = 7/211 (3%)
 Frame = +1

Query  133  VAGNFPSRR--AISVSGK--FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVEL  300
            +A +FP  +  AI V GK    +++ RL   V    + L   G+ PG  V++   N+ E 
Sbjct  4    LANSFPDNKSTAIIVPGKPPVLISYQRLCSDVLSFQARLANLGILPGAAVSIALTNSYEF  63

Query  301  VIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSI  471
            ++ FLAV   RA AAPLN AY  +EFEFY+ D  S + L+PK   E + +A  AA K S 
Sbjct  64   IVSFLAVSLQRAIAAPLNPAYKQDEFEFYIDDLSSALALVPKGSLENDVSAVRAARKYSA  123

Query  472  PAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFN  651
                   +G E  + +      +    V      P D++L LHTSGTT RPK VPLT  N
Sbjct  124  AIAECYWNGEEVVLDVKEIGKLAAKGGVKREEPQPDDIALVLHTSGTTGRPKAVPLTHRN  183

Query  652  LASSVNNIKSVYKLTESDSTVIVLPLFHVHG  744
            L  ++ NIK  YKLTE D T++V+PLFHVHG
Sbjct  184  LIRTMKNIKETYKLTEKDRTLLVMPLFHVHG  214



>ref|WP_008061294.1| AMP-dependent synthetase [Methyloversatilis universalis]
 gb|EGK71814.1| Putative peroxisomal-coenzyme A synthetase [Methyloversatilis 
universalis FAM5]
Length=508

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 116/202 (57%), Gaps = 1/202 (0%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            A+S   + DL+   L  L+ R  + L   G+   D VA+  PN  ++   F++ I   AT
Sbjct  20   ALSAPARTDLSFGNLRALMSRTVARLNELGIGRNDRVAIVLPNGPDMASSFIS-IASGAT  78

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIAL  519
            AAPLN  Y AEEFEFYLSD  +K L++ +     A   A KL +  +    + A  D +L
Sbjct  79   AAPLNPGYRAEEFEFYLSDLNAKALVVERGSVSPAIEVAQKLGVRVIDLVANEAAGDFSL  138

Query  520  FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTE  699
             P    + + A +       DV+L LHTSGTTSRPK VPLTQ N+++S  NI++    TE
Sbjct  139  EPRDAATVAPAANGGSAQADDVALVLHTSGTTSRPKIVPLTQRNVSASAQNIRATLAFTE  198

Query  700  SDSTVIVLPLFHVHGLIAGMLS  765
             D  + ++PLFH+HGLIAG+++
Sbjct  199  KDRGLNIMPLFHIHGLIAGIMA  220



>gb|KEQ75144.1| acetyl-CoA synthetase-like protein [Aureobasidium namibiae CBS 
147.97]
Length=512

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 120/206 (58%), Gaps = 5/206 (2%)
 Frame = +1

Query  160  AISVSGKFDLT--HSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            AI V GK  LT  + +L   +      L   G+ PG  V++  PNT   ++ FLA    R
Sbjct  16   AIIVPGKEPLTISYEQLTADILSFQLKLAKLGITPGSAVSIALPNTYPFIVAFLASAWQR  75

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPKE-GNEaaqaaaaKLSIPAVTATLSGAESD  510
            A AAPLN+AY   EFEFY+ D +S ++L+P+   +  A  AA K +        +G E  
Sbjct  76   AIAAPLNSAYKQAEFEFYIDDLKSALVLVPQGLADGPAVKAATKYNAAVAECYWNGKEVV  135

Query  511  IALF-PAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVY  687
            + +      +   D   EL   P DV+L LHTSGTT RPK VPL+  NL  +++NIK+ Y
Sbjct  136  LDVKDEGKLKGKGDKPLELAQ-PDDVALVLHTSGTTGRPKAVPLSHKNLTRTMSNIKATY  194

Query  688  KLTESDSTVIVLPLFHVHGLIAGMLS  765
            +LT++D T++V+PLFHVHGL+AG L+
Sbjct  195  ELTKADRTMLVMPLFHVHGLLAGFLA  220



>gb|EYE97890.1| acetyl-CoA synthetase-like protein [Aspergillus ruber CBS 135680]
Length=512

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 120/232 (52%), Gaps = 15/232 (6%)
 Frame = +1

Query  79   LADSLSMETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRP  258
            LA S S E S L  L+     N P+  AIS        + +LH  V    + L   GV  
Sbjct  5    LARSFSSENSRLAVLVP----NKPNPLAIS--------YQQLHSHVASFQAKLAKLGVSH  52

Query  259  GDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNE  438
            G  V++   N+ E V+ FLAV   R  AAPLN AY  EEFEFY+ D  S ++LIP+   E
Sbjct  53   GAAVSIALVNSYEFVVSFLAVSWQRGIAAPLNPAYKGEEFEFYIDDLSSTLVLIPRGAYE  112

Query  439  a---aqaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSG  609
                A  A  K           G E  + +      + S  +      P D++L LHTSG
Sbjct  113  QYGPAVQAGRKYQAAIAECYWDGEEVVLDVKEEGKLAGSLGLQVEEAQPDDIALVLHTSG  172

Query  610  TTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            TT RPK VPLT  NL +++ NIK+ Y+LT  D T +V+PLFHVHGL+A  L+
Sbjct  173  TTGRPKAVPLTHNNLTTTMKNIKATYELTPEDRTYLVMPLFHVHGLLAAFLA  224



>ref|XP_007925261.1| hypothetical protein MYCFIDRAFT_210936 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME84637.1| hypothetical protein MYCFIDRAFT_210936 [Pseudocercospora fijiensis 
CIRAD86]
Length=515

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 110/196 (56%), Gaps = 3/196 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +T+ RL+  V      L A G+ PG  V++  PN+   ++ FLA    R  AAPLN AY 
Sbjct  28   ITYQRLYSDVLAFQHKLAALGISPGAAVSIALPNSYPFIVSFLAASWQRGIAAPLNPAYK  87

Query  367  aEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDS  546
              EFEFY+ D  S ++L+P+   +     AA+    AV        ++  +     +   
Sbjct  88   QREFEFYIDDLSSSLVLVPQGQADGPAEKAARKYNAAVAEVYLHPRTNEVVLDVKEKGKL  147

Query  547  DAVSELVND---PSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
            +    +  +   P D +L LHTSGTT RPK VPL+  NLA +++NIK+ YKLT  D T++
Sbjct  148  EGRGNVPFERARPEDTALVLHTSGTTGRPKAVPLSHRNLARTIHNIKNTYKLTAEDRTML  207

Query  718  VLPLFHVHGLIAGMLS  765
            ++PLFHVHGL+AG L+
Sbjct  208  IMPLFHVHGLLAGFLA  223



>ref|XP_010068214.1| PREDICTED: 4-coumarate--CoA ligase-like 10 [Eucalyptus grandis]
Length=195

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 109/185 (59%), Gaps = 13/185 (7%)
 Frame = +1

Query  109  TLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVE----------RAASSLFAAGVRP  258
            TLT LLK    +FP++RA+S   + DLTH +L  LV           R   + F    R 
Sbjct  5    TLTDLLKKATSDFPNKRAVSACEELDLTHMQLQELVNHTTALITASHRHRRAHFPQQHRG  64

Query  259  GDVVALTFPNT--VELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEG  432
              V+     N   ++ VI+F AVI  RAT APLN  Y A+  EFYLSDSE K+LL  +EG
Sbjct  65   TGVIVFLLENVFVLQFVILFPAVIHCRATVAPLNPFYIAKVLEFYLSDSEPKLLLTLQEG  124

Query  433  NEaaqaaaaKLSIPAVTATLSGAESDIALFPA-HPESDSDAVSELVNDPSDVSLFLHTSG  609
            N  AQ+AA+KL+IP +TA L  A++ I LF     E   D++S +VNDPSDV++FLHTSG
Sbjct  125  NRRAQSAASKLNIPHLTANLHFADTKITLFDQRRAEPSLDSMSTVVNDPSDVAMFLHTSG  184

Query  610  TTSRP  624
                P
Sbjct  185  AMGHP  189



>ref|WP_019915532.1| AMP-dependent synthetase [Methyloversatilis sp. FAM1]
Length=508

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 116/202 (57%), Gaps = 1/202 (0%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            A+S   + DL+   L  L+ R  + L   GV   D VA+  PN  ++   F++ I   AT
Sbjct  20   ALSAPARTDLSFGNLRALMTRTVARLNELGVGRNDRVAIVLPNGPDMASAFIS-IASGAT  78

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIAL  519
            AAPLN  Y AEEFEFYLSD  +K L++ +     A   A KL +  +    + A  D +L
Sbjct  79   AAPLNPGYRAEEFEFYLSDLNAKALVVERGSVSPAIEVAKKLGVRVIDLVANEAAGDFSL  138

Query  520  FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTE  699
             P    + + A +       DV+L LHTSGTTSRPK VPLTQ N+++S  NI++    TE
Sbjct  139  EPREAAAVAPAANGGTAQADDVALVLHTSGTTSRPKIVPLTQRNVSASAQNIRATLAFTE  198

Query  700  SDSTVIVLPLFHVHGLIAGMLS  765
             D  + ++PLFH+HGLIAG+++
Sbjct  199  KDRGLNIMPLFHIHGLIAGIMA  220



>gb|KFY62248.1| hypothetical protein V496_04674 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=1054

 Score =   119 bits (299),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 85/216 (39%), Positives = 119/216 (55%), Gaps = 21/216 (10%)
 Frame = +1

Query  160  AISVSGKFDLT--HSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            A+ + G   LT  +  L  LV    S L   G+ P   V++  PNT+E ++ FLA    R
Sbjct  128  AVIIPGPTPLTVSYGELTRLVSSFQSRLAKLGITPQSAVSIALPNTIEFIVSFLASSWQR  187

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAE  504
            A AAPLN+AY  EEFEFY+ D +S + L+PK     +  A  AA K           G +
Sbjct  188  AIAAPLNSAYKQEEFEFYIDDLKSALALVPKGEFAKDGPAVRAARKYQAAIAECYWDGNK  247

Query  505  SDIALFPAHPESDSDAVSELVN---------DPSDVSLFLHTSGTTSRPKGVPLTQFNLA  657
             ++ L       D   + +L+           P DV+L LHTSGTT RPK VPLT  NL 
Sbjct  248  REVVL-------DVKDLGKLMGKGGQYVETAQPDDVALVLHTSGTTGRPKAVPLTHRNLT  300

Query  658  SSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             ++ NI++ Y+L+ +D T++V+PLFHVHGL+AG L+
Sbjct  301  RTMKNIQATYELSPADRTMLVMPLFHVHGLLAGFLA  336



>ref|XP_011116247.1| hypothetical protein H072_10831 [Dactylellina haptotyla CBS 200.50]
 gb|EPS35722.1| hypothetical protein H072_10831 [Dactylellina haptotyla CBS 200.50]
Length=513

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 114/195 (58%), Gaps = 4/195 (2%)
 Frame = +1

Query  190  THSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayta  369
            T+++L   +E   S L + GV  G  V+++  N +E ++ FLA    RA AAPLN AY  
Sbjct  27   TYAQLGAQIEAFQSFLASVGVTTGSAVSISLVNGLEFIVSFLAATYQRAIAAPLNPAYKQ  86

