BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7810

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006358558.1|  PREDICTED: putative RNA polymerase II subuni...    189   3e-52   Solanum tuberosum [potatoes]
ref|XP_011087531.1|  PREDICTED: putative RNA polymerase II subuni...    188   4e-52   Sesamum indicum [beniseed]
ref|XP_011087530.1|  PREDICTED: putative RNA polymerase II subuni...    188   5e-52   Sesamum indicum [beniseed]
ref|XP_011087529.1|  PREDICTED: putative RNA polymerase II subuni...    188   5e-52   Sesamum indicum [beniseed]
ref|XP_004230345.1|  PREDICTED: putative RNA polymerase II subuni...    186   2e-51   
ref|XP_009629188.1|  PREDICTED: putative RNA polymerase II subuni...    182   1e-49   Nicotiana tomentosiformis
ref|XP_009602820.1|  PREDICTED: putative RNA polymerase II subuni...    181   2e-49   Nicotiana tomentosiformis
ref|XP_009629199.1|  PREDICTED: putative RNA polymerase II subuni...    180   2e-49   Nicotiana tomentosiformis
ref|XP_009629194.1|  PREDICTED: putative RNA polymerase II subuni...    181   2e-49   Nicotiana tomentosiformis
ref|XP_009629198.1|  PREDICTED: putative RNA polymerase II subuni...    179   5e-49   
ref|XP_002321396.2|  hypothetical protein POPTR_0015s01330g             179   8e-49   
ref|XP_009602823.1|  PREDICTED: putative RNA polymerase II subuni...    177   2e-48   Nicotiana tomentosiformis
ref|XP_011044667.1|  PREDICTED: putative RNA polymerase II subuni...    178   3e-48   Populus euphratica
ref|XP_011044665.1|  PREDICTED: putative RNA polymerase II subuni...    178   3e-48   Populus euphratica
ref|XP_012072543.1|  PREDICTED: putative RNA polymerase II subuni...    177   4e-48   Jatropha curcas
emb|CDP15205.1|  unnamed protein product                                177   8e-48   Coffea canephora [robusta coffee]
ref|XP_009771014.1|  PREDICTED: putative RNA polymerase II subuni...    176   1e-47   Nicotiana sylvestris
gb|KHN23219.1|  Putative RNA polymerase II subunit B1 CTD phospha...    176   1e-47   Glycine soja [wild soybean]
ref|XP_003519102.1|  PREDICTED: putative RNA polymerase II subuni...    176   2e-47   Glycine max [soybeans]
ref|XP_009771016.1|  PREDICTED: putative RNA polymerase II subuni...    174   2e-47   Nicotiana sylvestris
ref|XP_006575272.1|  PREDICTED: putative RNA polymerase II subuni...    175   2e-47   Glycine max [soybeans]
ref|XP_002280625.1|  PREDICTED: putative RNA polymerase II subuni...    175   3e-47   Vitis vinifera
emb|CAN62034.1|  hypothetical protein VITISV_014731                     175   3e-47   Vitis vinifera
ref|XP_002521936.1|  conserved hypothetical protein                     174   5e-47   Ricinus communis
ref|XP_007016931.1|  F2P16.20-like protein isoform 6                    172   9e-47   
ref|XP_003537129.1|  PREDICTED: putative RNA polymerase II subuni...    172   2e-46   Glycine max [soybeans]
gb|KEH41826.1|  RNA polymerase II subunit B1 CTD phosphatase RPAP...    171   5e-46   Medicago truncatula
ref|XP_007016927.1|  F2P16.20-like protein isoform 2                    171   5e-46   
ref|XP_007016928.1|  F2P16.20-like protein isoform 3                    171   5e-46   
ref|XP_007016930.1|  F2P16.20-like protein isoform 5                    171   6e-46   
ref|XP_007016926.1|  F2P16.20 protein, putative isoform 1               171   6e-46   
ref|XP_007145767.1|  hypothetical protein PHAVU_007G265900g             171   1e-45   Phaseolus vulgaris [French bean]
ref|XP_007016929.1|  F2P16.20 protein, putative isoform 4               169   2e-45   
ref|XP_004497627.1|  PREDICTED: putative RNA polymerase II subuni...    165   6e-44   Cicer arietinum [garbanzo]
ref|XP_010271590.1|  PREDICTED: putative RNA polymerase II subuni...    164   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010674526.1|  PREDICTED: putative RNA polymerase II subuni...    164   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010097327.1|  hypothetical protein L484_006008                   163   5e-43   Morus notabilis
ref|XP_008454119.1|  PREDICTED: putative RNA polymerase II subuni...    160   2e-42   Cucumis melo [Oriental melon]
ref|XP_004152151.1|  PREDICTED: putative RNA polymerase II subuni...    157   6e-41   Cucumis sativus [cucumbers]
gb|EYU19406.1|  hypothetical protein MIMGU_mgv1a003240mg                156   9e-41   Erythranthe guttata [common monkey flower]
ref|XP_007208433.1|  hypothetical protein PRUPE_ppa002134mg             156   2e-40   Prunus persica
ref|XP_006480289.1|  PREDICTED: putative RNA polymerase II subuni...    155   5e-40   Citrus sinensis [apfelsine]
gb|KJB31664.1|  hypothetical protein B456_005G200700                    154   5e-40   Gossypium raimondii
gb|EPS64466.1|  hypothetical protein M569_10314                         152   2e-39   Genlisea aurea
ref|XP_006841578.1|  PREDICTED: putative RNA polymerase II subuni...    152   2e-39   Amborella trichopoda
gb|KHG00855.1|  hypothetical protein F383_23706                         151   7e-39   Gossypium arboreum [tree cotton]
gb|KHG00854.1|  hypothetical protein F383_23706                         151   8e-39   Gossypium arboreum [tree cotton]
ref|XP_008246291.1|  PREDICTED: putative RNA polymerase II subuni...    151   1e-38   Prunus mume [ume]
ref|XP_010042212.1|  PREDICTED: putative RNA polymerase II subuni...    148   9e-38   Eucalyptus grandis [rose gum]
ref|XP_002874325.1|  hypothetical protein ARALYDRAFT_326902             150   1e-37   
gb|KFK26439.1|  hypothetical protein AALP_AA8G248600                    149   1e-37   Arabis alpina [alpine rockcress]
ref|XP_010551019.1|  PREDICTED: putative RNA polymerase II subuni...    148   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_006394906.1|  hypothetical protein EUTSA_v10003721mg             146   5e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010921353.1|  PREDICTED: putative RNA polymerase II subuni...    145   6e-37   
ref|XP_010921352.1|  PREDICTED: putative RNA polymerase II subuni...    145   7e-37   Elaeis guineensis
ref|XP_010921354.1|  PREDICTED: putative RNA polymerase II subuni...    145   8e-37   
gb|ABR17753.1|  unknown                                                 144   2e-36   Picea sitchensis
ref|XP_010421540.1|  PREDICTED: putative RNA polymerase II subuni...    146   2e-36   Camelina sativa [gold-of-pleasure]
gb|KHG28494.1|  hypothetical protein F383_15905                         135   6e-36   Gossypium arboreum [tree cotton]
ref|XP_008781193.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...    143   7e-36   Phoenix dactylifera
ref|XP_006290171.1|  hypothetical protein CARUB_v10003849mg             143   1e-35   
ref|XP_009366054.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...    142   1e-35   
ref|XP_010493937.1|  PREDICTED: putative RNA polymerase II subuni...    143   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010456737.1|  PREDICTED: putative RNA polymerase II subuni...    141   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009335520.1|  PREDICTED: putative RNA polymerase II subuni...    140   8e-35   Pyrus x bretschneideri [bai li]
ref|XP_008388442.1|  PREDICTED: putative RNA polymerase II subuni...    139   3e-34   
ref|NP_974839.1|  uncharacterized protein                               137   9e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004302308.1|  PREDICTED: putative RNA polymerase II subuni...    137   1e-33   Fragaria vesca subsp. vesca
gb|AAB61054.1|  contains similarity to myosin heavy chain               136   8e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389521.1|  PREDICTED: putative RNA polymerase II subuni...    133   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX78156.1|  BnaA09g33510D                                          125   5e-31   
emb|CDY05542.1|  BnaA02g31490D                                          129   1e-30   
ref|XP_009129907.1|  PREDICTED: putative RNA polymerase II subuni...    127   6e-30   Brassica rapa
emb|CDY25002.1|  BnaC02g40060D                                          126   9e-30   Brassica napus [oilseed rape]
ref|NP_001054566.2|  Os05g0134300                                       103   2e-23   
ref|XP_002990357.1|  hypothetical protein SELMODRAFT_447998             105   1e-22   Selaginella moellendorffii
ref|XP_002979385.1|  hypothetical protein SELMODRAFT_444189             105   1e-22   Selaginella moellendorffii
sp|A2Y040.1|RPAP2_ORYSI  RecName: Full=Putative RNA polymerase II...    103   6e-22   Oryza sativa Indica Group [Indian rice]
sp|Q6AVZ9.1|RPAP2_ORYSJ  RecName: Full=Putative RNA polymerase II...    103   9e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CDX80586.1|  BnaC07g28580D                                          100   7e-21   
ref|XP_001782029.1|  predicted protein                                99.4    3e-20   
dbj|BAJ96888.1|  predicted protein                                    97.1    2e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002453603.1|  hypothetical protein SORBIDRAFT_04g008880        90.9    2e-18   Sorghum bicolor [broomcorn]
ref|XP_008650656.1|  PREDICTED: uncharacterized protein LOC103631550  82.8    1e-15   
ref|XP_003569080.1|  PREDICTED: putative RNA polymerase II subuni...  82.8    1e-14   Brachypodium distachyon [annual false brome]
ref|XP_002440538.1|  hypothetical protein SORBIDRAFT_09g002730        81.6    3e-14   Sorghum bicolor [broomcorn]
ref|XP_008654513.1|  PREDICTED: uncharacterized protein LOC100217...  80.9    5e-14   
ref|XP_008654514.1|  PREDICTED: uncharacterized protein LOC100217...  80.1    7e-14   
ref|XP_004960407.1|  PREDICTED: putative RNA polymerase II subuni...  78.2    3e-13   Setaria italica
ref|XP_002438289.1|  hypothetical protein SORBIDRAFT_10g011190        73.2    2e-12   
emb|CAJ38817.1|  hypothetical protein                                 73.2    2e-11   Platynereis dumerilii
gb|KFP17480.1|  Putative RNA polymerase II subunit B1 CTD phospha...  71.2    6e-11   Egretta garzetta
ref|XP_006278788.1|  PREDICTED: putative RNA polymerase II subuni...  71.2    6e-11   
ref|XP_009554783.1|  PREDICTED: putative RNA polymerase II subuni...  71.2    6e-11   Cuculus canorus
ref|XP_010580936.1|  PREDICTED: putative RNA polymerase II subuni...  70.9    8e-11   Haliaeetus leucocephalus
ref|XP_010161825.1|  PREDICTED: putative RNA polymerase II subuni...  70.5    1e-10   
gb|KFZ54164.1|  Putative RNA polymerase II subunit B1 CTD phospha...  70.5    1e-10   Antrostomus carolinensis
gb|KFR00386.1|  Putative RNA polymerase II subunit B1 CTD phospha...  70.5    1e-10   Nipponia nippon
gb|KGL93104.1|  Putative RNA polymerase II subunit B1 CTD phospha...  70.1    1e-10   Charadrius vociferus
gb|KFQ74312.1|  Putative RNA polymerase II subunit B1 CTD phospha...  70.1    1e-10   Phaethon lepturus
ref|XP_009883195.1|  PREDICTED: putative RNA polymerase II subuni...  70.1    1e-10   Charadrius vociferus
ref|XP_010284714.1|  PREDICTED: putative RNA polymerase II subuni...  70.1    2e-10   Phaethon lepturus
ref|XP_009466637.1|  PREDICTED: putative RNA polymerase II subuni...  70.1    2e-10   Nipponia nippon
ref|XP_010308897.1|  PREDICTED: putative RNA polymerase II subuni...  69.7    2e-10   Balearica regulorum gibbericeps
gb|EFA75713.1|  hypothetical protein PPL_10766                        69.7    3e-10   Heterostelium album PN500
ref|XP_010144144.1|  PREDICTED: putative RNA polymerase II subuni...  69.3    3e-10   Buceros rhinoceros silvestris
ref|XP_005111887.1|  PREDICTED: RNA polymerase II subunit B1 CTD ...  69.3    3e-10   Aplysia californica
ref|XP_010643225.1|  PREDICTED: putative RNA polymerase II subuni...  68.9    3e-10   Fukomys damarensis [Damara mole rat]
gb|KFQ07254.1|  Putative RNA polymerase II subunit B1 CTD phospha...  68.9    3e-10   Haliaeetus albicilla
ref|XP_010643223.1|  PREDICTED: putative RNA polymerase II subuni...  68.9    3e-10   Fukomys damarensis [Damara mole rat]
ref|XP_009921126.1|  PREDICTED: putative RNA polymerase II subuni...  68.9    3e-10   Haliaeetus albicilla
ref|XP_009921124.1|  PREDICTED: putative RNA polymerase II subuni...  68.9    3e-10   Haliaeetus albicilla
ref|XP_009921125.1|  PREDICTED: putative RNA polymerase II subuni...  68.9    3e-10   Haliaeetus albicilla
gb|KFO14911.1|  Putative RNA polymerase II subunit B1 CTD phospha...  68.9    3e-10   Balearica regulorum gibbericeps
ref|XP_010643224.1|  PREDICTED: putative RNA polymerase II subuni...  68.9    4e-10   Fukomys damarensis [Damara mole rat]
gb|KFU96429.1|  Putative RNA polymerase II subunit B1 CTD phospha...  68.6    4e-10   Chaetura pelagica
ref|XP_010643219.1|  PREDICTED: putative RNA polymerase II subuni...  68.6    4e-10   Fukomys damarensis [Damara mole rat]
ref|XP_011570882.1|  PREDICTED: putative RNA polymerase II subuni...  68.6    4e-10   Aquila chrysaetos canadensis
ref|XP_011570881.1|  PREDICTED: putative RNA polymerase II subuni...  68.6    4e-10   Aquila chrysaetos canadensis
ref|XP_010643220.1|  PREDICTED: putative RNA polymerase II subuni...  68.6    4e-10   Fukomys damarensis [Damara mole rat]
ref|XP_010580938.1|  PREDICTED: putative RNA polymerase II subuni...  68.6    4e-10   Haliaeetus leucocephalus
ref|XP_010580937.1|  PREDICTED: putative RNA polymerase II subuni...  68.6    4e-10   Haliaeetus leucocephalus
ref|XP_010005058.1|  PREDICTED: putative RNA polymerase II subuni...  68.6    4e-10   Chaetura pelagica
ref|XP_010580941.1|  PREDICTED: putative RNA polymerase II subuni...  68.6    4e-10   Haliaeetus leucocephalus
gb|KFV85220.1|  Putative RNA polymerase II subunit B1 CTD phospha...  68.6    4e-10   Struthio camelus australis
ref|XP_009680871.1|  PREDICTED: putative RNA polymerase II subuni...  68.6    5e-10   Struthio camelus australis
gb|EOA96367.1|  RNA polymerase II-associated protein 2                68.2    5e-10   Anas platyrhynchos [duck]
ref|XP_006021886.1|  PREDICTED: putative RNA polymerase II subuni...  68.6    5e-10   Alligator sinensis
gb|KGL82916.1|  Putative RNA polymerase II subunit B1 CTD phospha...  68.2    5e-10   Tinamus guttatus
gb|KFO69587.1|  Putative RNA polymerase II subunit B1 CTD phospha...  68.2    5e-10   Cuculus canorus
gb|KFO84345.1|  Putative RNA polymerase II subunit B1 CTD phospha...  68.2    5e-10   Buceros rhinoceros silvestris
gb|KFV38843.1|  Putative RNA polymerase II subunit B1 CTD phospha...  68.2    5e-10   Tyto alba [Schleiereule]
gb|KFP64201.1|  Putative RNA polymerase II subunit B1 CTD phospha...  68.2    6e-10   Cariama cristata
ref|XP_005026619.1|  PREDICTED: putative RNA polymerase II subuni...  68.2    6e-10   
ref|XP_010221201.1|  PREDICTED: putative RNA polymerase II subuni...  68.2    6e-10   Tinamus guttatus
ref|XP_004936662.1|  PREDICTED: putative RNA polymerase II subuni...  68.2    6e-10   
gb|KFR15907.1|  Putative RNA polymerase II subunit B1 CTD phospha...  67.8    7e-10   Opisthocomus hoazin [hoatzin]
ref|XP_009968966.1|  PREDICTED: putative RNA polymerase II subuni...  67.8    7e-10   Tyto alba [Schleiereule]
ref|XP_009696734.1|  PREDICTED: putative RNA polymerase II subuni...  68.2    7e-10   Cariama cristata
ref|XP_004336464.1|  hypothetical protein ACA1_191490                 67.8    7e-10   Acanthamoeba castellanii str. Neff
gb|KFW92635.1|  Putative RNA polymerase II subunit B1 CTD phospha...  67.8    7e-10   Phalacrocorax carbo [common cormorant]
ref|XP_010200271.1|  PREDICTED: putative RNA polymerase II subuni...  67.8    7e-10   Colius striatus
ref|XP_422341.3|  PREDICTED: putative RNA polymerase II subunit B...  67.8    7e-10   Gallus gallus [bantam]
ref|XP_009505988.1|  PREDICTED: putative RNA polymerase II subuni...  67.8    7e-10   Phalacrocorax carbo [common cormorant]
gb|KFQ87403.1|  Putative RNA polymerase II subunit B1 CTD phospha...  67.8    8e-10   Phoenicopterus ruber ruber
ref|XP_005445626.1|  PREDICTED: putative RNA polymerase II subuni...  67.8    8e-10   
gb|KFQ31182.1|  Putative RNA polymerase II subunit B1 CTD phospha...  67.8    8e-10   Mesitornis unicolor
ref|XP_010891878.1|  PREDICTED: putative RNA polymerase II subuni...  67.8    8e-10   Esox lucius
gb|KFV98137.1|  Putative RNA polymerase II subunit B1 CTD phospha...  67.8    9e-10   Fulmarus glacialis
ref|XP_004936663.1|  PREDICTED: putative RNA polymerase II subuni...  67.8    9e-10   
ref|XP_009954591.1|  PREDICTED: putative RNA polymerase II subuni...  67.4    9e-10   Leptosomus discolor
ref|XP_009939486.1|  PREDICTED: putative RNA polymerase II subuni...  67.8    9e-10   Opisthocomus hoazin [hoatzin]
gb|KFQ00413.1|  Putative RNA polymerase II subunit B1 CTD phospha...  67.4    9e-10   Leptosomus discolor
ref|XP_010178058.1|  PREDICTED: putative RNA polymerase II subuni...  67.4    9e-10   Mesitornis unicolor
ref|XP_009584959.1|  PREDICTED: putative RNA polymerase II subuni...  67.4    1e-09   Fulmarus glacialis
ref|XP_010008588.1|  PREDICTED: putative RNA polymerase II subuni...  67.4    1e-09   Nestor notabilis
ref|XP_008107451.1|  PREDICTED: putative RNA polymerase II subuni...  67.4    1e-09   Anolis carolinensis [Carolina anole]
gb|KFH68863.1|  hypothetical protein MVEG_05667                       66.6    1e-09   Mortierella verticillata NRRL 6337
gb|KFW62173.1|  Putative RNA polymerase II subunit B1 CTD phospha...  67.0    1e-09   Pygoscelis adeliae
ref|XP_003220143.1|  PREDICTED: putative RNA polymerase II subuni...  67.0    1e-09   Anolis carolinensis [Carolina anole]
gb|KFM02492.1|  Putative RNA polymerase II subunit B1 CTD phospha...  67.0    1e-09   Aptenodytes forsteri
ref|XP_009332152.1|  PREDICTED: putative RNA polymerase II subuni...  67.0    2e-09   Pygoscelis adeliae
ref|XP_009288766.1|  PREDICTED: putative RNA polymerase II subuni...  66.6    2e-09   Aptenodytes forsteri
ref|XP_010081917.1|  PREDICTED: putative RNA polymerase II subuni...  66.6    2e-09   Pterocles gutturalis
gb|KFQ46383.1|  Putative RNA polymerase II subunit B1 CTD phospha...  66.6    2e-09   Nestor notabilis
gb|KFZ67848.1|  Putative RNA polymerase II subunit B1 CTD phospha...  66.6    2e-09   Podiceps cristatus
ref|XP_005237333.1|  PREDICTED: putative RNA polymerase II subuni...  66.6    2e-09   
ref|XP_003767274.1|  PREDICTED: putative RNA polymerase II subuni...  66.6    2e-09   
gb|KFQ19173.1|  Putative RNA polymerase II subunit B1 CTD phospha...  66.2    2e-09   Merops nubicus
gb|KFP54220.1|  Putative RNA polymerase II subunit B1 CTD phospha...  66.2    2e-09   Cathartes aura
ref|XP_008941127.1|  PREDICTED: putative RNA polymerase II subuni...  66.2    2e-09   Merops nubicus
ref|XP_007430941.1|  PREDICTED: putative RNA polymerase II subuni...  66.2    3e-09   Python bivittatus
ref|XP_005327786.1|  PREDICTED: putative RNA polymerase II subuni...  65.9    3e-09   Ictidomys tridecemlineatus
gb|KFP73135.1|  Putative RNA polymerase II subunit B1 CTD phospha...  65.9    3e-09   Apaloderma vittatum
ref|XP_007058961.1|  PREDICTED: putative RNA polymerase II subuni...  65.9    3e-09   
ref|XP_009876051.1|  PREDICTED: putative RNA polymerase II subuni...  65.5    4e-09   Apaloderma vittatum
gb|KFV62455.1|  Putative RNA polymerase II subunit B1 CTD phospha...  65.5    4e-09   Picoides pubescens
gb|KFV53029.1|  Putative RNA polymerase II subunit B1 CTD phospha...  65.5    4e-09   Gavia stellata
ref|XP_009908192.1|  PREDICTED: putative RNA polymerase II subuni...  65.5    5e-09   Picoides pubescens
ref|XP_009809588.1|  PREDICTED: putative RNA polymerase II subuni...  65.5    5e-09   Gavia stellata
emb|CCJ29703.1|  unnamed protein product                              62.8    5e-09   Pneumocystis jirovecii
gb|KFV14931.1|  Putative RNA polymerase II subunit B1 CTD phospha...  65.1    6e-09   Tauraco erythrolophus
ref|XP_003784205.1|  PREDICTED: putative RNA polymerase II subuni...  65.1    6e-09   Otolemur garnettii
ref|XP_010407785.1|  PREDICTED: putative RNA polymerase II subuni...  65.1    6e-09   Corvus cornix cornix
ref|XP_008920200.1|  PREDICTED: putative RNA polymerase II subuni...  65.1    6e-09   
ref|XP_008167162.1|  PREDICTED: putative RNA polymerase II subuni...  65.1    6e-09   
gb|EMC78949.1|  RNA polymerase II-associated protein 2                64.7    8e-09   
ref|XP_009981389.1|  PREDICTED: putative RNA polymerase II subuni...  64.7    8e-09   Tauraco erythrolophus
gb|KFP31733.1|  Putative RNA polymerase II subunit B1 CTD phospha...  64.7    8e-09   Colius striatus
ref|XP_005499029.1|  PREDICTED: putative RNA polymerase II subuni...  64.7    8e-09   
ref|XP_007934311.1|  PREDICTED: putative RNA polymerase II subuni...  64.7    8e-09   Orycteropus afer afer
emb|CDQ69912.1|  unnamed protein product                              64.7    9e-09   Oncorhynchus mykiss
ref|XP_005385102.1|  PREDICTED: putative RNA polymerase II subuni...  64.3    9e-09   Chinchilla lanigera
dbj|GAM26926.1|  hypothetical protein SAMD00019534_101010             64.3    9e-09   Acytostelium subglobosum LB1
ref|XP_011353946.1|  PREDICTED: putative RNA polymerase II subuni...  64.3    9e-09   Pteropus vampyrus
ref|XP_007480383.1|  PREDICTED: putative RNA polymerase II subuni...  64.3    9e-09   
gb|KFV15387.1|  Putative RNA polymerase II subunit B1 CTD phospha...  64.3    1e-08   Pterocles gutturalis
ref|XP_005542798.1|  PREDICTED: putative RNA polymerase II subuni...  64.3    1e-08   Macaca fascicularis [crab eating macaque]
ref|NP_001244819.1|  RNA polymerase II associated protein 2           64.3    1e-08   Macaca mulatta [rhesus macaque]
ref|XP_005542799.1|  PREDICTED: putative RNA polymerase II subuni...  64.3    1e-08   Macaca fascicularis [crab eating macaque]
gb|EHH14952.1|  hypothetical protein EGK_00969                        64.3    1e-08   Macaca mulatta [rhesus macaque]
ref|XP_005542797.1|  PREDICTED: putative RNA polymerase II subuni...  63.9    1e-08   Macaca fascicularis [crab eating macaque]
ref|XP_005154184.1|  PREDICTED: putative RNA polymerase II subuni...  64.3    1e-08   
ref|XP_005542796.1|  PREDICTED: putative RNA polymerase II subuni...  63.9    1e-08   Macaca fascicularis [crab eating macaque]
ref|XP_011746000.1|  PREDICTED: putative RNA polymerase II subuni...  63.9    1e-08   Macaca nemestrina [pigtail macaque]
ref|NP_001156933.1|  putative RNA polymerase II subunit B1 CTD ph...  63.9    1e-08   Mus musculus [mouse]
gb|EDL20152.1|  expressed sequence AW060207, isoform CRA_e            63.9    1e-08   Mus musculus [mouse]
gb|EDL20148.1|  expressed sequence AW060207, isoform CRA_b            63.9    1e-08   Mus musculus [mouse]
ref|XP_005359704.1|  PREDICTED: putative RNA polymerase II subuni...  63.9    1e-08   Microtus ochrogaster [prairie voles]
dbj|BAE26681.1|  unnamed protein product                              63.9    2e-08   Mus musculus [mouse]
ref|XP_008999943.1|  PREDICTED: putative RNA polymerase II subuni...  63.9    2e-08   Callithrix jacchus [common marmoset]
ref|NP_659160.2|  putative RNA polymerase II subunit B1 CTD phosp...  63.9    2e-08   Mus musculus [mouse]
ref|NP_001276499.1|  putative RNA polymerase II subunit B1 CTD ph...  63.5    2e-08   Mus musculus [mouse]
gb|EDL20147.1|  expressed sequence AW060207, isoform CRA_a            63.9    2e-08   Mus musculus [mouse]
dbj|BAE38864.1|  unnamed protein product                              63.5    2e-08   Mus musculus [mouse]
gb|AAH21895.1|  RNA polymerase II associated protein 2                63.9    2e-08   Mus musculus [mouse]
ref|XP_004928680.1|  PREDICTED: putative RNA polymerase II subuni...  63.5    2e-08   
ref|XP_002751129.1|  PREDICTED: putative RNA polymerase II subuni...  63.5    2e-08   Callithrix jacchus [common marmoset]
gb|EDL83980.1|  similar to Expressed sequence AW060207, isoform C...  63.5    2e-08   Rattus norvegicus [brown rat]
gb|EDL83982.1|  similar to Expressed sequence AW060207, isoform C...  63.5    2e-08   Rattus norvegicus [brown rat]
gb|KFW79298.1|  Putative RNA polymerase II subunit B1 CTD phospha...  63.5    2e-08   Manacus vitellinus
ref|NP_001014009.1|  RNA polymerase II subunit B1 CTD phosphatase...  63.5    2e-08   Rattus norvegicus [brown rat]
ref|XP_005939421.1|  PREDICTED: putative RNA polymerase II subuni...  63.5    2e-08   Haplochromis burtoni
