BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7789

Length=934
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009770487.1|  PREDICTED: uncharacterized protein LOC104221184    190   6e-56   Nicotiana sylvestris
ref|XP_009614603.1|  PREDICTED: uncharacterized protein LOC104107...    188   2e-55   
ref|XP_009614596.1|  PREDICTED: uncharacterized protein LOC104107...    188   3e-55   Nicotiana tomentosiformis
ref|XP_004242361.1|  PREDICTED: uncharacterized protein LOC101261243    186   2e-54   Solanum lycopersicum
ref|XP_006352740.1|  PREDICTED: uncharacterized protein LOC102585732    186   2e-54   Solanum tuberosum [potatoes]
emb|CDP03743.1|  unnamed protein product                                165   3e-46   Coffea canephora [robusta coffee]
ref|XP_011083025.1|  PREDICTED: uncharacterized protein LOC105165646    162   3e-45   Sesamum indicum [beniseed]
ref|XP_009354948.1|  PREDICTED: uncharacterized protein LOC103946053    161   7e-45   Pyrus x bretschneideri [bai li]
ref|XP_008372091.1|  PREDICTED: uncharacterized protein LOC103435469    160   2e-44   Malus domestica [apple tree]
ref|XP_002278457.1|  PREDICTED: uncharacterized protein LOC100263547    159   5e-44   Vitis vinifera
ref|XP_008382864.1|  PREDICTED: uncharacterized protein LOC103445628    159   5e-44   
ref|XP_009369482.1|  PREDICTED: uncharacterized protein LOC103958885    158   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_010262324.1|  PREDICTED: uncharacterized protein LOC104600876    158   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_002300776.2|  hypothetical protein POPTR_0002s03930g             157   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_007199047.1|  hypothetical protein PRUPE_ppa018256mg             155   7e-43   Prunus persica
ref|XP_008235679.1|  PREDICTED: uncharacterized protein LOC103334480    155   1e-42   Prunus mume [ume]
ref|XP_011458001.1|  PREDICTED: uncharacterized protein LOC101311235    154   3e-42   Fragaria vesca subsp. vesca
ref|XP_011028805.1|  PREDICTED: uncharacterized protein LOC105128717    154   6e-42   Populus euphratica
ref|XP_006479541.1|  PREDICTED: uncharacterized protein LOC102615729    153   9e-42   Citrus sinensis [apfelsine]
ref|XP_006443838.1|  hypothetical protein CICLE_v10024115mg             153   1e-41   
ref|XP_002524607.1|  conserved hypothetical protein                     151   3e-41   Ricinus communis
ref|XP_010679301.1|  PREDICTED: uncharacterized protein LOC104894707    151   6e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003521291.1|  PREDICTED: uncharacterized protein LOC100776685    150   9e-41   Glycine max [soybeans]
ref|XP_012085317.1|  PREDICTED: uncharacterized protein LOC105644539    149   2e-40   Jatropha curcas
ref|XP_011004061.1|  PREDICTED: uncharacterized protein LOC105110658    149   2e-40   Populus euphratica
ref|XP_011025980.1|  PREDICTED: uncharacterized protein LOC105126722    149   3e-40   Populus euphratica
ref|XP_006857282.1|  PREDICTED: uncharacterized protein LOC18447116     149   4e-40   Amborella trichopoda
gb|ACU19025.1|  unknown                                                 149   4e-40   Glycine max [soybeans]
ref|XP_002307644.1|  hypothetical protein POPTR_0005s24600g             149   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_007162546.1|  hypothetical protein PHAVU_001G161200g             147   1e-39   Phaseolus vulgaris [French bean]
ref|XP_010540895.1|  PREDICTED: uncharacterized protein LOC104814517    148   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_007050297.1|  Uncharacterized protein TCM_004033                 145   2e-38   
gb|KEH23927.1|  pollen Ole e I family allergen                          143   5e-38   Medicago truncatula
ref|XP_010920481.1|  PREDICTED: uncharacterized protein LOC105044325    144   5e-38   Elaeis guineensis
gb|AAM64424.1|  unknown                                                 143   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565474.1|  uncharacterized protein                               143   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004493777.1|  PREDICTED: protodermal factor 1-like               143   7e-38   Cicer arietinum [garbanzo]
ref|XP_002886285.1|  hypothetical protein ARALYDRAFT_480880             142   1e-37   
gb|KJB06485.1|  hypothetical protein B456_001G177500                    142   1e-37   Gossypium raimondii
ref|XP_004148954.1|  PREDICTED: uncharacterized protein LOC101220310    141   2e-37   Cucumis sativus [cucumbers]
gb|KFK40425.1|  hypothetical protein AALP_AA3G372100                    140   7e-37   Arabis alpina [alpine rockcress]
ref|XP_010415612.1|  PREDICTED: uncharacterized protein LOC104701593    140   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010467805.1|  PREDICTED: uncharacterized protein LOC104747808    140   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006298730.1|  hypothetical protein CARUB_v10014827mg             139   1e-36   Capsella rubella
ref|XP_010489026.1|  PREDICTED: uncharacterized protein LOC104766776    139   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008791598.1|  PREDICTED: uncharacterized protein LOC103708447    139   2e-36   Phoenix dactylifera
gb|KHG04833.1|  Uroporphyrinogen decarboxylase                          139   2e-36   Gossypium arboreum [tree cotton]
emb|CDY11979.1|  BnaC03g14050D                                          137   1e-35   Brassica napus [oilseed rape]
ref|XP_006408976.1|  hypothetical protein EUTSA_v10002113mg             137   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_008451248.1|  PREDICTED: uncharacterized protein LOC103492595    137   3e-35   
emb|CDY36764.1|  BnaA03g11220D                                          136   3e-35   Brassica napus [oilseed rape]
ref|XP_009132352.1|  PREDICTED: uncharacterized protein LOC103856964    137   4e-35   Brassica rapa
gb|KDO60494.1|  hypothetical protein CISIN_1g042786mg                   127   3e-32   Citrus sinensis [apfelsine]
gb|EYU17919.1|  hypothetical protein MIMGU_mgv1a016687mg                125   7e-32   Erythranthe guttata [common monkey flower]
ref|XP_009413726.1|  PREDICTED: uncharacterized protein LOC103994975    127   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001132608.1|  hypothetical protein precursor                     121   2e-29   Zea mays [maize]
ref|XP_010037977.1|  PREDICTED: uncharacterized protein LOC104426571    120   4e-29   Eucalyptus grandis [rose gum]
ref|XP_002446788.1|  hypothetical protein SORBIDRAFT_06g022650          120   6e-29   Sorghum bicolor [broomcorn]
gb|ACG32677.1|  hypothetical protein                                    120   8e-29   Zea mays [maize]
ref|XP_004976229.1|  PREDICTED: uncharacterized protein LOC101786121    119   1e-28   Setaria italica
gb|EMT14391.1|  hypothetical protein F775_15820                         119   1e-28   
dbj|BAJ87228.1|  predicted protein                                      117   4e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003580138.1|  PREDICTED: uncharacterized protein LOC100843524    116   2e-27   Brachypodium distachyon [annual false brome]
gb|EMS55115.1|  hypothetical protein TRIUR3_30226                       116   2e-27   Triticum urartu
emb|CAH67221.1|  OSIGBa0145M07.3                                        113   2e-26   Oryza sativa [red rice]
ref|NP_001053317.1|  Os04g0517000                                     99.8    1e-21   
tpg|DAA36981.1|  TPA: hypothetical protein ZEAMMB73_327282            95.5    2e-20   
ref|XP_006653600.1|  PREDICTED: uncharacterized protein LOC102709642  92.4    3e-19   
emb|CAE05445.2|  OSJNBa0073E02.5                                      90.1    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ADE75752.1|  unknown                                               81.3    3e-15   Picea sitchensis
tpg|DAA36982.1|  TPA: hypothetical protein ZEAMMB73_327282            52.0    2e-05   
ref|XP_002960598.1|  hypothetical protein SELMODRAFT_437656           52.0    3e-04   



>ref|XP_009770487.1| PREDICTED: uncharacterized protein LOC104221184 [Nicotiana sylvestris]
Length=157

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 106/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  148  YCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYE  327
            YC   G  T  A+Q RPGF++TRNRGRCTPQY SSRRE+WP+MVP+MSTVSKVFGSRAYE
Sbjct  21   YCC-LGDLTVYAQQFRPGFVYTRNRGRCTPQYWSSRRESWPKMVPQMSTVSKVFGSRAYE  79

