BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7702

Length=667
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010655735.1|  PREDICTED: serine/threonine-protein phosphat...    285   1e-86   Vitis vinifera
ref|XP_010098575.1|  hypothetical protein L484_026017                   283   2e-85   
emb|CDP05604.1|  unnamed protein product                                281   2e-85   Coffea canephora [robusta coffee]
ref|XP_008372228.1|  PREDICTED: serine/threonine-protein phosphat...    278   2e-84   Malus domestica [apple tree]
ref|XP_007213638.1|  hypothetical protein PRUPE_ppa001709mg             276   7e-84   Prunus persica
ref|XP_009772965.1|  PREDICTED: serine/threonine-protein phosphat...    276   8e-84   Nicotiana sylvestris
gb|KDO75284.1|  hypothetical protein CISIN_1g0034112mg                  270   1e-83   Citrus sinensis [apfelsine]
ref|XP_002523200.1|  conserved hypothetical protein                     276   1e-83   Ricinus communis
gb|KDO75283.1|  hypothetical protein CISIN_1g0034112mg                  270   1e-83   Citrus sinensis [apfelsine]
ref|XP_009362241.1|  PREDICTED: serine/threonine-protein phosphat...    275   2e-83   Pyrus x bretschneideri [bai li]
ref|XP_006353024.1|  PREDICTED: serine/threonine-protein phosphat...    275   3e-83   Solanum tuberosum [potatoes]
ref|XP_004233174.1|  PREDICTED: serine/threonine-protein phosphat...    275   4e-83   Solanum lycopersicum
ref|XP_004293993.1|  PREDICTED: serine/threonine-protein phosphat...    274   4e-83   Fragaria vesca subsp. vesca
ref|XP_010687079.1|  PREDICTED: serine/threonine-protein phosphat...    273   2e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008225588.1|  PREDICTED: serine/threonine-protein phosphat...    272   2e-82   Prunus mume [ume]
ref|XP_009592305.1|  PREDICTED: serine/threonine-protein phosphat...    272   3e-82   Nicotiana tomentosiformis
ref|XP_006468292.1|  PREDICTED: serine/threonine-protein phosphat...    272   5e-82   Citrus sinensis [apfelsine]
ref|XP_006448922.1|  hypothetical protein CICLE_v10014271mg             272   5e-82   Citrus clementina [clementine]
ref|XP_006448920.1|  hypothetical protein CICLE_v10014271mg             272   5e-82   
ref|XP_010241190.1|  PREDICTED: serine/threonine-protein phosphat...    271   8e-82   Nelumbo nucifera [Indian lotus]
ref|XP_008383415.1|  PREDICTED: serine/threonine-protein phosphat...    269   4e-81   Malus domestica [apple tree]
ref|XP_011096673.1|  PREDICTED: serine/threonine-protein phosphat...    269   4e-81   Sesamum indicum [beniseed]
ref|XP_008383414.1|  PREDICTED: serine/threonine-protein phosphat...    269   5e-81   Malus domestica [apple tree]
ref|XP_012075635.1|  PREDICTED: serine/threonine-protein phosphat...    267   2e-80   Jatropha curcas
ref|XP_007147492.1|  hypothetical protein PHAVU_006G129000g             266   3e-80   Phaseolus vulgaris [French bean]
ref|XP_006846020.1|  PREDICTED: serine/threonine-protein phosphat...    266   1e-79   Amborella trichopoda
ref|XP_002529943.1|  conserved hypothetical protein                     265   3e-79   Ricinus communis
ref|XP_008245668.1|  PREDICTED: serine/threonine-protein phosphat...    265   3e-79   Prunus mume [ume]
ref|XP_010941543.1|  PREDICTED: serine/threonine-protein phosphat...    264   3e-79   Elaeis guineensis
ref|XP_008245669.1|  PREDICTED: serine/threonine-protein phosphat...    265   3e-79   Prunus mume [ume]
gb|EYU19129.1|  hypothetical protein MIMGU_mgv1a001633mg                264   3e-79   Erythranthe guttata [common monkey flower]
ref|XP_010941542.1|  PREDICTED: serine/threonine-protein phosphat...    264   4e-79   Elaeis guineensis
ref|XP_006424559.1|  hypothetical protein CICLE_v100278361mg            254   7e-79   
ref|XP_009344403.1|  PREDICTED: serine/threonine-protein phosphat...    263   8e-79   Pyrus x bretschneideri [bai li]
gb|KEH37054.1|  SIT4 phosphatase-associated family protein              258   1e-78   Medicago truncatula
ref|XP_007022860.1|  SIT4 phosphatase-associated family protein i...    262   1e-78   
ref|XP_007022859.1|  SIT4 phosphatase-associated family protein i...    262   2e-78   
ref|XP_008363509.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    263   2e-78   
ref|XP_009367065.1|  PREDICTED: serine/threonine-protein phosphat...    263   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_012064813.1|  PREDICTED: serine/threonine-protein phosphat...    263   2e-78   Jatropha curcas
ref|XP_009367066.1|  PREDICTED: serine/threonine-protein phosphat...    263   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_012064812.1|  PREDICTED: serine/threonine-protein phosphat...    263   2e-78   Jatropha curcas
ref|XP_009367067.1|  PREDICTED: serine/threonine-protein phosphat...    263   2e-78   Pyrus x bretschneideri [bai li]
gb|KJB83838.1|  hypothetical protein B456_013G267000                    262   4e-78   Gossypium raimondii
ref|XP_010051963.1|  PREDICTED: serine/threonine-protein phosphat...    262   4e-78   Eucalyptus grandis [rose gum]
gb|KJB83839.1|  hypothetical protein B456_013G267000                    262   4e-78   Gossypium raimondii
ref|XP_007208093.1|  hypothetical protein PRUPE_ppa001347mg             262   6e-78   Prunus persica
ref|XP_008799096.1|  PREDICTED: serine/threonine-protein phosphat...    261   8e-78   Phoenix dactylifera
tpg|DAA58712.1|  TPA: hypothetical protein ZEAMMB73_844198              246   1e-77   
gb|KHN22994.1|  Serine/threonine-protein phosphatase 6 regulatory...    261   1e-77   Glycine soja [wild soybean]
ref|XP_006586832.1|  PREDICTED: serine/threonine-protein phosphat...    261   1e-77   Glycine max [soybeans]
ref|XP_011010054.1|  PREDICTED: serine/threonine-protein phosphat...    261   1e-77   Populus euphratica
ref|XP_011010055.1|  PREDICTED: serine/threonine-protein phosphat...    261   1e-77   Populus euphratica
ref|XP_007150196.1|  hypothetical protein PHAVU_005G134600g             260   2e-77   Phaseolus vulgaris [French bean]
ref|XP_010253684.1|  PREDICTED: serine/threonine-protein phosphat...    260   3e-77   Nelumbo nucifera [Indian lotus]
gb|AFW83098.1|  hypothetical protein ZEAMMB73_724275                    248   3e-77   
ref|XP_010253686.1|  PREDICTED: serine/threonine-protein phosphat...    260   3e-77   Nelumbo nucifera [Indian lotus]