Query  370  EEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPES  540
             EFEFY+ D +S ++++PK     N  A  AA K +   +      A  D+         
Sbjct  87   AEFEFYIDDIKSALVVVPKGAVAENSEAVRAARKYNA-GIAEVWVDAYGDVKFELVERGR  145

Query  541  DSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIV  720
             S A  + +  P+DV+L LHTSGTT RPK VPLT  NL +++ NIK+ Y L+ +D T +V
Sbjct  146  LSVAALKSIAQPNDVALVLHTSGTTGRPKAVPLTHKNLTTTMRNIKATYHLSPADRTYLV  205

Query  721  LPLFHVHGLIAGMLS  765
            +PLFHVHGL+AG L+
Sbjct  206  MPLFHVHGLLAGFLA  220



>ref|XP_005712061.1| unnamed protein product [Chondrus crispus]
 emb|CDF32396.1| unnamed protein product [Chondrus crispus]
Length=529

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 128/208 (62%), Gaps = 12/208 (6%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            A S S    L+H  L   +   + +L A+ + P  VVA+  PN+   V+ FLA       
Sbjct  30   APSASTPQALSHCALRSRIATFSRTLVAS-LAPQSVVAIVVPNSPHFVLSFLACTSANLV  88

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKE--GNEaaqaaaaKLSIPAVTATLSGAESDI  513
            AAPLN+AYTA+EF+FYLSD+ +  +++  +   +   +AAAA LSIPA++      + D 
Sbjct  89   AAPLNSAYTADEFQFYLSDARAAAVVVKSDLRDDAPIRAAAASLSIPAISFPDPLVDPD-  147

Query  514  ALFPAHPES--DSDAVSE--LVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKS  681
                A P+S    D ++E   +  P  ++LFLHTSGTTSRPKGVPL+  NL +S+ NI +
Sbjct  148  ----AQPDSAASDDYITEPPFIPTPDSIALFLHTSGTTSRPKGVPLSHRNLVTSIANIAA  203

Query  682  VYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             Y+LT++D  ++V+PLFHVHGL+A  L+
Sbjct  204  TYELTDADRCLLVMPLFHVHGLMAATLT  231



>ref|WP_020163214.1| AMP-dependent synthetase [Methyloversatilis universalis]
Length=508

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 116/202 (57%), Gaps = 1/202 (0%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            A+S   + DL+   L  L+ R  + L   GV   D VA+  PN  ++   F++ I   AT
Sbjct  20   ALSAPARTDLSFGNLRALMTRTVARLNELGVGRNDRVAIVLPNGPDMASAFIS-IASGAT  78

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIAL  519
            AAPLN  Y AEEFEFYLSD  +K L++ +     A   A KL +  +    + A  D +L
Sbjct  79   AAPLNPGYRAEEFEFYLSDLNAKALVVERGSVSPAIEVAKKLGVRVIDLVANEAAGDFSL  138

Query  520  FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTE  699
             P    + + A +       DV+L LHTSGTTSRPK VPLTQ N+++S  NI++    TE
Sbjct  139  EPREAAAVAPAANGGAAQADDVALVLHTSGTTSRPKIVPLTQRNVSASAQNIRATLAFTE  198

Query  700  SDSTVIVLPLFHVHGLIAGMLS  765
             D  + ++PLFH+HGLIAG+++
Sbjct  199  KDRGLNIMPLFHIHGLIAGIMA  220



>gb|KIW85880.1| hypothetical protein Z517_01273 [Fonsecaea pedrosoi CBS 271.37]
Length=517

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 103/178 (58%), Gaps = 7/178 (4%)
 Frame = +1

Query  247  GVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK  426
            G+R  D V++  PN+ E ++ FLA    RA AAPLN AY   EFEFY+ D  S ++++P+
Sbjct  50   GIRHADAVSIALPNSYEFIVSFLATSFQRAIAAPLNPAYKQSEFEFYIDDLSSAVIILPR  109

Query  427  -----EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSL  591
                 +G     A   + +I       +    D+       +  S  V+E    P DV+L
Sbjct  110  GAHARDGPAVKAARKHRAAIAECYVDGTKLVLDVKEQGCLAQRQSQPVAEA--QPEDVAL  167

Query  592  FLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             LHTSGTT RPK VPLT  NL  ++ NI++ Y+LT  D T++V+PLFHVHGL+AG LS
Sbjct  168  VLHTSGTTGRPKAVPLTHRNLTRTMQNIQNTYELTAQDRTMLVMPLFHVHGLLAGFLS  225



>ref|WP_018227876.1| AMP-dependent synthetase [Methyloversatilis universalis]
Length=508

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 116/202 (57%), Gaps = 1/202 (0%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            A+S   + DL+   L  L+ R  + L   G+   D VA+  PN  ++   F++ I   AT
Sbjct  20   ALSAPARTDLSFGNLRALMSRTVARLNELGIGRNDRVAIVLPNGPDMASSFIS-IASGAT  78

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIAL  519
            AAPLN  Y AEEFEFYLSD  +K L++ +     A   A KL +  +    + A  D +L
Sbjct  79   AAPLNPGYRAEEFEFYLSDLNAKALVVERGSVSPAIEVAQKLGVRVLDLVSNEAAGDFSL  138

Query  520  FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTE  699
             P    + + A +       DV+L LHTSGTTSRPK VPLTQ N+++S  NI++    TE
Sbjct  139  EPRDAATVAPAANGGSAQADDVALVLHTSGTTSRPKIVPLTQRNVSASAQNIRATLAFTE  198

Query  700  SDSTVIVLPLFHVHGLIAGMLS  765
             D  + ++PLFH+HGLIAG+++
Sbjct  199  KDRGLNIMPLFHIHGLIAGIMA  220



>ref|XP_007295940.1| peroxisomal-coenzyme A synthetase [Marssonina brunnea f. sp. 
'multigermtubi' MB_m1]
 gb|EKD13850.1| peroxisomal-coenzyme A synthetase [Marssonina brunnea f. sp. 
'multigermtubi' MB_m1]
Length=516

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 102/176 (58%), Gaps = 3/176 (2%)
 Frame = +1

Query  247  GVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK  426
            GV P   V++  PNT E ++ FLA    R  AAPLN+AY  EEFEFY+ D +S + L+PK
Sbjct  50   GVTPQAAVSIALPNTYEFIVAFLASAWQRGIAAPLNSAYRQEEFEFYIDDLKSAVALVPK  109

Query  427  ---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFL  597
                 + AA  AA + S        +G+E  + +                  P D++L L
Sbjct  110  GSYAKDGAAVRAARRYSAAVAECYWNGSEVVLDVKEEGKLKGKGNQKVETARPDDIALVL  169

Query  598  HTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            HTSGTT RPK VPLT  NL  ++ NIK+ Y LT +D T++V+PLFHVHGL+AG L+
Sbjct  170  HTSGTTGRPKAVPLTHKNLTRTMKNIKATYDLTPADRTMLVMPLFHVHGLLAGFLA  225



>gb|EEH21927.2| hypothetical protein PABG_04138 [Paracoccidioides brasiliensis 
Pb03]
Length=512

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 117/211 (55%), Gaps = 7/211 (3%)
 Frame = +1

Query  133  VAGNFP--SRRAISVSGK--FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVEL  300
            +A +FP  +  AI V GK    +++ RL   V    + L   G+ PG  V++   N+ E 
Sbjct  4    LANSFPDNTSTAIIVPGKPPVLISYQRLCSDVLSFQARLANLGILPGAAVSIALTNSYEF  63

Query  301  VIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSI  471
            ++ FLAV   RA AAPLN AY  +EFEFY+ D  S + L+PK   E + +A  AA K S 
Sbjct  64   IVSFLAVSLQRAIAAPLNPAYKQDEFEFYIDDLSSALALVPKGSLENDVSAVRAARKYSA  123

Query  472  PAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFN  651
                   +G E  + +      +    V      P D++L LHTSGTT RPK VPLT  N
Sbjct  124  AIAECYWNGEEVVLDVKEIGKLAAKGGVKREEPQPDDIALVLHTSGTTGRPKAVPLTHRN  183

Query  652  LASSVNNIKSVYKLTESDSTVIVLPLFHVHG  744
            L  ++ NIK  YKLTE D T++V+PLFHVHG
Sbjct  184  LIRTMKNIKETYKLTEKDRTLLVMPLFHVHG  214



>ref|XP_009649893.1| peroxisomal-coenzyme A synthetase [Verticillium dahliae VdLs.17]
 gb|EGY13539.1| peroxisomal-coenzyme A synthetase [Verticillium dahliae VdLs.17]
Length=517

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 117/202 (58%), Gaps = 22/202 (11%)
 Frame = +1

Query  205  HHLVERAAS---SLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEE  375
            + L++  AS    L A G+  G  V++   N+ E +I FLA    R  AAPLN AY  +E
Sbjct  32   NDLIKETASFQQKLAAIGITKGAPVSIATVNSYEFIISFLAASWQRGIAAPLNPAYKQDE  91

Query  376  FEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDS  546
            FEFY+ D +S ++L+P+   + N  A  AA K +          ++ ++AL       D 
Sbjct  92   FEFYIEDVKSAIVLVPRGAYQSNAPAVKAAKKFNAAIAETYWDASKKEVAL-------DV  144

Query  547  DAVSELVN---------DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTE  699
              + +L           +PSDV+L LHTSGTTSRPK VPLT  NL  +++NI+  Y+LT+
Sbjct  145  KELGQLQGKPKEQILKPEPSDVALVLHTSGTTSRPKVVPLTHANLTRTMSNIQKTYELTD  204

Query  700  SDSTVIVLPLFHVHGLIAGMLS  765
             D T++V+PLFHVHGL+ G+L+
Sbjct  205  KDRTMLVMPLFHVHGLLCGLLA  226



>gb|EIE84401.1| hypothetical protein RO3G_09111 [Rhizopus delemar RA 99-880]
Length=1254

 Score =   119 bits (297),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 75/178 (42%), Positives = 115/178 (65%), Gaps = 10/178 (6%)
 Frame = +1

Query  256  PGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK---  426
            PG  +++++PN++E  + FLA   +   A+PLN AYT +EF FYL D++S +L++P+   
Sbjct  786  PGRSISISYPNSLEFAVSFLASTFMNLVASPLNPAYTEDEFNFYLEDAKSSVLILPRGSL  845

Query  427  -EGNEaaqaaaaKLSIPAVTATLSGAESDI-ALFPAHPESDSDA---VSELVNDPSDVSL  591
             + N  A  AA K  +  V    +G+E ++ A+ P  P+ +  A   ++  +  P + +L
Sbjct  846  AKKNNPAVLAAQKQKVFVVEIHWNGSELEMNAVVP--PQFNQQARRKINGFIPKPDEPAL  903

Query  592  FLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             LHTSGTT RPKGVPLT  NL +S+ NI + Y+L + D T++V+PLFHVHGLI G+LS
Sbjct  904  LLHTSGTTGRPKGVPLTHLNLLTSMRNIVNTYELNKQDCTLLVMPLFHVHGLICGLLS  961



>gb|KEQ98157.1| hypothetical protein AUEXF2481DRAFT_26553 [Aureobasidium subglaciale 
EXF-2481]
Length=512