Query  328  RYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVS  507
            RYRYDLTLLEAA RNDD D++FA LVK+STAALLNSYARK +Y ++AWEVKT LIQALVS
Sbjct  80   RYRYDLTLLEAAGRNDDRDNIFAKLVKQSTAALLNSYARK-NYPYSAWEVKTMLIQALVS  138

Query  508  K  510
            +
Sbjct  139  E  139



>ref|XP_009614603.1| PREDICTED: uncharacterized protein LOC104107478 isoform X2 [Nicotiana 
tomentosiformis]
Length=143

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 106/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  148  YCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYE  327
            YC   G  T  A+Q RPGF++TRNRGRCTPQY SSRRE+WP+MVP+MSTVSKVFGSRAYE
Sbjct  7    YCY-LGDLTVSAQQFRPGFVYTRNRGRCTPQYWSSRRESWPKMVPQMSTVSKVFGSRAYE  65

Query  328  RYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVS  507
            RYRYDLTLLEAA RNDD D++FA LVK+STAALLNSYARK +Y ++AWEVKT LIQALVS
Sbjct  66   RYRYDLTLLEAAGRNDDRDNIFARLVKQSTAALLNSYARK-NYPYSAWEVKTMLIQALVS  124

Query  508  K  510
            +
Sbjct  125  E  125



>ref|XP_009614596.1| PREDICTED: uncharacterized protein LOC104107478 isoform X1 [Nicotiana 
tomentosiformis]
Length=165

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 106/121 (88%), Gaps = 2/121 (2%)
 Frame = +1

Query  148  YCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYE  327
            YC   G  T  A+Q RPGF++TRNRGRCTPQY SSRRE+WP+MVP+MSTVSKVFGSRAYE
Sbjct  29   YCY-LGDLTVSAQQFRPGFVYTRNRGRCTPQYWSSRRESWPKMVPQMSTVSKVFGSRAYE  87

Query  328  RYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVS  507
            RYRYDLTLLEAA RNDD D++FA LVK+STAALLNSYARK +Y ++AWEVKT LIQALVS
Sbjct  88   RYRYDLTLLEAAGRNDDRDNIFARLVKQSTAALLNSYARK-NYPYSAWEVKTMLIQALVS  146

Query  508  K  510
            +
Sbjct  147  E  147



>ref|XP_004242361.1| PREDICTED: uncharacterized protein LOC101261243 [Solanum lycopersicum]
Length=167

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 102/110 (93%), Gaps = 1/110 (1%)
 Frame = +1

Query  181  AKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEA  360
            A+Q RPGF++TRNRGRCTPQY SSRRE+WP+MVP+ STVSK+FGSRAYERYRYDLTLLEA
Sbjct  41   AQQFRPGFVYTRNRGRCTPQYWSSRRESWPKMVPQTSTVSKIFGSRAYERYRYDLTLLEA  100

Query  361  ASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
            A RNDDGD+VFA LVK+STAALLNSYAR+ +Y ++AWEVKT LIQALVS+
Sbjct  101  AGRNDDGDNVFARLVKQSTAALLNSYARQ-NYPYSAWEVKTMLIQALVSE  149



>ref|XP_006352740.1| PREDICTED: uncharacterized protein LOC102585732 [Solanum tuberosum]
Length=152

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +1

Query  136  VAFLYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGS  315
            + F Y    G     A+Q RPGF++TRNRGRCTPQY SSRRE+WP+MVP+ STVSK+FGS
Sbjct  11   LLFTYYFYLGDFNVSAQQFRPGFVYTRNRGRCTPQYWSSRRESWPKMVPQTSTVSKIFGS  70

Query  316  RAYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQ  495
            RAYERYRYDLTLLEAA RNDDGD+VFA LVK+STAALLNSYAR  +Y ++AWEVKT LIQ
Sbjct  71   RAYERYRYDLTLLEAAGRNDDGDNVFARLVKQSTAALLNSYARH-NYPYSAWEVKTMLIQ  129

Query  496  ALVSK  510
            ALVS+
Sbjct  130  ALVSE  134



>emb|CDP03743.1| unnamed protein product [Coffea canephora]
Length=167

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  196  PGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRND  375
            PGF+F R RG+CTPQY SSR E+WP+MVP+MSTVS VFGSRA+ER+RYDLTLLEAASR+D
Sbjct  42   PGFVFARARGKCTPQYWSSRAESWPKMVPQMSTVSNVFGSRAFERFRYDLTLLEAASRSD  101

Query  376  DGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            D  + FA LVKESTAALLNSYARK  Y ++AWE+KT +IQALVSK 
Sbjct  102  DLGNAFAGLVKESTAALLNSYARKG-YPYSAWEIKTLVIQALVSKQ  146



>ref|XP_011083025.1| PREDICTED: uncharacterized protein LOC105165646 [Sesamum indicum]
Length=156

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 94/117 (80%), Gaps = 3/117 (3%)
 Frame = +1

Query  166  AATAMAKQRRP--GFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRY  339
            A  A+A  RRP  GFL++R RG CTPQY SSRRE WP+MVP  STVS VFGS+ +ERYR 
Sbjct  23   AIPAIAAVRRPSPGFLYSRTRGTCTPQYWSSRRELWPKMVPHKSTVSNVFGSQVFERYRE  82

Query  340  DLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
            DLTLLEAA+RNDDG D FA LVK+STAALLNSYARK  Y + AWEVKT LIQALVS+
Sbjct  83   DLTLLEAAARNDDGKDAFARLVKQSTAALLNSYARK-GYPYAAWEVKTLLIQALVSE  138



>ref|XP_009354948.1| PREDICTED: uncharacterized protein LOC103946053 [Pyrus x bretschneideri]
Length=154

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 2/118 (2%)
 Frame = +1

Query  157  GAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYR  336
            G    T  A+ +RPGFLFTR  GRCTPQY  SRREAWP+MVP+ STVSK+FGSRAYERYR
Sbjct  21   GCSVPTTTARNQRPGFLFTRTTGRCTPQYWGSRREAWPKMVPQTSTVSKMFGSRAYERYR  80

Query  337  YDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
             DLTLLEA  RND+ ++V+  L+K+++AAL+NSYARK  Y +TAWEVKT LIQALVS+
Sbjct  81   SDLTLLEATVRNDE-ENVYPRLLKQASAALVNSYARK-GYPYTAWEVKTLLIQALVSE  136



>ref|XP_008372091.1| PREDICTED: uncharacterized protein LOC103435469 [Malus domestica]
Length=154

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  172  TAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTL  351
            T  A+ +RPGFLFTR  GRCTPQY  SRRE+WP+MVP+ STVSKVFGSRAYERYR DLTL
Sbjct  26   TTTARNQRPGFLFTRTTGRCTPQYWGSRRESWPKMVPQTSTVSKVFGSRAYERYRSDLTL  85

Query  352  LEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
            LEA  RND+ ++ +  LVK+++AALLNSYARK  Y +TAWEVKT LIQALVS+
Sbjct  86   LEATVRNDE-ENAYPRLVKQASAALLNSYARK-GYPYTAWEVKTLLIQALVSE  136



>ref|XP_002278457.1| PREDICTED: uncharacterized protein LOC100263547 [Vitis vinifera]
 emb|CBI37118.3| unnamed protein product [Vitis vinifera]
Length=153

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 102/126 (81%), Gaps = 2/126 (2%)
 Frame = +1

Query  136  VAFLYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGS  315
            + FL C  A  ATA   Q RPGFL+TR+RGRCTPQY  SR+EAWPRMVP+ STV+KVFGS
Sbjct  13   ILFLSC-FAVTATAAQTQWRPGFLYTRSRGRCTPQYWGSRKEAWPRMVPQTSTVAKVFGS  71

Query  316  RAYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQ  495
            RA ER+R D+TLLEA ++++  ++VF  L+K+++AAL+NSYARK  + ++AWEVKT LIQ
Sbjct  72   RASERFRSDMTLLEATAQDESVENVFHGLLKQTSAALINSYARK-GFPYSAWEVKTLLIQ  130

Query  496  ALVSKD  513
            ALVS++
Sbjct  131  ALVSEE  136



>ref|XP_008382864.1| PREDICTED: uncharacterized protein LOC103445628 [Malus domestica]
Length=153

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = +1

Query  181  AKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEA  360
            A+ +RPGFLFTR  GRCTPQY  SRREAWP+MVP+ STVSKVFGSRAYERYR DLTLLEA
Sbjct  28   ARNQRPGFLFTRTTGRCTPQYWGSRREAWPKMVPQTSTVSKVFGSRAYERYRSDLTLLEA  87