ref|XP_010519074.1|  PREDICTED: serine/threonine-protein phosphat...    257   4e-77   Tarenaya hassleriana [spider flower]
ref|XP_003547324.1|  PREDICTED: serine/threonine-protein phosphat...    259   5e-77   Glycine max [soybeans]
ref|XP_004291712.1|  PREDICTED: serine/threonine-protein phosphat...    259   5e-77   Fragaria vesca subsp. vesca
ref|XP_011459441.1|  PREDICTED: serine/threonine-protein phosphat...    259   5e-77   Fragaria vesca subsp. vesca
emb|CDP07106.1|  unnamed protein product                                259   5e-77   Coffea canephora [robusta coffee]
gb|KFK43112.1|  hypothetical protein AALP_AA1G081700                    254   6e-77   Arabis alpina [alpine rockcress]
ref|XP_006384907.1|  SIT4 phosphatase-associated family protein         258   7e-77   
ref|XP_006384906.1|  hypothetical protein POPTR_0004s22110g             258   8e-77   Populus trichocarpa [western balsam poplar]
ref|XP_010519073.1|  PREDICTED: serine/threonine-protein phosphat...    257   8e-77   Tarenaya hassleriana [spider flower]
ref|XP_004134561.1|  PREDICTED: serine/threonine-protein phosphat...    257   8e-77   Cucumis sativus [cucumbers]
ref|XP_010926955.1|  PREDICTED: serine/threonine-protein phosphat...    258   9e-77   
gb|KJB26206.1|  hypothetical protein B456_004G229800                    258   1e-76   Gossypium raimondii
ref|XP_002314265.1|  SIT4 phosphatase-associated family protein         258   1e-76   
gb|KJB26208.1|  hypothetical protein B456_004G229800                    258   1e-76   Gossypium raimondii
ref|XP_010926954.1|  PREDICTED: serine/threonine-protein phosphat...    258   1e-76   Elaeis guineensis
emb|CDM83054.1|  unnamed protein product                                257   1e-76   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006654872.1|  PREDICTED: serine/threonine-protein phosphat...    257   2e-76   Oryza brachyantha
ref|XP_003540184.1|  PREDICTED: serine/threonine-protein phosphat...    258   2e-76   Glycine max [soybeans]
ref|XP_008777093.1|  PREDICTED: serine/threonine-protein phosphat...    257   2e-76   
ref|XP_010540614.1|  PREDICTED: serine/threonine-protein phosphat...    256   2e-76   Tarenaya hassleriana [spider flower]
gb|AES67505.2|  SIT4 phosphatase-associated family protein              258   2e-76   Medicago truncatula
ref|XP_006594978.1|  PREDICTED: serine/threonine-protein phosphat...    258   2e-76   Glycine max [soybeans]
ref|XP_003543458.1|  PREDICTED: serine/threonine-protein phosphat...    258   2e-76   Glycine max [soybeans]
gb|KHG24330.1|  Serine/threonine-protein phosphatase 6 regulatory...    257   2e-76   Gossypium arboreum [tree cotton]
gb|KHN21514.1|  Serine/threonine-protein phosphatase 6 regulatory...    257   2e-76   Glycine soja [wild soybean]
ref|XP_008439556.1|  PREDICTED: serine/threonine-protein phosphat...    256   2e-76   Cucumis melo [Oriental melon]
gb|KEH39331.1|  SIT4 phosphatase-associated family protein              257   3e-76   Medicago truncatula
ref|XP_010313413.1|  PREDICTED: serine/threonine-protein phosphat...    257   3e-76   Solanum lycopersicum
ref|XP_004251140.1|  PREDICTED: serine/threonine-protein phosphat...    257   3e-76   Solanum lycopersicum
ref|XP_010313414.1|  PREDICTED: serine/threonine-protein phosphat...    257   3e-76   Solanum lycopersicum
ref|XP_007016756.1|  SIT4 phosphatase-associated family protein i...    257   3e-76   
ref|XP_007016755.1|  SIT4 phosphatase-associated family protein i...    257   3e-76   
ref|XP_009795038.1|  PREDICTED: serine/threonine-protein phosphat...    257   4e-76   Nicotiana sylvestris
ref|XP_009795040.1|  PREDICTED: serine/threonine-protein phosphat...    257   4e-76   Nicotiana sylvestris
gb|EMT30482.1|  hypothetical protein F775_29416                         256   5e-76   
gb|KHN38759.1|  Serine/threonine-protein phosphatase 6 regulatory...    256   5e-76   Glycine soja [wild soybean]
ref|XP_009587813.1|  PREDICTED: serine/threonine-protein phosphat...    256   5e-76   Nicotiana tomentosiformis
ref|XP_009613055.1|  PREDICTED: serine/threonine-protein phosphat...    256   6e-76   Nicotiana tomentosiformis
ref|XP_009613054.1|  PREDICTED: serine/threonine-protein phosphat...    256   6e-76   Nicotiana tomentosiformis
ref|XP_009587814.1|  PREDICTED: serine/threonine-protein phosphat...    256   6e-76   Nicotiana tomentosiformis
ref|XP_011656998.1|  PREDICTED: serine/threonine-protein phosphat...    256   6e-76   Cucumis sativus [cucumbers]
ref|XP_004145744.1|  PREDICTED: serine/threonine-protein phosphat...    256   6e-76   Cucumis sativus [cucumbers]
ref|XP_008463950.1|  PREDICTED: serine/threonine-protein phosphat...    256   7e-76   Cucumis melo [Oriental melon]
ref|XP_008463951.1|  PREDICTED: serine/threonine-protein phosphat...    256   7e-76   Cucumis melo [Oriental melon]
ref|XP_010089978.1|  hypothetical protein L484_008056                   256   8e-76   Morus notabilis
ref|XP_007132264.1|  hypothetical protein PHAVU_011G080000g             256   9e-76   Phaseolus vulgaris [French bean]
ref|XP_003540757.1|  PREDICTED: serine/threonine-protein phosphat...    256   9e-76   Glycine max [soybeans]
gb|KHN05680.1|  Serine/threonine-protein phosphatase 6 regulatory...    255   1e-75   Glycine soja [wild soybean]
gb|KHG15599.1|  Serine/threonine-protein phosphatase 6 regulatory...    254   1e-75   Gossypium arboreum [tree cotton]
ref|XP_004969398.1|  PREDICTED: serine/threonine-protein phosphat...    254   1e-75   Setaria italica
ref|XP_004969397.1|  PREDICTED: serine/threonine-protein phosphat...    254   1e-75   Setaria italica
ref|XP_006488080.1|  PREDICTED: serine/threonine-protein phosphat...    255   2e-75   Citrus sinensis [apfelsine]
ref|XP_006488081.1|  PREDICTED: serine/threonine-protein phosphat...    255   2e-75   Citrus sinensis [apfelsine]
ref|XP_011040887.1|  PREDICTED: serine/threonine-protein phosphat...    254   2e-75   Populus euphratica
ref|XP_011040886.1|  PREDICTED: serine/threonine-protein phosphat...    254   2e-75   Populus euphratica
ref|XP_011040889.1|  PREDICTED: serine/threonine-protein phosphat...    254   2e-75   Populus euphratica
ref|XP_004969396.1|  PREDICTED: serine/threonine-protein phosphat...    254   2e-75   
ref|XP_009776728.1|  PREDICTED: serine/threonine-protein phosphat...    254   2e-75   Nicotiana sylvestris