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 115/205 (56%), Gaps = 3/205 (1%)
 Frame = +1

Query  160  AISVSGKFDLT--HSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            AI V GK  LT  + +L   +      L   G+  GD V++  PN+   ++ FLAV   R
Sbjct  16   AIIVPGKSPLTVSYEQLTADILSFQLKLAKLGITAGDAVSIAVPNSYPFIVAFLAVAWQR  75

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPKE-GNEaaqaaaaKLSIPAVTATLSGAESD  510
            A AAPLN AY   EFEFY+ D +S ++L+P+   +  A  AA K          +G E  
Sbjct  76   AIAAPLNPAYKQSEFEFYIDDLKSSLVLVPQGLADGPAVKAATKYKAAVAECYWNGKEVV  135

Query  511  IALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYK  690
            + +            S     P DV+L LHTSGTT RPK VPL+  NL  +++NIK+ Y 
Sbjct  136  LDIKHEGKLKGKGNKSLEYAQPDDVALVLHTSGTTGRPKAVPLSHKNLTRTMSNIKATYD  195

Query  691  LTESDSTVIVLPLFHVHGLIAGMLS  765
            LT++D T++V+PLFHVHGL+AG L+
Sbjct  196  LTKADRTMLVMPLFHVHGLLAGFLA  220



>gb|KEZ38752.1| putative peroxisomal-coenzyme A synthetase [Scedosporium apiospermum]
Length=513

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 114/203 (56%), Gaps = 17/203 (8%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +T+S ++  + +  + L   G++ G  V++   N+ E ++ FLA    RA AAPLN  Y 
Sbjct  29   VTYSGINAEIAKFQAKLADLGIKTGAPVSIALVNSYEFIVSFLATSWQRAIAAPLNPGYK  88

Query  367  aEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             +EFEFY+ D +S ++L+PK     N  A  AA +            A+ ++AL      
Sbjct  89   QDEFEFYIDDVKSALVLVPKGAVAQNTPAVRAARRFKAAIAECYWDAAKGEVAL------  142

Query  538  SDSDAVSELVN-------DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLT  696
             D     +L          P DV+L LHTSGTTSRPK VPLT  NL  ++ NI+  Y+LT
Sbjct  143  -DVKDQGQLRGRQPVQEPQPDDVALVLHTSGTTSRPKVVPLTHRNLTRTMKNIQQTYQLT  201

Query  697  ESDSTVIVLPLFHVHGLIAGMLS  765
             +D T++V+PLFHVHGL+ G+L+
Sbjct  202  SADRTMLVMPLFHVHGLLCGLLA  224



>gb|KFH45079.1| putative peroxisomal-coenzyme A synthetase-like protein [Acremonium 
chrysogenum ATCC 11550]
Length=516

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 109/205 (53%), Gaps = 7/205 (3%)
 Frame = +1

Query  148  PSRRAISVSGK---FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLA  318
            PS  A+ V  K     +T+S L     R    L A G+     V++  PNT E ++ FLA
Sbjct  13   PSATAVIVPSKPHALTVTYSSLASQTSRFQQQLAALGITRASPVSIALPNTWEFIVAFLA  72

Query  319  VIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTAT  489
                R  AAPLN AY  +EFEFY+SD ES ++L+P+   +    +  AA K +       
Sbjct  73   ASWQRGIAAPLNPAYKQDEFEFYISDIESAIVLVPRGAWDAGAPSVKAAQKFNAAVAECY  132

Query  490  LSGAESDIALFPAHPESDSDAVSELVN-DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSV  666
              G   ++ L    P        +++   P D +L LHTSGTTSRPK VPLT  NL  ++
Sbjct  133  WDGRRGEVVLDVKDPGKLRGKYEKVLKAQPDDAALILHTSGTTSRPKVVPLTHRNLTRTM  192

Query  667  NNIKSVYKLTESDSTVIVLPLFHVH  741
             NIK  Y+LT  D T++V+PLFHVH
Sbjct  193  KNIKETYQLTPKDRTMLVMPLFHVH  217



>ref|XP_003848177.1| hypothetical protein MYCGRDRAFT_77337 [Zymoseptoria tritici IPO323]
 gb|EGP83153.1| hypothetical protein MYCGRDRAFT_77337 [Zymoseptoria tritici IPO323]
Length=516

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 114/208 (55%), Gaps = 23/208 (11%)
 Frame = +1

Query  181  FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaa  360
             ++++ +LH  V +    L   G+ PG  V++  PN+   ++ FLA    R  AAPLN A
Sbjct  25   LEISYKQLHADVLKFQHKLAKLGITPGAAVSIALPNSYPFIVAFLAAAWQRGIAAPLNPA  84

Query  361  ytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTAT--LSGAESDIALFPAHP  534
            Y   EFEFY+ D  S ++L+P+           +   PAV A    + A ++  L P   
Sbjct  85   YKQSEFEFYIDDLSSALVLVPQ----------GQADGPAVKAAKRYNAAVAECYLHPLTH  134

Query  535  E-----SDSDAVSELVN------DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKS  681
            E      D   +S   N       P D +L LHTSGTT RPK VPL+  NL  +++NI++
Sbjct  135  EVVLDIKDQGKLSGRGNVAVEKAQPEDTALVLHTSGTTGRPKAVPLSHRNLTRTMSNIQN  194

Query  682  VYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             Y+L+ +D T++V+PLFHVHGL+AG L+
Sbjct  195  TYQLSSADRTMLVMPLFHVHGLLAGFLA  222



>emb|CEG67836.1| Putative YBR222Cp-like protein (Fragment) [Rhizopus microsporus]
Length=528

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 117/197 (59%), Gaps = 12/197 (6%)
 Frame = +1

Query  202  LHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFE  381
            +H    + ++ + A+ + PG  +++++PN++E V+ FL    +   A+PLN AYT +EF 
Sbjct  42   IHDFSNKLSNLVPASYLEPGRSISISYPNSLEFVVAFLGSTFMNLMASPLNPAYTEDEFN  101

Query  382  FYLSDSESKMLLIPK----EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESD--  543
            FYL D++S +L++PK    +    A  AA K  +  V    +G++ +I    AH  S+  
Sbjct  102  FYLEDAKSSVLVLPKGALNQEKNPAILAAKKQDVFVVEMHWNGSQMEIN---AHAPSEFS  158

Query  544  ---SDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTV  714
                  +      P + +L LHTSGTT RPKGVPLT  NL +S+ NI + Y+L   D T+
Sbjct  159  QQPHRQIHSFNPKPDEPALLLHTSGTTGRPKGVPLTHLNLVTSMRNITNTYELNTQDRTL  218

Query  715  IVLPLFHVHGLIAGMLS  765
            +V+PLFHVHGLI G+LS
Sbjct  219  LVMPLFHVHGLICGLLS  235



>ref|WP_028097565.1| AMP-dependent synthetase [Dongia sp. URHE0060]
Length=504

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 130/224 (58%), Gaps = 11/224 (5%)
 Frame = +1

Query  100  ETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALT  279
            E +T+  LL+   GN  +  AI    +  +    L  LV++   +L A GV P D VA+ 
Sbjct  3    EVTTVAELLRR--GNDKAE-AIGAPERRSMMRGELVTLVDQVGGALRAVGVGPQDPVAIV  59

Query  280  FPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaa  459
             PN  E+   FLAV    ATAAPLNAAY  +EF+FYL D ++K L+I    +  A+A AA
Sbjct  60   MPNGPEMATAFLAVAS-SATAAPLNAAYREDEFDFYLEDLQAKALIIQSGSDSPARAVAA  118

Query  460  KLSIPAV--TATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            +  I  +  T  L+G      L  + P +D+    ++  DP  V+L LHTSGTTSRPK V
Sbjct  119  RRGIRVIELTPDLNGPAGAFTL--SVPFADA---GQMRPDPDHVALVLHTSGTTSRPKIV  173

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PL Q NLA+S  +I     LT +D +++++PLFH+HGLI  +LS
Sbjct  174  PLRQRNLAASARHIAQTLALTPADRSLVIMPLFHIHGLIGALLS  217



>gb|EEQ87229.1| coenzyme A synthetase [Blastomyces dermatitidis ER-3]
 gb|EGE86689.1| peroxisomal-coenzyme A synthetase [Blastomyces dermatitidis ATCC 
18188]
 gb|EQL35314.1| hypothetical protein BDFG_03053 [Blastomyces dermatitidis ATCC 
26199]
Length=513

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 113/204 (55%), Gaps = 12/204 (6%)
 Frame = +1

Query  160  AISVSGK---FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRV  330
            AI V GK     +++ RL   V    + L   G+ PG  V++  PN+   ++ FLA    
Sbjct  15   AIIVPGKPEPLTISYQRLRSDVNSFQTKLAKLGISPGAAVSIALPNSYGFIVSFLAASWQ  74

Query  331  RataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGA  501
            RA AAPLN AY  EEFEFY+ D  S + L+P+     +  A  AA K S        +G 
Sbjct  75   RAIAAPLNPAYKQEEFEFYIDDLSSALTLVPRGSFASDGPAVRAARKYSAAIAECYWNG-  133

Query  502  ESDIAL-FPAHPE--SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNN  672
             SD+ L    H +     D   E V  P DV+L LHTSGTT RPK VPLT  NL  ++ N
Sbjct  134  -SDVVLDVKEHGKLVGKGDLKKE-VAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKN  191

Query  673  IKSVYKLTESDSTVIVLPLFHVHG  744
            I++ Y+LTE D T++V+PLFHVHG
Sbjct  192  IQATYELTEKDRTLLVMPLFHVHG  215



>ref|XP_002622738.1| coenzyme A synthetase [Blastomyces dermatitidis SLH14081]
 gb|EEQ71863.1| coenzyme A synthetase [Blastomyces dermatitidis SLH14081]
Length=513

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 113/204 (55%), Gaps = 12/204 (6%)
 Frame = +1

Query  160  AISVSGK---FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRV  330
            AI V GK     +++ RL   V    + L   G+ PG  V++  PN+   ++ FLA    
Sbjct  15   AIIVPGKPEPLTISYQRLRSDVNSFQTKLAKLGISPGAAVSIALPNSYGFIVSFLAASWQ  74

Query  331  RataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGA  501
            RA AAPLN AY  EEFEFY+ D  S + L+P+     +  A  AA K S        +G 
Sbjct  75   RAIAAPLNPAYKQEEFEFYIDDLSSALTLVPRGSFASDGPAVRAARKYSAAIAECYWNG-  133

Query  502  ESDIAL-FPAHPE--SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNN  672
             SD+ L    H +     D   E V  P DV+L LHTSGTT RPK VPLT  NL  ++ N
Sbjct  134  -SDVVLDVKEHGKLVGKGDLKKE-VAQPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMKN  191

Query  673  IKSVYKLTESDSTVIVLPLFHVHG  744
            I++ Y+LTE D T++V+PLFHVHG
Sbjct  192  IQATYELTEKDRTLLVMPLFHVHG  215



>ref|XP_002790366.1| 4-coumarate-CoA ligase [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH37384.1| 4-coumarate-CoA ligase [Paracoccidioides sp. 'lutzii' Pb01]
Length=512

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 116/211 (55%), Gaps = 7/211 (3%)
 Frame = +1