Query  361  ASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
             + N + ++V+  L+K+++AALLNSYARK  Y +TAWEVKT LIQALVSK 
Sbjct  88   TTMNGE-ENVYPRLLKQASAALLNSYARK-GYPYTAWEVKTLLIQALVSKK  136



>ref|XP_009369482.1| PREDICTED: uncharacterized protein LOC103958885 [Pyrus x bretschneideri]
Length=153

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = +1

Query  181  AKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEA  360
            A+ + PGFLFTR  GRCTPQY  SRREAWP+MVP+ STVSKVFGSRAYERYR DLTLLEA
Sbjct  28   ARNQWPGFLFTRTTGRCTPQYWGSRREAWPKMVPQTSTVSKVFGSRAYERYRSDLTLLEA  87

Query  361  ASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
             + ND+ ++V+  L+K+++AALLNSYARK  Y +TAWEVKT LIQALVSK 
Sbjct  88   TAMNDE-ENVYPRLLKQASAALLNSYARK-GYPYTAWEVKTLLIQALVSKK  136



>ref|XP_010262324.1| PREDICTED: uncharacterized protein LOC104600876 [Nelumbo nucifera]
Length=166

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  196  PGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRND  375
            PGFL+TR RGRCTPQY SSRRE+WPRM+P+ S+VSKVFG++A ERYR DLTLLEA  RND
Sbjct  45   PGFLYTRLRGRCTPQYWSSRRESWPRMIPQASSVSKVFGTQALERYRSDLTLLEATERND  104

Query  376  DGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            D ++ F  L+K+S+AALLNSYARK +Y ++AWEVKT LIQALVS++
Sbjct  105  DSNNAFFWLLKQSSAALLNSYARK-NYPYSAWEVKTLLIQALVSEE  149



>ref|XP_002300776.2| hypothetical protein POPTR_0002s03930g [Populus trichocarpa]
 gb|EEE80049.2| hypothetical protein POPTR_0002s03930g [Populus trichocarpa]
Length=154

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 106/140 (76%), Gaps = 4/140 (3%)
 Frame = +1

Query  94   ICAAMNNlllllllVAFLYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPR  273
            + +AM    LL  LV  ++ +   A+  +A   RPGFL+TR RGRCTPQ+ SSRREAWPR
Sbjct  2    LSSAMGKSFLLSRLVLIIFVAHFAASKVVAT--RPGFLYTRTRGRCTPQFWSSRREAWPR  59

Query  274  MVPEMSTVSKVFGSRAYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPH  453
            MVP+ STVSKVFGS  +ERYR D+TLLE+  RNDD ++ FA L+K+++AALLN+YARK  
Sbjct  60   MVPQRSTVSKVFGSGVFERYRSDVTLLESTGRNDD-ENAFAGLLKQASAALLNTYARK-G  117

Query  454  YHFTAWEVKTRLIQALVSKD  513
            + ++AWEVKT  IQALVSK+
Sbjct  118  FPYSAWEVKTLFIQALVSKE  137



>ref|XP_007199047.1| hypothetical protein PRUPE_ppa018256mg [Prunus persica]
 gb|EMJ00246.1| hypothetical protein PRUPE_ppa018256mg [Prunus persica]
Length=151

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +1

Query  181  AKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEA  360
            AK +RPGFLFTR  GRCTP Y  SRREAWPRMVP+ STVSKVFGSRAYERYR DLTLLEA
Sbjct  26   AKTQRPGFLFTRTTGRCTPHYWGSRREAWPRMVPQTSTVSKVFGSRAYERYRSDLTLLEA  85

Query  361  ASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVS  507
              RND+ ++V+  L+K+++AALLNSYARK  + ++AWEVKT +IQALVS
Sbjct  86   TVRNDE-ENVYPRLLKQASAALLNSYARK-GFPYSAWEVKTLVIQALVS  132



>ref|XP_008235679.1| PREDICTED: uncharacterized protein LOC103334480 [Prunus mume]
Length=156

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +1

Query  181  AKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEA  360
            AK +RPGFLFTR  GRCTP Y  SRREAWPRMVP+ STVSKVFGSRAYERYR DLTLLEA
Sbjct  31   AKTQRPGFLFTRTTGRCTPHYWGSRREAWPRMVPQTSTVSKVFGSRAYERYRSDLTLLEA  90

Query  361  ASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVS  507
              RND+ ++V+  L+K+++AALLNSYARK  + ++AWEVKT +IQALVS
Sbjct  91   TVRNDE-ENVYPRLLKQASAALLNSYARK-GFPYSAWEVKTLVIQALVS  137



>ref|XP_011458001.1| PREDICTED: uncharacterized protein LOC101311235 [Fragaria vesca 
subsp. vesca]
Length=147

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 90/106 (85%), Gaps = 2/106 (2%)
 Frame = +1

Query  193  RPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRN  372
            RPGFLFTR  GRCTP Y  SR E+WPRMVP+ STVSKVFGSRAYERYR DLTL+EA +RN
Sbjct  24   RPGFLFTRTTGRCTPDYWGSRVESWPRMVPQTSTVSKVFGSRAYERYRSDLTLMEATARN  83

Query  373  DDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
            DD ++VF  L+KE++AAL+NSYARK  + +TAWEVKTR+IQ LVS+
Sbjct  84   DD-ENVFPRLLKEASAALINSYARK-GFPYTAWEVKTRVIQGLVSE  127



>ref|XP_011028805.1| PREDICTED: uncharacterized protein LOC105128717 [Populus euphratica]
Length=155

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +1

Query  193  RPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRN  372
            RPGFL+TR RGRCTPQ+ SSRREAWPRMVP+ STVSKVFGS  +ERYR D+TLLE+  RN
Sbjct  34   RPGFLYTRTRGRCTPQFWSSRREAWPRMVPQRSTVSKVFGSGVFERYRSDVTLLESTGRN  93

Query  373  DDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            D+ ++ FA L+K+++AALLN+YARK  + ++AWEVKT  IQALVSK+
Sbjct  94   DE-ENAFAGLLKQASAALLNTYARK-GFPYSAWEVKTLFIQALVSKE  138



>ref|XP_006479541.1| PREDICTED: uncharacterized protein LOC102615729 [Citrus sinensis]
Length=156

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +1

Query  190  RRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASR  369
            RRPGFL+TR RGRCTPQ+ SSRRE WPRMVP+ ST+SKVFGSR YER+R DLTLLE+ +R
Sbjct  34   RRPGFLYTRIRGRCTPQFWSSRREVWPRMVPQTSTLSKVFGSRVYERFRSDLTLLESTTR  93

Query  370  NDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            NDD ++ FA LVK+ TAALLNSYAR   + +  W+VKT  IQALVSK+
Sbjct  94   NDD-ENAFAGLVKQGTAALLNSYARG-GFPYLPWQVKTLFIQALVSKE  139



>ref|XP_006443838.1| hypothetical protein CICLE_v10024115mg [Citrus clementina]
 gb|ESR57078.1| hypothetical protein CICLE_v10024115mg [Citrus clementina]
Length=157

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +1

Query  190  RRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASR  369
            RRPGFL+TR RGRCTPQ+ SSRRE WPRMVP+ ST+SKVFGSR YER+R DLTLLE+ +R
Sbjct  35   RRPGFLYTRIRGRCTPQFWSSRREVWPRMVPQTSTLSKVFGSRVYERFRSDLTLLESTTR  94

Query  370  NDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            NDD ++ FA LVK+ TAALLNSYAR   + +  W+VKT  IQALVSK+
Sbjct  95   NDD-ENAFAGLVKQGTAALLNSYARG-GFPYLPWQVKTLFIQALVSKE  140



>ref|XP_002524607.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37815.1| conserved hypothetical protein [Ricinus communis]
Length=147

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 88/114 (77%), Gaps = 2/114 (2%)
 Frame = +1

Query  169  ATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLT  348
            A   A   RP FLFTR RGRCT QY SSRREAWPRMVP+ STVS VFGSR +ERYR  LT
Sbjct  17   AVETASASRPAFLFTRTRGRCTAQYWSSRREAWPRMVPQTSTVSNVFGSRIFERYRSGLT  76

Query  349  LLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
            LLE+ +RNDD ++VF  L+K++ AALLNSYARK  + ++AWEVKT  IQ LVS+
Sbjct  77   LLESTARNDD-ENVFVGLLKQAIAALLNSYARK-EFAYSAWEVKTLFIQGLVSE  128