ref|XP_010541325.1|  PREDICTED: serine/threonine-protein phosphat...    253   3e-75   Tarenaya hassleriana [spider flower]
ref|XP_009776729.1|  PREDICTED: serine/threonine-protein phosphat...    254   3e-75   Nicotiana sylvestris
ref|NP_001056496.1|  Os05g0592500                                       253   3e-75   
ref|XP_006415470.1|  hypothetical protein EUTSA_v10006836mg             253   3e-75   Eutrema salsugineum [saltwater cress]
ref|XP_006340190.1|  PREDICTED: serine/threonine-protein phosphat...    254   4e-75   Solanum tuberosum [potatoes]
ref|XP_006340189.1|  PREDICTED: serine/threonine-protein phosphat...    254   4e-75   Solanum tuberosum [potatoes]
ref|XP_006340191.1|  PREDICTED: serine/threonine-protein phosphat...    254   4e-75   Solanum tuberosum [potatoes]
ref|XP_003569276.1|  PREDICTED: serine/threonine-protein phosphat...    254   4e-75   Brachypodium distachyon [annual false brome]
ref|XP_009115143.1|  PREDICTED: serine/threonine-protein phosphat...    253   4e-75   Brassica rapa
gb|KJB56284.1|  hypothetical protein B456_009G114900                    252   6e-75   Gossypium raimondii
ref|XP_008385322.1|  PREDICTED: serine/threonine-protein phosphat...    253   6e-75   
ref|NP_001170695.1|  uncharacterized protein LOC100384768               248   6e-75   
ref|NP_174335.4|  SIT4 phosphatase-associated family protein            253   7e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008359132.1|  PREDICTED: serine/threonine-protein phosphat...    253   8e-75   
ref|XP_004487102.1|  PREDICTED: serine/threonine-protein phosphat...    253   8e-75   Cicer arietinum [garbanzo]
ref|XP_004487101.1|  PREDICTED: serine/threonine-protein phosphat...    253   9e-75   Cicer arietinum [garbanzo]
ref|XP_006846781.2|  PREDICTED: serine/threonine-protein phosphat...    251   9e-75   Amborella trichopoda
ref|XP_002889677.1|  SIT4 phosphatase-associated family protein         252   1e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_011085212.1|  PREDICTED: serine/threonine-protein phosphat...    251   1e-74   Sesamum indicum [beniseed]
ref|XP_004961011.1|  PREDICTED: serine/threonine-protein phosphat...    251   1e-74   Setaria italica
ref|XP_004961012.1|  PREDICTED: serine/threonine-protein phosphat...    251   2e-74   Setaria italica
ref|XP_006417742.1|  hypothetical protein EUTSA_v10006825mg             251   2e-74   Eutrema salsugineum [saltwater cress]
emb|CDX98206.1|  BnaC07g08920D                                          251   2e-74   
gb|KJB56143.1|  hypothetical protein B456_009G107700                    252   2e-74   Gossypium raimondii
ref|XP_002455854.1|  hypothetical protein SORBIDRAFT_03g026240          251   3e-74   Sorghum bicolor [broomcorn]
gb|EPS64818.1|  hypothetical protein M569_09960                         244   3e-74   Genlisea aurea
emb|CDY09579.1|  BnaC05g23400D                                          251   3e-74   Brassica napus [oilseed rape]
ref|XP_009118397.1|  PREDICTED: serine/threonine-protein phosphat...    250   4e-74   Brassica rapa
emb|CDY02294.1|  BnaA09g26080D                                          254   4e-74   
emb|CBI16320.3|  unnamed protein product                                250   5e-74   Vitis vinifera
emb|CDX77590.1|  BnaA07g07280D                                          250   5e-74   
ref|XP_009102696.1|  PREDICTED: serine/threonine-protein phosphat...    250   5e-74   Brassica rapa
ref|XP_009102694.1|  PREDICTED: serine/threonine-protein phosphat...    250   5e-74   Brassica rapa
ref|XP_009102695.1|  PREDICTED: serine/threonine-protein phosphat...    250   5e-74   Brassica rapa
gb|EYU43237.1|  hypothetical protein MIMGU_mgv1a002224mg                248   6e-74   Erythranthe guttata [common monkey flower]
emb|CBI30997.3|  unnamed protein product                                250   7e-74   Vitis vinifera
ref|XP_010651169.1|  PREDICTED: serine/threonine-protein phosphat...    251   7e-74   Vitis vinifera
ref|XP_010460839.1|  PREDICTED: serine/threonine-protein phosphat...    250   7e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010651167.1|  PREDICTED: serine/threonine-protein phosphat...    251   8e-74   Vitis vinifera
ref|NP_172277.2|  SIT4 phosphatase-associated family protein            250   8e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285194.1|  PREDICTED: serine/threonine-protein phosphat...    251   8e-74   Vitis vinifera
ref|XP_010478456.1|  PREDICTED: serine/threonine-protein phosphat...    250   8e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010651168.1|  PREDICTED: serine/threonine-protein phosphat...    251   8e-74   Vitis vinifera
ref|XP_010499578.1|  PREDICTED: serine/threonine-protein phosphat...    250   8e-74   
ref|XP_010689536.1|  PREDICTED: serine/threonine-protein phosphat...    250   9e-74   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC70972.1|  hypothetical protein OsI_02602                          249   9e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_006644315.1|  PREDICTED: serine/threonine-protein phosphat...    249   1e-73   Oryza brachyantha
ref|XP_011089916.1|  PREDICTED: serine/threonine-protein phosphat...    250   1e-73   Sesamum indicum [beniseed]
ref|XP_011089914.1|  PREDICTED: serine/threonine-protein phosphat...    250   1e-73   Sesamum indicum [beniseed]
ref|XP_006644316.1|  PREDICTED: serine/threonine-protein phosphat...    249   1e-73   Oryza brachyantha
emb|CDY12058.1|  BnaC03g59740D                                          249   1e-73   Brassica napus [oilseed rape]
ref|XP_007022858.1|  SIT4 phosphatase-associated family protein i...    249   1e-73   
emb|CDX90252.1|  BnaA08g17320D                                          249   1e-73   
ref|XP_010503168.1|  PREDICTED: serine/threonine-protein phosphat...    249   2e-73   Camelina sativa [gold-of-pleasure]
emb|CDY22707.1|  BnaC08g43410D                                          249   2e-73   Brassica napus [oilseed rape]
ref|XP_008655348.1|  PREDICTED: uncharacterized protein LOC100384...    248   2e-73   
emb|CDY06292.1|  BnaA09g49110D                                          250   2e-73   
ref|XP_009109584.1|  PREDICTED: serine/threonine-protein phosphat...    248   3e-73   Brassica rapa
ref|XP_009109582.1|  PREDICTED: serine/threonine-protein phosphat...    248   3e-73   Brassica rapa