ref|XP_011283173.1|  PREDICTED: putative RNA polymerase II subuni...  63.5    2e-08   Felis catus [cat]
ref|XP_004635812.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    2e-08   
ref|XP_002600173.1|  hypothetical protein BRAFLDRAFT_66681            63.5    2e-08   Branchiostoma floridae
ref|XP_010342159.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    2e-08   Saimiri boliviensis boliviensis
ref|XP_003933354.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    2e-08   Saimiri boliviensis boliviensis
ref|XP_010342158.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    2e-08   Saimiri boliviensis boliviensis
ref|XP_643755.1|  hypothetical protein DDB_G0275113                   63.2    2e-08   Dictyostelium discoideum AX4
ref|XP_006114230.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    2e-08   
ref|XP_006114228.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    2e-08   
ref|XP_009245916.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    2e-08   Pongo abelii [orang utan]
ref|XP_009245913.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    2e-08   
ref|NP_001125811.1|  putative RNA polymerase II subunit B1 CTD ph...  63.2    2e-08   Pongo abelii [orang utan]
ref|XP_008584956.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    3e-08   Galeopterus variegatus [Malayan flying lemur]
ref|XP_006114229.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    3e-08   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_007976160.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    3e-08   Chlorocebus sabaeus
ref|XP_005422183.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    3e-08   Geospiza fortis
ref|XP_007976159.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    3e-08   Chlorocebus sabaeus
ref|XP_009245911.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    3e-08   Pongo abelii [orang utan]
ref|XP_009211263.1|  PREDICTED: putative RNA polymerase II subuni...  63.2    3e-08   
ref|XP_010368669.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Rhinopithecus roxellana
ref|XP_011923373.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Cercocebus atys
ref|XP_011795365.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Colobus angolensis palliatus
ref|XP_010368668.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Rhinopithecus roxellana
ref|XP_010368670.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Rhinopithecus roxellana
ref|XP_003290404.1|  hypothetical protein DICPUDRAFT_37287            62.8    3e-08   Dictyostelium purpureum
ref|XP_007976158.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Chlorocebus sabaeus
ref|XP_005721062.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Pundamilia nyererei
ref|XP_007976157.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Chlorocebus sabaeus
ref|XP_011829849.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Mandrillus leucophaeus
ref|XP_012015234.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Ovis aries musimon
ref|XP_007073487.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Panthera tigris altaica
ref|XP_005271280.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Homo sapiens [man]
ref|XP_012015231.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Ovis aries musimon
ref|XP_012015233.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Ovis aries musimon
ref|XP_012015236.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Ovis aries musimon
ref|XP_012015235.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   
ref|XP_011923372.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Cercocebus atys
ref|XP_008958749.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Pan paniscus [bonobo]
ref|XP_012015226.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Ovis aries musimon
ref|XP_009086790.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Serinus canaria [canary]
ref|XP_009423625.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   
ref|XP_004570605.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Maylandia zebra
ref|XP_011540470.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   
ref|XP_003260098.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    3e-08   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_009423628.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    4e-08   
ref|XP_011540469.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    4e-08   Homo sapiens [man]
ref|XP_009423632.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    4e-08   
ref|XP_009423630.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    4e-08   
gb|AAH31070.1|  RPAP2 protein                                         62.8    4e-08   Homo sapiens [man]
gb|EAW73096.1|  chromosome 1 open reading frame 82, isoform CRA_b     62.8    4e-08   Homo sapiens [man]
ref|XP_005721063.1|  PREDICTED: putative RNA polymerase II subuni...  62.8    4e-08   Pundamilia nyererei
ref|XP_008167163.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_008167166.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_006710968.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|NP_079089.2|  putative RNA polymerase II subunit B1 CTD phosp...  62.4    4e-08   Homo sapiens [man]
ref|XP_003808473.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   Pan paniscus [bonobo]
ref|XP_001153375.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_008167164.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_006061411.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_008167165.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
gb|KFP85710.1|  Putative RNA polymerase II subunit B1 CTD phospha...  62.4    4e-08   
dbj|BAB14465.1|  unnamed protein product                              62.4    4e-08   
ref|XP_010858752.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_005204354.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_006786856.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_006786855.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_010858748.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_010858749.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_005678160.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
gb|ELR57117.1|  Putative RNA polymerase II subunit B1 CTD phospha...  62.4    4e-08   
ref|XP_010858750.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_003438069.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_006061410.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    4e-08   
ref|XP_012031586.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    5e-08   
gb|KFO56568.1|  Putative RNA polymerase II subunit B1 CTD phospha...  62.4    5e-08   
ref|XP_010858741.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    5e-08   
ref|XP_010858746.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    5e-08   
ref|XP_005894739.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    5e-08   
ref|XP_010858747.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    5e-08   
ref|XP_005678159.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    5e-08   
ref|XP_012031598.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    5e-08   
ref|XP_010801621.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    5e-08   
ref|XP_010801619.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    5e-08   
ref|XP_012031593.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_006061400.1|  PREDICTED: putative RNA polymerase II subuni...  62.4    5e-08   
ref|XP_009078217.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_006061409.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_010801620.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_012031568.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_004841621.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_012031534.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_004884162.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_005204353.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_012031575.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_007875680.1|  hypothetical protein PNEG_03586                  60.1    5e-08   
ref|XP_005204350.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|NP_001096736.1|  putative RNA polymerase II subunit B1 CTD ph...  62.0    5e-08   
ref|XP_005482147.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_008628718.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_010801617.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    5e-08   
ref|XP_005983310.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    6e-08   
ref|XP_006919471.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    6e-08   
ref|XP_006634860.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    6e-08   
ref|XP_005770598.1|  amidase                                          62.0    6e-08   
ref|XP_006728928.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    6e-08   
ref|XP_007480384.1|  PREDICTED: putative RNA polymerase II subuni...  62.0    6e-08   
ref|XP_004420904.1|  PREDICTED: putative RNA polymerase II subuni...  61.6    7e-08   
ref|XP_004378845.1|  PREDICTED: putative RNA polymerase II subuni...  61.6    7e-08   
ref|XP_005521036.1|  PREDICTED: putative RNA polymerase II subuni...  61.6    8e-08   
ref|XP_005077447.1|  PREDICTED: putative RNA polymerase II subuni...  61.6    8e-08   
ref|XP_003639145.2|  PREDICTED: putative RNA polymerase II subuni...  61.6    9e-08   
ref|XP_005621983.1|  PREDICTED: putative RNA polymerase II subuni...  61.6    9e-08   
ref|XP_007611460.1|  PREDICTED: putative RNA polymerase II subuni...  61.2    1e-07   
ref|XP_002929193.1|  PREDICTED: putative RNA polymerase II subuni...  61.2    1e-07   
ref|XP_009044246.1|  hypothetical protein LOTGIDRAFT_228169           61.2    1e-07   
emb|CAF96376.1|  unnamed protein product                              61.2    1e-07   
ref|XP_002190346.2|  PREDICTED: putative RNA polymerase II subuni...  61.2    1e-07   
ref|XP_011614856.1|  PREDICTED: putative RNA polymerase II subuni...  60.8    1e-07   
ref|XP_004455631.1|  PREDICTED: putative RNA polymerase II subuni...  61.2    1e-07   
ref|XP_006831115.1|  PREDICTED: putative RNA polymerase II subuni...  61.2    1e-07   
ref|XP_007611458.1|  PREDICTED: putative RNA polymerase II subuni...  61.2    1e-07   
ref|XP_008152944.1|  PREDICTED: putative RNA polymerase II subuni...  60.8    1e-07   
ref|XP_007611459.1|  PREDICTED: putative RNA polymerase II subuni...  60.8    1e-07   
gb|KFM57894.1|  putative RNA polymerase II subunit B1 CTD phospha...  60.8    1e-07   
ref|XP_007641141.1|  PREDICTED: putative RNA polymerase II subuni...  60.8    1e-07   
ref|XP_003502397.1|  PREDICTED: putative RNA polymerase II subuni...  60.8    1e-07   
ref|XP_005050410.1|  PREDICTED: putative RNA polymerase II subuni...  60.8    2e-07   
ref|XP_007641140.1|  PREDICTED: putative RNA polymerase II subuni...  60.8    2e-07   
ref|XP_005050411.1|  PREDICTED: putative RNA polymerase II subuni...  60.5    2e-07   
ref|XP_008054547.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  60.8    2e-07   
ref|XP_010148759.1|  PREDICTED: putative RNA polymerase II subuni...  60.5    2e-07   
gb|AEX09230.1|  RNA polymerase II associated protein 2                57.8    2e-07   
gb|ERE68205.1|  RNA polymerase II subunit B1 CTD phosphatase Rpap...  60.5    2e-07   
gb|ERE68206.1|  RNA polymerase II subunit B1 CTD phosphatase Rpap...  60.5    2e-07   
ref|XP_006678970.1|  hypothetical protein BATDEDRAFT_24950            60.5    2e-07   
ref|XP_008768151.1|  PREDICTED: RNA polymerase II subunit B1 CTD ...  60.5    2e-07   
gb|ERE68207.1|  RNA polymerase II subunit B1 CTD phosphatase Rpap...  60.5    2e-07   
ref|XP_002933850.2|  PREDICTED: putative RNA polymerase II subuni...  60.5    2e-07   
gb|KFO98654.1|  Putative RNA polymerase II subunit B1 CTD phospha...  60.5    2e-07   
gb|KFW04106.1|  Putative RNA polymerase II subunit B1 CTD phospha...  60.5    2e-07   
dbj|GAA99998.1|  hypothetical protein E5Q_06701                       60.1    2e-07   
ref|XP_004402585.1|  PREDICTED: putative RNA polymerase II subuni...  60.5    2e-07   
ref|XP_006250610.2|  PREDICTED: RNA polymerase II subunit B1 CTD ...  60.5    2e-07   
ref|XP_008489181.1|  PREDICTED: putative RNA polymerase II subuni...  60.5    2e-07   
gb|ERZ95953.1|  hypothetical protein GLOINDRAFT_13105                 60.1    2e-07   
ref|XP_004582237.1|  PREDICTED: putative RNA polymerase II subuni...  60.5    2e-07   
gb|EXX69899.1|  Rtr1p                                                 60.1    2e-07   
gb|EFA00145.1|  hypothetical protein TcasGA2_TC002966                 60.5    2e-07   
ref|XP_011353947.1|  PREDICTED: putative RNA polymerase II subuni...  60.1    3e-07   
ref|XP_003125954.1|  PREDICTED: putative RNA polymerase II subuni...  60.1    3e-07   
ref|XP_006191021.1|  PREDICTED: putative RNA polymerase II subuni...  59.7    3e-07   
ref|XP_010973986.1|  PREDICTED: putative RNA polymerase II subuni...  60.1    3e-07   
ref|XP_010948699.1|  PREDICTED: putative RNA polymerase II subuni...  59.7    3e-07   
ref|XP_002715910.1|  PREDICTED: putative RNA polymerase II subuni...  59.7    4e-07   
ref|XP_004653829.1|  PREDICTED: putative RNA polymerase II subuni...  59.3    4e-07   
ref|XP_006197384.1|  PREDICTED: putative RNA polymerase II subuni...  59.3    4e-07   
ref|XP_004367148.1|  hypothetical protein DFA_07285                   59.3    4e-07   
ref|XP_008525695.1|  PREDICTED: putative RNA polymerase II subuni...  59.3    4e-07   
gb|EFB16422.1|  hypothetical protein PANDA_019297                     59.3    5e-07   
ref|XP_008695934.1|  PREDICTED: putative RNA polymerase II subuni...  59.3    5e-07   
ref|XP_006534960.1|  PREDICTED: putative RNA polymerase II subuni...  58.9    6e-07   
ref|XP_006758268.1|  PREDICTED: putative RNA polymerase II subuni...  58.9    6e-07   
ref|XP_005879060.1|  PREDICTED: putative RNA polymerase II subuni...  58.9    6e-07   
ref|XP_004699636.1|  PREDICTED: putative RNA polymerase II subuni...  58.9    6e-07   
ref|XP_004752654.1|  PREDICTED: putative RNA polymerase II subuni...  58.9    6e-07   
gb|ELU07401.1|  hypothetical protein CAPTEDRAFT_223261                58.9    7e-07   
ref|XP_008332277.1|  PREDICTED: putative RNA polymerase II subuni...  58.5    8e-07   
ref|XP_001650225.1|  AAEL005036-PA                                    57.8    8e-07   
ref|XP_010342160.1|  PREDICTED: putative RNA polymerase II subuni...  58.2    9e-07   
emb|CDS07578.1|  hypothetical protein LRAMOSA01527                    58.2    9e-07   
ref|XP_004620000.1|  PREDICTED: putative RNA polymerase II subuni...  58.2    1e-06   
ref|XP_973653.1|  PREDICTED: RNA polymerase II subunit B1 CTD pho...  58.2    1e-06   
ref|XP_007976161.1|  PREDICTED: putative RNA polymerase II subuni...  58.2    1e-06   
ref|XP_006882547.1|  PREDICTED: putative RNA polymerase II subuni...  58.2    1e-06   
emb|CDH56433.1|  hypothetical protein RO3G_09153                      58.2    1e-06   
dbj|BAE00575.1|  unnamed protein product                              58.2    1e-06   
gb|ELW72626.1|  Putative RNA polymerase II subunit B1 CTD phospha...  57.8    1e-06   
ref|XP_008277394.1|  PREDICTED: putative RNA polymerase II subuni...  58.2    1e-06   
ref|XP_010368671.1|  PREDICTED: putative RNA polymerase II subuni...  58.2    1e-06   
ref|XP_008825052.1|  PREDICTED: putative RNA polymerase II subuni...  58.2    1e-06   
ref|XP_011555992.1|  PREDICTED: putative RNA polymerase II subuni...  58.2    1e-06   
ref|XP_006140211.1|  PREDICTED: putative RNA polymerase II subuni...  57.8    1e-06   
ref|XP_001969354.1|  GG24003                                          55.1    1e-06   
ref|XP_004521411.1|  PREDICTED: putative RNA polymerase II subuni...  55.1    1e-06   
ref|XP_006140212.1|  PREDICTED: putative RNA polymerase II subuni...  57.8    1e-06   
ref|XP_004995456.1|  hypothetical protein PTSG_03732                  57.8    1e-06   
gb|EHB02581.1|  RNA polymerase II-associated protein 2                57.8    1e-06   
ref|XP_007533342.1|  PREDICTED: putative RNA polymerase II subuni...  57.8    2e-06   
ref|NP_001276498.1|  putative RNA polymerase II subunit B1 CTD ph...  57.4    2e-06   
ref|XP_005610614.1|  PREDICTED: putative RNA polymerase II subuni...  57.4    2e-06   
ref|XP_007468618.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  57.4    2e-06   
ref|XP_006083627.1|  PREDICTED: putative RNA polymerase II subuni...  57.4    2e-06   
ref|XP_006093242.1|  PREDICTED: putative RNA polymerase II subuni...  57.4    2e-06   
gb|EDL20151.1|  expressed sequence AW060207, isoform CRA_d            57.4    2e-06   
ref|XP_011484429.1|  PREDICTED: putative RNA polymerase II subuni...  57.0    2e-06   
gb|ELK35751.1|  Putative RNA polymerase II subunit B1 CTD phospha...  57.4    2e-06   
ref|XP_007111337.1|  PREDICTED: putative RNA polymerase II subuni...  57.0    2e-06   
ref|XP_007111335.1|  PREDICTED: putative RNA polymerase II subuni...  57.0    2e-06   
ref|XP_005327787.1|  PREDICTED: putative RNA polymerase II subuni...  57.0    3e-06   
gb|ABL75622.1|  IP16834p                                              54.3    3e-06   
ref|XP_007111336.1|  PREDICTED: putative RNA polymerase II subuni...  57.0    3e-06   
gb|ABL75686.1|  IP17135p                                              54.3    3e-06   
ref|XP_010596411.1|  PREDICTED: putative RNA polymerase II subuni...  57.0    3e-06   
ref|NP_001097134.1|  CG34183                                          54.3    3e-06   
ref|XP_007111333.1|  PREDICTED: putative RNA polymerase II subuni...  57.0    3e-06   
ref|XP_010596410.1|  PREDICTED: putative RNA polymerase II subuni...  57.0    3e-06   
ref|XP_011484428.1|  PREDICTED: putative RNA polymerase II subuni...  56.6    3e-06   
ref|XP_011484427.1|  PREDICTED: putative RNA polymerase II subuni...  56.6    3e-06   
ref|XP_006821462.1|  PREDICTED: putative RNA polymerase II subuni...  56.6    3e-06   
ref|XP_011431743.1|  PREDICTED: putative RNA polymerase II subuni...  56.6    4e-06   
ref|XP_002078822.1|  GD22332                                          53.9    4e-06   
ref|XP_004026188.1|  PREDICTED: putative RNA polymerase II subuni...  56.2    4e-06   
ref|XP_002437040.1|  hypothetical protein SORBIDRAFT_10g019650        53.9    5e-06   
ref|XP_001636368.1|  predicted protein                                56.2    5e-06   
ref|XP_004263072.1|  PREDICTED: putative RNA polymerase II subuni...  56.2    5e-06   
ref|XP_011152230.1|  PREDICTED: RNA polymerase II subunit B1 CTD ...  56.2    5e-06   
gb|ABL75663.1|  IP17035p                                              53.5    5e-06   
gb|EHJ73636.1|  putative RNA polymerase II associated protein 2       55.8    5e-06   
ref|XP_007169661.1|  PREDICTED: putative RNA polymerase II subuni...  55.8    6e-06   
ref|XP_004322482.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  55.8    6e-06   
gb|EDL20153.1|  expressed sequence AW060207, isoform CRA_f            55.8    6e-06   
ref|NP_001156934.1|  putative RNA polymerase II subunit B1 CTD ph...  55.8    6e-06   
ref|XP_011152231.1|  PREDICTED: RNA polymerase II subunit B1 CTD ...  55.8    6e-06   
ref|XP_006534964.1|  PREDICTED: putative RNA polymerase II subuni...  55.8    6e-06   
gb|EDL20149.1|  expressed sequence AW060207, isoform CRA_c            55.8    6e-06   
ref|XP_002132518.1|  GA25874                                          53.5    6e-06   
gb|EDL83978.1|  similar to Expressed sequence AW060207, isoform C...  55.8    6e-06   
ref|XP_002014468.1|  GL19204                                          53.1    6e-06   
ref|XP_006250609.1|  PREDICTED: RNA polymerase II subunit B1 CTD ...  55.5    7e-06   
ref|XP_011315097.1|  PREDICTED: putative RNA polymerase II subuni...  55.5    7e-06   
gb|ABL75685.1|  IP17134p                                              53.1    7e-06   
ref|NP_001019603.2|  putative RNA polymerase II subunit B1 CTD ph...  55.5    7e-06   
ref|XP_002064461.1|  GK23863                                          53.1    8e-06   
ref|NP_001264859.1|  putative RNA polymerase II subunit B1 CTD ph...  55.5    9e-06   
ref|XP_005171230.1|  PREDICTED: putative RNA polymerase II subuni...  55.5    9e-06   
ref|XP_003744444.1|  PREDICTED: uncharacterized protein LOC100902359  55.1    1e-05   
ref|XP_010768887.1|  PREDICTED: putative RNA polymerase II subuni...  55.1    1e-05   
ref|XP_002170259.2|  PREDICTED: RNA polymerase II subunit B1 CTD ...  53.1    1e-05   
ref|XP_004689581.1|  PREDICTED: putative RNA polymerase II subuni...  54.7    1e-05   
ref|XP_006985886.1|  PREDICTED: putative RNA polymerase II subuni...  54.7    2e-05   
gb|AAH95735.1|  RNA polymerase II associated protein 2                54.3    2e-05   
ref|XP_010731640.1|  PREDICTED: putative RNA polymerase II subuni...  54.7    2e-05   
ref|XP_011860464.1|  PREDICTED: putative RNA polymerase II subuni...  52.4    2e-05   
ref|XP_001688997.1|  AGAP008431-PA                                    53.5    2e-05   
ref|XP_002003069.1|  GI24388                                          52.0    2e-05   
ref|XP_011700432.1|  PREDICTED: putative RNA polymerase II subuni...  54.3    2e-05   
ref|XP_001636369.1|  predicted protein                                52.4    2e-05   
gb|EFN75975.1|  RNA polymerase II-associated protein 2                54.3    2e-05   
gb|ETN62861.1|  hypothetical protein AND_005432                       53.5    3e-05   
ref|XP_001198968.3|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...  53.9    3e-05   
ref|XP_003478984.1|  PREDICTED: putative RNA polymerase II subuni...  53.9    3e-05   
ref|XP_007901737.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  53.1    3e-05   
ref|XP_008606660.1|  hypothetical protein SDRG_02834                  53.5    4e-05   
gb|EFN88275.1|  RNA polymerase II-associated protein 2                50.4    4e-05   
ref|XP_007885346.1|  PREDICTED: putative RNA polymerase II subuni...  53.1    4e-05   
ref|XP_011197804.1|  PREDICTED: putative RNA polymerase II subuni...  51.2    4e-05   
gb|EGI62338.1|  RNA polymerase II-associated protein 2                53.1    5e-05   
ref|XP_002110005.1|  hypothetical protein TRIADDRAFT_53493            53.1    5e-05   
ref|XP_007885347.1|  PREDICTED: putative RNA polymerase II subuni...  53.1    5e-05   
ref|XP_012063537.1|  PREDICTED: RNA polymerase II subunit B1 CTD ...  53.1    6e-05   
gb|EFX69879.1|  hypothetical protein DAPPUDRAFT_300664                52.8    6e-05   
ref|XP_011059734.1|  PREDICTED: putative RNA polymerase II subuni...  52.8    6e-05   
ref|XP_011059732.1|  PREDICTED: putative RNA polymerase II subuni...  52.8    6e-05   
gb|KDR21450.1|  RNA polymerase II-associated protein 2                52.4    8e-05   
ref|XP_005802457.1|  PREDICTED: putative RNA polymerase II subuni...  52.4    8e-05   
ref|XP_009833212.1|  hypothetical protein H257_08844                  52.4    9e-05   
ref|XP_001950425.1|  PREDICTED: putative RNA polymerase II subuni...  51.2    1e-04   
ref|XP_006565556.1|  PREDICTED: putative RNA polymerase II subuni...  52.4    1e-04   
ref|XP_008186012.1|  PREDICTED: putative RNA polymerase II subuni...  51.2    1e-04   
ref|XP_008874848.1|  hypothetical protein H310_10286                  52.0    1e-04   
ref|XP_002052438.1|  GJ21647                                          50.1    1e-04   
gb|KDO24368.1|  hypothetical protein SPRG_10446                       52.0    1e-04   
ref|XP_005179801.1|  PREDICTED: putative RNA polymerase II subuni...  49.7    1e-04   
gb|ELK34436.1|  Putative RNA polymerase II subunit B1 CTD phospha...  50.8    1e-04   
ref|XP_007568802.1|  PREDICTED: putative RNA polymerase II subuni...  51.6    1e-04   
ref|XP_008431585.1|  PREDICTED: putative RNA polymerase II subuni...  51.6    2e-04   
ref|XP_009833213.1|  hypothetical protein, variant 1                  51.6    2e-04   