>ref|XP_010679301.1| PREDICTED: uncharacterized protein LOC104894707 [Beta vulgaris 
subsp. vulgaris]
Length=152

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = +1

Query  193  RPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRN  372
            RP FLF R+RGRCTPQY  SRRE WP MVP+ STVSKVFGSRA ER+R+DLTLLEAA+RN
Sbjct  30   RPSFLFIRHRGRCTPQYWGSRREEWPNMVPQRSTVSKVFGSRAIERFRFDLTLLEAATRN  89

Query  373  DDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
            DD ++V+  L+K+S+AALLNSYAR   Y + AWEVKT L++ L+S+
Sbjct  90   DDVENVYIRLLKQSSAALLNSYARV-GYPYKAWEVKTLLLKGLISE  134



>ref|XP_003521291.1| PREDICTED: uncharacterized protein LOC100776685 [Glycine max]
 gb|KHN10741.1| hypothetical protein glysoja_019172 [Glycine soja]
Length=153

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  196  PGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRND  375
            PGFL+TR+RGRCT Q+ S RREAWPRMVPE STVS VFGSR YERYR DLTLLEA +RND
Sbjct  32   PGFLYTRSRGRCTAQFWSGRREAWPRMVPETSTVSNVFGSRVYERYRSDLTLLEATARND  91

Query  376  DGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVS  507
            +  + F  LVKE TAALLNSYAR+  + F  W+VKT LI+ALVS
Sbjct  92   EESNPFGGLVKEGTAALLNSYARE-GFPFKPWQVKTLLIKALVS  134



>ref|XP_012085317.1| PREDICTED: uncharacterized protein LOC105644539 [Jatropha curcas]
 gb|KDP26531.1| hypothetical protein JCGZ_17689 [Jatropha curcas]
Length=150

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 90/115 (78%), Gaps = 2/115 (2%)
 Frame = +1

Query  169  ATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLT  348
            A + A   RPGFLFTR RGRCTPQY SSRREAWPRMVP+ STVS VFGS  +ERYR  LT
Sbjct  21   AVSKASASRPGFLFTRTRGRCTPQYWSSRREAWPRMVPQTSTVSNVFGSIIFERYRSGLT  80

Query  349  LLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            L+E+ +RNDD ++ F  L+K+ + ALLNSYARK  + ++AWEVKT  IQALVS++
Sbjct  81   LVESTARNDD-ENAFGRLLKQGSTALLNSYARK-GFKYSAWEVKTLFIQALVSEE  133



>ref|XP_011004061.1| PREDICTED: uncharacterized protein LOC105110658 [Populus euphratica]
Length=149

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +1

Query  193  RPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRN  372
            RPGF++TR RGRCTPQ+ SSRRE+WPRMVP+ +TVSKVFGS  +ERY  D+TLLE+ +RN
Sbjct  28   RPGFIYTRTRGRCTPQFWSSRRESWPRMVPQRATVSKVFGSGVFERYGSDVTLLESTTRN  87

Query  373  DDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            DD ++ FA L+K+++AALLNSYAR+  + ++AWEVKT LIQALVSK+
Sbjct  88   DD-ENAFAGLLKQASAALLNSYARE-GFPYSAWEVKTLLIQALVSKE  132



>ref|XP_011025980.1| PREDICTED: uncharacterized protein LOC105126722 [Populus euphratica]
Length=149

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +1

Query  193  RPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRN  372
            RPGF++TR RGRCTPQ+ SSRRE+WPRMVP+ +TVSKVFGS  +ERY  D+TLLE+ +RN
Sbjct  28   RPGFIYTRTRGRCTPQFWSSRRESWPRMVPQRATVSKVFGSGVFERYGSDVTLLESTTRN  87

Query  373  DDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            DD ++ FA L+K+++AALLNSYAR+  + ++AWEVKT LIQALVSK+
Sbjct  88   DD-ENAFAGLLKQASAALLNSYARE-GFPYSAWEVKTLLIQALVSKE  132



>ref|XP_006857282.1| PREDICTED: uncharacterized protein LOC18447116 [Amborella trichopoda]
 gb|ERN18749.1| hypothetical protein AMTR_s00067p00030870 [Amborella trichopoda]
Length=156

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  193  RPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRN  372
            RPGFL+TR++G+CTP+Y SSRRE WP+MVP  S+VSKVFGSRA +RYR DLTLLEA  RN
Sbjct  34   RPGFLYTRSKGKCTPEYWSSRRETWPKMVPLTSSVSKVFGSRALDRYRADLTLLEATERN  93

Query  373  DDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
            DD  + +  L+K+++AALLNSYARKP + +++W+VKT LIQALVS+
Sbjct  94   DDIGNAYHRLLKQASAALLNSYARKP-FPYSSWKVKTLLIQALVSE  138



>gb|ACU19025.1| unknown [Glycine max]
Length=153

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = +1

Query  196  PGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRND  375
            PGFL+TR+RGRCT Q+ S RREAWPRMVPE STVS VFGSR YERYR DLTLLEA +RND
Sbjct  32   PGFLYTRSRGRCTAQFWSGRREAWPRMVPETSTVSNVFGSRVYERYRSDLTLLEATARND  91

Query  376  DGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVS  507
            +  + F  LVKE TAALLNSYAR+  + F  W+VKT  I+ALVS
Sbjct  92   EESNPFGGLVKEGTAALLNSYARE-GFPFKPWQVKTLFIKALVS  134



>ref|XP_002307644.1| hypothetical protein POPTR_0005s24600g [Populus trichocarpa]
 gb|EEE94640.1| hypothetical protein POPTR_0005s24600g [Populus trichocarpa]
Length=149

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +1

Query  193  RPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRN  372
            RPGF+++R RGRCTPQ+ SSRRE+WPRMVP+ +TVSKVFGS  +ERY  D+TLLE+ +RN
Sbjct  28   RPGFIYSRTRGRCTPQFWSSRRESWPRMVPQRATVSKVFGSGVFERYGSDVTLLESTTRN  87

Query  373  DDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            DD ++ FA L+K+++AALLNSYAR+  + ++AWEVKT LIQALVSK+
Sbjct  88   DD-ENAFAGLLKQASAALLNSYARE-GFPYSAWEVKTLLIQALVSKE  132



>ref|XP_007162546.1| hypothetical protein PHAVU_001G161200g [Phaseolus vulgaris]
 gb|ESW34540.1| hypothetical protein PHAVU_001G161200g [Phaseolus vulgaris]
Length=149

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = +1

Query  187  QRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAAS  366
             R PGFL+TR+RGRCT Q+ S RRE WPRMVPE STVS VFGSR YERYR DLTL+EA +
Sbjct  25   HRIPGFLYTRSRGRCTAQFWSGRREEWPRMVPETSTVSNVFGSRVYERYRSDLTLVEATA  84

Query  367  RNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
            RND+  + F  LVKE TAAL+NSYAR+  + +  WEVKT +I+ALVS+
Sbjct  85   RNDEESNAFGGLVKEGTAALVNSYARE-GFPYKPWEVKTLVIKALVSE  131



>ref|XP_010540895.1| PREDICTED: uncharacterized protein LOC104814517 [Tarenaya hassleriana]
Length=202

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 100/140 (71%), Gaps = 5/140 (4%)
 Frame = +1

Query  91   RICAAMNNlllllllVAFLYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWP  270
            RI    N  L   L+  F+ C  +G +TA     RPG  +TR+RGRCTPQY SSRRE WP
Sbjct  50   RIQMGANPSLSFALVALFVLCFVSGDSTAA----RPGLFYTRHRGRCTPQYWSSRREVWP  105

Query  271  RMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKP  450
            RMVPE STV KVFG+ A ER+R DLTL+E+A+RNDD  + + +L+K+  AALLNSYAR+ 
Sbjct  106  RMVPERSTVEKVFGAMAKERWRSDLTLVESAARNDDDGNAYGALLKQGIAALLNSYARE-  164

Query  451  HYHFTAWEVKTRLIQALVSK  510
             + +T W+VKT LIQA+VS+
Sbjct  165  RFAYTPWQVKTMLIQAMVSE  184



>ref|XP_007050297.1| Uncharacterized protein TCM_004033 [Theobroma cacao]
 gb|EOX94454.1| Uncharacterized protein TCM_004033 [Theobroma cacao]
Length=168

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +1

Query  187  QRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAAS  366
            +R+PGFL+TR RGRCTPQ+ SSRREAWPRMVP+ STV  VFGSRA+ERYR ++TLLE+  
Sbjct  45   KRQPGFLYTRTRGRCTPQFWSSRREAWPRMVPQTSTVLNVFGSRAFERYRSEMTLLESTG  104