ref|XP_009109583.1|  PREDICTED: serine/threonine-protein phosphat...    248   3e-73   Brassica rapa
ref|XP_008647473.1|  PREDICTED: uncharacterized protein LOC100217...    246   3e-73   Zea mays [maize]
ref|XP_010458020.1|  PREDICTED: serine/threonine-protein phosphat...    248   3e-73   Camelina sativa [gold-of-pleasure]
dbj|BAF01295.1|  hypothetical protein                                   248   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008647472.1|  PREDICTED: uncharacterized protein LOC100217...    246   5e-73   Zea mays [maize]
ref|XP_008647471.1|  PREDICTED: uncharacterized protein LOC100217...    246   5e-73   
ref|XP_009148052.1|  PREDICTED: serine/threonine-protein phosphat...    248   6e-73   Brassica rapa
ref|XP_009148053.1|  PREDICTED: serine/threonine-protein phosphat...    248   6e-73   Brassica rapa
ref|XP_003594506.1|  Serine/threonine protein phosphatase 6 regul...    247   7e-73   
ref|XP_008676369.1|  PREDICTED: serine/threonine-protein phosphat...    247   8e-73   
ref|XP_010475582.1|  PREDICTED: serine/threonine-protein phosphat...    247   8e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010514860.1|  PREDICTED: serine/threonine-protein phosphat...    247   8e-73   Camelina sativa [gold-of-pleasure]
ref|NP_190105.3|  SIT4 phosphatase-associated family protein            247   9e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290616.1|  hypothetical protein CARUB_v10016707mg             247   9e-73   Capsella rubella
ref|XP_002877390.1|  SIT4 phosphatase-associated family protein         247   9e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_010495852.1|  PREDICTED: serine/threonine-protein phosphat...    247   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010488251.1|  PREDICTED: serine/threonine-protein phosphat...    247   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010414535.1|  PREDICTED: serine/threonine-protein phosphat...    246   1e-72   Camelina sativa [gold-of-pleasure]
gb|KFK43115.1|  hypothetical protein AALP_AA1G082000                    243   2e-72   Arabis alpina [alpine rockcress]
ref|XP_010488242.1|  PREDICTED: serine/threonine-protein phosphat...    246   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_009787317.1|  PREDICTED: serine/threonine-protein phosphat...    246   2e-72   Nicotiana sylvestris
ref|XP_006409861.1|  hypothetical protein EUTSA_v10016277mg             246   2e-72   Eutrema salsugineum [saltwater cress]
ref|XP_009787316.1|  PREDICTED: serine/threonine-protein phosphat...    246   2e-72   Nicotiana sylvestris
ref|XP_009787315.1|  PREDICTED: serine/threonine-protein phosphat...    246   3e-72   Nicotiana sylvestris
gb|KHG09664.1|  Serine/threonine-protein phosphatase 6 regulatory...    246   3e-72   Gossypium arboreum [tree cotton]
gb|KDO73307.1|  hypothetical protein CISIN_1g0361043mg                  234   3e-72   Citrus sinensis [apfelsine]
ref|XP_006305894.1|  hypothetical protein CARUB_v10011058mg             246   3e-72   Capsella rubella
ref|XP_010510633.1|  PREDICTED: serine/threonine-protein phosphat...    245   3e-72   Camelina sativa [gold-of-pleasure]
gb|KJB20296.1|  hypothetical protein B456_003G142400                    246   3e-72   Gossypium raimondii
gb|KJB20294.1|  hypothetical protein B456_003G142400                    246   4e-72   Gossypium raimondii
emb|CDX93601.1|  BnaA06g04470D                                          245   4e-72   
ref|XP_001775253.1|  predicted protein                                  241   4e-72   
ref|XP_011089293.1|  PREDICTED: serine/threonine-protein phosphat...    246   4e-72   Sesamum indicum [beniseed]
ref|XP_010510632.1|  PREDICTED: serine/threonine-protein phosphat...    245   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_011089292.1|  PREDICTED: serine/threonine-protein phosphat...    246   4e-72   Sesamum indicum [beniseed]
gb|EMS55914.1|  hypothetical protein TRIUR3_26440                       245   4e-72   Triticum urartu
ref|XP_006293709.1|  hypothetical protein CARUB_v10022667mg             245   4e-72   Capsella rubella
emb|CDY32814.1|  BnaC08g02360D                                          245   4e-72   Brassica napus [oilseed rape]
ref|NP_180403.4|  SIT4 phosphatase-associated family protein            245   5e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006419062.1|  hypothetical protein EUTSA_v10002405mg             244   6e-72   Eutrema salsugineum [saltwater cress]
ref|XP_009598804.1|  PREDICTED: serine/threonine-protein phosphat...    245   7e-72   Nicotiana tomentosiformis
ref|XP_009598803.1|  PREDICTED: serine/threonine-protein phosphat...    245   8e-72   Nicotiana tomentosiformis
ref|XP_010520373.1|  PREDICTED: serine/threonine-protein phosphat...    244   8e-72   Tarenaya hassleriana [spider flower]
ref|XP_009598802.1|  PREDICTED: serine/threonine-protein phosphat...    245   9e-72   Nicotiana tomentosiformis
dbj|BAJ97543.1|  predicted protein                                      244   1e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010557326.1|  PREDICTED: serine/threonine-protein phosphat...    244   1e-71   Tarenaya hassleriana [spider flower]
dbj|BAJ92006.1|  predicted protein                                      244   1e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU36182.1|  hypothetical protein MIMGU_mgv1a001475mg                244   1e-71   Erythranthe guttata [common monkey flower]
gb|EYU36183.1|  hypothetical protein MIMGU_mgv1a001475mg                244   1e-71   Erythranthe guttata [common monkey flower]
ref|XP_010458019.1|  PREDICTED: serine/threonine-protein phosphat...    244   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010264671.1|  PREDICTED: serine/threonine-protein phosphat...    244   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010264673.1|  PREDICTED: serine/threonine-protein phosphat...    244   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010264672.1|  PREDICTED: serine/threonine-protein phosphat...    244   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010264670.1|  PREDICTED: serine/threonine-protein phosphat...    244   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_009150090.1|  PREDICTED: serine/threonine-protein phosphat...    243   2e-71   
gb|KFK44857.1|  hypothetical protein AALP_AA1G311500                    243   2e-71   Arabis alpina [alpine rockcress]