>ref|XP_006358558.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Solanum tuberosum]
Length=662

 Score =   189 bits (479),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 84/107 (79%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K EA  VKDAVHKLQLCLL+GI+DEN+L+AAGSL+ RSDYQDVVTER+I NMCGYPLC
Sbjct  1    MAKGEAVAVKDAVHKLQLCLLEGIKDENQLIAAGSLLSRSDYQDVVTERSIANMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+R  KG YRI+L+EHK+YDL ETYMYCSTNC VNS AFAGS
Sbjct  61   SNSLPSERSRKGHYRISLKEHKVYDLHETYMYCSTNCVVNSGAFAGS  107



>ref|XP_011087531.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Sesamum indicum]
 ref|XP_011087533.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Sesamum indicum]
Length=655

 Score =   188 bits (478),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K E  TVKDAVHKLQL LL+GI +EN+L AAGSL+CRSDYQDVVTERTI+NMCGYPLC
Sbjct  1    MKKDEVLTVKDAVHKLQLSLLEGINNENQLSAAGSLICRSDYQDVVTERTIINMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+RP KGRYRI+L+EHK+YDL+ETY+YCS++C +NSRAFA S
Sbjct  61   SNSLPSERPRKGRYRISLKEHKVYDLQETYLYCSSSCLINSRAFAAS  107



>ref|XP_011087530.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Sesamum indicum]
Length=687

 Score =   188 bits (478),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K E  TVKDAVHKLQL LL+GI +EN+L AAGSL+CRSDYQDVVTERTI+NMCGYPLC
Sbjct  45   MKKDEVLTVKDAVHKLQLSLLEGINNENQLSAAGSLICRSDYQDVVTERTIINMCGYPLC  104

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+RP KGRYRI+L+EHK+YDL+ETY+YCS++C +NSRAFA S
Sbjct  105  SNSLPSERPRKGRYRISLKEHKVYDLQETYLYCSSSCLINSRAFAAS  151



>ref|XP_011087529.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Sesamum indicum]
Length=699

 Score =   188 bits (478),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K E  TVKDAVHKLQL LL+GI +EN+L AAGSL+CRSDYQDVVTERTI+NMCGYPLC
Sbjct  45   MKKDEVLTVKDAVHKLQLSLLEGINNENQLSAAGSLICRSDYQDVVTERTIINMCGYPLC  104

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+RP KGRYRI+L+EHK+YDL+ETY+YCS++C +NSRAFA S
Sbjct  105  SNSLPSERPRKGRYRISLKEHKVYDLQETYLYCSSSCLINSRAFAAS  151



>ref|XP_004230345.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Solanum lycopersicum]
Length=660

 Score =   186 bits (473),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 83/107 (78%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K EA  VKDAVHKLQLCLL+GI+DE++L+AAGSL+ RSDYQDVVTER+I NMCGYPLC
Sbjct  1    MAKGEAVAVKDAVHKLQLCLLEGIKDESQLIAAGSLLSRSDYQDVVTERSIANMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+R  KG YRI+L+EHK+YDL ETYMYCSTNC VNS AFAGS
Sbjct  61   SNSLPSERSRKGHYRISLKEHKVYDLHETYMYCSTNCVVNSGAFAGS  107



>ref|XP_009629188.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629189.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629190.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629192.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629193.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
Length=680

 Score =   182 bits (461),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 82/111 (74%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  286  KPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCG  465
            K S M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTER+IVNMCG
Sbjct  13   KSSLMANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIVNMCG  72

Query  466  YPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            YPLCSN LPS+RP KG YRI+L+EHK+YDL ETY YCSTNC VNS AFA S
Sbjct  73   YPLCSNSLPSERPSKGHYRISLKEHKVYDLHETYTYCSTNCVVNSGAFARS  123



>ref|XP_009602820.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602821.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
Length=664

 Score =   181 bits (459),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTERTI NMCGYPLC
Sbjct  1    MANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERTIANMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+RP KG YRI+L+EHK+YDL E YMYCSTNC VNS AFA S
Sbjct  61   SNCLPSERPKKGHYRISLKEHKVYDLHEAYMYCSTNCVVNSGAFARS  107



>ref|XP_009629199.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X4 [Nicotiana tomentosiformis]
Length=592

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  286  KPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCG  465
            K S M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTER+IVNMCG
Sbjct  13   KSSLMANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIVNMCG  72

Query  466  YPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            YPLCSN LPS+RP KG YRI+L+EHK+YDL ETY YCSTNC VNS AFA S
Sbjct  73   YPLCSNSLPSERPSKGHYRISLKEHKVYDLHETYTYCSTNCVVNSGAFARS  123



>ref|XP_009629194.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629195.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629196.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629197.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
Length=664

 Score =   181 bits (458),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 80/107 (75%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTER+IVNMCGYPLC
Sbjct  1    MANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIVNMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+RP KG YRI+L+EHK+YDL ETY YCSTNC VNS AFA S
Sbjct  61   SNSLPSERPSKGHYRISLKEHKVYDLHETYTYCSTNCVVNSGAFARS  107



>ref|XP_009629198.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Nicotiana tomentosiformis]
Length=656

 Score =   179 bits (455),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 82/111 (74%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  286  KPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCG  465
            K S M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTER+IVNMCG
Sbjct  13   KSSLMANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIVNMCG  72

Query  466  YPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            YPLCSN LPS+RP KG YRI+L+EHK+YDL ETY YCSTNC VNS AFA S
Sbjct  73   YPLCSNSLPSERPSKGHYRISLKEHKVYDLHETYTYCSTNCVVNSGAFARS  123



>ref|XP_002321396.2| hypothetical protein POPTR_0015s01330g [Populus trichocarpa]
 gb|EEF05523.2| hypothetical protein POPTR_0015s01330g [Populus trichocarpa]
Length=696

 Score =   179 bits (454),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++T VKD ++KLQL LLDGIQ+E++LLAAGS+M  SDY+DVVTERTI N+CGYPLC
Sbjct  1    MAKDQSTVVKDTIYKLQLSLLDGIQNEDQLLAAGSIMSHSDYEDVVTERTIANLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             N LPSDRP KGRYRI+L+EHK+YDL ETYMYCS++C +NSR F+GS
Sbjct  61   GNSLPSDRPQKGRYRISLKEHKVYDLHETYMYCSSSCVINSRTFSGS  107



>ref|XP_009602823.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
Length=576

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   E   VKDA+HKLQLCLL+GI+DEN+L AAGSL+ R DYQDVVTERTI NMCGYPLC
Sbjct  1    MANEEVIAVKDAIHKLQLCLLEGIKDENQLFAAGSLLSRRDYQDVVTERTIANMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+RP KG YRI+L+EHK+YDL E YMYCSTNC VNS AFA S
Sbjct  61   SNCLPSERPKKGHYRISLKEHKVYDLHEAYMYCSTNCVVNSGAFARS  107



>ref|XP_011044667.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Populus euphratica]
Length=722

 Score =   178 bits (451),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K + T VKD ++KLQL LL+GIQ+E++L AAGS+M RSDY+DVVTERTI N+CGYPLC
Sbjct  1    MAKDQLTVVKDTIYKLQLSLLEGIQNEDQLFAAGSIMSRSDYEDVVTERTIANLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             N LPSDRP KGRYRI+L+EHK+YDL ETYMYCS++C VNSR F+GS
Sbjct  61   GNSLPSDRPQKGRYRISLKEHKVYDLNETYMYCSSSCVVNSRTFSGS  107



>ref|XP_011044665.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Populus euphratica]
 ref|XP_011044666.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Populus euphratica]
Length=733

 Score =   178 bits (451),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K + T VKD ++KLQL LL+GIQ+E++L AAGS+M RSDY+DVVTERTI N+CGYPLC
Sbjct  1    MAKDQLTVVKDTIYKLQLSLLEGIQNEDQLFAAGSIMSRSDYEDVVTERTIANLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             N LPSDRP KGRYRI+L+EHK+YDL ETYMYCS++C VNSR F+GS
Sbjct  61   GNSLPSDRPQKGRYRISLKEHKVYDLNETYMYCSSSCVVNSRTFSGS  107



>ref|XP_012072543.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Jatropha curcas]
 ref|XP_012072544.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Jatropha curcas]
 ref|XP_012072546.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Jatropha curcas]
 gb|KDP37902.1| hypothetical protein JCGZ_05341 [Jatropha curcas]
Length=654

 Score =   177 bits (449),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++ +VKD VHKLQL LL+GI++E++L  AGSLM RSDY+DVVTER+I N+CGYPLC
Sbjct  1    MAKDQSISVKDTVHKLQLSLLEGIKNEDQLFTAGSLMSRSDYEDVVTERSIANLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            +N LP DRP+KGRYRI+L+EHK+YDL ETYMYCS++C VNSRAFAGS
Sbjct  61   NNSLPLDRPYKGRYRISLKEHKVYDLHETYMYCSSSCIVNSRAFAGS  107



>emb|CDP15205.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   177 bits (448),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K     +KDAVH+LQL LL+GIQDENKL AAGS+M +SDYQDVVTER+I N+CGYPLC
Sbjct  1    MAKDHVIAIKDAVHRLQLSLLEGIQDENKLFAAGSVMSQSDYQDVVTERSITNLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             N LP +RP KGRYRI+L+EHK+YDL ETYMYCSTNC VNS+AF  S
Sbjct  61   GNSLPLERPRKGRYRISLKEHKVYDLHETYMYCSTNCVVNSQAFVAS  107



>ref|XP_009771014.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana sylvestris]
 ref|XP_009771015.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana sylvestris]
Length=664

 Score =   176 bits (445),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   E   VKDA+HKLQL LL+GI+DEN+L AAGSL+ R DYQDVVTER+I NMCGYPLC
Sbjct  1    MANEEVIAVKDAIHKLQLYLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIANMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+RP  G YRI+L+EHK+YDL ETYMYCSTNC VNS AFA S
Sbjct  61   SNSLPSERPRNGHYRISLKEHKVYDLHETYMYCSTNCAVNSGAFARS  107



>gb|KHN23219.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 like 
[Glycine soja]
Length=706

 Score =   176 bits (446),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  +VKDAV KLQ+ LL+GIQ+E++L AAGSLM RSDY+D+VTER+I NMCGYPLC
Sbjct  1    MAKDKPVSVKDAVFKLQMSLLEGIQNEDQLFAAGSLMSRSDYEDIVTERSITNMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPSDRP KGRYRI+L+EHK+YDL+ETYM+CS+NC V+S+ FAGS
Sbjct  61   SNALPSDRPQKGRYRISLKEHKVYDLQETYMFCSSNCLVSSKTFAGS  107



>ref|XP_003519102.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Glycine max]
Length=706

 Score =   176 bits (445),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  +VKDAV KLQ+ LL+GIQ+E++L AAGSLM RSDY+D+VTER+I NMCGYPLC
Sbjct  1    MAKDKPVSVKDAVFKLQMSLLEGIQNEDQLFAAGSLMSRSDYEDIVTERSITNMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPSDRP KGRYRI+L+EHK+YDL+ETYM+CS+NC V+S+ FAGS
Sbjct  61   SNALPSDRPRKGRYRISLKEHKVYDLQETYMFCSSNCLVSSKTFAGS  107



>ref|XP_009771016.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana sylvestris]
Length=576

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   E   VKDA+HKLQL LL+GI+DEN+L AAGSL+ R DYQDVVTER+I NMCGYPLC
Sbjct  1    MANEEVIAVKDAIHKLQLYLLEGIKDENQLFAAGSLLSRRDYQDVVTERSIANMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGSC  621
            SN LPS+RP  G YRI+L+EHK+YDL ETYMYCSTNC VNS AFA S 
Sbjct  61   SNSLPSERPRNGHYRISLKEHKVYDLHETYMYCSTNCAVNSGAFARSL  108



>ref|XP_006575272.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Glycine max]
Length=716

 Score =   175 bits (444),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  +VKDAV KLQ+ LL+GIQ+E++L AAGSLM RSDY+D+VTER+I NMCGYPLC
Sbjct  1    MAKDKPVSVKDAVFKLQMSLLEGIQNEDQLFAAGSLMSRSDYEDIVTERSITNMCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPSDRP KGRYRI+L+EHK+YDL+ETYM+CS+NC V+S+ FAGS
Sbjct  61   SNALPSDRPRKGRYRISLKEHKVYDLQETYMFCSSNCLVSSKTFAGS  107



>ref|XP_002280625.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 ref|XP_010659731.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 ref|XP_010659732.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 emb|CBI39649.3| unnamed protein product [Vitis vinifera]
Length=659

 Score =   175 bits (443),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   +   VKDAVHKLQL LL+GIQ+EN+L AAGSLM RSDY+DVVTERTI N+CGYPLC
Sbjct  1    MAGDQPIAVKDAVHKLQLFLLEGIQNENQLFAAGSLMSRSDYEDVVTERTIANLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+R  KG YRI+L+EHK+YDL ETYMYCS+ C VNSR+FAGS
Sbjct  61   SNSLPSERLRKGHYRISLKEHKVYDLHETYMYCSSGCVVNSRSFAGS  107



>emb|CAN62034.1| hypothetical protein VITISV_014731 [Vitis vinifera]
Length=659

 Score =   175 bits (443),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M   +   VKDAVHKLQL LL+GIQ+EN+L AAGSLM RSDY+DVVTERTI N+CGYPLC
Sbjct  1    MAGDQPIAVKDAVHKLQLFLLEGIQNENQLFAAGSLMSRSDYEDVVTERTIANLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPS+R  KG YRI+L+EHK+YDL ETYMYCS+ C VNSR+FAGS
Sbjct  61   SNSLPSERLRKGHYRISLKEHKVYDLHETYMYCSSGCVVNSRSFAGS  107



>ref|XP_002521936.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40460.1| conserved hypothetical protein [Ricinus communis]
Length=645

 Score =   174 bits (441),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K E+ +VKD V+KLQL LL+GI++E++LLAAGSLM RSDY+DVV ER+I N+CGYPLC
Sbjct  1    MAKEESVSVKDTVYKLQLSLLEGIENEDQLLAAGSLMSRSDYEDVVVERSISNLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            +N LPSDRP+KGRYRI+L+EH++YDL+ETYMYCS++C VNSRAF+ S
Sbjct  61   NNSLPSDRPYKGRYRISLKEHRVYDLQETYMYCSSSCLVNSRAFSES  107



>ref|XP_007016931.1| F2P16.20-like protein isoform 6 [Theobroma cacao]
 gb|EOY34550.1| F2P16.20-like protein isoform 6 [Theobroma cacao]
Length=515

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  VRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENK  384
             +F+ +  A+  P +    S + L+ +  S M K ++ +V +AVHK+QL LLDGI+DE +
Sbjct  24   AKFNRKPTATLKPPSLQQHSRERLSKKSSSSMAKEQSISVSEAVHKIQLHLLDGIRDEKQ  83

Query  385  LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRET  564
            LLA+GSL+ RSDY+DVVTERTI N CGYPLC+N LPS+   KGRYRI+L+EHK+YDL+ET
Sbjct  84   LLASGSLISRSDYEDVVTERTISNTCGYPLCANPLPSEPRRKGRYRISLKEHKVYDLQET  143

Query  565  YMYCSTNCCVNSRAFAGS  618
            YM+CSTNC +NSRAFAGS
Sbjct  144  YMFCSTNCLINSRAFAGS  161



>ref|XP_003537129.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Glycine max]
 gb|KHN37760.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 like 
[Glycine soja]
Length=706