Query  367  RNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
             N +G +V+  L+ +++AALLNSYARK  + ++AWEVKT +IQ LVS+D
Sbjct  105  VN-EGGNVYDKLLTQASAALLNSYARK-GFPYSAWEVKTLMIQGLVSED  151



>gb|KEH23927.1| pollen Ole e I family allergen [Medicago truncatula]
Length=151

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = +1

Query  172  TAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTL  351
            +A A    PGFL+TRNRG CTPQ+ S R+E WPRMVPE STVS VFG R Y+RYR DLTL
Sbjct  22   SAQASPHLPGFLYTRNRGTCTPQFWSGRKETWPRMVPETSTVSNVFGWRVYKRYRSDLTL  81

Query  352  LEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
            LEA +RND+ D+ F +L+KE T AL+NSYAR+  + +  W+VKT ++Q  VS+
Sbjct  82   LEATTRNDEVDNPFGALLKEGTTALINSYARQ-GFPYKPWQVKTLVMQGFVSE  133



>ref|XP_010920481.1| PREDICTED: uncharacterized protein LOC105044325 [Elaeis guineensis]
Length=164

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 90/115 (78%), Gaps = 2/115 (2%)
 Frame = +1

Query  172  TAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTL  351
            +A+++ R PGFL+TR  GRCTPQ+  S REAWP MVP+ ++VSKVFGSR  ERY   LTL
Sbjct  34   SAISEMRGPGFLYTRTPGRCTPQFWGSGREAWPNMVPQEASVSKVFGSRVLERYEPALTL  93

Query  352  LEAASRNDD-GDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            LEA  RNDD G + F+ LVK+S+AALLN+Y R P + ++AWEVKT L++ALVS++
Sbjct  94   LEATQRNDDVGGNAFSKLVKQSSAALLNAYTR-PGFAYSAWEVKTMLLEALVSEE  147



>gb|AAM64424.1| unknown [Arabidopsis thaliana]
Length=152

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 6/124 (5%)
 Frame = +1

Query  142  FLYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSR-  318
            FL C  AG ++A     RPGF++TR+RGRCTPQY SS+REAWPRMVPE STV K+FG   
Sbjct  16   FLLCFFAGDSSAT----RPGFIYTRHRGRCTPQYWSSQREAWPRMVPERSTVEKIFGVMV  71

Query  319  AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQA  498
            A ER+R DLTL+E+ +RND+  + + +L+K+  AAL+NSYARK  + +  WEVKT LIQA
Sbjct  72   AKERWRSDLTLVESTARNDEEGNAYGALLKQGIAALINSYARK-SFSYAPWEVKTMLIQA  130

Query  499  LVSK  510
            +VS+
Sbjct  131  MVSE  134



>ref|NP_565474.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM15393.1| Expressed protein [Arabidopsis thaliana]
 gb|AAP40503.1| unknown protein [Arabidopsis thaliana]
 gb|AAV84515.1| At2g20515 [Arabidopsis thaliana]
 gb|ABD59100.1| At2g20515 [Arabidopsis thaliana]
 gb|AEC07021.1| uncharacterized protein AT2G20515 [Arabidopsis thaliana]
Length=155

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 6/124 (5%)
 Frame = +1

Query  142  FLYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSR-  318
            FL C  AG ++A     RPGF++TR+RGRCTPQY SS+REAWPRMVPE STV K+FG   
Sbjct  19   FLLCFFAGDSSAT----RPGFIYTRHRGRCTPQYWSSQREAWPRMVPERSTVEKIFGVMV  74

Query  319  AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQA  498
            A ER+R DLTL+E+ +RND+  + + +L+K+  AAL+NSYARK  + +  WEVKT LIQA
Sbjct  75   AKERWRSDLTLVESTARNDEEGNAYGALLKQGIAALINSYARK-SFSYAPWEVKTMLIQA  133

Query  499  LVSK  510
            +VS+
Sbjct  134  MVSE  137



>ref|XP_004493777.1| PREDICTED: protodermal factor 1-like [Cicer arietinum]
Length=151

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +1

Query  196  PGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRND  375
            PGF++TR+ G CTPQ+ S R+E WPRMVPE STVS VFG R YERYR DLTLLEA +RND
Sbjct  30   PGFIYTRSTGTCTPQFWSGRKETWPRMVPETSTVSNVFGWRVYERYRSDLTLLEATARND  89

Query  376  DGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVS  507
            + D+ F  L+KE TAALLNSYARK  + F  W+VKT +I+A VS
Sbjct  90   EVDNPFGGLLKEGTAALLNSYARK-GFPFKPWQVKTLVIKAFVS  132



>ref|XP_002886285.1| hypothetical protein ARALYDRAFT_480880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62544.1| hypothetical protein ARALYDRAFT_480880 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 6/124 (5%)
 Frame = +1

Query  142  FLYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSR-  318
            FL C  AGA +A     RPGF++TR+RGRCTPQY SS+REAWPRMVPE STV K+FG   
Sbjct  16   FLLCFFAGALSAT----RPGFVYTRHRGRCTPQYWSSQREAWPRMVPERSTVEKIFGVMV  71

Query  319  AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQA  498
            A ER+R DLTL+E+ +RND+  + + +L+K+  AAL+NSYAR+  + +  WEVKT LIQA
Sbjct  72   AKERWRSDLTLVESTARNDEEGNAYGALLKQGIAALVNSYARR-SFSYAPWEVKTMLIQA  130

Query  499  LVSK  510
            +VS+
Sbjct  131  MVSE  134



>gb|KJB06485.1| hypothetical protein B456_001G177500 [Gossypium raimondii]
Length=158

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = +1

Query  187  QRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAAS  366
            +R  GFL++R RG+CTPQ+ SSRREAWPRMVP+ STVS VFGSRA ERYR D+TLLE+ +
Sbjct  35   KRHSGFLYSRTRGKCTPQFWSSRREAWPRMVPQGSTVSNVFGSRASERYRSDMTLLESRA  94

Query  367  RNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
             N++G +VF  L+K+++AALLNSYARK  + ++AWEVKT +IQ LVS+
Sbjct  95   VNEEG-NVFNELLKQASAALLNSYARK-GFPYSAWEVKTLMIQGLVSE  140



>ref|XP_004148954.1| PREDICTED: uncharacterized protein LOC101220310 [Cucumis sativus]
 gb|KGN44734.1| hypothetical protein Csa_7G375760 [Cucumis sativus]
Length=151

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +1

Query  190  RRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAAS-  366
            RRPGFLF+R  GRCT Q+ SSR EAWPRM PE +TV+K+FGSRA+ERY  ++TL+EAA+ 
Sbjct  26   RRPGFLFSRTTGRCTAQFWSSRSEAWPRMAPESATVAKIFGSRAHERYGSEMTLMEAAAG  85

Query  367  RNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
              D+ ++VF  +VKE+TAALLNSY R+  + ++AWEVKT  I+ALVSK+
Sbjct  86   AGDEEEEVFGRVVKEATAALLNSYTRRRVFPYSAWEVKTLFIKALVSKE  134



>gb|KFK40425.1| hypothetical protein AALP_AA3G372100 [Arabis alpina]
Length=152

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 91/124 (73%), Gaps = 6/124 (5%)
 Frame = +1

Query  142  FLYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSR-  318
            FL C  AG ++A     RPG  +TR RGRCTPQY SS+RE+WPRMVPE STV K FG   
Sbjct  16   FLLCFLAGDSSAT----RPGLFYTRQRGRCTPQYWSSKRESWPRMVPERSTVEKTFGVMV  71

Query  319  AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQA  498
            A ER+R+DLTL+E+ +RND+  + + +L+K+  AALLNSYARK  + +  WEVKT LIQA
Sbjct  72   ANERWRFDLTLVESTARNDEEGNAYGALLKQGIAALLNSYARK-SFSYAPWEVKTMLIQA  130

Query  499  LVSK  510
            ++S+
Sbjct  131  MISE  134



>ref|XP_010415612.1| PREDICTED: uncharacterized protein LOC104701593 [Camelina sativa]
Length=152

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 7/127 (6%)
 Frame = +1

Query  136  VAFL-YCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFG  312
            V FL  C  AG ++A     RPGFL+TR+RGRCTPQY SS REAWPRMVPE STV K+FG
Sbjct  13   VTFLVLCFFAGDSSAT----RPGFLYTRHRGRCTPQYWSSEREAWPRMVPERSTVEKMFG  68