ref|XP_006357565.1|  PREDICTED: serine/threonine-protein phosphat...    244   3e-71   Solanum tuberosum [potatoes]
ref|XP_006357564.1|  PREDICTED: serine/threonine-protein phosphat...    244   3e-71   Solanum tuberosum [potatoes]
emb|CDY31030.1|  BnaC03g55050D                                          240   3e-71   Brassica napus [oilseed rape]
emb|CDX99166.1|  BnaA06g18570D                                          243   3e-71   
ref|XP_004506011.1|  PREDICTED: serine/threonine-protein phosphat...    243   4e-71   Cicer arietinum [garbanzo]
emb|CDY58827.1|  BnaAnng15450D                                          243   4e-71   Brassica napus [oilseed rape]
ref|XP_008667318.1|  PREDICTED: uncharacterized protein LOC100216...    241   7e-71   
ref|XP_010314884.1|  PREDICTED: serine/threonine-protein phosphat...    242   7e-71   Solanum lycopersicum
gb|KFK43114.1|  hypothetical protein AALP_AA1G081900                    241   8e-71   Arabis alpina [alpine rockcress]
ref|XP_004253228.1|  PREDICTED: serine/threonine-protein phosphat...    242   8e-71   Solanum lycopersicum
emb|CDY52192.1|  BnaAnng11330D                                          234   9e-71   Brassica napus [oilseed rape]
ref|XP_002890872.1|  SIT4 phosphatase-associated family protein         241   1e-70   
ref|XP_010470094.1|  PREDICTED: serine/threonine-protein phosphat...    241   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009110912.1|  PREDICTED: serine/threonine-protein phosphat...    241   2e-70   Brassica rapa
ref|XP_003580575.1|  PREDICTED: serine/threonine-protein phosphat...    241   2e-70   Brachypodium distachyon [annual false brome]
ref|XP_006365733.1|  PREDICTED: serine/threonine-protein phosphat...    241   2e-70   Solanum tuberosum [potatoes]
ref|XP_004241276.1|  PREDICTED: serine/threonine-protein phosphat...    241   2e-70   Solanum lycopersicum
ref|NP_001185116.1|  SIT4 phosphatase-associated family protein         241   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010538265.1|  PREDICTED: serine/threonine-protein phosphat...    240   2e-70   Tarenaya hassleriana [spider flower]
gb|KFK32305.1|  hypothetical protein AALP_AA6G225000                    240   2e-70   Arabis alpina [alpine rockcress]
ref|XP_004976848.1|  PREDICTED: serine/threonine-protein phosphat...    240   3e-70   Setaria italica
ref|XP_004976847.1|  PREDICTED: serine/threonine-protein phosphat...    240   3e-70   Setaria italica
ref|XP_010521761.1|  PREDICTED: serine/threonine-protein phosphat...    240   4e-70   Tarenaya hassleriana [spider flower]
ref|NP_001169338.1|  uncharacterized protein LOC100383205               238   4e-70   Zea mays [maize]
emb|CDX95104.1|  BnaC05g05670D                                          239   5e-70   
ref|NP_001053906.1|  Os04g0620400                                       237   5e-70   
emb|CDX77174.1|  BnaC04g39690D                                          239   5e-70   
ref|XP_009383686.1|  PREDICTED: serine/threonine-protein phosphat...    239   7e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383685.1|  PREDICTED: serine/threonine-protein phosphat...    239   7e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380794.1|  PREDICTED: serine/threonine-protein phosphat...    238   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001769230.1|  predicted protein                                  238   1e-69   
ref|XP_008662182.1|  PREDICTED: uncharacterized protein LOC100383...    238   1e-69   Zea mays [maize]
emb|CAH66980.1|  H0714H04.7                                             237   3e-69   Oryza sativa [red rice]
emb|CAD41753.2|  OSJNBa0058K23.19                                       237   3e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306420.1|  hypothetical protein CARUB_v10012357mg             238   4e-69   
ref|XP_009140897.1|  PREDICTED: serine/threonine-protein phosphat...    236   4e-69   Brassica rapa
ref|XP_001784123.1|  predicted protein                                  233   7e-69   
ref|XP_010935870.1|  PREDICTED: serine/threonine-protein phosphat...    236   9e-69   Elaeis guineensis
ref|XP_008805198.1|  PREDICTED: serine/threonine-protein phosphat...    234   4e-68   Phoenix dactylifera
ref|XP_008805199.1|  PREDICTED: serine/threonine-protein phosphat...    234   4e-68   Phoenix dactylifera
ref|XP_008805195.1|  PREDICTED: serine/threonine-protein phosphat...    234   5e-68   Phoenix dactylifera
ref|XP_008805190.1|  PREDICTED: serine/threonine-protein phosphat...    234   5e-68   Phoenix dactylifera
ref|XP_008805197.1|  PREDICTED: serine/threonine-protein phosphat...    234   5e-68   Phoenix dactylifera
ref|XP_008805193.1|  PREDICTED: serine/threonine-protein phosphat...    234   5e-68   Phoenix dactylifera
ref|XP_008805192.1|  PREDICTED: serine/threonine-protein phosphat...    234   6e-68   Phoenix dactylifera
ref|XP_008805191.1|  PREDICTED: serine/threonine-protein phosphat...    234   6e-68   Phoenix dactylifera
ref|XP_008805194.1|  PREDICTED: serine/threonine-protein phosphat...    234   6e-68   Phoenix dactylifera
ref|XP_009412026.1|  PREDICTED: serine/threonine-protein phosphat...    233   9e-68   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY30492.1|  BnaA04g16410D                                          233   1e-67   Brassica napus [oilseed rape]
gb|AES64757.2|  SIT4 phosphatase-associated family protein              231   4e-67   
gb|AAF79824.1|AC026875_4  T6D22.8                                       232   8e-67   
ref|XP_003597254.1|  Serine/threonine protein phosphatase 6 regul...    230   2e-66   
gb|KJB69066.1|  hypothetical protein B456_011G004000                    229   3e-66   
gb|KHG05028.1|  Serine/threonine-protein phosphatase 6 regulatory...    229   4e-66   
gb|ERN08362.1|  hypothetical protein AMTR_s00148p00040560               228   5e-66   
gb|EYU18827.1|  hypothetical protein MIMGU_mgv1a022178mg                228   8e-66   
gb|KJB26207.1|  hypothetical protein B456_004G229800                    227   3e-65   
ref|XP_009385589.1|  PREDICTED: serine/threonine-protein phosphat...    226   7e-65   
gb|EPS66808.1|  hypothetical protein M569_07969                         222   7e-65   
gb|EMT18298.1|  hypothetical protein F775_26602                         224   1e-64   