Query  133  VAGNFP--SRRAISVSGKFD--LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVEL  300
            +A +FP  +  AI V GK    +++ RL   V    + L   G+ PG  V++   N+ E 
Sbjct  4    LANSFPDNTSTAIIVPGKLPVLISYQRLCSDVLSFQAKLAKLGISPGAAVSIALTNSYEF  63

Query  301  VIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKE--GNEa-aqaaaaKLSI  471
            ++ FLAV   RA AAPLN AY  +EFEFY+ D  S + L+PK   GN+  A  AA K S 
Sbjct  64   IVSFLAVSLQRAIAAPLNPAYKQDEFEFYIDDLSSALALVPKGSLGNDVPAVRAARKYSA  123

Query  472  PAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFN  651
                   +G E  + +      +           P D++L LHTSGTT RPK VPLT  N
Sbjct  124  AIAECYWNGEEVVLDVKEIGKLAAKGGFKREEPRPDDIALVLHTSGTTGRPKAVPLTHRN  183

Query  652  LASSVNNIKSVYKLTESDSTVIVLPLFHVHG  744
            L  ++ NIK  YKLTE D T++V+PLFHVHG
Sbjct  184  LIRTMENIKETYKLTERDRTLLVMPLFHVHG  214



>ref|XP_007778156.1| hypothetical protein W97_02064 [Coniosporium apollinis CBS 100218]
 gb|EON62839.1| hypothetical protein W97_02064 [Coniosporium apollinis CBS 100218]
Length=516

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 110/196 (56%), Gaps = 3/196 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++ +L   V      L A G+ P   V++  PN+ E ++ FLA    R  AAPLN AY 
Sbjct  28   ISYQQLSAEVSSFQKKLAALGIAPESAVSIALPNSYEFIVAFLAASWQRGIAAPLNPAYK  87

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
              EFEFY+ D  S + L+PK   + + AA  AA K          +G E  + +      
Sbjct  88   QSEFEFYIDDLSSAVALVPKGAFKEDAAAVRAARKYKAAIAECYWNGKEVVLDVKDKGKL  147

Query  538  SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
            +  +  +     P DV+L LHTSGTT RPK VPLT  NL+ ++ NI++ Y L+ SD T++
Sbjct  148  AGKENRTVEQAQPDDVALVLHTSGTTGRPKAVPLTHRNLSRTMKNIQATYDLSSSDRTLL  207

Query  718  VLPLFHVHGLIAGMLS  765
            V+PLFHVHGL+AG L+
Sbjct  208  VMPLFHVHGLLAGFLA  223



>gb|KJX96446.1| peroxisomal-coenzyme a synthetase like protein [Zymoseptoria 
brevis]
Length=516

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 114/208 (55%), Gaps = 23/208 (11%)
 Frame = +1

Query  181  FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaa  360
             ++++ +LH  V +    L   G+ PG  V++  PN+   ++ FLA    R  AAPLN A
Sbjct  25   LEISYKQLHADVLKFQHKLAKLGITPGAAVSIALPNSYPFIVAFLAAAWQRGIAAPLNPA  84

Query  361  ytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTAT--LSGAESDIALFPAHP  534
            Y   EFEFY+ D  S ++L+P+           +   PAV A    + A ++  L P   
Sbjct  85   YKQSEFEFYIDDLSSALVLVPQ----------GQADGPAVKAAKKYNAAVAECYLHPLTH  134

Query  535  E-----SDSDAVSELVN------DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKS  681
            E      D   +S   N       P D +L LHTSGTT RPK VPL+  NL  +++NI++
Sbjct  135  EVVLDIKDRGKLSGRGNVAVEKAQPEDTALVLHTSGTTGRPKAVPLSHRNLTRTMSNIQN  194

Query  682  VYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             Y+L+ +D T++V+PLFHVHGL+AG L+
Sbjct  195  TYQLSSADRTMLVMPLFHVHGLLAGFLA  222



>gb|KIV88538.1| hypothetical protein PV10_08214 [Exophiala mesophila]
Length=517

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 116/204 (57%), Gaps = 19/204 (9%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++S+L   +      L   G++ GD V++  PNT E ++ FLA    RA AAPLN AY 
Sbjct  30   ISYSQLSSDITGLQGQLAQLGIQHGDAVSIALPNTYEFIVSFLATSYQRAIAAPLNPAYK  89

Query  367  aEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTAT--LSGAESDIALFPAHPES  540
             +EFEFY+ D  S ++++P+        + AK+  PAV A    + A +++ L  +    
Sbjct  90   QDEFEFYIEDLSSAIVIVPQ-------GSYAKVG-PAVRAARRFNAAIAELYLKGSQLVL  141

Query  541  DSDAVSELVN---------DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKL  693
            D     +L           +P DV+L LHTSGTT RPK VPLT  NL  ++ NI+  Y+L
Sbjct  142  DVKEKGKLAKRQPQALARAEPEDVALVLHTSGTTGRPKAVPLTHRNLTRTMANIRDTYEL  201

Query  694  TESDSTVIVLPLFHVHGLIAGMLS  765
            T  D T +V+PLFHVHGL+AG L+
Sbjct  202  TAQDRTYLVMPLFHVHGLLAGFLA  225



>gb|KEQ86365.1| acetyl-CoA synthetase-like protein [Aureobasidium pullulans EXF-150]
Length=512

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 1/174 (1%)
 Frame = +1

Query  247  GVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK  426
            G+ P   V++  PNT   ++ FLA    R  AAPLN AY   EFEFY+ D +S ++L+P+
Sbjct  47   GITPASAVSIALPNTYPFIVAFLATAWQRGIAAPLNPAYKQSEFEFYIDDLKSALVLVPQ  106

Query  427  E-GNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHT  603
               +  A  AA K +        +G E  + +            S     P DV+L LHT
Sbjct  107  GLADGPAVKAAQKYNAAVAECYWNGKEVVLDIKDEGKLKGKGKKSIEYAQPDDVALVLHT  166

Query  604  SGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            SGTT RPK VPL+  NL  +++NIK+ Y+LT +D T++V+PLFHVHGL+AG L+
Sbjct  167  SGTTGRPKAVPLSHKNLTRTMSNIKATYELTSADRTMLVMPLFHVHGLLAGFLA  220



>emb|CCX05949.1| Similar to Putative peroxisomal-coenzyme A synthetase; acc. no. 
O74976 [Pyronema omphalodes CBS 100304]
Length=513

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 113/196 (58%), Gaps = 3/196 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++  L+ L+      L + G+  G  V++  PN +E ++ FL V   R+ AAPLN AY 
Sbjct  29   ISYEHLNRLIVGFQERLASFGINAGSAVSIALPNNLEFIVSFLGVAAQRSIAAPLNPAYK  88

Query  367  aEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
              EFEFY+ D +S ++++P+   + N  A  AAA+             +  IAL    P 
Sbjct  89   QSEFEFYIDDIKSALVIVPRGAVKANAPAVRAAARYGAAVAETWWCPRQDKIALELLVPG  148

Query  538  SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
            +   +   +  +P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ YKL+  D T +
Sbjct  149  NLKGSAPVVTAEPDDVALVLHTSGTTGRPKAVPLTHRNLTRTMENIRNTYKLSPQDRTYL  208

Query  718  VLPLFHVHGLIAGMLS  765
            V+PLFHVHGL+AG L+
Sbjct  209  VMPLFHVHGLLAGFLA  224



>ref|XP_008714115.1| hypothetical protein HMPREF1541_01533 [Cyphellophora europaea 
CBS 101466]
 gb|ETN42379.1| hypothetical protein HMPREF1541_01533 [Cyphellophora europaea 
CBS 101466]
Length=512

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 123/227 (54%), Gaps = 15/227 (7%)
 Frame = +1

Query  106  STLTGLLKHVAGN----FPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVA  273
            STL+    H +G      PS  A++VS      + +L   ++     L   G+  G  V+
Sbjct  3    STLSSSFSHTSGQTAVIIPSEPALTVS------YKQLDSDIQSFRKQLAELGIGHGAAVS  56

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEG---NEaa  444
            +   N+ E ++ FLA    RA AAPLN AY  +EFEFY+ D  S ++L+PK     NE +
Sbjct  57   IALINSYEFIVAFLATAYQRAIAAPLNPAYKQDEFEFYIDDLSSSLILVPKGAFAKNEPS  116

Query  445  qaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRP  624
              AA K         L G++  + +      +   A+  L   P+D +L LHTSGTT RP
Sbjct  117  IRAARKYGATIAECYLDGSKVILDVKETKKRATPQAL--LTAQPNDTALVLHTSGTTGRP  174

Query  625  KGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            K VPL+  NL  +++NI+  Y L+ +D T +V+PLFHVHGL+AG L+
Sbjct  175  KAVPLSHRNLTRTMHNIQHTYDLSPADRTYLVMPLFHVHGLLAGFLA  221



>gb|KIX04662.1| hypothetical protein Z518_05532 [Rhinocladiella mackenziei CBS 
650.93]
Length=516

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 125/228 (55%), Gaps = 20/228 (9%)
 Frame = +1

Query  100  ETSTLTGLLKHVAGNFPSR-RAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVAL  276
            ETST T ++       PS+  A+++S      + RL   +    + L   G+R  D V++
Sbjct  12   ETSTATAII------VPSKPNALTIS------YKRLTQDILDFQTKLAHLGIRHADAVSI  59

Query  277  TFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK--EGNEaaqa  450
              PN+ E ++ FLA    RA AAPLN +Y   EFEFY+ D  S + ++PK     E A  
Sbjct  60   ALPNSYEFIVSFLATSFQRAIAAPLNPSYKQNEFEFYIEDLSSAVSILPKGSWSKEGAAV  119

Query  451  aaaKLSIPAVTATLSGAES---DIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSR  621
             AA+    A+       E    D+       +  S  V++   DP DV+L LHTSGTT R
Sbjct  120  RAARKYNAAIAECYMDGEKLVLDVKEQGQLAQRQSQLVAQA--DPEDVALVLHTSGTTGR  177

Query  622  PKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PK VPLT  NL  ++ NI++ Y+LT  D T++V+PLFHVHGL+AG L+
Sbjct  178  PKAVPLTHRNLTRTMLNIQNTYELTPGDRTMLVMPLFHVHGLLAGFLA  225



>emb|CEI87857.1| Putative YBR222Cp-like protein (Fragment) [Rhizopus microsporus]
Length=528

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 117/197 (59%), Gaps = 12/197 (6%)
 Frame = +1

Query  202  LHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFE  381
            +H    + ++ + A+ + PG  +++++PN++E V+ FL    +   A+PLN AYT +EF 
Sbjct  42   IHDFSNKLSNLVPASYLEPGRSISISYPNSLEFVVAFLGSTFMNLIASPLNPAYTEDEFN  101

Query  382  FYLSDSESKMLLIPK----EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESD--  543
            FYL D++S +L++PK    +    A  AA K  +  V    +G++ +I    AH  S+  
Sbjct  102  FYLEDAKSSVLVLPKGTLNQEKNPAILAAKKQGVFVVEMHWNGSQMEIN---AHAPSEFS  158