Query  313  SR-AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRL  489
               A ER+R DLTLLE+ +RND+  + + +L+K+  AAL+NSYARK  + +  WEVKT L
Sbjct  69   VMVAKERWRSDLTLLESTARNDEEGNAYGALLKQGIAALVNSYARK-SFSYAPWEVKTML  127

Query  490  IQALVSK  510
            IQA+VS+
Sbjct  128  IQAMVSE  134



>ref|XP_010467805.1| PREDICTED: uncharacterized protein LOC104747808 [Camelina sativa]
Length=152

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 7/127 (6%)
 Frame = +1

Query  136  VAFL-YCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFG  312
            V FL  C  AG ++A     RPGFL+TR+RGRCTPQY SS REAWPRMVPE STV K+FG
Sbjct  13   VTFLVLCFFAGDSSAT----RPGFLYTRHRGRCTPQYWSSEREAWPRMVPERSTVEKMFG  68

Query  313  SR-AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRL  489
               A ER+R DLTLLE+ +RND+  + + +L+K+  AAL+NSYARK  + +  WEVKT L
Sbjct  69   VMVAKERWRSDLTLLESTARNDEEGNAYGALLKQGIAALVNSYARK-SFSYAPWEVKTML  127

Query  490  IQALVSK  510
            IQA+VS+
Sbjct  128  IQAMVSE  134



>ref|XP_006298730.1| hypothetical protein CARUB_v10014827mg [Capsella rubella]
 gb|EOA31628.1| hypothetical protein CARUB_v10014827mg [Capsella rubella]
Length=154

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 92/126 (73%), Gaps = 8/126 (6%)
 Frame = +1

Query  136  VAFLYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGS  315
            +   + +G  +AT      RPGFL+TR+RGRCTPQY SS REAWPRMVPE STV K+FG 
Sbjct  17   LVLCFLTGDSSAT------RPGFLYTRHRGRCTPQYWSSEREAWPRMVPERSTVEKIFGV  70

Query  316  R-AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLI  492
              A ER+R DLTLLE+ +RND+  + + +L+K+  AAL+NSYARK  + +  WEVKT LI
Sbjct  71   MVAKERWRSDLTLLESTARNDEEGNAYGALLKQGIAALVNSYARK-SFSYAPWEVKTMLI  129

Query  493  QALVSK  510
            QA++S+
Sbjct  130  QAMISE  135



>ref|XP_010489026.1| PREDICTED: uncharacterized protein LOC104766776 [Camelina sativa]
Length=152

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 7/127 (6%)
 Frame = +1

Query  136  VAFL-YCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFG  312
            V FL  C  AG ++A     RPGFL+TR+RGRCTPQY SS REAWPRMVPE STV K+FG
Sbjct  13   VTFLVLCFFAGDSSAT----RPGFLYTRHRGRCTPQYWSSEREAWPRMVPERSTVEKMFG  68

Query  313  SR-AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRL  489
               A ER+R DLTLLE+ +RND+  + + +L+K+  AAL+NSYARK  + +  WEVKT L
Sbjct  69   VMVAKERWRSDLTLLESTARNDEEGNAYDALLKQGIAALVNSYARK-SFSYAPWEVKTML  127

Query  490  IQALVSK  510
            IQA+VS+
Sbjct  128  IQAMVSE  134



>ref|XP_008791598.1| PREDICTED: uncharacterized protein LOC103708447 [Phoenix dactylifera]
Length=164

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +1

Query  172  TAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTL  351
            +A+++ + PGFL+TR  GRCTPQ+  S RE WP M P+ ++VSKVFGSR  ERY   LTL
Sbjct  34   SAISEMKGPGFLYTRAPGRCTPQFWGSGREVWPNMAPQEASVSKVFGSRVLERYEPGLTL  93

Query  352  LEAASRNDD-GDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            LEA  RNDD G + F+ LVK+S+AALLN+Y R P + ++AWEVKT L++ALVS++
Sbjct  94   LEATQRNDDVGGNAFSKLVKQSSAALLNAYTR-PGFAYSAWEVKTLLLEALVSEE  147



>gb|KHG04833.1| Uroporphyrinogen decarboxylase [Gossypium arboreum]
Length=158

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = +1

Query  187  QRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAAS  366
            +R  GFL++R R +CTPQ+ SSRREAWPRMVP+ STVS VFGSRA ERYR D+TLLE+ +
Sbjct  35   KRHSGFLYSRTREKCTPQFWSSRREAWPRMVPQGSTVSNVFGSRASERYRSDMTLLESRA  94

Query  367  RNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
             N++G +VF  L+K+++AALLNSYARK  + ++AWEVKT +IQ LVS+
Sbjct  95   VNEEG-NVFNELLKQASAALLNSYARKG-FPYSAWEVKTLMIQGLVSE  140



>emb|CDY11979.1| BnaC03g14050D [Brassica napus]
Length=152

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 94/127 (74%), Gaps = 7/127 (6%)
 Frame = +1

Query  136  VAFLY-CSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFG  312
            VAF + C  AG ++A     R GF +TR++GRCTPQY SSRREAWPRMVPE STV K+FG
Sbjct  13   VAFCFLCLFAGDSSAT----RSGFFYTRHKGRCTPQYWSSRREAWPRMVPERSTVEKMFG  68

Query  313  SR-AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRL  489
               A ER+R DLTL+E+ SRND+  + + +L+K+  AALLNSYAR+  + +  WEVKT L
Sbjct  69   VMVAKERWRSDLTLVESTSRNDEEGNAYGALLKQGIAALLNSYARR-SFSYAPWEVKTML  127

Query  490  IQALVSK  510
            IQA++S+
Sbjct  128  IQAMISE  134



>ref|XP_006408976.1| hypothetical protein EUTSA_v10002113mg [Eutrema salsugineum]
 gb|ESQ50429.1| hypothetical protein EUTSA_v10002113mg [Eutrema salsugineum]
Length=153

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 5/124 (4%)
 Frame = +1

Query  142  FLYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSR-  318
            FL C  AG ++A    R  GF +TR+RGRCTPQY SSRREAWPRMVPE STV K+FG   
Sbjct  16   FLVCFFAGDSSAT---RPAGFSYTRHRGRCTPQYWSSRREAWPRMVPERSTVEKMFGVMV  72

Query  319  AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQA  498
            A ER+R DLTL+E+ +RND+  + + +L+K+  AALLNSYAR+  + +  WEVKT LIQA
Sbjct  73   AKERWRSDLTLVESTARNDEEGNAYGALLKQGIAALLNSYARR-SFSYAPWEVKTMLIQA  131

Query  499  LVSK  510
            ++S+
Sbjct  132  MISE  135



>ref|XP_008451248.1| PREDICTED: uncharacterized protein LOC103492595 [Cucumis melo]
Length=178

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = +1

Query  190  RRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASR  369
            R PGFLF+R  GRCT Q+ SSR EAWPRM PE +TV+K+FGSRA ERY  ++TL+EAA  
Sbjct  57   RPPGFLFSRTTGRCTAQFWSSRSEAWPRMAPESATVAKIFGSRARERYGSEMTLMEAAGG  116

Query  370  NDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
             +  ++VF  +VKE+TAALLNSYAR+  + ++AWEVKT LI+ALVSK+
Sbjct  117  AE--EEVFGRVVKEATAALLNSYARRRDFPYSAWEVKTLLIKALVSKE  162



>emb|CDY36764.1| BnaA03g11220D [Brassica napus]
Length=152

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 94/127 (74%), Gaps = 7/127 (6%)
 Frame = +1

Query  136  VAFLY-CSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFG  312
            VAF + C  AG ++A     R GF +TR+RGRCTPQY SSRREAWPRMVPE STV K+FG
Sbjct  13   VAFCFLCFFAGDSSAT----RAGFYYTRHRGRCTPQYWSSRREAWPRMVPERSTVEKMFG  68

Query  313  SR-AYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRL  489
               A ER+R DLTL+E+ +RND+  + + +L+K+  AALLNSYAR+  + +  WEVKT L
Sbjct  69   VMVAKERWRSDLTLVESTARNDEEGNAYGALLKQGIAALLNSYARR-SFSYAPWEVKTML  127

Query  490  IQALVSK  510
            IQA++S+
Sbjct  128  IQAMISE  134



>ref|XP_009132352.1| PREDICTED: uncharacterized protein LOC103856964 [Brassica rapa]
Length=205

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 91/123 (74%), Gaps = 6/123 (5%)
 Frame = +1