ref|XP_010520374.1|  PREDICTED: serine/threonine-protein phosphat...    223   4e-64   
gb|AAD20690.1|  hypothetical protein                                    223   5e-64   
ref|XP_002879101.1|  SIT4 phosphatase-associated family protein         223   9e-64   
ref|XP_009382444.1|  PREDICTED: serine/threonine-protein phosphat...    221   2e-63   
gb|EEC78024.1|  hypothetical protein OsI_17451                          216   4e-62   
ref|XP_002440377.1|  hypothetical protein SORBIDRAFT_09g030580          220   1e-61   
gb|EEE61708.1|  hypothetical protein OsJ_16198                          216   1e-61   
gb|AAF19748.1|AC009917_7  Contains similarity to gb|D21822 ORF fr...    215   3e-61   
gb|KHG10743.1|  Serine/threonine-protein phosphatase 6 regulatory...    203   8e-57   
emb|CDY48149.1|  BnaCnng15910D                                          192   2e-53   
gb|KHN14338.1|  Serine/threonine-protein phosphatase 6 regulatory...    185   2e-50   
ref|XP_006419061.1|  hypothetical protein EUTSA_v10002405mg             185   2e-50   
gb|EEE54882.1|  hypothetical protein OsJ_02383                          183   6e-50   
gb|KJB56285.1|  hypothetical protein B456_009G114900                    181   5e-49   
ref|XP_002991888.1|  hypothetical protein SELMODRAFT_269871             176   2e-47   
emb|CDP14075.1|  unnamed protein product                                155   9e-44   
gb|KIY96785.1|  Serine/threonine-protein phosphatase 6 regulatory...    166   1e-43   
gb|KIZ05115.1|  Serine/threonine-protein phosphatase 6 regulatory...    165   4e-43   
ref|NP_001185115.1|  SIT4 phosphatase-associated family protein         160   1e-41   
ref|XP_005645980.1|  SAPS-domain-containing protein                     157   5e-41   
ref|XP_011401375.1|  Serine/threonine-protein phosphatase 6 regul...    153   8e-40   
ref|XP_001703190.1|  hypothetical protein CHLREDRAFT_180347             149   3e-38   
dbj|BAA04846.1|  ORF                                                    149   6e-38   
emb|CAB72157.1|  putative protein                                       144   6e-36   
ref|XP_002893658.1|  hypothetical protein ARALYDRAFT_336206             142   2e-35   
ref|XP_002980128.1|  hypothetical protein SELMODRAFT_419685             139   5e-34   
ref|XP_003060140.1|  predicted protein                                  138   1e-33   
ref|XP_010538266.1|  PREDICTED: serine/threonine-protein phosphat...    135   8e-33   
ref|XP_010264674.1|  PREDICTED: serine/threonine-protein phosphat...    127   1e-29   
ref|NP_082081.1|  serine/threonine-protein phosphatase 6 regulato...    117   3e-28   
ref|XP_006521475.1|  PREDICTED: serine/threonine-protein phosphat...    118   2e-27   
ref|NP_001085816.1|  protein phosphatase 6, regulatory subunit 2        120   3e-27   
ref|XP_004913119.1|  PREDICTED: serine/threonine-protein phosphat...    119   5e-27   
ref|XP_004913120.1|  PREDICTED: serine/threonine-protein phosphat...    119   5e-27   
gb|AAI36141.1|  LOC100125053 protein                                    119   5e-27   
ref|XP_006521473.1|  PREDICTED: serine/threonine-protein phosphat...    117   7e-27   
ref|XP_004330281.1|  PREDICTED: serine/threonine-protein phosphat...    115   9e-27   
ref|XP_006521461.1|  PREDICTED: serine/threonine-protein phosphat...    118   1e-26   
ref|XP_006521468.1|  PREDICTED: serine/threonine-protein phosphat...    118   1e-26   
ref|XP_006521469.1|  PREDICTED: serine/threonine-protein phosphat...    118   1e-26   
sp|Q8R3Q2.1|PP6R2_MOUSE  RecName: Full=Serine/threonine-protein p...    118   1e-26   
ref|NP_081089.1|  serine/threonine-protein phosphatase 6 regulato...    118   1e-26   
ref|XP_007126852.1|  PREDICTED: serine/threonine-protein phosphat...    114   2e-26   
ref|XP_011455979.1|  PREDICTED: serine/threonine-protein phosphat...    117   3e-26   
ref|XP_007241070.1|  PREDICTED: serine/threonine-protein phosphat...    117   4e-26   
ref|XP_011455948.1|  PREDICTED: serine/threonine-protein phosphat...    117   4e-26   
ref|XP_011455970.1|  PREDICTED: serine/threonine-protein phosphat...    117   4e-26   
ref|XP_004007731.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-26   
gb|ELU00356.1|  hypothetical protein CAPTEDRAFT_184298                  116   4e-26   
dbj|BAG59651.1|  unnamed protein product                                114   4e-26   
gb|AAH45920.1|  SAPS domain family, member 3                            113   6e-26   
ref|XP_004279711.1|  PREDICTED: serine/threonine-protein phosphat...    116   7e-26   
ref|XP_005094786.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   
ref|XP_007189309.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   
ref|XP_007454142.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   
ref|XP_007189311.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   
ref|XP_007189310.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   
ref|XP_005701654.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   
ref|XP_005094785.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   
ref|XP_005094787.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   
ref|XP_007189307.1|  PREDICTED: serine/threonine-protein phosphat...    115   1e-25   
ref|XP_006212628.1|  PREDICTED: serine/threonine-protein phosphat...    115   2e-25   
ref|XP_010896479.1|  PREDICTED: serine/threonine-protein phosphat...    115   2e-25   
ref|XP_005207603.1|  PREDICTED: serine/threonine-protein phosphat...    114   2e-25   
ref|XP_010804137.1|  PREDICTED: serine/threonine-protein phosphat...    114   2e-25   
ref|XP_010896478.1|  PREDICTED: serine/threonine-protein phosphat...    115   2e-25   
ref|XP_005207602.1|  PREDICTED: serine/threonine-protein phosphat...    115   2e-25   
ref|NP_001167063.1|  SAPS domain family, member 3                       115   2e-25   
gb|ELR50786.1|  Serine/threonine-protein phosphatase 6 regulatory...    115   2e-25   
ref|XP_002688030.2|  PREDICTED: serine/threonine-protein phosphat...    115   2e-25   
ref|XP_005207601.1|  PREDICTED: serine/threonine-protein phosphat...    115   2e-25   
ref|XP_010896482.1|  PREDICTED: serine/threonine-protein phosphat...    115   2e-25   
ref|XP_010896481.1|  PREDICTED: serine/threonine-protein phosphat...    115   2e-25   
ref|XP_010896480.1|  PREDICTED: serine/threonine-protein phosphat...    115   2e-25   