Query  544  ---SDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTV  714
                  +      P + +L LHTSGTT RPKGVPLT  NL +S+ NI + Y+L   D T+
Sbjct  159  QQPHRQIHSFNPKPDEPALLLHTSGTTGRPKGVPLTHLNLVTSMRNIINTYELNTQDRTL  218

Query  715  IVLPLFHVHGLIAGMLS  765
            +V+PLFHVHGLI G+LS
Sbjct  219  LVMPLFHVHGLICGLLS  235



>gb|KHJ32714.1| putative peroxisomal-coenzyme a synthetase [Erysiphe necator]
Length=521

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 99/176 (56%), Gaps = 3/176 (2%)
 Frame = +1

Query  247  GVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK  426
            GV     V++ FPN+ E VI FLA    RA AAPLN  Y  EEFEFY+ D  S +LL+PK
Sbjct  55   GVTVESAVSIAFPNSYEFVISFLASTSQRAIAAPLNPQYKQEEFEFYIGDLNSTLLLVPK  114

Query  427  ---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFL  597
               + N  A  AA   +        +G E  + L      +           P+D++L L
Sbjct  115  GSFDRNTPAVRAARNFNTAIAECYWNGREMILDLKDGGKLNGKGNQKIERARPNDIALIL  174

Query  598  HTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            HTSGTT RPK VPLT  NL  S+ NI++ Y LT  D + +V+PLFHVHGL+AG L+
Sbjct  175  HTSGTTGRPKAVPLTHRNLIKSMKNIRTTYALTSHDRSFLVMPLFHVHGLLAGFLA  230



>gb|ENH76437.1| peroxisomal-coenzyme a synthetase [Colletotrichum orbiculare 
MAFF 240422]
Length=517

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 114/212 (54%), Gaps = 19/212 (9%)
 Frame = +1

Query  166  SVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataa  345
            S SG  ++T+  L          L A G+  G  V++   N+ E ++ FLA    R  AA
Sbjct  22   SKSGALNVTYGDLVRETANFQGKLAAIGITRGSPVSIATVNSYEFIVSFLAASWQRGIAA  81

Query  346  plnaaytaEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESDIA  516
            PLN AY  +EFEFY+ D +S ++L+PK        A  AA K +          A+ ++A
Sbjct  82   PLNPAYKQDEFEFYIDDVKSAIVLVPKGAYAAGAPAVKAAQKFNAAVAETYWDAAKKEVA  141

Query  517  LFPAHPESDSDAVSELVN---------DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVN  669
            L       D   + +L           D  DV+L LHTSGTTSRPK VPLT  NL  ++ 
Sbjct  142  L-------DVKELGQLKGKGPEQVLKADADDVALVLHTSGTTSRPKVVPLTHRNLTRTMK  194

Query  670  NIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            NI++ Y+LT  D T++V+PLFHVHGL+ G+L+
Sbjct  195  NIQNTYQLTNKDRTMLVMPLFHVHGLLCGLLA  226



>emb|CAK47898.1| unnamed protein product [Aspergillus niger]
Length=515

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 112/196 (57%), Gaps = 3/196 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++ +LH+ +    + L   GV  G  V+L   N+ E ++ FLA    RA AAPLN AY 
Sbjct  28   ISYQQLHNHIADFQAKLARLGVTHGAAVSLALINSYEFIVAFLAASWQRAIAAPLNPAYK  87

Query  367  aEEFEFYLSDSESKMLLIPKEGN-EaaqaaaaKLSIPAVTATLSGAESDIAL-FPAHPES  540
             EEFEFY+ D  S +LLIPK    +   A  A     A  A      S+I L    H + 
Sbjct  88   QEEFEFYIDDLSSTLLLIPKGSYIKDGPAVRAGRKYQAAIAECYWNGSEIVLDVKEHGKL  147

Query  541  DSDAVSELVN-DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
              +  +++    P D++L LHTSGTT RPK VPLT  NL +++ NI++ Y LT +D T +
Sbjct  148  AGNGGADIQEAQPDDIALVLHTSGTTGRPKAVPLTHKNLTTTMRNIQATYNLTPADRTYL  207

Query  718  VLPLFHVHGLIAGMLS  765
            V+PLFHVHGL+A  L+
Sbjct  208  VMPLFHVHGLLAAFLA  223



>dbj|GAA82618.1| coenzyme A synthetase [Aspergillus kawachii IFO 4308]
Length=512

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 113/196 (58%), Gaps = 3/196 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++ +LH+ +    + L   GV  G  V+L   N+ E ++ FLA    RA AAPLN AY 
Sbjct  28   ISYQQLHNHIADFQAKLARLGVTHGAAVSLALINSYEFIVAFLAASWQRAIAAPLNPAYK  87

Query  367  aEEFEFYLSDSESKMLLIPKEGN-EaaqaaaaKLSIPAVTATLSGAESDIAL-FPAHPES  540
             EEFEFY+ D  S +LLIPK    +   A  A     A  A      S+I L    H + 
Sbjct  88   QEEFEFYIDDLSSTLLLIPKGSYIKDGPAVRAGRKYQAAIAECYWNGSEIVLDVKEHGKL  147

Query  541  DSDAVSELV-NDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
              +  +++  + P D++L LHTSGTT RPK VPLT  NL +++ NI++ Y LT +D T +
Sbjct  148  AGNGGTDIQESQPDDIALVLHTSGTTGRPKAVPLTHKNLTTTMRNIQATYNLTPADRTYL  207

Query  718  VLPLFHVHGLIAGMLS  765
            V+PLFHVHGL+A  L+
Sbjct  208  VMPLFHVHGLLAAFLA  223



>gb|KIW67249.1| hypothetical protein PV04_06514 [Capronia semiimmersa]
Length=517

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 105/178 (59%), Gaps = 7/178 (4%)
 Frame = +1

Query  247  GVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK  426
            G+  GD V++  PN+ E ++ FLA    RA AAPLN AY   EFEFY+ D  S ++++P+
Sbjct  50   GIPSGDAVSIALPNSYEFIVSFLATAFQRAIAAPLNPAYKQSEFEFYIEDLSSAVIILPQ  109

Query  427  EG---NEaaqaaaaKLSIPAVTATLSGAES--DIALFPAHPESDSDAVSELVNDPSDVSL  591
                 +  A  AA K +       L+GA    D+       +  S  V+     P DV+L
Sbjct  110  GAYAKDGPAVKAARKYNTAIAECYLNGASLILDVKEQGKLAQRQSQPVARA--QPEDVAL  167

Query  592  FLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             LHTSGTT RPK VPLT  NL  ++ NI++ Y+LT  D T++V+PLFHVHGL+AG L+
Sbjct  168  VLHTSGTTGRPKAVPLTHRNLTKTMQNIRNTYELTPQDRTMLVMPLFHVHGLLAGFLA  225



>ref|XP_001401502.2| peroxisomal-coenzyme A synthetase [Aspergillus niger CBS 513.88]
 gb|EHA20423.1| hypothetical protein ASPNIDRAFT_190481 [Aspergillus niger ATCC 
1015]
Length=512

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 112/196 (57%), Gaps = 3/196 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++ +LH+ +    + L   GV  G  V+L   N+ E ++ FLA    RA AAPLN AY 
Sbjct  28   ISYQQLHNHIADFQAKLARLGVTHGAAVSLALINSYEFIVAFLAASWQRAIAAPLNPAYK  87

Query  367  aEEFEFYLSDSESKMLLIPKEGN-EaaqaaaaKLSIPAVTATLSGAESDIAL-FPAHPES  540
             EEFEFY+ D  S +LLIPK    +   A  A     A  A      S+I L    H + 
Sbjct  88   QEEFEFYIDDLSSTLLLIPKGSYIKDGPAVRAGRKYQAAIAECYWNGSEIVLDVKEHGKL  147

Query  541  DSDAVSELVN-DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
              +  +++    P D++L LHTSGTT RPK VPLT  NL +++ NI++ Y LT +D T +
Sbjct  148  AGNGGADIQEAQPDDIALVLHTSGTTGRPKAVPLTHKNLTTTMRNIQATYNLTPADRTYL  207

Query  718  VLPLFHVHGLIAGMLS  765
            V+PLFHVHGL+A  L+
Sbjct  208  VMPLFHVHGLLAAFLA  223



>gb|EPE05667.1| peroxisomal-coenzyme a synthetase [Ophiostoma piceae UAMH 11346]
Length=517

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 117/206 (57%), Gaps = 4/206 (2%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            A + S   D+++  L   V R  + L A G+  G  V++   N+ E ++ FLA    R  
Sbjct  22   ATASSPALDISYLDLVSEVSRYQAKLAALGIGRGAPVSIATVNSYEFIVAFLAAAWQRGI  81

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESD  510
            AAPLN AY  +EFEFY+ D +S ++L+P+     +  A  AA K +     +  S    +
Sbjct  82   AAPLNPAYKQDEFEFYIEDVKSAIVLVPRGAYAADAPAVRAARKFNAAIAESYWSAERGE  141

Query  511  IAL-FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVY  687
            + L      + +S     L   P DV+L LHTSGTTSRPK VPLT  NL  ++ NI+  Y
Sbjct  142  VVLDVKESGKLNSGPQPTLWPKPHDVALVLHTSGTTSRPKVVPLTHRNLTVTMKNIQDTY  201

Query  688  KLTESDSTVIVLPLFHVHGLIAGMLS  765
            KLT +D T++V+PLFHVHGL+ G+L+
Sbjct  202  KLTAADRTMLVMPLFHVHGLLCGLLA  227



>gb|EKG21405.1| AMP-dependent synthetase/ligase [Macrophomina phaseolina MS6]
Length=515

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 114/215 (53%), Gaps = 21/215 (10%)
 Frame = +1

Query  148  PSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIR  327
            P + A+SVS      + +L   V      L A G+ P   V++  PN+ E ++ FLA   
Sbjct  21   PGKPALSVS------YRQLSAEVASFQRKLAALGITPASAVSIALPNSYEFIVSFLAASW  74

Query  328  VRataaplnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSG  498
             RA AAPLN AY   EFEFY+ D  S + L+PK     +  A  AA K          +G
Sbjct  75   QRAIAAPLNPAYKQSEFEFYIDDLSSAVALVPKGQFAQDSPAVRAARKYQAAIAECYWNG  134

Query  499  AESDIALFPAHPESDSDAVSELVND------PSDVSLFLHTSGTTSRPKGVPLTQFNLAS  660
             E  + +       D+  +    N       P DV+L LHTSGTT RPK VPLT  NL  
Sbjct  135  KEVVLDV------KDNGKLKGKANQKVEQAQPEDVALVLHTSGTTGRPKAVPLTHRNLTR  188

Query  661  SVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            ++ NI++ Y+L+  D T++V+PLFHVHGL+AG L+
Sbjct  189  TMKNIQATYQLSPQDRTMLVMPLFHVHGLLAGFLA  223



>ref|XP_009223944.1| peroxisomal-coenzyme A synthetase [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT74000.1| peroxisomal-coenzyme A synthetase [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=524

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 90/245 (37%), Positives = 128/245 (52%), Gaps = 29/245 (12%)
 Frame = +1

Query  79   LADSLSMETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRP  258
            +A + +++ +T  G     A   PS R    +     ++ RL   V    + L A G+  
Sbjct  1    MASAATLKGATQGGSPDATAVIIPSPRGPDAA--LTASYRRLAADVSAFQAKLAALGITH  58