Query  145  LYCSGAGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSR-A  321
            L C  AG ++A     R GF +TR+RGRCTPQY SSRREAWPRMVPE STV K+FG   A
Sbjct  70   LLCFFAGDSSAA----RAGFFYTRHRGRCTPQYWSSRREAWPRMVPERSTVEKMFGVMVA  125

Query  322  YERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQAL  501
             ER+R DLTL+E+ +RND+  + + +L+K+  AALLNSYAR+  + +  WEVKT LIQA+
Sbjct  126  KERWRSDLTLVESTARNDEEGNAYGALLKQGIAALLNSYARR-SFSYAPWEVKTMLIQAM  184

Query  502  VSK  510
            +S+
Sbjct  185  ISE  187



>gb|KDO60494.1| hypothetical protein CISIN_1g042786mg, partial [Citrus sinensis]
Length=113

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = +1

Query  190  RRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASR  369
            RRPGFL+TR RGRCTPQ+ SSRRE WPRMVP+ ST+SKVFGSR YER+R DLTLLE+ +R
Sbjct  34   RRPGFLYTRIRGRCTPQFWSSRREVWPRMVPQTSTLSKVFGSRVYERFRSDLTLLESTTR  93

Query  370  NDDGDDVFASLVKESTAALLN  432
            NDD ++ FA LVK+ TAALLN
Sbjct  94   NDD-ENAFAGLVKQGTAALLN  113



>gb|EYU17919.1| hypothetical protein MIMGU_mgv1a016687mg [Erythranthe guttata]
Length=111

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 76/88 (86%), Gaps = 1/88 (1%)
 Frame = +1

Query  247  SSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRNDDGDDVFASLVKESTAAL  426
            SSR+E+ P+MVPE STVS VFGSRA+ERYR DLTL+EAASRN++ ++ FA LVK+STAAL
Sbjct  7    SSRKESCPKMVPEKSTVSNVFGSRAFERYREDLTLMEAASRNEEAENAFAGLVKQSTAAL  66

Query  427  LNSYARKPHYHFTAWEVKTRLIQALVSK  510
            LNSYARK  Y + AWEVKT LI+A+VS+
Sbjct  67   LNSYARKG-YPYAAWEVKTLLIRAMVSE  93



>ref|XP_009413726.1| PREDICTED: uncharacterized protein LOC103994975 [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +1

Query  190  RRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASR  369
            R PG+L+ R  GRCTPQ+ SS RE WP  VP  S+VSKVFGSR  ERY   LTLLEA  R
Sbjct  38   RMPGYLYIRTTGRCTPQFWSSGREPWPNTVPHDSSVSKVFGSRLLERYEPGLTLLEATQR  97

Query  370  NDD-GDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSK  510
             DD G   F+ LVK+S+AALLN+Y+R P + ++AWE+K+ +++ALVS+
Sbjct  98   TDDIGGSAFSKLVKQSSAALLNAYSR-PGFPYSAWEIKSLVLEALVSE  144



>ref|NP_001132608.1| hypothetical protein precursor [Zea mays]
 gb|ACF81526.1| unknown [Zea mays]
 tpg|DAA36979.1| TPA: hypothetical protein ZEAMMB73_327282 [Zea mays]
Length=182

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +1

Query  196  PGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRND  375
            PG+L+TR  GRCTPQ+ SS  E WP +VP+ + V+KVFGSR+ ERY   LTLLEA  R D
Sbjct  60   PGYLYTRAVGRCTPQFWSSGAEPWPNIVPQEAAVAKVFGSRSVERYGPRLTLLEATMRTD  119

Query  376  D-GDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            D G   F  LVK+ +AALLN+YAR+  + F +WEVK  L++ALVS+D
Sbjct  120  DAGGSAFVKLVKQGSAALLNAYARR-GFPFDSWEVKALLLEALVSED  165



>ref|XP_010037977.1| PREDICTED: uncharacterized protein LOC104426571 [Eucalyptus grandis]
 ref|XP_010042243.1| PREDICTED: uncharacterized protein LOC104431282 [Eucalyptus grandis]
 gb|KCW49768.1| hypothetical protein EUGRSUZ_K03259 [Eucalyptus grandis]
Length=162

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 2/110 (2%)
 Frame = +1

Query  166  AATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAY-ERYRYD  342
            AA   ++ R+ GF +TR RGRCTPQY SS RE WPRM+P  STVS+ FGSRA  ERY  D
Sbjct  30   AAPPPSRGRKLGFFYTRTRGRCTPQYWSSGREKWPRMLPRKSTVSRAFGSRAIGERYGGD  89

Query  343  LTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLI  492
            LT+ E+ +    G D +  LVK+++AALLNSYARK  + ++AWEVKT LI
Sbjct  90   LTVWESTAGVVGGGDAYGRLVKQASAALLNSYARK-GFAYSAWEVKTLLI  138



>ref|XP_002446788.1| hypothetical protein SORBIDRAFT_06g022650 [Sorghum bicolor]
 gb|EES11116.1| hypothetical protein SORBIDRAFT_06g022650 [Sorghum bicolor]
Length=182

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +1

Query  196  PGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRND  375
            PG+L+TR  GRCTPQ+ SS  E WP ++P+ + V+KVFGSR+ ERY   LTLLEA  R D
Sbjct  60   PGYLYTRAVGRCTPQFWSSGAEPWPNIIPQEAAVAKVFGSRSVERYGPRLTLLEATMRTD  119

Query  376  D-GDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            D G   F  LVK+ +AALLN+YAR+  + F +WEVK  L++ALVS++
Sbjct  120  DIGGSAFVKLVKQGSAALLNAYARR-GFPFNSWEVKALLLEALVSEE  165



>gb|ACG32677.1| hypothetical protein [Zea mays]
Length=182

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +1

Query  196  PGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRND  375
            PG+L+TR  GRCTPQ+ SS  E WP +VP+ + V+KVFGSR+ ERY   LTLLEA  R D
Sbjct  60   PGYLYTRAVGRCTPQFWSSGAEPWPNIVPQEAAVAKVFGSRSVERYGPRLTLLEATMRTD  119

Query  376  D-GDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            D G   F  LVK+ +AALLN+YAR+  + F +WEVK  L++ALVS++
Sbjct  120  DAGGSAFVKLVKQGSAALLNAYARR-GFPFDSWEVKALLLEALVSEE  165



>ref|XP_004976229.1| PREDICTED: uncharacterized protein LOC101786121 [Setaria italica]
Length=182

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = +1

Query  196  PGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRND  375
            PG+L+TR  GRCTPQ+ SS  E WP +VP+ + VSKVFGSR+ ERY   LTLLEA  R D
Sbjct  60   PGYLYTRAVGRCTPQFWSSGAEPWPNIVPQEAAVSKVFGSRSVERYGPRLTLLEATMRTD  119

Query  376  D-GDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            D G   F  LVK+ +AALLN+Y R+  + F +WEVK  L++ALVS++
Sbjct  120  DIGGSAFVKLVKQGSAALLNAYTRR-GFPFDSWEVKALLLEALVSEE  165



>gb|EMT14391.1| hypothetical protein F775_15820 [Aegilops tauschii]
Length=177

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = +1

Query  160  AGAATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRY  339
            AG A    +   PG+L+TR  GRCTPQ+ SS  E WP +VP+ + VSKVFGSR+ ++Y  
Sbjct  44   AGGARGGVRSAWPGYLYTRAVGRCTPQFWSSGAEQWPNIVPQEAAVSKVFGSRSMDKYGP  103

Query  340  DLTLLEAASRNDDGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
             LTLLEA  R DD    F  LVK  +AAL+N+Y R   + F +WEVK  L++ALVS+D
Sbjct  104  RLTLLEATMRTDDVGSPFVKLVKHGSAALINAYTRT-GFPFDSWEVKALLLEALVSED  160



>dbj|BAJ87228.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88039.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=174

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 85/149 (57%), Gaps = 24/149 (16%)
 Frame = +1

Query  136  VAFLYCSGAGAATAM----------AKQRR-------------PGFLFTRNRGRCTPQYT  246
            +  L CS  GAA  M          A  RR             PG+L+TR  GRCTPQ+ 
Sbjct  10   ILILLCSSLGAANGMHRRAAGDEGEAAGRRVADGARGGARSAWPGYLYTRAVGRCTPQFW  69

Query  247  SSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRNDDGDDVFASLVKESTAAL  426
            SS  E WP +VP+ + VSKVFGSR+ ++Y   LTLLEA  R DD    F  LVK  +AAL
Sbjct  70   SSGAEQWPNIVPQEAAVSKVFGSRSMDKYGPRLTLLEATMRTDDVGSPFVKLVKHGSAAL  129