tpg|DAA28983.1|  TPA: SAPS domain family, member 3-like                 115   2e-25   
gb|EPY89737.1|  serine/threonine-protein phosphatase 6 regulatory...    115   2e-25   
ref|XP_006066439.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    115   2e-25   
ref|XP_010955607.1|  PREDICTED: serine/threonine-protein phosphat...    115   2e-25   
ref|XP_010955611.1|  PREDICTED: serine/threonine-protein phosphat...    114   2e-25   
ref|NP_001100259.1|  serine/threonine-protein phosphatase 6 regul...    114   3e-25   
ref|XP_010955610.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_009296091.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_006173100.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    114   3e-25   
ref|XP_009296086.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|NP_955978.2|  serine/threonine-protein phosphatase 6 regulato...    114   3e-25   
ref|XP_009296096.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_010979908.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_009296089.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_010837580.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_009296097.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_004599814.1|  PREDICTED: serine/threonine-protein phosphat...    108   3e-25   
ref|XP_009296094.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_009296092.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_009296095.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_009296093.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_007245102.1|  PREDICTED: serine/threonine-protein phosphat...    109   3e-25   
ref|XP_005354411.1|  PREDICTED: serine/threonine-protein phosphat...    114   3e-25   
ref|XP_002111130.1|  hypothetical protein TRIADDRAFT_23113              113   3e-25   
ref|XP_005903474.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-25   
ref|XP_002939288.2|  PREDICTED: serine/threonine-protein phosphat...    114   4e-25   
ref|XP_005354412.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-25   
ref|XP_006976208.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-25   
ref|XP_006976215.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-25   
ref|XP_011965354.1|  PREDICTED: serine/threonine-protein phosphat...    114   4e-25   
ref|XP_004061503.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    114   5e-25   
ref|XP_011965355.1|  PREDICTED: serine/threonine-protein phosphat...    114   5e-25   
ref|XP_011965353.1|  PREDICTED: serine/threonine-protein phosphat...    114   5e-25   
ref|NP_001080016.1|  protein phosphatase 6, regulatory subunit 1        114   5e-25   
ref|XP_003281685.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    114   5e-25   
ref|NP_055746.3|  serine/threonine-protein phosphatase 6 regulato...    114   5e-25   
ref|XP_003807155.1|  PREDICTED: serine/threonine-protein phosphat...    114   5e-25   
dbj|BAA83067.3|  KIAA1115 protein                                       114   6e-25   
ref|XP_004916366.1|  PREDICTED: serine/threonine-protein phosphat...    113   6e-25   
ref|XP_007648363.1|  PREDICTED: serine/threonine-protein phosphat...    113   7e-25   
ref|XP_007648365.1|  PREDICTED: serine/threonine-protein phosphat...    113   7e-25   
ref|XP_007648361.1|  PREDICTED: serine/threonine-protein phosphat...    113   7e-25   
ref|XP_008978944.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    113   8e-25   
ref|NP_001129321.1|  serine/threonine-protein phosphatase 6 regul...    113   8e-25   
gb|ERE62763.1|  serine/threonine-protein phosphatase 6 regulatory...    111   8e-25   
ref|XP_006228337.1|  PREDICTED: serine/threonine-protein phosphat...    113   8e-25   
ref|XP_007648358.1|  PREDICTED: serine/threonine-protein phosphat...    113   8e-25   
gb|ELW49012.1|  Serine/threonine-protein phosphatase 6 regulatory...    113   8e-25   
ref|XP_007648364.1|  PREDICTED: serine/threonine-protein phosphat...    113   9e-25   
gb|ERE86422.1|  serine/threonine-protein phosphatase 6 regulatory...    113   1e-24   
ref|XP_003449229.1|  PREDICTED: serine/threonine-protein phosphat...    113   1e-24   
ref|XP_007635706.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    112   1e-24   
gb|ERE86423.1|  serine/threonine-protein phosphatase 6 regulatory...    113   1e-24   
ref|XP_005454309.1|  PREDICTED: serine/threonine-protein phosphat...    113   1e-24   
ref|XP_005454308.1|  PREDICTED: serine/threonine-protein phosphat...    113   1e-24   
ref|XP_005088323.1|  PREDICTED: serine/threonine-protein phosphat...    105   1e-24   
ref|XP_005454305.1|  PREDICTED: serine/threonine-protein phosphat...    113   1e-24   
ref|XP_005747964.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   
ref|XP_006782322.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    112   1e-24   
ref|XP_005933584.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   
ref|XP_004556390.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   
ref|XP_005747965.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   
ref|XP_005933586.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   
ref|XP_005933585.1|  PREDICTED: serine/threonine-protein phosphat...    112   1e-24   
ref|XP_011471127.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_004086253.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529034.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529027.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011917772.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011471129.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011471126.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529032.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011471128.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529024.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_008961625.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529026.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529023.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_008961624.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529025.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529029.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
dbj|BAA31660.2|  KIAA0685 protein                                       112   2e-24   