Query  259  GDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNE  438
            G  V++   N+ E ++ FLA    RA AAPLN AY   EFEFY+ D  S ++L+P+   +
Sbjct  59   GSAVSIATVNSYEFIVSFLAASWQRAVAAPLNPAYKQAEFEFYIEDVGSAVVLVPRGAFD  118

Query  439  aaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVND---------------  573
            AA         PAV A       + A+   + +     V+  V D               
Sbjct  119  AAS--------PAVKAAR---RFNAAIAECYWDDGKGEVALDVKDYGLLKGKGGQQVLEP  167

Query  574  -PSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLI  750
             P DV+L LHTSGTTSRPK VPLT  NL  ++NNIK+ YKLT +D T++V+PLFHVHGL+
Sbjct  168  QPDDVALVLHTSGTTSRPKVVPLTHRNLTRTMNNIKNTYKLTPADRTMLVMPLFHVHGLL  227

Query  751  AGMLS  765
             G+L+
Sbjct  228  CGLLA  232



>ref|XP_007674649.1| hypothetical protein BAUCODRAFT_67136 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC97978.1| hypothetical protein BAUCODRAFT_67136 [Baudoinia compniacensis 
UAMH 10762]
Length=512

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 112/212 (53%), Gaps = 13/212 (6%)
 Frame = +1

Query  145  FPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVI  324
             P+  A++VS      H+ LH  + +    L   G++ G  V++  PN +EL+ +FLAV 
Sbjct  26   IPTEPAVTVS------HADLHDHIGQLQGELAKLGIQHGSAVSIALPNCLELIGVFLAVT  79

Query  325  RVRataaplnaaytaEEFEFYLSDSESKMLLIP-----KEGNEaaqaaaaKLSIPAVTAT  489
              R  AAPLN  Y  +E EFY+ D  S +L+IP     K G     A   + +I      
Sbjct  80   WQRGIAAPLNPGYKQDEVEFYIGDLGSDLLVIPQGAFEKGGPAVKAARTYEAAIAECYWN  139

Query  490  LSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVN  669
                  D+         DS  V E   D  DV L LHTSGTT RPK VPLT  NL +S+ 
Sbjct  140  GKKIVLDVKDCGKLGSRDSQDVLEAEED--DVGLVLHTSGTTGRPKAVPLTHANLLASIE  197

Query  670  NIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            +I   Y+L+ +D T++V+PLFHVHGL+A  LS
Sbjct  198  SICRTYELSPNDRTLLVMPLFHVHGLLASFLS  229



>ref|WP_043334885.1| AMP-dependent synthetase [Belnapia moabensis]
Length=505

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 121/213 (57%), Gaps = 22/213 (10%)
 Frame = +1

Query  154  RRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            R AI    +  L+++ L  L ER  +SL A G+  GD VA+  PN  E+   F+ +    
Sbjct  18   RPAIRAPERPPLSYAGLRALSERTLASLNAMGIGRGDRVAIVLPNGPEMAAAFVTIAGA-  76

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIP---------AVTA  486
            AT APLN AY  EEFEFYL+D ++K L++ +     A+A AA+LS+P         A   
Sbjct  77   ATTAPLNPAYKDEEFEFYLTDLKAKALVVQQGMETPARAVAARLSVPVLELVPGEAAGEF  136

Query  487  TLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSV  666
            TL+G  +  A  P    +D            DV+L LHTSGTT+RPK VPLT  N+ +S 
Sbjct  137  TLAGGSAATAAQPGPAAAD------------DVALVLHTSGTTARPKIVPLTHTNVTASA  184

Query  667  NNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             +I +  +LT +D+ + V+PLFH+HGLIA  LS
Sbjct  185  GSIAATLELTPADACLNVMPLFHIHGLIAATLS  217



>ref|XP_008728961.1| hypothetical protein G647_06418 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI22344.1| hypothetical protein G647_06418 [Cladophialophora carrionii CBS 
160.54]
Length=517

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 105/178 (59%), Gaps = 7/178 (4%)
 Frame = +1

Query  247  GVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK  426
            G+  GD V++  PN+ E ++ FLA    RA AAPLN AY   EFEFY+ D  S ++++P+
Sbjct  50   GIPSGDAVSIALPNSYEFIVSFLATAFQRAIAAPLNPAYKQSEFEFYIEDLSSAVVILPQ  109

Query  427  ---EGNEaaqaaaaKLSIPAVTATLSGAES--DIALFPAHPESDSDAVSELVNDPSDVSL  591
                 +  A  AA K +       L+GA    D+       +  S  V+     P DV+L
Sbjct  110  GAYANDGPAVKAARKYNAAIAECYLNGASLILDVKEQGKLAKRQSQPVARA--QPEDVAL  167

Query  592  FLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             LHTSGTT RPK VPLT  NL  ++ NI++ Y+LT  D T++V+PLFHVHGL+AG L+
Sbjct  168  VLHTSGTTGRPKAVPLTHRNLTRTMQNIRNTYELTHQDRTMLVMPLFHVHGLLAGFLA  225



>ref|XP_011125061.1| hypothetical protein AOL_s00110g69 [Arthrobotrys oligospora ATCC 
24927]
 gb|EGX46245.1| hypothetical protein AOL_s00110g69 [Arthrobotrys oligospora ATCC 
24927]
Length=513

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 113/195 (58%), Gaps = 4/195 (2%)
 Frame = +1

Query  190  THSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayta  369
            T+++L   +    + L + G+  G  V+++  N ++ ++ FLA    RA AAPLN AY  
Sbjct  27   TYAQLSSQIHAFQTFLASVGITNGSAVSISLVNGLDFIVSFLAATHQRAIAAPLNPAYKQ  86

Query  370  EEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPES  540
             EFEFY+ D +S +L++P+     N  A  AA K +       + G   D+ +       
Sbjct  87   AEFEFYIDDIKSALLVVPQGSVASNSEAVRAARKYNAGIAEVHVDG-NGDVKVSLVERGR  145

Query  541  DSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIV  720
              ++V      PSDV+L LHTSGTT RPK VPLT  NL +++ NIK+ Y LT +D T +V
Sbjct  146  LGNSVPLATAQPSDVALVLHTSGTTGRPKAVPLTHKNLTTTMRNIKATYALTPADRTYLV  205

Query  721  LPLFHVHGLIAGMLS  765
            +PLFHVHGL+AG L+
Sbjct  206  MPLFHVHGLLAGFLA  220



>gb|KIX94514.1| hypothetical protein Z520_09900 [Fonsecaea multimorphosa CBS 
102226]
Length=517

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 105/198 (53%), Gaps = 7/198 (4%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            ++  +L   V      L   G+R  D V++  PN+ E ++ FLA    RA AAPLN  Y 
Sbjct  30   ISFKQLAQDVSAFQKQLAGLGIRQTDAVSIALPNSYEFIVSFLATSFQRAIAAPLNPTYK  89

Query  367  aEEFEFYLSDSESKMLLIP-----KEGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAH  531
              EFEFY+ D  S  +++P     K+G     A     +I       +    D+      
Sbjct  90   QSEFEFYIEDLSSAAIILPRGAYAKDGPAVKAARKYHAAIAECYVDGTKLILDVKEQGKL  149

Query  532  PESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDST  711
             +  S  V++    P DV+L LHTSGTT RPK VPLT  NL  ++ NI++ Y+LT  D T
Sbjct  150  AQRQSQPVAQA--QPEDVALVLHTSGTTGRPKAVPLTHRNLTRTMQNIRNTYELTAQDRT  207

Query  712  VIVLPLFHVHGLIAGMLS  765
            ++V+PLFHVHGL+AG L 
Sbjct  208  MLVMPLFHVHGLLAGFLG  225



>ref|WP_018412030.1| AMP-dependent synthetase [Methyloversatilis sp. NVD]
Length=508

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 111/202 (55%), Gaps = 1/202 (0%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            A+S   + DL+   L  L+ R  + L   GV   D VA+  PN  ++   F++V     T
Sbjct  20   ALSAPSRTDLSFGNLRALMSRTVARLNEFGVGRNDRVAIVLPNGPDMASAFISV-GTGTT  78

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIAL  519
            AAPLN AY AEEFEFYLSD  +K L++ +     A   A KL +  +      A  D  L
Sbjct  79   AAPLNPAYRAEEFEFYLSDLNAKALVVERGSVSPAVEVARKLGVRILELVAQEAAGDFVL  138

Query  520  FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTE  699
                    + A +       DV+L LHTSGTTSRPK VPLTQ N+ +S  NI++    TE
Sbjct  139  EAVDASPVAAAANGGTAQADDVALVLHTSGTTSRPKIVPLTQRNVTASAQNIRNTLAFTE  198

Query  700  SDSTVIVLPLFHVHGLIAGMLS  765
             D  + ++PLFH+HGLIAG+++
Sbjct  199  KDRGLNIMPLFHIHGLIAGIMA  220



>ref|XP_001267342.1| coenzyme A synthetase, putative [Neosartorya fischeri NRRL 181]
 gb|EAW25445.1| coenzyme A synthetase, putative [Neosartorya fischeri NRRL 181]
Length=512

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 109/196 (56%), Gaps = 3/196 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++ +LH  V    + L   GV  G  V+L   N+ E ++ +LA    RA AAPLN AY 
Sbjct  28   VSYQQLHTHVANFQAKLARLGVGHGAAVSLALVNSFEFIVSYLATSWQRAIAAPLNPAYK  87

Query  367  aEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPE  537
             +EFEFY+ D  S ++LIP+     +  A  A  K +         G E  + +      
Sbjct  88   QDEFEFYIDDLSSSLVLIPRGAFAQSGPAVRAGRKYNAAIAECYWDGKEVVLDVKELGKL  147

Query  538  SDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVI  717
            +   ++  L   P D++L LHTSGTT RPK VPLT  NLA+++ NI+  Y LT  D T +
Sbjct  148  AGKGSIGILEAQPDDIALVLHTSGTTGRPKAVPLTHKNLATTMKNIRDTYLLTPEDRTYL  207

Query  718  VLPLFHVHGLIAGMLS  765
            V+PLFHVHGL+AG L+
Sbjct  208  VMPLFHVHGLLAGFLA  223



>gb|KIL96606.1| hypothetical protein FAVG1_01350 [Fusarium avenaceum]
Length=515

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 111/204 (54%), Gaps = 4/204 (2%)
 Frame = +1

Query  166  SVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataa  345
            S S    + +S L   V      L   G+     V++   N+ E ++ FLA    R  AA
Sbjct  23   SKSKALTVRYSDLQSDVAAFQRKLADLGITKAAPVSIALVNSYEFIVSFLAASWQRGIAA  82

Query  346  plnaaytaEEFEFYLSDSESKMLLIPK---EGNEaaqaaaaKLSIPAVTATLSGAESDIA  516
            PLN AY  +EFEFY+ D +S ++L+P+   +    +  AA K +           + ++A
Sbjct  83   PLNPAYKQDEFEFYIQDVKSAIVLVPQGAWDAGAPSVKAAKKFNAAVAECYWDATKGEVA  142