Query  427  LNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            +N+Y R   + F +WEVK  L++ALVS+D
Sbjct  130  INAYTRT-GFPFDSWEVKALLLEALVSED  157



>ref|XP_003580138.1| PREDICTED: uncharacterized protein LOC100843524 [Brachypodium 
distachyon]
Length=173

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 86/146 (59%), Gaps = 23/146 (16%)
 Frame = +1

Query  142  FLYCSGAGAATAM--------------------AKQRRPGFLFTRNRGRCTPQYTSSRRE  261
            FL CS  GAA  M                    ++   PG+L+TR  GRCTPQ+ SS  E
Sbjct  12   FLLCSSLGAANGMYGRAGGEGEASRGVTDGARGSRNAWPGYLYTRAVGRCTPQFWSSGAE  71

Query  262  AWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRNDD--GDDVFASLVKESTAALLNS  435
             WP +VP+ + V KVFGSR+ ++Y   LTLL+A +R DD  G   F  LVK  +AALLN+
Sbjct  72   PWPNIVPQEAAVWKVFGSRSIDKYGPRLTLLDATTRTDDVGGGRPFVKLVKHGSAALLNA  131

Query  436  YARKPHYHFTAWEVKTRLIQALVSKD  513
            Y R+  + F +WEVK  L++ALVS+D
Sbjct  132  YTRR-GFPFDSWEVKALLLEALVSED  156



>gb|EMS55115.1| hypothetical protein TRIUR3_30226 [Triticum urartu]
Length=201

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = +1

Query  196  PGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRND  375
            PG+L+TR  GRCTPQ+ SS  E WP +VP+ + VSKVFGSR+ ++Y   LTLLEA  R D
Sbjct  56   PGYLYTRAVGRCTPQFWSSGAEQWPNIVPQEAAVSKVFGSRSMDKYGPRLTLLEATMRTD  115

Query  376  DGDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            D    F  LVK  +AAL+N+Y R   + F +WEVK  L++ALVS+D
Sbjct  116  DVGSPFVKLVKHGSAALINAYTRT-GFPFDSWEVKALLLEALVSED  160



>emb|CAH67221.1| OSIGBa0145M07.3 [Oryza sativa Indica Group]
 gb|EAY94853.1| hypothetical protein OsI_16649 [Oryza sativa Indica Group]
 gb|EAZ31347.1| hypothetical protein OsJ_15469 [Oryza sativa Japonica Group]
Length=179

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 76/106 (72%), Gaps = 3/106 (3%)
 Frame = +1

Query  202  FLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRNDDG  381
            +L+TR  GRCTPQ+ SS  E WP ++P+ + VSKVFGSR+ +RY   LT+LEA +R DD 
Sbjct  58   YLYTRAVGRCTPQFWSSGAEQWPNIIPQEAAVSKVFGSRSIDRYGPRLTVLEATTRTDDN  117

Query  382  --DDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
                 FA LVK+ +AALLN+YARK  +   +WEVK  L++ALVS+D
Sbjct  118  GSSSAFAKLVKQGSAALLNAYARK-GFPLDSWEVKALLLEALVSED  162



>ref|NP_001053317.1| Os04g0517000 [Oryza sativa Japonica Group]
 dbj|BAF15231.1| Os04g0517000 [Oryza sativa Japonica Group]
Length=156

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 3/117 (3%)
 Frame = +1

Query  169  ATAMAKQRRPGFLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLT  348
            A A A+   PG       G   P++ SS  E WP ++P+ + VSKVFGSR+ +RY   LT
Sbjct  24   ALAAARVGGPGTSTPGPSGDARPKFWSSGAEQWPNIIPQEAAVSKVFGSRSIDRYGPRLT  83

Query  349  LLEAASRNDDG--DDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            +LEA +R DD      FA LVK+ +AALLN+YARK  +   +WEVK  L++ALVS+D
Sbjct  84   VLEATTRTDDNGSSSAFAKLVKQGSAALLNAYARK-GFPLDSWEVKALLLEALVSED  139



>tpg|DAA36981.1| TPA: hypothetical protein ZEAMMB73_327282 [Zea mays]
Length=126

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (71%), Gaps = 2/92 (2%)
 Frame = +1

Query  241  YTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRNDD-GDDVFASLVKEST  417
            + SS  E WP +VP+ + V+KVFGSR+ ERY   LTLLEA  R DD G   F  LVK+ +
Sbjct  19   FWSSGAEPWPNIVPQEAAVAKVFGSRSVERYGPRLTLLEATMRTDDAGGSAFVKLVKQGS  78

Query  418  AALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            AALLN+YAR+  + F +WEVK  L++ALVS+D
Sbjct  79   AALLNAYARR-GFPFDSWEVKALLLEALVSED  109



>ref|XP_006653600.1| PREDICTED: uncharacterized protein LOC102709642 [Oryza brachyantha]
Length=156

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 3/94 (3%)
 Frame = +1

Query  238  QYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRNDD--GDDVFASLVKE  411
            ++ SS  E WP ++P+ + VSKVFGSR+ +RY   LT+LEA  R DD   +  FA LVK+
Sbjct  47   KFWSSGAEQWPNIIPQEAAVSKVFGSRSIDRYGPRLTVLEATMRTDDSGSNSAFAKLVKQ  106

Query  412  STAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
             +AALLN+YAR+  +   +WEVK  L++ALVS+D
Sbjct  107  GSAALLNAYARR-GFPLDSWEVKALLLEALVSED  139



>emb|CAE05445.2| OSJNBa0073E02.5 [Oryza sativa Japonica Group]
Length=175

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 7/106 (7%)
 Frame = +1

Query  202  FLFTRNRGRCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRNDDG  381
            +L+TR  GRCTPQ  + +     +   + + VSKVFGSR+ +RY   LT+LEA +R DD 
Sbjct  58   YLYTRAVGRCTPQILAKK----VQHECQEAAVSKVFGSRSIDRYGPRLTVLEATTRTDDN  113

Query  382  --DDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
                 FA LVK+ +AALLN+YARK  +   +WEVK  L++ALVS+D
Sbjct  114  GSSSAFAKLVKQGSAALLNAYARK-GFPLDSWEVKALLLEALVSED  158



>gb|ADE75752.1| unknown [Picea sitchensis]
Length=148

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = +1

Query  226  RCTPQYTSSRREAWPRMVPEMSTVSKVFGSRAYERYRY-DLTLLEAASRNDDGDDVFASL  402
            +CT QY S  +E WPRM+P  STVSK+ GS A E Y + +LT+L+A    +   D ++SL
Sbjct  38   KCTAQYWSEGKETWPRMLPVGSTVSKLLGSGALEAYGHSELTVLDAMRMEE--RDGYSSL  95

Query  403  VKESTAALLNSYARKPHYHFTAWEVKTRLIQALVS  507
            +K+S+AAL+N+Y+R+  + ++ W VKT  I++LVS
Sbjct  96   LKQSSAALVNAYSRE-GFPYSPWRVKTLFIESLVS  129



>tpg|DAA36982.1| TPA: hypothetical protein ZEAMMB73_327282 [Zea mays]
Length=67

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +1

Query  367  RNDD-GDDVFASLVKESTAALLNSYARKPHYHFTAWEVKTRLIQALVSKD  513
            R DD G   F  LVK+ +AALLN+YAR+  + F +WEVK  L++ALVS+D
Sbjct  2    RTDDAGGSAFVKLVKQGSAALLNAYARR-GFPFDSWEVKALLLEALVSED  50



>ref|XP_002960598.1| hypothetical protein SELMODRAFT_437656 [Selaginella moellendorffii]
 gb|EFJ38137.1| hypothetical protein SELMODRAFT_437656 [Selaginella moellendorffii]
Length=355

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 3/83 (4%)
 Frame = +1

Query  259  EAWPRMVPEMSTVSKVFGSRAYERYRYDLTLLEAASRNDDGDDVFASLVKESTAALLNSY  438
             +WP  +  +STVS VFG  A   +    TLL A        D ++ L+++ TAA+LN+Y
Sbjct  251  NSWPDPLQLISTVSAVFGGLAGNTFGPSTTLLTALETRR--SDPYSQLLRQGTAAMLNAY  308

Query  439  ARKPHYHFTAWEVKTRLIQALVS  507
            +R P++ +T   V+  L  ALVS
Sbjct  309  SR-PNFQYTPLAVRNHLNAALVS  330



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2213930630844