BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7773

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006351113.1|  PREDICTED: RNA-binding protein 39-like isofo...  52.0    7e-05   Solanum tuberosum [potatoes]
ref|XP_011100931.1|  PREDICTED: RNA-binding protein 39                52.0    7e-05   Sesamum indicum [beniseed]
ref|XP_010312457.1|  PREDICTED: RNA-binding protein 39                51.6    8e-05   Solanum lycopersicum



>ref|XP_006351113.1| PREDICTED: RNA-binding protein 39-like isoform X1 [Solanum tuberosum]
Length=578

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  121  MDFDEYDYLEKAVEETNGPSSKSKDKDRENS  213
            MDFDEYDYLEK VEETNG S+KSKDKD  +S
Sbjct  1    MDFDEYDYLEKTVEETNGTSTKSKDKDNNSS  31



>ref|XP_011100931.1| PREDICTED: RNA-binding protein 39 [Sesamum indicum]
Length=587

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 3/34 (9%)
 Frame = +1

Query  121  MDFDEYDYLEKAVEETNGPSSKS---KDKDRENS  213
            MDFDEYDYLEKAVEETNGPS K    K+KDRE S
Sbjct  1    MDFDEYDYLEKAVEETNGPSKKETPDKEKDREKS  34



>ref|XP_010312457.1| PREDICTED: RNA-binding protein 39 [Solanum lycopersicum]
Length=576

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  121  MDFDEYDYLEKAVEETNGPSSKSKDKDRENS  213
            MDFDEYDYLEK VEETNG S+KSKDKD  +S
Sbjct  1    MDFDEYDYLEKTVEETNGTSTKSKDKDNNSS  31



Lambda      K        H        a         alpha
   0.312    0.130    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 576277578591