Query  517  L-FPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKL  693
            L    +          L  +P DV+L LHTSGTTSRPK VPLT  NL  ++NNIK+ Y+L
Sbjct  143  LDVKDYGLLKGKKEQILTAEPDDVALILHTSGTTSRPKVVPLTHRNLTRTMNNIKNTYEL  202

Query  694  TESDSTVIVLPLFHVHGLIAGMLS  765
            T  D T++V+PLFHVHGL+ G+L+
Sbjct  203  TSKDRTMLVMPLFHVHGLLCGLLA  226



>ref|WP_043815178.1| AMP-dependent synthetase [Rubrivivax gelatinosus]
Length=509

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 117/205 (57%), Gaps = 4/205 (2%)
 Frame = +1

Query  160  AISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRat  339
            A++  G+  L +  L   +    S+L   GV  GD VA+   N  E+   F+A       
Sbjct  18   ALAAPGRAPLNYRGLRAQIAGTVSTLNTLGVGRGDRVAIVLANGPEMASCFVACAS-GVA  76

Query  340  aaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLS-GAESD-I  513
            +APLN AY AEEFEFYLSD  +K L++ +     A A A +L +  +   ++ GA +   
Sbjct  77   SAPLNPAYRAEEFEFYLSDLRAKALIVERGSASPAVAVAERLGVRVLDLVVADGAPAGSF  136

Query  514  ALFPAHPESDSD-AVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYK  690
             L P    +DS  A       P DVS+ LHTSGTTSRPK VPL+Q NLA+S  +I+   +
Sbjct  137  TLVPRDGSADSTPAAVGGAAQPGDVSMVLHTSGTTSRPKIVPLSQANLAASAQHIRDTLQ  196

Query  691  LTESDSTVIVLPLFHVHGLIAGMLS  765
            LT +D  + V+PLFH+HGLIAG+L+
Sbjct  197  LTPADGGLNVMPLFHIHGLIAGVLA  221



>ref|WP_008439794.1| acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Thaumarchaeota 
archaeon SCGC AB-539-E09]
 gb|EMR74214.1| acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Thaumarchaeota 
archaeon SCGC AB-539-E09]
Length=873

 Score =   115 bits (287),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 84/222 (38%), Positives = 124/222 (56%), Gaps = 3/222 (1%)
 Frame = +1

Query  100  ETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALT  279
            + +T+ G++   A   P + AI    +  LT+  LH  V++    L   G+R  D VA+ 
Sbjct  15   KANTIQGIISFWAQKNPRKIAIISPERKPLTYGNLHRQVKKIVVQLNDFGIRRNDRVAVV  74

Query  280  FPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaa  459
             PN  E+ + FLAV    A  APLN  Y A E+EFYL+D  +K ++I K     A   A 
Sbjct  75   LPNGPEMAVSFLAVSST-AAYAPLNPKYKAHEYEFYLTDLNAKAIIIKKGMISPAINIAK  133

Query  460  KLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPL  639
            +L I  +  + S  +S   +F  + E  S   S      +DV+L LHTSGTTSRPK VPL
Sbjct  134  ELGIEIIRLSPSFKKS-AGIFEINTEFSSQKNSGWART-NDVALVLHTSGTTSRPKMVPL  191

Query  640  TQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            T  N+ +S  NI++V +++++D  + ++PLFH+HGLI   LS
Sbjct  192  TNKNICNSAENIRNVLRISQNDRCLNIMPLFHIHGLIGATLS  233



>gb|EWG40839.1| hypothetical protein FVEG_03096 [Fusarium verticillioides 7600]
Length=515

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 112/197 (57%), Gaps = 4/197 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++S L   V      L   G+     V++   N+ E ++ FLA    R  AAPLN AY 
Sbjct  30   ISYSNLEADVSAFQRKLADLGITKAAPVSIALVNSYEFIVSFLAASWQRGIAAPLNPAYK  89

Query  367  aEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESDIAL-FPAHP  534
             +EFEFY+ D +S ++L+PK       A+  AA K +          A+ ++AL    + 
Sbjct  90   QDEFEFYIEDVKSAIVLVPKGAWAAGAASVKAAKKFNAAVAECYWDAAKGEVALDVKDYG  149

Query  535  ESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTV  714
              +      L  +P DV+L LHTSGTTSRPK VPLT  NL  ++NNIK+ Y+LT  D T+
Sbjct  150  LLEGKKEKVLTAEPDDVALILHTSGTTSRPKVVPLTHRNLTRTMNNIKNTYQLTSKDRTM  209

Query  715  IVLPLFHVHGLIAGMLS  765
            +V+PLFHVHGL+ G+L+
Sbjct  210  LVMPLFHVHGLLCGLLA  226



>gb|KEF56440.1| hypothetical protein A1O9_08021 [Exophiala aquamarina CBS 119918]
Length=516

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 104/184 (57%), Gaps = 7/184 (4%)
 Frame = +1

Query  229  SSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESK  408
            + L   G+R GD V++  PN+ E ++ FLA    RA AAPLN AY  +EFEFY+ D  S 
Sbjct  43   AQLSQLGIRHGDAVSIALPNSYEFIVSFLATSYQRAIAAPLNPAYKQDEFEFYIEDLSSA  102

Query  409  MLLIP-----KEGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVND  573
            ++++P     K G     A   + +I       S    DI       +  S+ V+     
Sbjct  103  VVILPHGAFAKNGPAVRAARKYQAAIAECFLQDSKLVLDIKEQGKLAQRQSEPVAHA--Q  160

Query  574  PSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIA  753
            P DV+L LHTSGTT RPK VPL+  NL  ++ NI + Y+L+  D T +V+PLFHVHGL+A
Sbjct  161  PEDVALVLHTSGTTGRPKAVPLSHRNLTRTMQNIGNTYELSPKDRTYLVMPLFHVHGLLA  220

Query  754  GMLS  765
            G L+
Sbjct  221  GFLA  224



>ref|XP_011388056.1| putative AMP-binding protein [Ustilago maydis 521]
 gb|KIS70284.1| putative AMP-binding protein [Ustilago maydis 521]
Length=524

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 108/201 (54%), Gaps = 21/201 (10%)
 Frame = +1

Query  181  FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaa  360
            F  T++RLH LV    S L +  + PG  V+ +  N +E  + FLA    R  AAPLN  
Sbjct  31   FTFTYARLHELVLDLQSQLASYNLAPGIAVSSSLANGIEFTLAFLATGAERLVAAPLNPN  90

Query  361  ytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESD---IALFPAH  531
            Y+  E EFYL D++S++LL+PK         A K   PAV A       D   I   P+H
Sbjct  91   YSQGEVEFYLQDTKSQLLLLPK--------GALKAGHPAVEAAKKVGGVDVVEIVFDPSH  142

Query  532  PES------DSDAVSE--LVNDPSD--VSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKS  681
              S      D   V +   +  P D  V+L LHTSGTT RPKGVPLT  NL +++ NI +
Sbjct  143  SGSISLVRADGSNVGKKSQIRKPQDDDVALVLHTSGTTGRPKGVPLTHRNLYTTMGNIIA  202

Query  682  VYKLTESDSTVIVLPLFHVHG  744
             Y LT  D T +V+PLFHVHG
Sbjct  203  TYNLTPVDRTYLVMPLFHVHG  223



>dbj|GAC96532.1| hypothetical protein PHSY_004112 [Pseudozyma hubeiensis SY62]
Length=524

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 110/202 (54%), Gaps = 23/202 (11%)
 Frame = +1

Query  181  FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaa  360
            F  +++RLH LV    S L +  + PG  V+ +  N +E  + FLA    R  AAPLN  
Sbjct  31   FTFSYARLHELVLDLQSQLASFDLAPGSAVSSSLVNGIEFTLAFLATGAERLVAAPLNPN  90

Query  361  ytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPES  540
            Y+  E EFYL D++S++LL+PK         A K   PA+ A     + D+      P S
Sbjct  91   YSQGEVEFYLQDTKSQLLLLPK--------GAIKAGHPAIEAAKKAGKVDVVEIVFDP-S  141

Query  541  DSDAVSELVNDPS--------------DVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIK  678
             + +VS +  D +              DV+L LHTSGTT RPKGVPLT  NL +++ NI 
Sbjct  142  GAGSVSLVRGDGTKVGKKSQIRKPQDEDVALVLHTSGTTGRPKGVPLTHKNLYTTMGNII  201

Query  679  SVYKLTESDSTVIVLPLFHVHG  744
            + Y LT +D T +V+PLFHVHG
Sbjct  202  TTYSLTPADRTYLVMPLFHVHG  223



>ref|XP_662001.1| hypothetical protein AN4397.2 [Aspergillus nidulans FGSC A4]
 gb|EAA60314.1| hypothetical protein AN4397.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF77610.1| TPA: coenzyme A synthetase, putative (AFU_orthologue; AFUA_4G06850) 
[Aspergillus nidulans FGSC A4]
Length=506

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 107/203 (53%), Gaps = 5/203 (2%)
 Frame = +1

Query  151  SRRAISVSGK--FDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVI  324
            S  A+ V GK    +T+++LH  +      L   GV  G  V L   N+ E ++ FLA  
Sbjct  13   SNAAVIVPGKPALTVTYAQLHSHISAFQEKLAKLGVGHGAAVNLALINSYEFIVGFLAAS  72

Query  325  RVRataaplnaaytaEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLS  495
              RA AAPLN AY  +EFEFY+ D  S ++LIP+E    N  A  A  K          +
Sbjct  73   WQRAIAAPLNPAYKQDEFEFYIDDLSSTLVLIPRESYAQNGPAVLAGRKYQAAIAECYWN  132

Query  496  GAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNI  675
            G E  + +           +      P D++L LHTSGTT RPK VPLT  NL +++ NI
Sbjct  133  GTEVVLDVKELGKLKGKGDIGVQTAQPDDIALVLHTSGTTGRPKAVPLTHKNLTTTMRNI  192

Query  676  KSVYKLTESDSTVIVLPLFHVHG  744
            ++ YKLT  D T +V+PLFHVHG
Sbjct  193  QATYKLTPQDRTYLVMPLFHVHG  215



>gb|EWZ36841.1| hypothetical protein FOZG_10781 [Fusarium oxysporum Fo47]
 gb|EWZ90497.1| hypothetical protein FOWG_08126 [Fusarium oxysporum f. sp. lycopersici 
MN25]
Length=498

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 112/197 (57%), Gaps = 4/197 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++S L   V      L   G+     V++   N+ E ++ FLA    R  AAPLN+AY 
Sbjct  30   ISYSNLEADVSAFQRKLADLGITKAAPVSIALVNSYEFIVSFLAASWQRGIAAPLNSAYK  89

Query  367  aEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESDIAL-FPAHP  534
             +EFEFY+ D +S ++L+PK       A+  AA K +          A+ ++AL    + 
Sbjct  90   QDEFEFYIEDVKSAIVLVPKGAWAAGAASVKAAKKFNAAVAECYWDAAKGEVALDVKDYG  149

Query  535  ESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTV  714
                     L  +P DV+L LHTSGTTSRPK VPLT  NL  ++NNIK+ Y+LT  D T+
Sbjct  150  FLKGRKEKVLTAEPDDVALILHTSGTTSRPKVVPLTHRNLTRTMNNIKNTYQLTSKDRTM  209