 Score =   172 bits (437),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  +VKDAV KLQ+ LL+GIQ+E++L AAGSLM RSDY+D+VTER+I N+CGYPLC
Sbjct  1    MEKDKPVSVKDAVFKLQMSLLEGIQNEDQLFAAGSLMSRSDYEDIVTERSITNVCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LPSDRP KGRYRI+L+EHK+YDL ETYM+C +NC V+S+AFAGS
Sbjct  61   SNALPSDRPRKGRYRISLKEHKVYDLHETYMFCCSNCVVSSKAFAGS  107



>gb|KEH41826.1| RNA polymerase II subunit B1 CTD phosphatase RPAP2, putative 
[Medicago truncatula]
Length=702

 Score =   171 bits (434),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +   VKDAV KLQL LLDGIQ E++L AAGSL+ +SDY+DVVTER+I N+CGYPLC
Sbjct  1    MEKNQPVFVKDAVLKLQLALLDGIQKEDQLFAAGSLISKSDYEDVVTERSITNLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             N LP+DRP KGRYRI+L+EHK+YDL+ETYM+CS+ C +NS+AFAGS
Sbjct  61   RNALPTDRPRKGRYRISLKEHKVYDLQETYMFCSSGCVINSKAFAGS  107



>ref|XP_007016927.1| F2P16.20-like protein isoform 2 [Theobroma cacao]
 gb|EOY34546.1| F2P16.20-like protein isoform 2 [Theobroma cacao]
Length=679

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  VRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENK  384
             +F+ +  A+  P +    S + L+ +  S M K ++ +V +AVHK+QL LLDGI+DE +
Sbjct  24   AKFNRKPTATLKPPSLQQHSRERLSKKSSSSMAKEQSISVSEAVHKIQLHLLDGIRDEKQ  83

Query  385  LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRET  564
            LLA+GSL+ RSDY+DVVTERTI N CGYPLC+N LPS+   KGRYRI+L+EHK+YDL+ET
Sbjct  84   LLASGSLISRSDYEDVVTERTISNTCGYPLCANPLPSEPRRKGRYRISLKEHKVYDLQET  143

Query  565  YMYCSTNCCVNSRAFAGS  618
            YM+CSTNC +NSRAFAGS
Sbjct  144  YMFCSTNCLINSRAFAGS  161



>ref|XP_007016928.1| F2P16.20-like protein isoform 3, partial [Theobroma cacao]
 gb|EOY34547.1| F2P16.20-like protein isoform 3, partial [Theobroma cacao]
Length=703

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  VRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENK  384
             +F+ +  A+  P +    S + L+ +  S M K ++ +V +AVHK+QL LLDGI+DE +
Sbjct  24   AKFNRKPTATLKPPSLQQHSRERLSKKSSSSMAKEQSISVSEAVHKIQLHLLDGIRDEKQ  83

Query  385  LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRET  564
            LLA+GSL+ RSDY+DVVTERTI N CGYPLC+N LPS+   KGRYRI+L+EHK+YDL+ET
Sbjct  84   LLASGSLISRSDYEDVVTERTISNTCGYPLCANPLPSEPRRKGRYRISLKEHKVYDLQET  143

Query  565  YMYCSTNCCVNSRAFAGS  618
            YM+CSTNC +NSRAFAGS
Sbjct  144  YMFCSTNCLINSRAFAGS  161



>ref|XP_007016930.1| F2P16.20-like protein isoform 5 [Theobroma cacao]
 gb|EOY34549.1| F2P16.20-like protein isoform 5 [Theobroma cacao]
Length=708

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  VRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENK  384
             +F+ +  A+  P +    S + L+ +  S M K ++ +V +AVHK+QL LLDGI+DE +
Sbjct  24   AKFNRKPTATLKPPSLQQHSRERLSKKSSSSMAKEQSISVSEAVHKIQLHLLDGIRDEKQ  83

Query  385  LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRET  564
            LLA+GSL+ RSDY+DVVTERTI N CGYPLC+N LPS+   KGRYRI+L+EHK+YDL+ET
Sbjct  84   LLASGSLISRSDYEDVVTERTISNTCGYPLCANPLPSEPRRKGRYRISLKEHKVYDLQET  143

Query  565  YMYCSTNCCVNSRAFAGS  618
            YM+CSTNC +NSRAFAGS
Sbjct  144  YMFCSTNCLINSRAFAGS  161



>ref|XP_007016926.1| F2P16.20 protein, putative isoform 1 [Theobroma cacao]
 gb|EOY34545.1| F2P16.20 protein, putative isoform 1 [Theobroma cacao]
Length=739

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  205  VRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENK  384
             +F+ +  A+  P +    S + L+ +  S M K ++ +V +AVHK+QL LLDGI+DE +
Sbjct  24   AKFNRKPTATLKPPSLQQHSRERLSKKSSSSMAKEQSISVSEAVHKIQLHLLDGIRDEKQ  83

Query  385  LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRET  564
            LLA+GSL+ RSDY+DVVTERTI N CGYPLC+N LPS+   KGRYRI+L+EHK+YDL+ET
Sbjct  84   LLASGSLISRSDYEDVVTERTISNTCGYPLCANPLPSEPRRKGRYRISLKEHKVYDLQET  143

Query  565  YMYCSTNCCVNSRAFAGS  618
            YM+CSTNC +NSRAFAGS
Sbjct  144  YMFCSTNCLINSRAFAGS  161



>ref|XP_007145767.1| hypothetical protein PHAVU_007G265900g [Phaseolus vulgaris]
 gb|ESW17761.1| hypothetical protein PHAVU_007G265900g [Phaseolus vulgaris]
Length=706

 Score =   171 bits (432),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 72/106 (68%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +A +VKDAV KLQ+ LL+GIQ+E++L AAGSLM RSDY+D+VTER+I N+CGYPLC
Sbjct  1    MAKDKAVSVKDAVFKLQMLLLEGIQNEDQLFAAGSLMSRSDYEDIVTERSITNVCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             N LPS+RP KG+YRI+L+EHK+YDL+ETYM+CS+NC V+S+AF+G
Sbjct  61   CNALPSERPRKGKYRISLKEHKVYDLQETYMFCSSNCVVSSKAFSG  106



>ref|XP_007016929.1| F2P16.20 protein, putative isoform 4 [Theobroma cacao]
 gb|EOY34548.1| F2P16.20 protein, putative isoform 4 [Theobroma cacao]
Length=607

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++ +V +AVHK+QL LLDGI+DE +LLA+GSL+ RSDY+DVVTERTI N CGYPLC
Sbjct  1    MAKEQSISVSEAVHKIQLHLLDGIRDEKQLLASGSLISRSDYEDVVTERTISNTCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            +N LPS+   KGRYRI+L+EHK+YDL+ETYM+CSTNC +NSRAFAGS
Sbjct  61   ANPLPSEPRRKGRYRISLKEHKVYDLQETYMFCSTNCLINSRAFAGS  107



>ref|XP_004497627.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cicer arietinum]
Length=666

 Score =   165 bits (418),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  +VKDAV KLQL LL+GIQ E++L AAGSL+ RSDY+DVVTER+I  +C YPLC
Sbjct  1    MEKDQPISVKDAVFKLQLALLEGIQSEDQLFAAGSLISRSDYEDVVTERSITEVCSYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             N LPS+RP KGRYRI+L+EHK+YDL ETYM+CS++C VNS+AFAGS
Sbjct  61   CNALPSERPRKGRYRISLKEHKVYDLHETYMFCSSSCVVNSKAFAGS  107



>ref|XP_010271590.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Nelumbo nucifera]
 ref|XP_010271591.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Nelumbo nucifera]
Length=650

 Score =   164 bits (415),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M + +  +VKDAVHKLQL LL+GI +E++L AAGSLM RSDY+DVVTER I  +CGYPLC
Sbjct  1    MVEHQPLSVKDAVHKLQLSLLEGICNEDQLFAAGSLMSRSDYEDVVTERHITKVCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             N L  +RP KGRYRI+++EHK+YDL+ETYMYCS+ C VNSRAFAGS
Sbjct  61   KNPLSLERPRKGRYRISVKEHKVYDLQETYMYCSSGCLVNSRAFAGS  107



>ref|XP_010674526.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Beta vulgaris subsp. vulgaris]
 ref|XP_010674527.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Beta vulgaris subsp. vulgaris]
Length=730

 Score =   164 bits (416),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 69/107 (64%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K   TTV + VHKLQL LL+GI+D+N+L AAGSLM RSDY+DVVTER+I N+CGYPLC
Sbjct  1    MEKDRITTVSEVVHKLQLALLNGIEDDNQLFAAGSLMSRSDYEDVVTERSIANLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            SN LP +R  KG+YRI+++EH++YDL ET++YC ++C +NS+AFAGS
Sbjct  61   SNSLPVERSKKGQYRISIKEHRVYDLSETFLYCDSSCLINSKAFAGS  107



>ref|XP_010097327.1| hypothetical protein L484_006008 [Morus notabilis]
 gb|EXB67559.1| hypothetical protein L484_006008 [Morus notabilis]
Length=695

 Score =   163 bits (412),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 69/100 (69%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            +VKD V++LQL LL G+  E++L AAGS+M RSDY DVVTER+I N+CGYPLC N LPSD
Sbjct  10   SVKDTVYRLQLSLLQGLHGEDQLFAAGSIMSRSDYNDVVTERSIANLCGYPLCPNPLPSD  69

Query  499  RPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            RP KGRYRI+L+EHK+YDL ETYMYCS++C +NSR FA S
Sbjct  70   RPRKGRYRISLKEHKVYDLHETYMYCSSDCVINSRTFAAS  109



>ref|XP_008454119.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis melo]
 ref|XP_008454120.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis melo]
Length=661

 Score =   160 bits (406),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 69/106 (65%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++  +KD V+KLQL L +GIQ+EN+L AAGSLM RSDY+DVVTER+I N+CGYPLC
Sbjct  1    MAKNQSALIKDTVYKLQLALYEGIQNENQLFAAGSLMSRSDYEDVVTERSIANLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             + LPSD   +GRYRI+L+EHK+YDL ETY YCS+ C +NSRAF+G
Sbjct  61   HSNLPSDNTRRGRYRISLKEHKVYDLEETYKYCSSACLINSRAFSG  106



>ref|XP_004152151.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis sativus]
 ref|XP_011653018.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis sativus]
 gb|KGN52984.1| hypothetical protein Csa_4G009360 [Cucumis sativus]
Length=662

 Score =   157 bits (396),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++  +KD V+KLQL L +GI++EN+L AAGSLM RSDY+DVVTER+I ++CGYPLC
Sbjct  1    MAKNQSVLIKDTVYKLQLALYEGIKNENQLFAAGSLMSRSDYEDVVTERSIADLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             + LPSD   +GRYRI+L+EHK+YDL ETY YCS+ C +NSRAF+G
Sbjct  61   HSNLPSDNTRRGRYRISLKEHKVYDLEETYKYCSSACLINSRAFSG  106



>gb|EYU19406.1| hypothetical protein MIMGU_mgv1a003240mg [Erythranthe guttata]
Length=597

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDR  501
            VKDAVHKLQL LL+GI+ E++L+AAGSL+ +SDYQDVVTERTI ++CGYPLC N LPS+ 
Sbjct  9    VKDAVHKLQLSLLEGIKHESQLIAAGSLISQSDYQDVVTERTIAHVCGYPLCVNSLPSEP  68

Query  502  PHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            P KG YRI+L+EHK+YDL ET+MYCST C + SRAF  S
Sbjct  69   PRKGHYRISLKEHKVYDLHETHMYCSTECLIRSRAFGAS  107



>ref|XP_007208433.1| hypothetical protein PRUPE_ppa002134mg [Prunus persica]
 gb|EMJ09632.1| hypothetical protein PRUPE_ppa002134mg [Prunus persica]
Length=711

 Score =   156 bits (394),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 69/102 (68%), Positives = 84/102 (82%), Gaps = 2/102 (2%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            +VKD V+KLQL LL+GI+ ++ L  AGS++ RSDY DVVTERTI N+CGYPLCSN LPSD
Sbjct  14   SVKDTVYKLQLALLEGIKTQDHLYLAGSIISRSDYNDVVTERTIANLCGYPLCSNALPSD  73

Query  499  --RPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
              RPHKG YRI+L+EHK+YDL ETYMYCS+ C + S+AFA S
Sbjct  74   SSRPHKGHYRISLKEHKVYDLHETYMYCSSRCVIESKAFAQS  115



>ref|XP_006480289.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Citrus sinensis]
Length=768

 Score =   155 bits (392),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 69/101 (68%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP--S  495
            V DAVHKLQL LL+GI+ E +LLAAG+L+ +SDY DVVTER+I ++CGYPLCSN LP   
Sbjct  6    VNDAVHKLQLALLEGIEAEKQLLAAGTLISKSDYNDVVTERSIADLCGYPLCSNPLPPAD  65

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             R  KGRYRI+L+EHK+YD+RE Y+YCSTNC VNS+AF+GS
Sbjct  66   SRTRKGRYRISLKEHKVYDVRENYLYCSTNCLVNSKAFSGS  106



>gb|KJB31664.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31665.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31666.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31667.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31668.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
Length=708

 Score =   154 bits (390),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 67/109 (61%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  292  SRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYP  471
            S M K ++ +V +AVHK+QL LLDGI+DE +L+++GSL+ RSDY+DVVTER+I N CGYP
Sbjct  6    SSMAKDQSISVSEAVHKIQLHLLDGIRDEKQLISSGSLISRSDYEDVVTERSISNTCGYP  65

Query  472  LCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            LC N LPS+   +GRYRI+L+EH++YDL+ET  +CS +C +NSRAFAGS
Sbjct  66   LCQNPLPSEPRRRGRYRISLKEHRVYDLQETSRFCSADCLINSRAFAGS  114



>gb|EPS64466.1| hypothetical protein M569_10314, partial [Genlisea aurea]
Length=597

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K E  T+K+AV++LQ  LL+G ++EN+L AAGSLM R DYQD+VTER I  +CGYPLC
Sbjct  1    MAKDEILTMKEAVYRLQTSLLEGAKNENQLSAAGSLMSRGDYQDLVTERVIAKICGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFA  612
            SN L S+RP KGRYRI+L+EHK+YD++ETY +CS+ C +NSRAF+
Sbjct  61   SNNLNSERPSKGRYRISLKEHKVYDVQETYSFCSSGCLINSRAFS  105



>ref|XP_006841578.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Amborella trichopoda]
 gb|ERN03253.1| hypothetical protein AMTR_s00003p00194360 [Amborella trichopoda]
Length=591

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M      ++KDA++K+Q  LLDGI  EN+LLAA +L+ RSDY DVVTERTI N+CGYPLC
Sbjct  1    MAMNSIPSLKDAIYKIQTYLLDGISKENQLLAAANLISRSDYDDVVTERTITNLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFA  612
            + +LP DRP KGRYRI+L+EH +YDL+ET++YCS  C +NS+AF+
Sbjct  61   NKYLPCDRPKKGRYRISLKEHSVYDLKETWLYCSPECVINSQAFS  105



>gb|KHG00855.1| hypothetical protein F383_23706 [Gossypium arboreum]
Length=708

 Score =   151 bits (382),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 65/109 (60%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +1

Query  292  SRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYP  471
            S M K ++ +V +AVHK+QL LLDGI+DE +L+++GSL+ RSDY+DV+TER+I N CGYP
Sbjct  6    SSMAKDQSISVSEAVHKIQLHLLDGIRDEKQLISSGSLISRSDYEDVITERSISNTCGYP  65

Query  472  LCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            LC N LPS+   +GRYRI+L+EH++YDL+ET  +C  +C +NSRAFAGS
Sbjct  66   LCQNPLPSEPRRRGRYRISLKEHRVYDLQETSRFCLADCLINSRAFAGS  114



>gb|KHG00854.1| hypothetical protein F383_23706 [Gossypium arboreum]
Length=729

 Score =   151 bits (382),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 65/109 (60%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +1

Query  292  SRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYP  471
            S M K ++ +V +AVHK+QL LLDGI+DE +L+++GSL+ RSDY+DV+TER+I N CGYP
Sbjct  6    SSMAKDQSISVSEAVHKIQLHLLDGIRDEKQLISSGSLISRSDYEDVITERSISNTCGYP  65

Query  472  LCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            LC N LPS+   +GRYRI+L+EH++YDL+ET  +C  +C +NSRAFAGS
Sbjct  66   LCQNPLPSEPRRRGRYRISLKEHRVYDLQETSRFCLADCLINSRAFAGS  114



>ref|XP_008246291.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Prunus mume]
Length=711

 Score =   151 bits (381),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 83/102 (81%), Gaps = 2/102 (2%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSD  498
            +VKD V+KLQL LL+GI+ ++ L  AGS++ RSDY DVVTERTI N+CGYPLCSN LPS+
Sbjct  14   SVKDTVYKLQLALLEGIKTQDHLYLAGSIISRSDYNDVVTERTIANLCGYPLCSNALPSE  73

Query  499  --RPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
              RP KG YRI+L+EHK+YDL ETYMYCS+ C + S+AFA S
Sbjct  74   CSRPRKGHYRISLKEHKVYDLHETYMYCSSRCVIESKAFAQS  115



>ref|XP_010042212.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Eucalyptus grandis]
 gb|KCW84978.1| hypothetical protein EUGRSUZ_B01798 [Eucalyptus grandis]
Length=672

 Score =   148 bits (373),  Expect = 9e-38, Method: Composition-based stats.
 Identities = 68/110 (62%), Positives = 86/110 (78%), Gaps = 3/110 (3%)
 Frame = +1

Query  298  MTKTE--ATTVKDAVHKLQLCLLDGIQ-DENKLLAAGSLMCRSDYQDVVTERTIVNMCGY  468
            M K E    +VKDAV++LQ  LLDG    E +LLAAG+++ R DY+DVV ER+I  +CGY
Sbjct  1    MVKLEEAPVSVKDAVYRLQHLLLDGAAAGEAQLLAAGAILSRRDYEDVVAERSIAGLCGY  60

Query  469  PLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PLC+  LP+DRP KGRYRI+L+EH++YDL+ETYMYCS  C V+SRAFAGS
Sbjct  61   PLCATPLPADRPRKGRYRISLKEHRVYDLQETYMYCSPGCVVDSRAFAGS  110



>ref|XP_002874325.1| hypothetical protein ARALYDRAFT_326902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50584.1| hypothetical protein ARALYDRAFT_326902 [Arabidopsis lyrata subsp. 
lyrata]
Length=1147

 Score =   150 bits (379),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 67/118 (57%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = +1

Query  274  LNFRKP--SRMTKT-EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTER  444
            + FR P   +M K  EA  + DAVHKLQL +LDGI D+N+L AAG L+ R DY+DVVTER
Sbjct  326  IQFRFPFDGKMAKDDEAIAINDAVHKLQLAMLDGINDQNQLFAAGKLISRLDYEDVVTER  385

Query  445  TIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            TI  +CGYPLC  FLPSD   +G+YRI+L+EHK+YDL+ET  +CS  C ++S++F+G+
Sbjct  386  TIAKLCGYPLCRRFLPSDVSRRGKYRISLKEHKVYDLQETRKFCSAGCLIDSKSFSGT  443



>gb|KFK26439.1| hypothetical protein AALP_AA8G248600 [Arabis alpina]
Length=791

 Score =   149 bits (375),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 63/107 (59%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M+K +   V DAVHKLQL +LDGI D+ +L AAG++M RSDY+DVVTERTI  +CG+PLC
Sbjct  1    MSKDQVIAVNDAVHKLQLAMLDGITDQKQLFAAGTVMSRSDYEDVVTERTIAKLCGFPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
               LPS+   +G+YRI+L+EHK+YDL+ET  +CS +C ++SRAF+GS
Sbjct  61   RTSLPSEVSRRGKYRISLKEHKVYDLQETRKFCSADCLISSRAFSGS  107



>ref|XP_010551019.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Tarenaya hassleriana]
Length=719

 Score =   148 bits (373),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 62/107 (58%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M+K +   + +AV KLQL LLDGI D+ +L AAGSLM RSDY+DVVTERTI  +CGYPLC
Sbjct  1    MSKDQEIAINEAVRKLQLALLDGITDQKQLFAAGSLMSRSDYEDVVTERTIAKLCGYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             + LPS+   +GRYRI+L+EHK+YD++E   +CS++C ++SRAF+G+
Sbjct  61   GSSLPSEPSRRGRYRISLKEHKVYDMQEACKFCSSDCLISSRAFSGT  107



>ref|XP_006394906.1| hypothetical protein EUTSA_v10003721mg [Eutrema salsugineum]
 gb|ESQ32192.1| hypothetical protein EUTSA_v10003721mg [Eutrema salsugineum]
Length=720

 Score =   146 bits (369),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  304  KTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN  483
            + +A  + DAVHK+QL +LDGI D+ +L AAG+LM R DY+DVVTERTI  +CGYPLC  
Sbjct  4    RDQAIAINDAVHKIQLAMLDGITDQKQLFAAGTLMSRLDYEDVVTERTIAKLCGYPLCRA  63

Query  484  FLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFA  612
             LPSD   +G+YRI+L+EHK+YDLRET  +CS +C +NSRAF+
Sbjct  64   SLPSDVSRRGKYRISLKEHKVYDLRETRKFCSADCLINSRAFS  106



>ref|XP_010921353.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Elaeis guineensis]
Length=664

 Score =   145 bits (367),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDG-IQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            + TV +A+H++Q+ LLDG    E +L AAG+L+ R DY+DVV ER+I + CGYPLC N L
Sbjct  7    SVTVANAIHRIQIALLDGATSSERQLFAAGALLSRPDYEDVVVERSIADHCGYPLCPNPL  66

Query  490  PSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            P DRP KGRYR++LREHK+YDL+ETY YCS  C + SRAFAGS
Sbjct  67   PHDRPLKGRYRVSLREHKVYDLKETYKYCSPACVIASRAFAGS  109



>ref|XP_010921352.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Elaeis guineensis]
Length=681

 Score =   145 bits (367),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDG-IQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            + TV +A+H++Q+ LLDG    E +L AAG+L+ R DY+DVV ER+I + CGYPLC N L
Sbjct  7    SVTVANAIHRIQIALLDGATSSERQLFAAGALLSRPDYEDVVVERSIADHCGYPLCPNPL  66

Query  490  PSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            P DRP KGRYR++LREHK+YDL+ETY YCS  C + SRAFAGS
Sbjct  67   PHDRPLKGRYRVSLREHKVYDLKETYKYCSPACVIASRAFAGS  109



>ref|XP_010921354.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Elaeis guineensis]
Length=593

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDG-IQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            + TV +A+H++Q+ LLDG    E +L AAG+L+ R DY+DVV ER+I + CGYPLC N L
Sbjct  7    SVTVANAIHRIQIALLDGATSSERQLFAAGALLSRPDYEDVVVERSIADHCGYPLCPNPL  66

Query  490  PSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            P DRP KGRYR++LREHK+YDL+ETY YCS  C + SRAFAGS
Sbjct  67   PHDRPLKGRYRVSLREHKVYDLKETYKYCSPACVIASRAFAGS  109



>gb|ABR17753.1| unknown [Picea sitchensis]
Length=668

 Score =   144 bits (364),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 85/106 (80%), Gaps = 6/106 (6%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            A +VKDAV+K+Q  LLDG++ E +L AA +L+ +SDY+DVVTERTIVN+CGYPLCSN LP
Sbjct  2    APSVKDAVYKIQTTLLDGVKTEAQLHAAANLLSKSDYEDVVTERTIVNLCGYPLCSNKLP  61

Query  493  SD------RPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFA  612
            +       R  KGRYRI+L++HK+YDL+ET++YCST C +NSR F+
Sbjct  62   ASEEQQQQRKRKGRYRISLKDHKVYDLQETWLYCSTPCLINSRTFS  107



>ref|XP_010421540.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Camelina sativa]
Length=890

 Score =   146 bits (368),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            +   + DAVHKLQL +LDGI D+N+L AAG L+ R DY+DVVTERTI  +CGYPLC  FL
Sbjct  59   QVIAINDAVHKLQLAMLDGITDQNQLFAAGKLISRLDYEDVVTERTIAKLCGYPLCQRFL  118

Query  490  PSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PSD   +G+YRI+L+EHK+YDL+ET  +CS  C ++S+ F+G+
Sbjct  119  PSDVSRRGKYRISLKEHKVYDLQETGKFCSAGCLIDSKTFSGT  161



>gb|KHG28494.1| hypothetical protein F383_15905 [Gossypium arboreum]
Length=151

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K ++ +  +AVHK+QL LLDGI+DE +L ++GSL+ +S Y+DVVTER+I N+C YPLC
Sbjct  1    MAKDQSISGLEAVHKIQLHLLDGIRDEKQLFSSGSLISQSGYEDVVTERSISNICSYPLC  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             N LPS+   +GRYR  L+EH++YDL+ET  +CS +C +NS+AFAGS
Sbjct  61   RNPLPSEPRRRGRYRSFLKEHRVYDLQETNRFCSADCLINSQAFAGS  107



>ref|XP_008781193.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA polymerase II subunit 
B1 CTD phosphatase RPAP2 homolog [Phoenix dactylifera]
Length=689

 Score =   143 bits (360),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDGI-QDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            + T+ DAVH++Q+ L DG    E +L AAG+L+ RSDY+DVV ER+I + CGYPLC N L
Sbjct  7    SVTISDAVHQIQIALFDGAASSEGQLFAAGALLSRSDYEDVVVERSIADHCGYPLCPNPL  66

Query  490  PSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            P D P K RYRI+LREHK+YDL ETY YCS  C + SRAFAGS
Sbjct  67   PQDVPRKSRYRISLREHKVYDLEETYKYCSPACVIASRAFAGS  109



>ref|XP_006290171.1| hypothetical protein CARUB_v10003849mg [Capsella rubella]
 gb|EOA23069.1| hypothetical protein CARUB_v10003849mg [Capsella rubella]
Length=743

 Score =   143 bits (361),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 7/127 (6%)
 Frame = +1

Query  259  SSHQILNFRKPSRMT-------KTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRS  417
            SS  +L+  KP + +         +   + DAVHKLQL +L+GI D+N+L AAG L+ R 
Sbjct  8    SSPNLLSGSKPIKSSLHHTLRPNNQVIAINDAVHKLQLAMLEGITDQNQLFAAGKLISRL  67

Query  418  DYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVN  597
            DY+DVVTERTI  +CGYPLC  FLPSD   +G+YRI+L+EHK+YDL+ET  +CS  C ++
Sbjct  68   DYEDVVTERTIAKLCGYPLCQRFLPSDVSRRGKYRISLKEHKVYDLQETRKFCSAGCLID  127

Query  598  SRAFAGS  618
            S+ F G+
Sbjct  128  SKTFLGT  134



>ref|XP_009366054.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA polymerase II subunit 
B1 CTD phosphatase RPAP2 homolog [Pyrus x bretschneideri]
Length=704

 Score =   142 bits (359),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 64/102 (63%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP--  492
            +VKD V+KLQL LLDG++  + L  AGS++ RSDY DVVTERTI + CGYPLC N LP  
Sbjct  15   SVKDTVYKLQLALLDGVKTLDHLYLAGSIISRSDYNDVVTERTIADHCGYPLCPNALPPE  74

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            S RP KG YRI+L+EHK+YDL ETYMYCS++C + S+AF  S
Sbjct  75   SSRPRKGHYRISLKEHKVYDLHETYMYCSSSCLIESKAFVQS  116



>ref|XP_010493937.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Camelina sativa]
Length=879

 Score =   143 bits (360),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 62/118 (53%), Positives = 86/118 (73%), Gaps = 4/118 (3%)
 Frame = +1

Query  277  NFRKPSRMTKT----EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTER  444
            N ++  +  KT    +   + DAVHKLQL +LDGI ++N+L AAG L+ R DY+DVVTER
Sbjct  44   NVKEGKKREKTPIDDQVIAINDAVHKLQLAMLDGITEQNQLFAAGKLISRLDYEDVVTER  103

Query  445  TIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            TI  +CGYPLC  FLPSD   +G+YRI+L+EHK+YDL+ET  +CS  C ++S+ F+G+
Sbjct  104  TIAKLCGYPLCQRFLPSDVSRRGKYRISLKEHKVYDLQETGKFCSAGCLIDSKTFSGT  161



>ref|XP_010456737.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog, partial [Camelina sativa]
Length=622

 Score =   141 bits (355),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            +   + DAVHKLQL +LDGI ++N+L AAG L+ R DY+DVVTERTI  +CGYPLC  FL
Sbjct  59   QVIAINDAVHKLQLAMLDGITEQNQLFAAGKLISRLDYEDVVTERTIAKLCGYPLCQRFL  118

Query  490  PSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PSD   +G+YRI+L+EHK+YDL+ET  +CS  C ++S+ F+G+
Sbjct  119  PSDVSRRGKYRISLKEHKVYDLQETGKFCSAGCLIDSKTFSGT  161



>ref|XP_009335520.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Pyrus x bretschneideri]
Length=705

 Score =   140 bits (353),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 63/102 (62%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP--  492
            +VK+ V+KLQL LLDG++  ++L  AGS++ RSDY DVVTERTI + CGYPLC + LP  
Sbjct  15   SVKETVYKLQLALLDGVKTLDQLYLAGSIISRSDYGDVVTERTIADHCGYPLCPHALPPE  74

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            S RP KG YRI+L+EHK+YDL ETYMYCS++C + S+AFA S
Sbjct  75   SSRPRKGHYRISLKEHKVYDLHETYMYCSSSCLIESKAFAQS  116



>ref|XP_008388442.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Malus domestica]
Length=706

 Score =   139 bits (349),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP--  492
            +VKD V+KLQL LL+G++  ++L  AGS++ RSDY DVVTERTI + CGYPLC + LP  
Sbjct  16   SVKDTVYKLQLALLEGVKTLDQLYLAGSIISRSDYSDVVTERTIADHCGYPLCPSALPPE  75

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            S  P KG YRI+L+EHK+YDL ETYMYCS++C + S+AFA S
Sbjct  76   SSHPRKGHYRISLKEHKVYDLHETYMYCSSSCLIGSKAFAQS  117



>ref|NP_974839.1| uncharacterized protein [Arabidopsis thaliana]
 sp|F4K1B1.1|RPAP2_ARATH RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Arabidopsis thaliana]
 gb|AED93598.1| uncharacterized protein AT5G26760 [Arabidopsis thaliana]
Length=735

 Score =   137 bits (346),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 58/103 (56%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            EA  + DAVHKLQL +L+   D+N+L AA  LM RSDY+DVVTER I  +CGY LC  FL
Sbjct  6    EAIAINDAVHKLQLYMLENTTDQNQLFAARKLMSRSDYEDVVTERAIAKLCGYTLCQRFL  65

Query  490  PSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PSD   +G+YRI+L++HK+YDL+ET  +CS  C ++S+ F+GS
Sbjct  66   PSDVSRRGKYRISLKDHKVYDLQETSKFCSAGCLIDSKTFSGS  108



>ref|XP_004302308.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Fragaria vesca subsp. vesca]
Length=692

 Score =   137 bits (345),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/102 (59%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            + +V DAV+KLQL LLD ++  ++L  AGS++ RSDY DVVTER+I ++CGYPLCSN LP
Sbjct  10   SKSVNDAVYKLQLALLDSVKTLDRLYLAGSIISRSDYTDVVTERSIADLCGYPLCSNALP  69

Query  493  --SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFA  612
              + R  KG YRI+L+EHK+YDLRET +YCS+ C ++S+AFA
Sbjct  70   PEASRTRKGHYRISLKEHKVYDLRETKLYCSSKCVIDSKAFA  111



>gb|AAB61054.1| contains similarity to myosin heavy chain [Arabidopsis thaliana]
Length=1133

 Score =   136 bits (342),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 60/109 (55%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = +1

Query  295  RMTK-TEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYP  471
            +M K  EA  + DAVHKLQL +L+   D+N+L AA  LM RSDY+DVVTER I  +CGY 
Sbjct  335  KMAKDNEAIAINDAVHKLQLYMLENTTDQNQLFAARKLMSRSDYEDVVTERAIAKLCGYT  394

Query  472  LCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            LC  FLPSD   +G+YRI+L++HK+YDL+ET  +CS  C ++S+ F+GS
Sbjct  395  LCQRFLPSDVSRRGKYRISLKDHKVYDLQETSKFCSAGCLIDSKTFSGS  443



>ref|XP_009389521.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Musa acuminata subsp. malaccensis]
Length=668

 Score =   133 bits (334),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = +1

Query  313  ATTVKDAVHKLQLCLLDGI-QDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            A TV DAV+++Q  LL+G  + E+ LL A +L+ RSDY+DVV E +I ++CGYPLC N L
Sbjct  7    AATVADAVYQIQQALLNGAARSEHHLLVAAALLSRSDYEDVVVELSIADVCGYPLCRNPL  66

Query  490  PSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PSDR  +GRYRI+LREHK+YDL ETY YC   C V+SRAF+ +
Sbjct  67   PSDRQKRGRYRISLREHKVYDLEETYKYCCEACVVSSRAFSAT  109



>emb|CDX78156.1| BnaA09g33510D [Brassica napus]
Length=262

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            +A  + DAVHK+QL LL+GI  +  L +A +LM +SDY+DVVTERTI  +CGYPLC + L
Sbjct  6    QAIAINDAVHKIQLSLLNGITSQTHLFSARALMSQSDYEDVVTERTIAKLCGYPLCRSPL  65

Query  490  PSDR-PHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PSD    +G+YR++L+EH++YD+RE+  +CS  C V+SRAF  S
Sbjct  66   PSDDVSRRGKYRVSLKEHRVYDVRESQKFCSGECLVSSRAFEKS  109



>emb|CDY05542.1| BnaA02g31490D [Brassica napus]
Length=827

 Score =   129 bits (324),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/104 (55%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            EA  + DAVHK+QL LL+GI  +  L +A +LM +SDY+DVVTERTI  +CGYPLC + L
Sbjct  6    EAIAINDAVHKIQLALLNGITSQTHLFSARALMSQSDYEDVVTERTIAKLCGYPLCRSRL  65

Query  490  PSD-RPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PSD    +G+YR++L+EH++YD+RE+  +CS  C V+SRAF  S
Sbjct  66   PSDVVSRRGKYRVSLKEHRVYDVRESRKFCSGECLVSSRAFGKS  109



>ref|XP_009129907.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Brassica rapa]
Length=852

 Score =   127 bits (319),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 56/104 (54%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            +A  + DAVHK+QL LL+GI  +  L +A +LM +SDY+DVVTERTI  +CGYPLC + L
Sbjct  28   QAIAINDAVHKIQLALLNGITSQTHLFSARALMSQSDYEDVVTERTIAKLCGYPLCRSPL  87

Query  490  PSDR-PHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PSD    +G+YR++L+EH++YD+RE+  +CS  C V+SRAF  S
Sbjct  88   PSDDVSRRGKYRVSLKEHRVYDVRESRKFCSGECLVSSRAFGKS  131



>emb|CDY25002.1| BnaC02g40060D [Brassica napus]
Length=772

 Score =   126 bits (317),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 56/104 (54%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  310  EATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            +A  + DAVHK+QL LL+GI  +  L +A +LM +SDY+DVVTERTI  +CGYPLC + L
Sbjct  29   QAIAINDAVHKIQLSLLNGITSQTHLFSARALMSQSDYEDVVTERTIAKLCGYPLCRSPL  88

Query  490  PSDR-PHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PSD    +G+YR++L+EH++YD+RE+  +CS  C V+SRAF  S
Sbjct  89   PSDDVSRRGKYRVSLKEHRVYDVRESQKFCSGECLVSSRAFEKS  132



>ref|NP_001054566.2| Os05g0134300 [Oryza sativa Japonica Group]
 dbj|BAF16480.2| Os05g0134300 [Oryza sativa Japonica Group]
Length=224

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 76/132 (58%), Gaps = 17/132 (13%)
 Frame = +1

Query  238  GPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGI--QDENKLLAAGSLMC  411
            GP+T T++  ++    KP        TTV  AVH++Q+ L DG     E  L AA SL+ 
Sbjct  2    GPTTATDTGARM----KP--------TTVASAVHRVQMALYDGAAASREPLLRAAASLLS  49

Query  412  RSDYQDVVTERTIVNMCGYPLCSNFLPSDRPH---KGRYRIALREHKIYDLRETYMYCST  582
              DY DVVTER+I + CGYP C N LPS+        R+RI+LREH++YDL E   +CS 
Sbjct  50   GPDYADVVTERSIADACGYPACPNPLPSEDARGKAAPRFRISLREHRVYDLEEARKFCSE  109

Query  583  NCCVNSRAFAGS  618
             C V S AF  S
Sbjct  110  RCLVASAAFGAS  121



>ref|XP_002990357.1| hypothetical protein SELMODRAFT_447998 [Selaginella moellendorffii]
 gb|EFJ08626.1| hypothetical protein SELMODRAFT_447998 [Selaginella moellendorffii]
Length=608

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +1

Query  307  TEATTV-KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN  483
             EA  V K AV  +Q+ L +G++ + +L AA  L+ +S+Y DVVTER+    CG+PLC N
Sbjct  105  AEAVKVMKKAVFAIQMALYNGLRSDFQLKAATCLLTQSEYADVVTERSNDKQCGFPLCPN  164

Query  484  FLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             L  ++  KGRY I+LREHK+YDL ET  +CST C V+S+ +A S
Sbjct  165  SLKVEKARKGRYHISLREHKVYDLEETRAFCSTGCAVSSKTYAAS  209



>ref|XP_002979385.1| hypothetical protein SELMODRAFT_444189 [Selaginella moellendorffii]
 gb|EFJ19793.1| hypothetical protein SELMODRAFT_444189 [Selaginella moellendorffii]
Length=608

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +1

Query  307  TEATTV-KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN  483
             EA  V K AV  +Q+ L +G++ + +L AA  L+ +S+Y DVVTER+    CG+PLC N
Sbjct  105  AEAVKVMKKAVFAIQMALYNGLRSDFQLKAATCLLTQSEYADVVTERSNDKQCGFPLCPN  164

Query  484  FLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             L  ++  KGRY I+LREHK+YDL ET  +CST C V+S+ +A S
Sbjct  165  SLKVEKARKGRYHISLREHKVYDLEETRAFCSTGCAVSSKTYAAS  209



>sp|A2Y040.1|RPAP2_ORYSI RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Oryza sativa Indica Group]
 gb|EAY96450.1| hypothetical protein OsI_18345 [Oryza sativa Indica Group]
Length=726

 Score =   103 bits (258),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 59/132 (45%), Positives = 76/132 (58%), Gaps = 17/132 (13%)
 Frame = +1

Query  238  GPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGI--QDENKLLAAGSLMC  411
            GP+T T++  ++    KP        TTV  AVH++Q+ L DG     E  L AA SL+ 
Sbjct  2    GPTTATDAGARM----KP--------TTVASAVHRVQMALYDGAAASREPLLRAAASLLS  49

Query  412  RSDYQDVVTERTIVNMCGYPLCSNFLPSDRPH---KGRYRIALREHKIYDLRETYMYCST  582
              DY DVVTER+I + CGYP C N LPS+        R+RI+LREH++YDL E   +CS 
Sbjct  50   GPDYADVVTERSIADACGYPACPNPLPSEDARGKAAPRFRISLREHRVYDLEEARKFCSE  109

Query  583  NCCVNSRAFAGS  618
             C V S AF  S
Sbjct  110  RCLVASAAFGAS  121



>sp|Q6AVZ9.1|RPAP2_ORYSJ RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Oryza sativa Japonica Group]
 gb|AAT94046.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE62232.1| hypothetical protein OsJ_17019 [Oryza sativa Japonica Group]
Length=726

 Score =   103 bits (257),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 57/119 (48%), Positives = 70/119 (59%), Gaps = 9/119 (8%)
 Frame = +1

Query  289  PSRMTKTEA----TTVKDAVHKLQLCLLDGI--QDENKLLAAGSLMCRSDYQDVVTERTI  450
            P+  T T A    TTV  AVH++Q+ L DG     E  L AA SL+   DY DVVTER+I
Sbjct  3    PTTATDTGARMKPTTVASAVHRVQMALYDGAAASREPLLRAAASLLSGPDYADVVTERSI  62

Query  451  VNMCGYPLCSNFLPSDRPH---KGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             + CGYP C N LPS+        R+RI+LREH++YDL E   +CS  C V S AF  S
Sbjct  63   ADACGYPACPNPLPSEDARGKAAPRFRISLREHRVYDLEEARKFCSERCLVASAAFGAS  121



>emb|CDX80586.1| BnaC07g28580D [Brassica napus]
Length=607

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = +1

Query  298  MTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLC  477
            M K +  T+ DAVHKLQL +LD I D+  L AAG+L+ RSDY+DV+TERTI  +CGYPL 
Sbjct  1    MAKDQLITINDAVHKLQLAMLDRITDQKHLFAAGTLIYRSDYEDVITERTIAKLCGYPLR  60

Query  478  SNFLPSDRPHKGRYRIALREHKIYDLR  558
             +   S+   KG+Y+I++ EH +YDL+
Sbjct  61   RSSPLSNVSRKGKYQISISEHIVYDLK  87



>ref|XP_001782029.1| predicted protein [Physcomitrella patens]
 gb|EDQ53172.1| predicted protein [Physcomitrella patens]
Length=863

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDR  501
            +K AV ++QL LLDG+  + +L AAG ++ +S+Y DVV ER I  +CGY  C+N L ++ 
Sbjct  28   MKKAVLEVQLILLDGVNTDEQLQAAGKILSQSEYSDVVEERFIAKVCGYTRCANSLDTEN  87

Query  502  PHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFA  612
              KGRYRI+L   K+YDL E+  +CS +C + S+ F 
Sbjct  88   MRKGRYRISLSAKKVYDLEESRHFCSPSCLITSKDFG  124



>dbj|BAJ96888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/103 (48%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGI--QDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPS  495
            V  AV ++Q+ LLDG    DE  L AA  ++ R+DY DVVTER+I + CG+P C++ LP 
Sbjct  19   VAGAVFRVQMALLDGAAASDEPLLHAAAGVLSRADYDDVVTERSIADACGHPACASPLPD  78

Query  496  DRPHKG--RYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
                K   R+ I+LREH++YDL E   +CS  C V S AFA S
Sbjct  79   PANPKAAPRFHISLREHRVYDLEEARKFCSERCLVASAAFAAS  121



>ref|XP_002453603.1| hypothetical protein SORBIDRAFT_04g008880 [Sorghum bicolor]
 gb|EES06579.1| hypothetical protein SORBIDRAFT_04g008880 [Sorghum bicolor]
Length=251

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 62/107 (58%), Gaps = 7/107 (7%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLL---AAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            TV  AV ++Q+ LLDG    N+ L    A +L+ R+DY DV+TERTI + CG P C + L
Sbjct  35   TVASAVLRIQIALLDGAAASNEALLHAVASALLSRADYDDVITERTIADACGNPACPDPL  94

Query  490  PSDRPHKG----RYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PS          R+ IAL EH +YDL E   +CS  C V S+A A S
Sbjct  95   PSSGAAAAATGPRFHIALSEHHVYDLEEARKFCSDRCLVASKALAAS  141



>ref|XP_008650656.1| PREDICTED: uncharacterized protein LOC103631550 [Zea mays]
Length=318

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 63/105 (60%), Gaps = 5/105 (5%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLL---AAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            TV  AV ++Q+ LLDG    ++ L   AA +L+  +DY DVVTERTI + CG P C N L
Sbjct  164  TVASAVLRVQMALLDGAAVSSEALIHAAASALLSSADYDDVVTERTISDACGNPACPNPL  223

Query  490  PSDRPHK--GRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PS        R+ IAL EH++YDL E   +CS  C V S+A A S
Sbjct  224  PSSSAAATGPRFHIALSEHRVYDLEEARKFCSERCLVASKALAAS  268



>ref|XP_003569080.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Brachypodium distachyon]
Length=746