Query  715  IVLPLFHVHGLIAGMLS  765
            +V+PLFHVHGL+ G+L+
Sbjct  210  LVMPLFHVHGLLCGLLA  226



>ref|WP_019500419.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=505

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 115/216 (53%), Gaps = 28/216 (13%)
 Frame = +1

Query  154  RRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVR  333
            R A++  GK DLT+ +L   V   A+ L   G+  GD V++  PN+  +V+ FLA     
Sbjct  18   RIALTAPGKPDLTYKQLRRNVRELAAKLNGFGIGKGDRVSIAIPNSPGMVVTFLATATC-  76

Query  334  ataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIPAVTATLSGAESDI  513
            ATAAPLN  Y  EEF FY  D+ +  L++  EG               + A L+    DI
Sbjct  77   ATAAPLNPKYNREEFVFYYEDTNAVALIVLDEG---------------IEAALAAVTPDI  121

Query  514  ALFPAHPESDSDAVSELVN------------DPSDVSLFLHTSGTTSRPKGVPLTQFNLA  657
             +  A    D     E +N            +  D++  LHTSGTTSRPK VP+   NLA
Sbjct  122  LVIRATSNPDGTLSFEKINGIERSPRVEELAESDDIATILHTSGTTSRPKRVPIRHRNLA  181

Query  658  SSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            +SV NI S Y+L+ +D+T+ ++PLFH+HGL+  +LS
Sbjct  182  ASVGNITSAYELSPADTTLCLMPLFHIHGLVGCLLS  217



>ref|WP_038027144.1| AMP-dependent synthetase, partial [Synechococcus sp. PCC 7336]
Length=497

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 110/211 (52%), Gaps = 12/211 (6%)
 Frame = +1

Query  148  PSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIR  327
            P   AI+  G   L++  L   +   A  L A GV   D VA+  PN  E+ + FLA I 
Sbjct  10   PEAIAIAAPGHTPLSYRELLEQIHCIADKLNAIGVGRNDRVAIVLPNGPEMAVAFLA-IA  68

Query  328  VRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaaaaKLSIP-----AVTATL  492
              AT APLN AY   E++FYLSD ++K L++       A   A K  IP      V    
Sbjct  69   SSATCAPLNPAYRQSEYDFYLSDLDAKALIVRSGIAVPAVEVARKKGIPLLELSPVKQAA  128

Query  493  SGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNN  672
            +G    +   P HP+         +  P DV+L LHTSGTTSRPK VPLT  NL SS NN
Sbjct  129  AGIFQLLGGEPQHPDRGG------IAQPEDVALVLHTSGTTSRPKMVPLTGHNLCSSANN  182

Query  673  IKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            I +  +L   D  + V+PLFH+HGL+  +LS
Sbjct  183  IAATLRLGAGDRCLNVMPLFHIHGLVGSLLS  213



>gb|KIW31802.1| hypothetical protein PV07_03394 [Cladophialophora immunda]
Length=517

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 100/178 (56%), Gaps = 7/178 (4%)
 Frame = +1

Query  247  GVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK  426
            G+R  D V++  PN+ E ++ FLA    RA AAPLN  Y   EFEFY+ D  S  +++P+
Sbjct  50   GIRHADAVSIALPNSYEFIVSFLATAFQRAIAAPLNPTYKQSEFEFYIEDLSSAAIILPR  109

Query  427  -----EGNEaaqaaaaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSL  591
                 +G     A     +I       +    D+       +  S  V++    P DV+L
Sbjct  110  GAYARDGPAVKAARKYHAAIAECYVDGTKLILDVKEQGKLAQRQSQPVAQA--QPEDVAL  167

Query  592  FLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
             LHTSGTT RPK VPLT  NL  ++ NI++ Y+LT  D T++V+PLFHVHGL+AG L+
Sbjct  168  VLHTSGTTGRPKAVPLTHRNLTRTMQNIQNTYELTAQDRTMLVMPLFHVHGLLAGFLA  225



>gb|EWZ36840.1| hypothetical protein FOZG_10781 [Fusarium oxysporum Fo47]
 gb|EWZ90496.1| hypothetical protein FOWG_08126 [Fusarium oxysporum f. sp. lycopersici 
MN25]
Length=515

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 112/197 (57%), Gaps = 4/197 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++S L   V      L   G+     V++   N+ E ++ FLA    R  AAPLN+AY 
Sbjct  30   ISYSNLEADVSAFQRKLADLGITKAAPVSIALVNSYEFIVSFLAASWQRGIAAPLNSAYK  89

Query  367  aEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESDIAL-FPAHP  534
             +EFEFY+ D +S ++L+PK       A+  AA K +          A+ ++AL    + 
Sbjct  90   QDEFEFYIEDVKSAIVLVPKGAWAAGAASVKAAKKFNAAVAECYWDAAKGEVALDVKDYG  149

Query  535  ESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTV  714
                     L  +P DV+L LHTSGTTSRPK VPLT  NL  ++NNIK+ Y+LT  D T+
Sbjct  150  FLKGRKEKVLTAEPDDVALILHTSGTTSRPKVVPLTHRNLTRTMNNIKNTYQLTSKDRTM  209

Query  715  IVLPLFHVHGLIAGMLS  765
            +V+PLFHVHGL+ G+L+
Sbjct  210  LVMPLFHVHGLLCGLLA  226



>gb|KIJ54974.1| hypothetical protein M422DRAFT_42153 [Sphaerobolus stellatus 
SS14]
Length=539

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 107/185 (58%), Gaps = 12/185 (6%)
 Frame = +1

Query  247  GVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPK  426
            GV+ GDVVA++F N  E V+ FL     RA +APLN  Y+  E EFYL D++  +LLIP 
Sbjct  56   GVKTGDVVAMSFVNGFEFVVGFLGTGLARAISAPLNPVYSTSEVEFYLGDTKPVVLLIPA  115

Query  427  -----------EGNEaaqaaaaKLSIP-AVTATLSGAESDIALFPAHPESDSDAVSELVN  570
                       +G  AA  AA   +IP A  + ++G      +F     S   A +    
Sbjct  116  LASLQSTAPQFKGAHAALQAAKNCNIPTAEFSMVNGTPQIKTIFNGPHTSPPRAQNNGEP  175

Query  571  DPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLI  750
             P DV+L LHTSGTTSRPK VPLT  NL ++  N+ + Y  T +D + +V+PLFHVHGL+
Sbjct  176  QPDDVALVLHTSGTTSRPKSVPLTHRNLLTTTKNVINTYSFTPADRSYLVMPLFHVHGLL  235

Query  751  AGMLS  765
            AG+LS
Sbjct  236  AGLLS  240



>gb|EXL72559.1| hypothetical protein FOPG_11927 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
Length=498

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 111/197 (56%), Gaps = 4/197 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++S L   V      L   G+     V++   N+ E ++ FLA    R  AAPLN AY 
Sbjct  30   ISYSNLEADVSAFQRKLADLGITKAAPVSIALVNSYEFIVSFLAASWQRGIAAPLNPAYK  89

Query  367  aEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESDIAL-FPAHP  534
             +EFEFY+ D +S ++L+PK       A+  AA K +          A+ ++AL    + 
Sbjct  90   QDEFEFYIEDVKSAIVLVPKGAWAAGAASVKAAKKFNAAVAECYWDAAKGEVALDVKDYG  149

Query  535  ESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTV  714
                     L  +P DV+L LHTSGTTSRPK VPLT  NL  ++NNIK+ Y+LT  D T+
Sbjct  150  LLKGRKEKVLTAEPDDVALILHTSGTTSRPKVVPLTHRNLTRTMNNIKNTYQLTSKDRTM  209

Query  715  IVLPLFHVHGLIAGMLS  765
            +V+PLFHVHGL+ G+L+
Sbjct  210  LVMPLFHVHGLLCGLLA  226



>ref|WP_034469963.1| AMP-dependent synthetase [Afipia sp. P52-10]
 gb|ETR74742.1| AMP-dependent synthetase [Afipia sp. P52-10]
Length=509

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 123/224 (55%), Gaps = 5/224 (2%)
 Frame = +1

Query  94   SMETSTLTGLLKHVAGNFPSRRAISVSGKFDLTHSRLHHLVERAASSLFAAGVRPGDVVA  273
            S  +STL  L+   A + P   AI+  G   L +S L  +VE+  ++L A GV   D VA
Sbjct  5    SPRSSTLRELIGSGADDQP---AITAPGATPLKYSALRTMVEQTVAALNAFGVGRDDRVA  61

Query  274  LTFPNTVELVIMFLAVIRVRataaplnaaytaEEFEFYLSDSESKMLLIPKEGNEaaqaa  453
            +  PN  ++   F+ V    ATAAPLN +Y A+EFEFY+SD ++K L++       A   
Sbjct  62   IVLPNGPDMATTFIGVASA-ATAAPLNPSYKADEFEFYMSDLKAKALVVETGSTSPAIDV  120

Query  454  aaKLSIPAVTATLSGAESDIALFPAHPESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGV  633
            A +L I  VT     A+     F    +  S +      +  D++L LHTSGTTSRPK V
Sbjct  121  ARRLGIKIVTLHPDHAQG-AGYFSLECDDRSGSCRAGHAEADDIALILHTSGTTSRPKIV  179

Query  634  PLTQFNLASSVNNIKSVYKLTESDSTVIVLPLFHVHGLIAGMLS  765
            PLTQ N+ +S  NI        +D  + ++PLFH+HGLIAG+L+
Sbjct  180  PLTQRNVCTSAGNIAETLAFDTTDCGLNIMPLFHIHGLIAGVLA  223



>gb|EXA44425.1| hypothetical protein FOVG_05866 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK88924.1| hypothetical protein FOQG_08183 [Fusarium oxysporum f. sp. raphani 
54005]
Length=498

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 111/197 (56%), Gaps = 4/197 (2%)
 Frame = +1

Query  187  LTHSRLHHLVERAASSLFAAGVRPGDVVALTFPNTVELVIMFLAVIRVRataaplnaayt  366
            +++S L   V      L   G+     V++   N+ E ++ FLA    R  AAPLN AY 
Sbjct  30   ISYSNLEADVSAFQRKLADLGITKAAPVSIALVNSYEFIVSFLAASWQRGIAAPLNPAYK  89

Query  367  aEEFEFYLSDSESKMLLIPKEG---NEaaqaaaaKLSIPAVTATLSGAESDIAL-FPAHP  534
             +EFEFY+ D +S ++L+PK       A+  AA K +          A+ ++AL    + 
Sbjct  90   QDEFEFYIEDVKSAIVLVPKGAWAAGAASVKAAKKFNAAVAECYWDAAKGEVALDVKDYG  149

Query  535  ESDSDAVSELVNDPSDVSLFLHTSGTTSRPKGVPLTQFNLASSVNNIKSVYKLTESDSTV  714
                     L  +P DV+L LHTSGTTSRPK VPLT  NL  ++NNIK+ Y+LT  D T+
Sbjct  150  LLKGRKEKVLTAEPDDVALILHTSGTTSRPKVVPLTHRNLTRTMNNIKNTYQLTSKDRTM  209

Query  715  IVLPLFHVHGLIAGMLS  765
            +V+PLFHVHGL+ G+L+
Sbjct  210  LVMPLFHVHGLLCGLLA  226



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1510973279075