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = +1

Query  301  TKTEATTVKDAVHKLQLCLLDGIQDENK--LLAAGSLMCRSDYQDVVTERTIVNMCGY--  468
            T      V  AV+++QL LLDG    N+  L AA +++ R+DY DVVTER+I + CG+  
Sbjct  12   TTRTTMNVATAVYRVQLALLDGAAASNEPLLHAAAAVLSRADYDDVVTERSIADACGHPP  71

Query  469  -PLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
                     +      R+ I+LREH++YDL E   +CS  C V S AFA S
Sbjct  72   CASPLPAAAAAAAAPPRFHISLREHRVYDLEEARKFCSERCLVASAAFAAS  122



>ref|XP_002440538.1| hypothetical protein SORBIDRAFT_09g002730 [Sorghum bicolor]
 gb|EES18968.1| hypothetical protein SORBIDRAFT_09g002730 [Sorghum bicolor]
Length=746

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 58/107 (54%), Gaps = 7/107 (7%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRS---DYQDVVTERTIVNMCGYPLCSNFL  489
            TV  AV ++Q+ LLDG    N+ L   +        DY DVVTERTI + CG P C N L
Sbjct  15   TVASAVLRIQMALLDGAAASNEALLHAAASALLSRADYDDVVTERTIADACGNPACPNPL  74

Query  490  PSDRPHKG----RYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PS          R+ IAL EH++YDL E   +CS  C V S+A A S
Sbjct  75   PSSSSAAAATGPRFHIALSEHRVYDLEEARKFCSDRCLVASKALAAS  121



>ref|XP_008654513.1| PREDICTED: uncharacterized protein LOC100217208 isoform X1 [Zea 
mays]
 gb|AFW82703.1| hypothetical protein ZEAMMB73_107648 [Zea mays]
Length=725

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 49/105 (47%), Positives = 64/105 (61%), Gaps = 5/105 (5%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLL---AAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            TV  AV ++Q+ LLDG    ++ L   AA +L+ R+DY DVVTERTI ++CG P C N L
Sbjct  16   TVASAVLRVQMALLDGAAVSSEALIHAAASALLSRADYDDVVTERTISDVCGNPACPNPL  75

Query  490  PSDRPHKG--RYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             S        R+ IAL EH++YDL E   +CS  C V S+A A S
Sbjct  76   SSSSAAATGPRFHIALSEHRVYDLEEARKFCSERCLVASKALAAS  120



>ref|XP_008654514.1| PREDICTED: uncharacterized protein LOC100217208 isoform X2 [Zea 
mays]
Length=645

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 49/105 (47%), Positives = 64/105 (61%), Gaps = 5/105 (5%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLL---AAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL  489
            TV  AV ++Q+ LLDG    ++ L   AA +L+ R+DY DVVTERTI ++CG P C N L
Sbjct  16   TVASAVLRVQMALLDGAAVSSEALIHAAASALLSRADYDDVVTERTISDVCGNPACPNPL  75

Query  490  PSDRPHKG--RYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
             S        R+ IAL EH++YDL E   +CS  C V S+A A S
Sbjct  76   SSSSAAATGPRFHIALSEHRVYDLEEARKFCSERCLVASKALAAS  120



>ref|XP_004960407.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Setaria italica]
Length=739

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 45/95 (47%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query  322  VKDAVHKLQLCLLDGIQDENK---LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            V  AV ++Q+ LLDG    N+     AA +L+ R+DY DVVTERTI + CG P C N LP
Sbjct  18   VASAVLRVQMALLDGAAASNEPLLHAAASALLSRADYDDVVTERTIADACGNPACPNPLP  77

Query  493  SDRPHKG-RYRIALREHKIYDLRETYMYCSTNCCV  594
            +     G R+ I+LREH++YDL E   +CS  C V
Sbjct  78   AATTAGGPRFHISLREHRVYDLEEARKFCSERCLV  112



>ref|XP_002438289.1| hypothetical protein SORBIDRAFT_10g011190 [Sorghum bicolor]
 gb|EER89656.1| hypothetical protein SORBIDRAFT_10g011190 [Sorghum bicolor]
Length=229

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 55/107 (51%), Gaps = 7/107 (7%)
 Frame = +1

Query  319  TVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRS---DYQDVVTERTIVNMCGYPLCSNFL  489
            TV   V ++Q+ LLD     N+ L   +        DY DVVTERTI + CG P C + L
Sbjct  13   TVASVVLRIQIALLDCAAASNEALLHAAASALLSRADYDDVVTERTIADACGNPACPDPL  72

Query  490  PSDRPHKG----RYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            PS          R+ IAL EH++YDL E   +CS  C V S A A S
Sbjct  73   PSSGAAAAATVPRFHIALSEHRVYDLEEARKFCSDRCLVASMALAAS  119



>emb|CAJ38817.1| hypothetical protein [Platynereis dumerilii]
Length=888

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            ++  H+L   LL+    E  L  AG L+  S YQDV  ER I  MCGYP+CSN +  + P
Sbjct  33   EERAHRLVEQLLENPISEKFLTEAGKLITPSHYQDVTEERAITKMCGYPICSNVI-KNVP  91

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFA  612
             + +Y+I+ + +K+YD+ E   +CS  C   S  F+
Sbjct  92   RQ-KYKISTKTNKVYDISERKNFCSNQCYKASEFFS  126



>gb|KFP17480.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Egretta garzetta]
Length=569

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 59/101 (58%), Gaps = 6/101 (6%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            K A  K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L 
Sbjct  12   KVAFEKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL-  70

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +   K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  71   -ENVPKQKYRISTKTNRVYDITERKCFCSNFCYKASKYFEA  110



>ref|XP_006278788.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Alligator mississippiensis]
Length=632

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL  G L+  S Y+D V ER+I+ +CGYPLC N L  +  
Sbjct  48   KKALHIVEQLLEEDITEEF-LLNCGKLITPSHYKDAVDERSIIKLCGYPLCQNKL--EHV  104

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +K+YD+ E   +CS  C   S+ F
Sbjct  105  PKQKYRISTKTNKVYDITERKCFCSNFCYRASKYF  139



>ref|XP_009554783.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Cuculus canorus]
Length=670

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  44   KKALHIVEELLEEDITEEF-LLNSGKCITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  100

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  101  PKQKYRISTKTNRVYDITERKCFCSNFCYKASKYF  135



>ref|XP_010580936.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Haliaeetus leucocephalus]
Length=625

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 57/94 (61%), Gaps = 6/94 (6%)
 Frame = +1

Query  340  KLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPH  507
            K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +   
Sbjct  52   KKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL--ENVP  109

Query  508  KGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
            K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  110  KQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  143



>ref|XP_010161825.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Caprimulgus carolinensis]
Length=657

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  31   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  122



>gb|KFZ54164.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Caprimulgus carolinensis]
Length=570

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>gb|KFR00386.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Nipponia nippon]
Length=569

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>gb|KGL93104.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Charadrius vociferus]
Length=570

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>gb|KFQ74312.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Phaethon lepturus]
Length=574

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCKNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_009883195.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Charadrius vociferus]
Length=608

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  49   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  105

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  106  PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  142



>ref|XP_010284714.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Phaethon lepturus]
Length=615

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  31   KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCKNKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  124



>ref|XP_009466637.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Nipponia nippon]
Length=621

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  108  KKALHIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  164

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  165  PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  199



>ref|XP_010308897.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Balearica regulorum gibbericeps]
Length=682

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E   L +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  69   KKALHIVEQLLEENITEEF-FLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  125

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  126  PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  160



>gb|EFA75713.1| hypothetical protein PPL_10766 [Polysphondylium pallidum PN500]
Length=855

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 39/131 (30%), Positives = 63/131 (48%), Gaps = 4/131 (3%)
 Frame = +1

Query  223  APASTGPST*TNSSHQILNFRKPSRMTK--TEATTVKDAVHKLQLCLLDGIQDENKLLAA  396
            +  ST   +  NS    +  RK   M K  T+   +     + Q  L++ I  E +L  +
Sbjct  129  SSGSTDVDSTVNSLDNEVVRRKKEEMRKMITDKVMIDKKTFETQSILIENIVSEQELKLS  188

Query  397  GSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYC  576
               +  + Y D+V ER +  +CGYP C+  +   + +K  Y I+ ++ K+YD  E   YC
Sbjct  189  AMFLQPNHYDDIVVERALTKLCGYPTCNKQVQQRKSYK--YYISTKDQKVYDQEELANYC  246

Query  577  STNCCVNSRAF  609
            ST C  NS+ F
Sbjct  247  STECLTNSKLF  257



>ref|XP_010144144.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Buceros rhinoceros silvestris]
Length=628

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL++G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  31   KKALSIVEQLLEENITEEF-LLSSGKFITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  122



>ref|XP_005111887.1| PREDICTED: RNA polymerase II subunit B1 CTD phosphatase Rpap2-like 
isoform X1 [Aplysia californica]
 ref|XP_005111888.1| PREDICTED: RNA polymerase II subunit B1 CTD phosphatase Rpap2-like 
isoform X2 [Aplysia californica]
Length=681

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 2/85 (2%)
 Frame = +1

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALR  534
            L+DG  +E+ L+  G L+ R  Y D+V ER I  +CGYPLC    P +   K ++ I+ +
Sbjct  32   LIDGAVEESYLIECGQLISREHYSDIVEERAISLLCGYPLCDK--PLENIPKKKFHISTK  89

Query  535  EHKIYDLRETYMYCSTNCCVNSRAF  609
             +K+YD+ E   +CS  C   S+ F
Sbjct  90   SNKVYDISERKNFCSNQCLRASKHF  114



>ref|XP_010643225.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X5 [Fukomys damarensis]
Length=498

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 73/152 (48%), Gaps = 16/152 (11%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQ  348
            AG++   R +  APAS G +T T  +          R  + EA   K       A+H ++
Sbjct  9    AGNIRVGRRTRAAPAS-GKATGTKQTRATRQEDASKRKAELEAAVKKKIEFERKALHIVE  67

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN---FLPSDRPHKGRY  519
              L + I +E  L+  G  +  + Y DVV ER+IV  CGYPLC      +P     K +Y
Sbjct  68   QLLEENITEEF-LMECGKFITPAHYSDVVVERSIVKFCGYPLCQKKLGIVP-----KQKY  121

Query  520  RIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
            +I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  122  KISTKTNKVYDITERKSFCSNFCYKASKFFEA  153



>gb|KFQ07254.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Haliaeetus albicilla]
Length=569

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            K    K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L 
Sbjct  12   KIEFEKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL-  70

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +   K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  71   -ENVPKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_010643223.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Fukomys damarensis]
Length=562

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 73/152 (48%), Gaps = 16/152 (11%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQ  348
            AG++   R +  APAS G +T T  +          R  + EA   K       A+H ++
Sbjct  9    AGNIRVGRRTRAAPAS-GKATGTKQTRATRQEDASKRKAELEAAVKKKIEFERKALHIVE  67

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN---FLPSDRPHKGRY  519
              L + I +E  L+  G  +  + Y DVV ER+IV  CGYPLC      +P     K +Y
Sbjct  68   QLLEENITEEF-LMECGKFITPAHYSDVVVERSIVKFCGYPLCQKKLGIVP-----KQKY  121

Query  520  RIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
            +I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  122  KISTKTNKVYDITERKSFCSNFCYKASKFFEA  153



>ref|XP_009921126.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Haliaeetus albicilla]
Length=569

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            K    K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L 
Sbjct  14   KIEFEKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL-  72

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +   K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  73   -ENVPKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  112



>ref|XP_009921124.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Haliaeetus albicilla]
Length=592

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            K    K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L 
Sbjct  14   KIEFEKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL-  72

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +   K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  73   -ENVPKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  112



>ref|XP_009921125.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Haliaeetus albicilla]
Length=581

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            K    K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L 
Sbjct  14   KIEFEKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL-  72

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +   K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  73   -ENVPKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  112



>gb|KFO14911.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Balearica regulorum gibbericeps]
Length=570

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E   L +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALHIVEQLLEENITEEF-FLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_010643224.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X4 [Fukomys damarensis]
Length=560

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 73/152 (48%), Gaps = 16/152 (11%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQ  348
            AG++   R +  APAS G +T T  +          R  + EA   K       A+H ++
Sbjct  9    AGNIRVGRRTRAAPAS-GKATGTKQTRATRQEDASKRKAELEAAVKKKIEFERKALHIVE  67

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN---FLPSDRPHKGRY  519
              L + I +E  L+  G  +  + Y DVV ER+IV  CGYPLC      +P     K +Y
Sbjct  68   QLLEENITEEF-LMECGKFITPAHYSDVVVERSIVKFCGYPLCQKKLGIVP-----KQKY  121

Query  520  RIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
            +I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  122  KISTKTNKVYDITERKSFCSNFCYKASKFFEA  153



>gb|KFU96429.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Chaetura pelagica]
Length=568

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYKASKYFEA  110



>ref|XP_010643219.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Fukomys damarensis]
Length=617

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 73/152 (48%), Gaps = 16/152 (11%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQ  348
            AG++   R +  APAS G +T T  +          R  + EA   K       A+H ++
Sbjct  9    AGNIRVGRRTRAAPAS-GKATGTKQTRATRQEDASKRKAELEAAVKKKIEFERKALHIVE  67

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN---FLPSDRPHKGRY  519
              L + I +E  L+  G  +  + Y DVV ER+IV  CGYPLC      +P     K +Y
Sbjct  68   QLLEENITEEF-LMECGKFITPAHYSDVVVERSIVKFCGYPLCQKKLGIVP-----KQKY  121

Query  520  RIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
            +I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  122  KISTKTNKVYDITERKSFCSNFCYKASKFFEA  153



>ref|XP_011570882.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Aquila chrysaetos canadensis]
Length=590

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            K    K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L 
Sbjct  47   KIEFEKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL-  105

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +   K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  106  -ENVPKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  145



>ref|XP_011570881.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Aquila chrysaetos canadensis]
Length=613

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            K    K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L 
Sbjct  47   KIEFEKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL-  105

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +   K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  106  -ENVPKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  145



>ref|XP_010643220.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Fukomys damarensis]
 ref|XP_010643222.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Fukomys damarensis]
Length=606

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 73/152 (48%), Gaps = 16/152 (11%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQ  348
            AG++   R +  APAS G +T T  +          R  + EA   K       A+H ++
Sbjct  9    AGNIRVGRRTRAAPAS-GKATGTKQTRATRQEDASKRKAELEAAVKKKIEFERKALHIVE  67

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN---FLPSDRPHKGRY  519
              L + I +E  L+  G  +  + Y DVV ER+IV  CGYPLC      +P     K +Y
Sbjct  68   QLLEENITEEF-LMECGKFITPAHYSDVVVERSIVKFCGYPLCQKKLGIVP-----KQKY  121

Query  520  RIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
            +I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  122  KISTKTNKVYDITERKSFCSNFCYKASKFFEA  153



>ref|XP_010580938.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Haliaeetus leucocephalus]
Length=602

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            K    K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L 
Sbjct  47   KIEFEKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL-  105

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +   K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  106  -ENVPKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  145



>ref|XP_010580937.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Haliaeetus leucocephalus]
Length=614

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 6/101 (6%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            K    K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L 
Sbjct  47   KIEFEKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL-  105

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +   K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  106  -ENVPKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  145



>ref|XP_010005058.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Chaetura pelagica]
Length=609

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  41   KKALHIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  97

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  98   PKQKYRISTKTNRVYDITERKCFCSNFCYKASKYFEA  134



>ref|XP_010580941.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X4 [Haliaeetus leucocephalus]
Length=565

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 57/95 (60%), Gaps = 6/95 (6%)
 Frame = +1

Query  337  HKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
             K  LC+++ + +EN     LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  51   EKKALCIVEQLLEENITEEFLLNSGKFITPSHYKDIVDERSIIKLCGYPLCPNKL--ENV  108

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  109  PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  143



>gb|KFV85220.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Struthio camelus australis]
Length=572

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  L+ +G L+  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYTVEQLLEENITEEF-LVNSGKLITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_009680871.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Struthio camelus australis]
Length=598

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  L+ +G L+  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  33   KKALYTVEQLLEENITEEF-LVNSGKLITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  89

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  90   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  126



>gb|EOA96367.1| RNA polymerase II-associated protein 2, partial [Anas platyrhynchos]
Length=575

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+DVV ER+I+ +CGYP+C N L  +  
Sbjct  16   KKALHIVEQLLEENITEEF-LLNSGKNITPSHYKDVVDERSIIKLCGYPICQNKL--ENV  72

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  73   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  109



>ref|XP_006021886.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Alligator sinensis]
Length=611

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  L+  G L+  S Y+D V ER+I+ +CGYPLC N L  +  
Sbjct  48   KKALHIVEQLLEEDITEEF-LMNCGKLITPSHYKDAVDERSIIKLCGYPLCQNKL--EHV  104

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  105  AKQKYRISTKTNKVYDITERKCFCSNFCYRASKYFEA  141



>gb|KGL82916.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Tinamus guttatus]
Length=586

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  L+ +G L+  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYTVEQLLEENITEEF-LVNSGKLITPSHYKDIVDERSIIRLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>gb|KFO69587.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Cuculus canorus]
Length=569

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALHIVEELLEEDITEEF-LLNSGKCITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYKASKYFEA  110



>gb|KFO84345.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Buceros rhinoceros silvestris]
Length=562

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL++G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALSIVEQLLEENITEEF-LLSSGKFITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>gb|KFV38843.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Tyto alba]
Length=504

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+N+CGYPLC N L  +  
Sbjct  17   KKALYIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIINLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>gb|KFP64201.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Cariama cristata]
Length=569

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + + +E   L +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYIVEQLLEENVTEEF-FLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F G
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEG  110



>ref|XP_005026619.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Anas platyrhynchos]
Length=604

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 58/99 (59%), Gaps = 3/99 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+DVV ER+I+ +CGYP+C N L  +  
Sbjct  38   KKALHIVEQLLEENITEEF-LLNSGKNITPSHYKDVVDERSIIKLCGYPICQNKL--ENV  94

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGSC  621
             K +YRI+ + +++YD+ E   +CS  C   S+ F    
Sbjct  95   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEAQV  133



>ref|XP_010221201.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Tinamus guttatus]
Length=578

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  L+ +G L+  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  37   KKALYTVEQLLEENITEEF-LVNSGKLITPSHYKDIVDERSIIRLCGYPLCQNKL--ENV  93

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  94   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  130



>ref|XP_004936662.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X4 [Gallus gallus]
Length=626

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 37/103 (36%), Positives = 61/103 (59%), Gaps = 3/103 (3%)
 Frame = +1

Query  301  TKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCS  480
            T+ +    K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYP+C 
Sbjct  44   TRKKIELEKKALHIVEQLLEENITEEF-LLNSGRCITPSHYKDIVDERSIIKLCGYPVCQ  102

Query  481  NFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
            N L  +   K +YRI+ R +++YD+ E   +CS  C   S+ F
Sbjct  103  NKL--ENVPKQKYRISTRTNRVYDITERKCFCSNFCYRASKYF  143



>gb|KFR15907.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Opisthocomus hoazin]
Length=570

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYMVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_009968966.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Tyto alba]
Length=518

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 59/97 (61%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+N+CGYPLC N L  +  
Sbjct  31   KKALYIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIINLCGYPLCQNKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  124



>ref|XP_009696734.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Cariama cristata]
Length=601

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + + +E   L +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  31   KKALYIVEQLLEENVTEEF-FLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F G
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEG  124



>ref|XP_004336464.1| hypothetical protein ACA1_191490 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14451.1| hypothetical protein ACA1_191490 [Acanthamoeba castellanii str. 
Neff]
Length=507

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +1

Query  403  LMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDR--PHKGRYRIALREHKIYDLRETYMYC  576
            L+    Y+DVV ER +  +CG+PLC N+L +    P + RYRI+LRE ++YD+ +  ++C
Sbjct  56   LLTAGQYRDVVAERAVAGLCGFPLCPNYLTTAHAVPAQ-RYRISLREKRVYDVSDRVLFC  114

Query  577  STNCCVNSR  603
            S  C V++R
Sbjct  115  SDECLVSAR  123



>gb|KFW92635.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Phalacrocorax carbo]
Length=567

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYKASKYFEA  110



>ref|XP_010200271.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Colius striatus]
Length=622

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E   L +G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  61   KKALYIVEQLLEENITEEF-FLNSGKCITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  117

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  118  PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  152



>ref|XP_422341.3| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Gallus gallus]
Length=615

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYP+C N L  +  
Sbjct  52   KKALHIVEQLLEENITEEF-LLNSGRCITPSHYKDIVDERSIIKLCGYPVCQNKL--ENV  108

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ R +++YD+ E   +CS  C   S+ F  
Sbjct  109  PKQKYRISTRTNRVYDITERKCFCSNFCYRASKYFEA  145



>ref|XP_009505988.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Phalacrocorax carbo]
Length=542

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  31   KKALYIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYKASKYFEA  124



>gb|KFQ87403.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Phoenicopterus ruber ruber]
Length=574

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENK----LLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLP  492
            K    K  LC+++ + +EN      L +G  +  S Y+D+V ER+I+ +CGYPLC N L 
Sbjct  12   KIEFEKKALCIVEQLLEENITEEFFLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL-  70

Query  493  SDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +   K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  71   -ENVPKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_005445626.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Falco cherrug]
Length=624

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  51   KKALYIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  107

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  108  PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  142



>gb|KFQ31182.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Mesitornis unicolor]
Length=526

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER I+ +CGYPLC N L  +  
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKSITPSHYKDIVDERAIIKLCGYPLCHNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_010891878.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Esox lucius]
Length=615

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 74/139 (53%), Gaps = 2/139 (1%)
 Frame = +1

Query  193  SVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHKLQLCLLDGIQ  372
            S   V  S +A    G S    ++ ++    + +R+T  E   ++    ++   LLD   
Sbjct  3    SRKRVARSSKASKKDGKSVKAQTAAELARRTEATRVTFRERVQLEKRAVQVVERLLDNNV  62

Query  373  DENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYD  552
            +E+ L+    L+  + Y+DVV ER+IV +CGYP+CSN L   +    +++I+ + +K+YD
Sbjct  63   NEDLLVECARLITPTHYKDVVEERSIVKLCGYPICSNRL--GKVPTQQFKISTKTNKVYD  120

Query  553  LRETYMYCSTNCCVNSRAF  609
            + E   +CS  C   S++F
Sbjct  121  ITERKCFCSNYCYKASKSF  139



>gb|KFV98137.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Fulmarus glacialis]
Length=570

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_004936663.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X5 [Gallus gallus]
Length=594

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYP+C N L  +  
Sbjct  52   KKALHIVEQLLEENITEEF-LLNSGRCITPSHYKDIVDERSIIKLCGYPVCQNKL--ENV  108

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ R +++YD+ E   +CS  C   S+ F
Sbjct  109  PKQKYRISTRTNRVYDITERKCFCSNFCYRASKYF  143



>ref|XP_009954591.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Leptosomus discolor]
Length=549

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  36   KKALYIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  92

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  93   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  129



>ref|XP_009939486.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Opisthocomus hoazin]
Length=692

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  52   KKALYMVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  108

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  109  PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  143



>gb|KFQ00413.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Leptosomus discolor]
Length=526

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_010178058.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Mesitornis unicolor]
Length=544

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER I+ +CGYPLC N L  +  
Sbjct  31   KKALHIVEQLLEENITEEF-LLNSGKSITPSHYKDIVDERAIIKLCGYPLCHNKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  124



>ref|XP_009584959.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Fulmarus glacialis]
Length=545

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  31   KKALYIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  124



>ref|XP_010008588.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Nestor notabilis]
Length=628

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  62   KKALNIVEQLLEENITEEF-LLNSGKYITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  118

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  119  LKQKYRISTKTNRVYDITERKCFCSNFCYKASKYF  153



>ref|XP_008107451.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Anolis carolinensis]
Length=597

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 70/149 (47%), Gaps = 16/149 (11%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHK------LQ  348
            A S +  R   R P +  PS  TN            R    EA   K   H+      ++
Sbjct  6    ARSGSKARRQRRRPGNKQPSVLTNEDA-------AQRKAALEAAIRKKIEHERKALKVVE  58

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIA  528
              L D I +E  L   G L+  S Y+DVV ER IV +CGYP C N L  + P K +Y+I+
Sbjct  59   RLLEDDITEEF-LTNCGKLITPSHYKDVVEERFIVKLCGYPTCRNRL-QNVP-KQKYQIS  115

Query  529  LREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             + +K+YD+ E   +CS  C   S+ F G
Sbjct  116  TKTNKVYDITERKCFCSNFCYRASKYFEG  144



>gb|KFH68863.1| hypothetical protein MVEG_05667 [Mortierella verticillata NRRL 
6337]
Length=358

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 9/83 (11%)
 Frame = +1

Query  376  ENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPH---KGRYRIALREHKI  546
            E  L  A + + +S Y++ + ER I N+CGYPLC      DRP    KG++RI+L E K+
Sbjct  85   EATLGEAANRLKQSHYREAIEERKIGNLCGYPLC------DRPPRDIKGKFRISLSERKV  138

Query  547  YDLRETYMYCSTNCCVNSRAFAG  615
            +D+    +YCS+ C   SR   G
Sbjct  139  FDISVLKLYCSSTCLAASRWLEG  161



>gb|KFW62173.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Pygoscelis adeliae]
Length=570

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALRIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_003220143.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Anolis carolinensis]
Length=620

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 70/149 (47%), Gaps = 16/149 (11%)
 Frame = +1

Query  187  AGSVNSVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKDAVHK------LQ  348
            A S +  R   R P +  PS  TN            R    EA   K   H+      ++
Sbjct  6    ARSGSKARRQRRRPGNKQPSVLTNEDA-------AQRKAALEAAIRKKIEHERKALKVVE  58

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIA  528
              L D I +E  L   G L+  S Y+DVV ER IV +CGYP C N L  + P K +Y+I+
Sbjct  59   RLLEDDITEEF-LTNCGKLITPSHYKDVVEERFIVKLCGYPTCRNRL-QNVP-KQKYQIS  115

Query  529  LREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             + +K+YD+ E   +CS  C   S+ F G
Sbjct  116  TKTNKVYDITERKCFCSNFCYRASKYFEG  144



>gb|KFM02492.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Aptenodytes forsteri]
Length=570

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALRIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_009332152.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Pygoscelis adeliae]
Length=599

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  36   KKALRIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  92

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  93   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  129



>ref|XP_009288766.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Aptenodytes forsteri]
Length=598

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  35   KKALRIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  91

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  92   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  128



>ref|XP_010081917.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Pterocles gutturalis]
Length=629

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E   L +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  31   KKALYIVEQLLEENITEEF-FLNSGKCITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  122



>gb|KFQ46383.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Nestor notabilis]
Length=568

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALNIVEQLLEENITEEF-LLNSGKYITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   LKQKYRISTKTNRVYDITERKCFCSNFCYKASKYFEA  110



>gb|KFZ67848.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Podiceps cristatus]
Length=570

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E   L +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYTVEQLLEENITEEF-FLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSDFCYRASKYFEA  110



>ref|XP_005237333.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Falco peregrinus]
Length=625

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  52   KKALYIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  108

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  109  PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  143



>ref|XP_003767274.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Sarcophilus harrisii]
Length=746

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 59/95 (62%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            + A+H ++  L + I +E  L+ +G  +  + Y+D+V ER I+++CGYPLC N L  + P
Sbjct  188  RKALHIVEQLLEEDITEEF-LMESGKHITSAHYKDIVEERFIIHLCGYPLCHNQL-GNVP  245

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +K+YD+ E   +CS  C   S+ F
Sbjct  246  -KQKYRISTKTNKVYDITERKYFCSNFCYRASKYF  279



>gb|KFQ19173.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Merops nubicus]
Length=502

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +   +  S Y+D+V ER+I+ +CGYPLC N L  D  
Sbjct  17   KKALYIVEQLLEENITEEF-LLNSAKFITPSHYKDIVDERSIIKLCGYPLCQNKL--DNV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSDFCYRASKYFEA  110



>gb|KFP54220.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Cathartes aura]
Length=569

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYIVEQLLEENITEEF-LLNSGKSITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_008941127.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Merops nubicus]
Length=549

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +   +  S Y+D+V ER+I+ +CGYPLC N L  D  
Sbjct  31   KKALYIVEQLLEENITEEF-LLNSAKFITPSHYKDIVDERSIIKLCGYPLCQNKL--DNV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSDFCYRASKYFEA  124



>ref|XP_007430941.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Python bivittatus]
Length=600

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            + A+  ++  L D I +E   +  G L+  S YQDVV ER I+ +CGYP+C N L  + P
Sbjct  47   RKALQVVESLLEDDITEEF-FVDCGRLITPSHYQDVVEERFIIRLCGYPVCRNKL-QNVP  104

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +Y+I+ + +K+YD+ E   +CS  C   S+ FAG
Sbjct  105  -KQKYKISTKTNKVYDITERKCFCSNFCYRASKYFAG  140



>ref|XP_005327786.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Ictidomys tridecemlineatus]
Length=609

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 60/116 (52%), Gaps = 15/116 (13%)
 Frame = +1

Query  295  RMTKTEATTVKD------AVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVN  456
            R T+ EA   K       A+H ++  L + I DE  L+  G  +  + Y DVV ER+I+ 
Sbjct  40   RKTELEAAVKKKIEFERRALHIVEQLLEENITDEF-LMECGKFITPAHYSDVVDERSIIK  98

Query  457  MCGYPLCSN---FLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
            +CGYPLC      +P     K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  99   LCGYPLCQKKLGIVP-----KQKYKISTKTNKVYDITERKSFCSDFCYKASKFFEA  149



>gb|KFP73135.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Apaloderma vittatum]
Length=567

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC   L  +  
Sbjct  17   KKALHIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIIKLCGYPLCQKKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_007058961.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Chelonia mydas]
Length=628

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 55/95 (58%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  L+  G+ +  S Y+D V ER I+ +CGYPLC N L +   
Sbjct  52   KKALHVVEQLLEEDITEEF-LVNCGNFITPSHYKDAVEERFIIKLCGYPLCQNRLENVPT  110

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K  YR++ + +K+YD+ E   +CS  C   S+ F
Sbjct  111  QK--YRVSTKTNKVYDITERKCFCSNFCYRASKYF  143



>ref|XP_009876051.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Apaloderma vittatum]
Length=600

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC   L  +  
Sbjct  31   KKALHIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIIKLCGYPLCQKKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  124



>gb|KFV62455.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Picoides pubescens]
Length=568

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  + Y+D+V ER I+ +CGYPLC N L  +  
Sbjct  17   KKALYIVEQLLEENITEEF-LLNSGKCITPAHYKDIVDERAIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ FA 
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFAA  110



>gb|KFV53029.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Gavia stellata]
Length=570

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC + L  +  
Sbjct  17   KKALYIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQSKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_009908192.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Picoides pubescens]
Length=612

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  + Y+D+V ER I+ +CGYPLC N L  +  
Sbjct  40   KKALYIVEQLLEENITEEF-LLNSGKCITPAHYKDIVDERAIIKLCGYPLCQNKL--ENV  96

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ FA 
Sbjct  97   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFAA  133



>ref|XP_009809588.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Gavia stellata]
Length=545

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC + L  +  
Sbjct  31   KKALYIVEQLLEENITEEF-LLNSGKFITPSHYKDIVDERSIIKLCGYPLCQSKL--ENV  87

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  88   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  124



>emb|CCJ29703.1| unnamed protein product, partial [Pneumocystis jirovecii]
Length=204

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 47/89 (53%), Gaps = 4/89 (4%)
 Frame = +1

Query  349  LCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIA  528
            L LL+ + D   L A GS +   DY++V+ ER +  +CGYPLC N     R  K  YRI 
Sbjct  8    LLLLNPV-DSATLCAVGSKLRPQDYENVLLERNLKKLCGYPLCHN---PPRKQKQPYRIL  63

Query  529  LREHKIYDLRETYMYCSTNCCVNSRAFAG  615
              + KIYD R    +CS NC   S  FA 
Sbjct  64   YSKCKIYDQRNLLRFCSVNCFKKSAFFAA  92



>gb|KFV14931.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Tauraco erythrolophus]
Length=568

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E   L +G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYIVEQLLEENITEEF-FLNSGKCITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_003784205.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Otolemur garnettii]
Length=610

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 56/100 (56%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I  E+ L+  G  +  + Y DVV ER+IVN+CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENI-TEDFLMECGKFITPAHYNDVVDERSIVNLCGYPLCQKRLGVVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKAFCSNFCYQASKFFEA  149



>ref|XP_010407785.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Corvus cornix cornix]
Length=646

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = +1

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALR  534
            LL+    E  LL  G  +  S Y+D+V ER+I+ +CGYPLC N L  +   K +YRI+ +
Sbjct  97   LLEEDITEEFLLNCGKCITPSHYKDIVDERSIIKLCGYPLCHNKL--ENVPKQKYRISTK  154

Query  535  EHKIYDLRETYMYCSTNCCVNSRAF  609
             +++YD+ E   +CS  C   S+ F
Sbjct  155  TNRVYDITERKCFCSNFCYRASKYF  179



>ref|XP_008920200.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Manacus vitellinus]
Length=632

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  74   KKALSIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  130

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +Y+I+ + +++YD+ E   +CS  C   S+ F
Sbjct  131  PKQKYKISTKTNRVYDITERKCFCSNFCYRASKYF  165



>ref|XP_008167162.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Chrysemys picta bellii]
Length=633

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 55/95 (58%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  L+  GS +  S Y+D V ER I+ +CGYPLC N L  +  
Sbjct  54   KKALRVVEQLLEEDITEEF-LVNCGSFITPSHYKDAVEERFIIKLCGYPLCRNGL--ENV  110

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YR++ + +K+YD+ E   +CS  C   S+ F
Sbjct  111  PKQKYRVSTKTNKVYDITERKCFCSNFCYRASKYF  145



>gb|EMC78949.1| RNA polymerase II-associated protein 2, partial [Columba livia]
Length=575

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALSIVEQLLEENITEEF-LLDSGKCITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  108



>ref|XP_009981389.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2, partial [Tauraco erythrolophus]
Length=578

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E   L +G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  65   KKALYIVEQLLEENITEEF-FLNSGKCITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  121

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  122  PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  156



>gb|KFP31733.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Colius striatus]
Length=566

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E   L +G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYIVEQLLEENITEEF-FLNSGKCITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_005499029.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Columba livia]
Length=597

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  35   KKALSIVEQLLEENITEEF-LLDSGKCITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  91

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
             K +YRI+ + +++YD+ E   +CS  C   S+ F
Sbjct  92   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYF  126



>ref|XP_007934311.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Orycteropus afer afer]
Length=680

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 36/98 (37%), Positives = 54/98 (55%), Gaps = 9/98 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L D I +E  LL  G  +  + Y DVV ER+I  +CGYPLC   L   P 
Sbjct  88   RKALHIVEQLLEDNITEEF-LLECGKFITSAHYNDVVDERSISKLCGYPLCQKKLGIVP-  145

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F
Sbjct  146  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFF  179



>emb|CDQ69912.1| unnamed protein product [Oncorhynchus mykiss]
Length=678

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 32/95 (34%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L D + D+  L+    L+  ++Y+D V ER+IV +CGYP+CSN L   + 
Sbjct  59   KRALQVVERLLEDSVADDF-LVDCARLITTANYKDTVEERSIVKLCGYPVCSNKL--GKV  115

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
               +++I+ + +K+YD+ E   +CS  C   S++F
Sbjct  116  STQQFKISTKTNKVYDITERKSFCSNFCYKASKSF  150



>ref|XP_005385102.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Chinchilla lanigera]
 ref|XP_005385103.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Chinchilla lanigera]
Length=604

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 68/139 (49%), Gaps = 14/139 (10%)
 Frame = +1

Query  223  APAS---TGPST*TNSSHQILNFRKPS--RMTKTEATTVKDAVHKLQLCLLDGIQDENKL  387
            APAS   TG    +   H+  + RK       K +    + A+H ++  L + I +E  L
Sbjct  17   APASRKATGTKQTSALRHEDASKRKAELEAAVKKKIEFERKALHIVEQLLEENITEEF-L  75

Query  388  LAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN---FLPSDRPHKGRYRIALREHKIYDLR  558
            L  G  +  + Y DVV ER+I+  CGYPLC      +P     K +Y+I+ + +K+YD+ 
Sbjct  76   LECGKFITPAHYSDVVVERSIIKFCGYPLCQKKLGIVP-----KQKYKISTKTNKVYDIT  130

Query  559  ETYMYCSTNCCVNSRAFAG  615
            E   +CS  C   S+ F  
Sbjct  131  ERKSFCSNFCYKASKYFEA  149



>dbj|GAM26926.1| hypothetical protein SAMD00019534_101010 [Acytostelium subglobosum 
LB1]
Length=504

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (48%), Gaps = 2/113 (2%)
 Frame = +1

Query  283  RKPSRMTKTEATTVKDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMC  462
            R   R   T+   ++    + Q  L++    E +L      +  + Y+D+V ER I  +C
Sbjct  81   RDKVRKLITDRVMIEKKTFETQATLIENTVTEEQLKLYAIFLQPNHYEDIVIERAIQKIC  140

Query  463  GYPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGSC  621
            GYP C+  +    P K  Y I+ ++ ++YD  E   YCST C  NS+ F  S 
Sbjct  141  GYPTCNKVVKEKLPFK--YYISTKDQRVYDQEELANYCSTECLTNSKLFKHSI  191



>ref|XP_011353946.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Pteropus vampyrus]
Length=608

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 69/137 (50%), Gaps = 11/137 (8%)
 Frame = +1

Query  220  RAPASTGPST*TNSSHQILNFRKPS--RMTKTEATTVKDAVHKLQLCLLDGIQDENKLLA  393
            RAP +   +  TN+  Q  + RK       + +    + A+H ++  L + I +E  L  
Sbjct  18   RAPRNPAGTKQTNALQQDTSKRKEELEETMRKKIEFERKALHIVEQLLEENITEEF-LRE  76

Query  394  AGSLMCRSDYQDVVTERTIVNMCGYPLCSN---FLPSDRPHKGRYRIALREHKIYDLRET  564
             G  +  + Y+DVV ER+I+ +CGYPLC      +P     K +Y+I+ + +K+YD+ E 
Sbjct  77   CGKFITPAHYRDVVDERSIIKLCGYPLCQKKLGIVP-----KQKYKISTKTNKVYDITER  131

Query  565  YMYCSTNCCVNSRAFAG  615
              +CS  C   S+ F  
Sbjct  132  KCFCSNFCYKASKFFQA  148



>ref|XP_007480383.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Monodelphis domestica]
Length=615

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +1

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALR  534
            LL+    E  L  AG  +  + Y+DVV ER I+ +CGYPLC N L  + P K +Y+I+ +
Sbjct  66   LLEEDITEEFLERAGKHITSAHYKDVVEERFIIKLCGYPLCHNKL-GNVP-KQKYKISTK  123

Query  535  EHKIYDLRETYMYCSTNCCVNSRAFAGSC  621
             +K+YD+ E   +CS  C   S+ F    
Sbjct  124  TNKVYDITERKFFCSNFCYRASKFFEAQI  152



>gb|KFV15387.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Pterocles gutturalis]
Length=570

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E   L +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALYIVEQLLEENITEEF-FLNSGKCITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|XP_005542798.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Macaca fascicularis]
Length=571

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|NP_001244819.1| RNA polymerase II associated protein 2 [Macaca mulatta]
Length=612

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_005542799.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X4 [Macaca fascicularis]
Length=565

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>gb|EHH14952.1| hypothetical protein EGK_00969, partial [Macaca mulatta]
Length=612

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_005542797.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Macaca fascicularis]
Length=573

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_005154184.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Melopsittacus undulatus]
Length=621

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A++ ++  L + I +E  LL  G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  43   KKALNIVEQLLEESITEEF-LLNCGKYITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  99

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  100  LKQKYRISTKTNRVYDITERKCFCSNFCYKASKYFEA  136



>ref|XP_005542796.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Macaca fascicularis]
 gb|EHH61759.1| hypothetical protein EGM_19845, partial [Macaca fascicularis]
Length=612

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_011746000.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Macaca nemestrina]
Length=612

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|NP_001156933.1| putative RNA polymerase II subunit B1 CTD phosphatase Rpap2 isoform 
B [Mus musculus]
 dbj|BAE36627.1| unnamed protein product [Mus musculus]
Length=568

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 69/144 (48%), Gaps = 19/144 (13%)
 Frame = +1

Query  226  PASTGPST*TNSSHQILNFRKPSRMTK----------TEATTVKD------AVHKLQLCL  357
            P S GPST  +S+H+     K +R  K           EA   +       AV  ++  L
Sbjct  7    PCSLGPSTRASSTHRDATGTKQTRALKRGDASKRQAELEAAIQRKVEFERKAVRIVEQLL  66

Query  358  LDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALRE  537
             + I +E  L   G  +  + Y DVV ER+I+ +CGYPLC   L      K +YRI+ + 
Sbjct  67   EENITEEF-LKECGMFITPAHYSDVVDERSIIKLCGYPLCQKKLGV--IPKQKYRISTKT  123

Query  538  HKIYDLRETYMYCSTNCCVNSRAF  609
            +K+YD+ E   +CS  C   S+ F
Sbjct  124  NKVYDITERKSFCSNFCYRASKFF  147



>gb|EDL20152.1| expressed sequence AW060207, isoform CRA_e [Mus musculus]
Length=570

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 69/144 (48%), Gaps = 19/144 (13%)
 Frame = +1

Query  226  PASTGPST*TNSSHQILNFRKPSRMTK----------TEATTVKD------AVHKLQLCL  357
            P S GPST  +S+H+     K +R  K           EA   +       AV  ++  L
Sbjct  7    PCSLGPSTRASSTHRDATGTKQTRALKRGDASKRQAELEAAIQRKVEFERKAVRIVEQLL  66

Query  358  LDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALRE  537
             + I +E  L   G  +  + Y DVV ER+I+ +CGYPLC   L      K +YRI+ + 
Sbjct  67   EENITEEF-LKECGMFITPAHYSDVVDERSIIKLCGYPLCQKKLGV--IPKQKYRISTKT  123

Query  538  HKIYDLRETYMYCSTNCCVNSRAF  609
            +K+YD+ E   +CS  C   S+ F
Sbjct  124  NKVYDITERKSFCSNFCYRASKFF  147



>gb|EDL20148.1| expressed sequence AW060207, isoform CRA_b [Mus musculus]
Length=568

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 69/144 (48%), Gaps = 19/144 (13%)
 Frame = +1

Query  226  PASTGPST*TNSSHQILNFRKPSRMTK----------TEATTVKD------AVHKLQLCL  357
            P S GPST  +S+H+     K +R  K           EA   +       AV  ++  L
Sbjct  7    PCSLGPSTRASSTHRDATGTKQTRALKRGDASKRQAELEAAIQRKVEFERKAVRIVEQLL  66

Query  358  LDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALRE  537
             + I +E  L   G  +  + Y DVV ER+I+ +CGYPLC   L      K +YRI+ + 
Sbjct  67   EENITEEF-LKECGMFITPAHYSDVVDERSIIKLCGYPLCQKKLGV--IPKQKYRISTKT  123

Query  538  HKIYDLRETYMYCSTNCCVNSRAF  609
            +K+YD+ E   +CS  C   S+ F
Sbjct  124  NKVYDITERKSFCSNFCYRASKFF  147



>ref|XP_005359704.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
Rpap2 [Microtus ochrogaster]
Length=605

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 69/144 (48%), Gaps = 17/144 (12%)
 Frame = +1

Query  223  APASTGPST*TNSSHQILNFRKPSRMTKTEATT-----VKDAVHKLQLC----------L  357
            AP   GPS   +S+H+     K +R+ K E  +     ++ AV +   C          L
Sbjct  6    APHCLGPSARASSTHRKAAGTKQTRVLKPEDASRRRAELEAAVQRKVECERKAVRIVEQL  65

Query  358  LDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALRE  537
            L+    E  L   G  +  + Y DVV ER I+ +CGYPLC   L +    K +Y+I+ + 
Sbjct  66   LEENITEEFLKECGMFITPAHYSDVVDERAIIKLCGYPLCQKKLGA--IPKQKYKISTKT  123

Query  538  HKIYDLRETYMYCSTNCCVNSRAF  609
            +K+YD+ E   +CS  C   S+ F
Sbjct  124  NKVYDITERKSFCSNFCYRASKFF  147



>dbj|BAE26681.1| unnamed protein product [Mus musculus]
Length=614

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 69/145 (48%), Gaps = 19/145 (13%)
 Frame = +1

Query  223  APASTGPST*TNSSHQILNFRKPSRMTK----------TEATTVKD------AVHKLQLC  354
             P S GPST  +S+H+     K +R  K           EA   +       AV  ++  
Sbjct  6    VPCSLGPSTRASSTHRDATGTKQTRALKRGDASKRQAELEAAIQRKVEFERKAVRIVEQL  65

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALR  534
            L + I +E  L   G  +  + Y DVV ER+I+ +CGYPLC   L      K +YRI+ +
Sbjct  66   LEENITEEF-LKECGMFITPAHYSDVVDERSIIKLCGYPLCQKKLGV--IPKQKYRISTK  122

Query  535  EHKIYDLRETYMYCSTNCCVNSRAF  609
             +K+YD+ E   +CS  C   S+ F
Sbjct  123  TNKVYDITERKSFCSNFCYRASKFF  147



>ref|XP_008999943.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Callithrix jacchus]
Length=582

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 55/97 (57%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L +   
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGT--V  112

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  113  PKQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|NP_659160.2| putative RNA polymerase II subunit B1 CTD phosphatase Rpap2 isoform 
A [Mus musculus]
 sp|Q8VC34.2|RPAP2_MOUSE RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
Rpap2; AltName: Full=RNA polymerase II-associated protein 
2 [Mus musculus]
Length=614

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 69/145 (48%), Gaps = 19/145 (13%)
 Frame = +1

Query  223  APASTGPST*TNSSHQILNFRKPSRMTK----------TEATTVKD------AVHKLQLC  354
             P S GPST  +S+H+     K +R  K           EA   +       AV  ++  
Sbjct  6    VPCSLGPSTRASSTHRDATGTKQTRALKRGDASKRQAELEAAIQRKVEFERKAVRIVEQL  65

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALR  534
            L + I +E  L   G  +  + Y DVV ER+I+ +CGYPLC   L      K +YRI+ +
Sbjct  66   LEENITEEF-LKECGMFITPAHYSDVVDERSIIKLCGYPLCQKKLGV--IPKQKYRISTK  122

Query  535  EHKIYDLRETYMYCSTNCCVNSRAF  609
             +K+YD+ E   +CS  C   S+ F
Sbjct  123  TNKVYDITERKSFCSNFCYRASKFF  147



>ref|NP_001276499.1| putative RNA polymerase II subunit B1 CTD phosphatase Rpap2 isoform 
E [Mus musculus]
Length=570

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 69/144 (48%), Gaps = 19/144 (13%)
 Frame = +1

Query  226  PASTGPST*TNSSHQILNFRKPSRMTK----------TEATTVKD------AVHKLQLCL  357
            P S GPST  +S+H+     K +R  K           EA   +       AV  ++  L
Sbjct  7    PCSLGPSTRASSTHRDATGTKQTRALKRGDASKRQAELEAAIQRKVEFERKAVRIVEQLL  66

Query  358  LDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALRE  537
             + I +E  L   G  +  + Y DVV ER+I+ +CGYPLC   L      K +YRI+ + 
Sbjct  67   EENITEEF-LKECGMFITPAHYSDVVDERSIIKLCGYPLCQKKLGV--IPKQKYRISTKT  123

Query  538  HKIYDLRETYMYCSTNCCVNSRAF  609
            +K+YD+ E   +CS  C   S+ F
Sbjct  124  NKVYDITERKSFCSNFCYRASKFF  147



>gb|EDL20147.1| expressed sequence AW060207, isoform CRA_a [Mus musculus]
Length=614

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 69/145 (48%), Gaps = 19/145 (13%)
 Frame = +1

Query  223  APASTGPST*TNSSHQILNFRKPSRMTK----------TEATTVKD------AVHKLQLC  354
             P S GPST  +S+H+     K +R  K           EA   +       AV  ++  
Sbjct  6    VPCSLGPSTRASSTHRDATGTKQTRALKRGDASKRQAELEAAIQRKVEFERKAVRIVEQL  65

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALR  534
            L + I +E  L   G  +  + Y DVV ER+I+ +CGYPLC   L      K +YRI+ +
Sbjct  66   LEENITEEF-LKECGMFITPAHYSDVVDERSIIKLCGYPLCQKKLGV--IPKQKYRISTK  122

Query  535  EHKIYDLRETYMYCSTNCCVNSRAF  609
             +K+YD+ E   +CS  C   S+ F
Sbjct  123  TNKVYDITERKSFCSNFCYRASKFF  147



>dbj|BAE38864.1| unnamed protein product [Mus musculus]
Length=570

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 69/144 (48%), Gaps = 19/144 (13%)
 Frame = +1

Query  226  PASTGPST*TNSSHQILNFRKPSRMTK----------TEATTVKD------AVHKLQLCL  357
            P S GPST  +S+H+     K +R  K           EA   +       AV  ++  L
Sbjct  7    PCSLGPSTRASSTHRDATGTKQTRALKRGDASKRQAELEAAIQRKVEFERKAVRIVEQLL  66

Query  358  LDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALRE  537
             + I +E  L   G  +  + Y DVV ER+I+ +CGYPLC   L      K +YRI+ + 
Sbjct  67   EENITEEF-LKECGMFITPAHYSDVVDERSIIKLCGYPLCQKKLGV--IPKQKYRISTKT  123

Query  538  HKIYDLRETYMYCSTNCCVNSRAF  609
            +K+YD+ E   +CS  C   S+ F
Sbjct  124  NKVYDITERKSFCSNFCYRASKFF  147



>gb|AAH21895.1| RNA polymerase II associated protein 2 [Mus musculus]
Length=614

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 69/145 (48%), Gaps = 19/145 (13%)
 Frame = +1

Query  223  APASTGPST*TNSSHQILNFRKPSRMTK----------TEATTVKD------AVHKLQLC  354
             P S GPST  +S+H+     K +R  K           EA   +       AV  ++  
Sbjct  6    VPCSLGPSTRASSTHRDATGTKQTRALKRGDASKRQAELEAAIQRKVEFERKAVRIVEQL  65

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALR  534
            L + I +E  L   G  +  + Y DVV ER+I+ +CGYPLC   L      K +YRI+ +
Sbjct  66   LEENITEEF-LKECGMFITPAHYSDVVDERSIIKLCGYPLCQKKLGV--IPKQKYRISTK  122

Query  535  EHKIYDLRETYMYCSTNCCVNSRAF  609
             +K+YD+ E   +CS  C   S+ F
Sbjct  123  TNKVYDITERKSFCSNFCYRASKFF  147



>ref|XP_004928680.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2-like [Bombyx mori]
Length=578

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  406  MCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTN  585
            + +S ++DV+ ER+I+++CGYPLCSN L      K +YRI+++ +K+YD+     +CS +
Sbjct  64   LNQSHFEDVIEERSIISLCGYPLCSNTLSKKDIPKQKYRISMKTNKVYDITVRKSFCSNS  123

Query  586  C  588
            C
Sbjct  124  C  124



>ref|XP_002751129.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Callithrix jacchus]
 ref|XP_008999942.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Callithrix jacchus]
Length=610

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 55/97 (57%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L +   
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGT--V  112

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  113  PKQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>gb|EDL83980.1| similar to Expressed sequence AW060207, isoform CRA_c [Rattus 
norvegicus]
Length=563

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 69/146 (47%), Gaps = 19/146 (13%)
 Frame = +1

Query  226  PASTGPST*TNSSHQILNFRKPS----------RMTKTEAT------TVKDAVHKLQLCL  357
            P S GPS   +S+H++    K +          R  + EA       + + AV  ++  L
Sbjct  7    PYSLGPSARASSTHRVATGTKQTSALKRRDASKRQAELEAALQRKVESERRAVRLVEQLL  66

Query  358  LDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALRE  537
             + I +E  L   G  +  + Y DVV ER I+ +CGYPLC   L      K +YRI+ + 
Sbjct  67   EENITEEF-LKECGMFITPAHYSDVVDERAIIKLCGYPLCQKKLGV--IPKQKYRISTKT  123

Query  538  HKIYDLRETYMYCSTNCCVNSRAFAG  615
            +K+YD+ E   +CS  C   S+ F  
Sbjct  124  NKVYDITERKSFCSNFCYKASKFFEA  149



>gb|EDL83982.1| similar to Expressed sequence AW060207, isoform CRA_e [Rattus 
norvegicus]
Length=577

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 69/146 (47%), Gaps = 19/146 (13%)
 Frame = +1

Query  226  PASTGPST*TNSSHQILNFRKPS----------RMTKTEAT------TVKDAVHKLQLCL  357
            P S GPS   +S+H++    K +          R  + EA       + + AV  ++  L
Sbjct  7    PYSLGPSARASSTHRVATGTKQTSALKRRDASKRQAELEAALQRKVESERRAVRLVEQLL  66

Query  358  LDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALRE  537
             + I +E  L   G  +  + Y DVV ER I+ +CGYPLC   L      K +YRI+ + 
Sbjct  67   EENITEEF-LKECGMFITPAHYSDVVDERAIIKLCGYPLCQKKLGV--IPKQKYRISTKT  123

Query  538  HKIYDLRETYMYCSTNCCVNSRAFAG  615
            +K+YD+ E   +CS  C   S+ F  
Sbjct  124  NKVYDITERKSFCSNFCYKASKFFEA  149



>gb|KFW79298.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2, 
partial [Manacus vitellinus]
Length=573

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 57/97 (59%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL +G  +  S Y+D+V ER+I+ +CGYPLC N L  +  
Sbjct  17   KKALSIVEQLLEENITEEF-LLNSGKCITPSHYKDIVDERSIIKLCGYPLCQNKL--ENV  73

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +Y+I+ + +++YD+ E   +CS  C   S+ F  
Sbjct  74   PKQKYKISTKTNRVYDITERKCFCSNFCYRASKYFEA  110



>ref|NP_001014009.1| RNA polymerase II subunit B1 CTD phosphatase Rpap2 [Rattus norvegicus]
 sp|Q5I0E6.1|RPAP2_RAT RecName: Full=RNA polymerase II subunit B1 CTD phosphatase Rpap2; 
AltName: Full=Putative RNA polymerase II-associated protein 
2 [Rattus norvegicus]
 gb|AAH88426.1| RNA polymerase II associated protein 2 [Rattus norvegicus]
 gb|EDL83981.1| similar to Expressed sequence AW060207, isoform CRA_d [Rattus 
norvegicus]
Length=609

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 69/146 (47%), Gaps = 19/146 (13%)
 Frame = +1

Query  226  PASTGPST*TNSSHQILNFRKPS----------RMTKTEAT------TVKDAVHKLQLCL  357
            P S GPS   +S+H++    K +          R  + EA       + + AV  ++  L
Sbjct  7    PYSLGPSARASSTHRVATGTKQTSALKRRDASKRQAELEAALQRKVESERRAVRLVEQLL  66

Query  358  LDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALRE  537
             + I +E  L   G  +  + Y DVV ER I+ +CGYPLC   L      K +YRI+ + 
Sbjct  67   EENITEEF-LKECGMFITPAHYSDVVDERAIIKLCGYPLCQKKL--GVIPKQKYRISTKT  123

Query  538  HKIYDLRETYMYCSTNCCVNSRAFAG  615
            +K+YD+ E   +CS  C   S+ F  
Sbjct  124  NKVYDITERKSFCSNFCYKASKFFEA  149



>ref|XP_005939421.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
rpap2-like [Haplochromis burtoni]
Length=640

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = +1

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PSDRPHKGRYRI  525
            LLD    E+ L+   +++  ++Y+D V ER+I  +CGYP+C N L   PS      +Y+I
Sbjct  52   LLDDSVAEDFLVDCATMITPANYRDTVEERSIAKLCGYPICPNKLGKIPSQ-----QYKI  106

Query  526  ALREHKIYDLRETYMYCSTNCCVNSRAF  609
            + + +K+YD+ E   +CS  C   S+AF
Sbjct  107  STKTNKVYDITERKCFCSNFCYKASKAF  134



>ref|XP_011283173.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Felis catus]
 ref|XP_011283174.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Felis catus]
 ref|XP_011283175.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Felis catus]
Length=612

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 69/147 (47%), Gaps = 15/147 (10%)
 Frame = +1

Query  202  SVRFSLRAPASTGPST*TNSSHQILNFRKPSRMTKTEATTVKD------AVHKLQLCLLD  363
            S R   R P ++  +T    ++ +       R  + EA   K       A+H ++  L +
Sbjct  9    SARLKARTPRASRNATGAKQTNALKQEDTSKRKAELEAAVRKKIEFERKALHIVEQLLEE  68

Query  364  GIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSN---FLPSDRPHKGRYRIALR  534
             I +E  L   G  +  + Y DVV ER+I+ +CGYPLC      +P     K +Y+I+ +
Sbjct  69   DITEEF-LRECGKFITPAHYSDVVDERSIIKLCGYPLCQKKLGIVP-----KQKYKISTK  122

Query  535  EHKIYDLRETYMYCSTNCCVNSRAFAG  615
             +K+YD+ E   +CS  C   S+ F  
Sbjct  123  TNKVYDITERKCFCSNFCYKASKFFEA  149



>ref|XP_004635812.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Octodon degus]
Length=461

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I  E+ L+  G  +  + Y DVV ER+I+N CGYPLC   L   P 
Sbjct  34   RKALHIVEQLLEENI-TEDFLVECGKFITPAHYSDVVVERSIINFCGYPLCQKKLGIVP-  91

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  92   ----KQKYKISTKTNKVYDITERKSFCSNFCYKASKYFEA  127



>ref|XP_002600173.1| hypothetical protein BRAFLDRAFT_66681 [Branchiostoma floridae]
 gb|EEN56185.1| hypothetical protein BRAFLDRAFT_66681, partial [Branchiostoma 
floridae]
Length=653

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = +1

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRPHKGRYRIALR  534
            LLD   D +  +     +  S Y DV+ ER I+  CGYP+CS  LP ++P K +Y I  R
Sbjct  52   LLDNPVDMDFFVNCAQYIEPSHYGDVLVERAIIGQCGYPVCSKKLPKNKP-KQQYHIDTR  110

Query  535  EHKIYDLRETYMYCSTNCCVNSRAF  609
             +K+YD+ E   +CS N C  +  F
Sbjct  111  HNKVYDITERKNFCS-NWCYKASQF  134



>ref|XP_010342159.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Saimiri boliviensis boliviensis]
Length=565

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y+DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYRDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_003933354.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Saimiri boliviensis boliviensis]
Length=612

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y+DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYRDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_010342158.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Saimiri boliviensis boliviensis]
Length=589

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y+DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYRDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_643755.1| hypothetical protein DDB_G0275113 [Dictyostelium discoideum AX4]
 gb|EAL69837.1| hypothetical protein DDB_G0275113 [Dictyostelium discoideum AX4]
Length=537

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 71/122 (58%), Gaps = 11/122 (9%)
 Frame = +1

Query  277  NFRKPSRMTKTEATTVKDAVH--KL----QLCLLDGIQDENKLLAAGSLMCRSD-YQDVV  435
            N +K S + K    ++K+ +H  KL    Q+ L++    EN+L +    + + D ++DVV
Sbjct  75   NVQKKSDILKK---SIKEKIHFDKLTYDAQMSLIEDETTENELRSHYYNLFQPDHFKDVV  131

Query  436  TERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             ER+    CGYP CS  L   + ++ +Y I+++E K+Y++ E  M+CS++C V S+ +A 
Sbjct  132  AERSASGKCGYPCCSKPLGVKKLNQ-KYFISVKEQKVYNVEELSMFCSSDCLVKSKLYAS  190

Query  616  SC  621
            + 
Sbjct  191  TL  192



>ref|XP_006114230.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Pelodiscus sinensis]
Length=571

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (58%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  L+  G+ +  S Y+D V ER I+ +CGYPLC N L  +  
Sbjct  33   KKALHVVEQLLEEDITEEF-LVTCGNCITPSHYKDAVEERFIIKLCGYPLCRNRL--ENV  89

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YR++ + +K+YD+ E   +CS  C   S+ F  
Sbjct  90   PKQKYRVSTKTNKVYDITERKCFCSNFCYRASKYFEA  126



>ref|XP_006114228.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Pelodiscus sinensis]
Length=613

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (58%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  L+  G+ +  S Y+D V ER I+ +CGYPLC N L  +  
Sbjct  33   KKALHVVEQLLEEDITEEF-LVTCGNCITPSHYKDAVEERFIIKLCGYPLCRNRL--ENV  89

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YR++ + +K+YD+ E   +CS  C   S+ F  
Sbjct  90   PKQKYRVSTKTNKVYDITERKCFCSNFCYRASKYFEA  126



>ref|XP_009245916.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Pongo abelii]
Length=565

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_009245913.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Pongo abelii]
Length=566

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|NP_001125811.1| putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 [Pongo 
abelii]
 sp|Q5RA37.1|RPAP2_PONAB RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2; AltName: Full=RNA polymerase II-associated protein 
2 [Pongo abelii]
 emb|CAH91373.1| hypothetical protein [Pongo abelii]
Length=612

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_008584956.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Galeopterus variegatus]
Length=685

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 54/98 (55%), Gaps = 9/98 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y D+V ER+IV  CGYPLC   L   P 
Sbjct  131  RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDIVEERSIVKFCGYPLCQKRLGIVP-  188

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAF  609
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F
Sbjct  189  ----KQKYKISTKNNKVYDITERKSFCSNFCYRASKFF  222



>ref|XP_006114229.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Pelodiscus sinensis]
Length=602

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (58%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+H ++  L + I +E  L+  G+ +  S Y+D V ER I+ +CGYPLC N L  +  
Sbjct  33   KKALHVVEQLLEEDITEEF-LVTCGNCITPSHYKDAVEERFIIKLCGYPLCRNRL--ENV  89

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YR++ + +K+YD+ E   +CS  C   S+ F  
Sbjct  90   PKQKYRVSTKTNKVYDITERKCFCSNFCYRASKYFEA  126



>ref|XP_007976160.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X4 [Chlorocebus sabaeus]
Length=565

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_005422183.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Geospiza fortis]
Length=594

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (58%), Gaps = 3/97 (3%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFLPSDRP  504
            K A+  ++  L + I +E  LL  G  +  S Y+DVV ER+I+ +CGYPLC N L  +  
Sbjct  36   KKALSIVEQLLEEDITEEF-LLNCGKCITPSHYKDVVDERSIIKLCGYPLCQNKL--ENV  92

Query  505  HKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
             K +YRI+ + +++YD+ E   +CS  C   S+ F  
Sbjct  93   PKQKYRISTKTNRVYDITERKCFCSNFCYRASKYFEA  129



>ref|XP_007976159.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Chlorocebus sabaeus]
Length=571

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_009245911.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Pongo abelii]
Length=612

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_009211263.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Papio anubis]
Length=615

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_010368669.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Rhinopithecus roxellana]
Length=608

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_011923373.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Cercocebus atys]
 ref|XP_011923374.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Cercocebus atys]
Length=612

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_011795365.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 [Colobus angolensis palliatus]
Length=612

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_010368668.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X1 [Rhinopithecus roxellana]
Length=612

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_010368670.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X3 [Rhinopithecus roxellana]
Length=573

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_003290404.1| hypothetical protein DICPUDRAFT_37287 [Dictyostelium purpureum]
 gb|EGC33054.1| hypothetical protein DICPUDRAFT_37287 [Dictyostelium purpureum]
Length=554

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 69/121 (57%), Gaps = 9/121 (7%)
 Frame = +1

Query  286  KPSRMTKTE--ATTVKDAVH--KL----QLCLLDGIQDENKLLAAG-SLMCRSDYQDVVT  438
            KP  ++K+E    T+K+ V+  KL    Q+ L++    E++L     + +  S ++D+V 
Sbjct  95   KPQVVSKSEILKKTIKEKVYFDKLTFDSQMFLIENETTEDQLKNHYYNYLQDSHFKDIVV  154

Query  439  ERTIVNMCGYPLCSNFLPSDRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAGS  618
            ER+    CGYP C   + S +    +Y+I+++E K+Y++ E  M+CS++C + S+ F  +
Sbjct  155  ERSTSLKCGYPCCGKSIDSKKILNQKYKISIKEQKVYNVEELSMFCSSDCLIKSKLFEST  214

Query  619  C  621
             
Sbjct  215  L  215



>ref|XP_007976158.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 isoform X2 [Chlorocebus sabaeus]
Length=573

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 9/100 (9%)
 Frame = +1

Query  325  KDAVHKLQLCLLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PS  495
            + A+H ++  L + I +E  L+  G  +  + Y DVV ER+IV +CGYPLC   L   P 
Sbjct  56   RKALHIVEQLLEENITEEF-LMECGKFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVP-  113

Query  496  DRPHKGRYRIALREHKIYDLRETYMYCSTNCCVNSRAFAG  615
                K +Y+I+ + +K+YD+ E   +CS  C   S+ F  
Sbjct  114  ----KQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEA  149



>ref|XP_005721062.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
rpap2-like isoform X1 [Pundamilia nyererei]
Length=643

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 51/88 (58%), Gaps = 8/88 (9%)
 Frame = +1

Query  355  LLDGIQDENKLLAAGSLMCRSDYQDVVTERTIVNMCGYPLCSNFL---PSDRPHKGRYRI  525
            LLD    E+ L+    ++  ++Y+D V ER+I  +CGYP+C N L   PS      +Y+I
Sbjct  55   LLDDSVAEDFLVDCAKMITPANYRDTVEERSIAKLCGYPICPNKLGKIPSQ-----QYKI  109

Query  526  ALREHKIYDLRETYMYCSTNCCVNSRAF  609
            + + +K+YD+ E   +CS  C   S+AF
Sbjct  110  STKTNKVYDITERKCFCSNFCYKASKAF  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 899714680832