ref|XP_011529033.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_008961623.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529031.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011917758.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_008961628.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529022.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529030.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011471130.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011917757.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_008961630.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_008961621.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011917764.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011917759.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011529028.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|NP_766482.2|  serine/threonine-protein phosphatase 6 regulato...    112   2e-24   
ref|XP_011917756.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_008961629.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_006992015.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011917762.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011917760.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011917761.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_011917763.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_005566962.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_005566967.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_006261980.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_005566959.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
gb|AAI41040.1|  SAPS domain family, member 1                            112   2e-24   
ref|XP_005566958.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_005653227.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_005566957.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_005566961.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_005566960.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_005566956.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|XP_005369400.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
ref|NP_001193301.1|  serine/threonine-protein phosphatase 6 regul...    112   2e-24   
ref|XP_008251612.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    112   2e-24   
ref|XP_005653228.1|  PREDICTED: serine/threonine-protein phosphat...    112   2e-24   
dbj|BAC38066.1|  unnamed protein product                                107   2e-24   
ref|XP_009060319.1|  hypothetical protein LOTGIDRAFT_106669             111   3e-24   
ref|XP_010341657.1|  PREDICTED: serine/threonine-protein phosphat...    112   3e-24   
ref|XP_008410668.1|  PREDICTED: serine/threonine-protein phosphat...    112   3e-24   
ref|XP_010341659.1|  PREDICTED: serine/threonine-protein phosphat...    112   3e-24   
ref|XP_010341658.1|  PREDICTED: serine/threonine-protein phosphat...    112   3e-24   
ref|XP_009503037.1|  PREDICTED: serine/threonine-protein phosphat...    105   3e-24   
ref|XP_005606860.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   
ref|XP_008410667.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   
ref|XP_005606859.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   
ref|XP_006868165.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   
ref|XP_008410665.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   
ref|XP_006157671.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   
ref|XP_005606861.1|  PREDICTED: serine/threonine-protein phosphat...    111   3e-24   
ref|XP_005606858.1|  PREDICTED: serine/threonine-protein phosphat...    111   4e-24   
ref|XP_001490118.2|  PREDICTED: serine/threonine-protein phosphat...    111   4e-24   
gb|EPQ09008.1|  Serine/threonine-protein phosphatase 6 regulatory...    111   4e-24   
ref|XP_007545751.1|  PREDICTED: serine/threonine-protein phosphat...    111   4e-24   



>ref|XP_010655735.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 2 [Vitis vinifera]
Length=871

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = +2

Query  155  FLRDFTMFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQ  334
            F+  FTMFWRMAGLSTASPVETILDK+NFTLEELLDEDEIIQECKALNGRLINFLRER+Q
Sbjct  76   FVDQFTMFWRMAGLSTASPVETILDKENFTLEELLDEDEIIQECKALNGRLINFLRERAQ  135

Query  335  VEQLVRYIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPV  514
            VEQL+RYIVEEA ++ EKKRTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP 
Sbjct  136  VEQLIRYIVEEAPEDAEKKRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPK  195

Query  515  RPHSALLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
              HS LLAGYFSKVVICLL RKTVPLM+YI+ HQE+ R++VDLIGITSIME
Sbjct  196  HSHSTLLAGYFSKVVICLLLRKTVPLMHYIQVHQEIFRQMVDLIGITSIME  246



>ref|XP_010098575.1| hypothetical protein L484_026017 [Morus notabilis]
 gb|EXB75235.1| hypothetical protein L484_026017 [Morus notabilis]
Length=933

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = +2

Query  152  SFLRDFTMFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERS  331
            +F  +F MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECKALNGRLINFLRER 
Sbjct  149  NFFEEFNMFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECKALNGRLINFLRERV  208

Query  332  QVEQLVRYIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEP  511
            QVEQL+RYIVEE+ ++ EK+RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP
Sbjct  209  QVEQLLRYIVEESPEDAEKRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEP  268

Query  512  VRPHSALLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
               HS LLAGYFSKVVICLL RKTVP MNYI+ H+E+++KLVDLIGITSIME
Sbjct  269  KHSHSTLLAGYFSKVVICLLLRKTVPFMNYIQAHREIVQKLVDLIGITSIME  320



>emb|CDP05604.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+N+TLEELLDEDEIIQECKALNGRLINFLRER+QVEQLVR
Sbjct  1    MFWRMAGLSTASPVETILDKENYTLEELLDEDEIIQECKALNGRLINFLRERAQVEQLVR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EK RTFKFPFIACEIFTCEVDIILKALV+DEELM++LFSFLEP R HS L
Sbjct  61   YIVEEAPEDAEKTRTFKFPFIACEIFTCEVDIILKALVEDEELMSILFSFLEPGRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKTVPLMNYI+ HQ+VI KLVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTVPLMNYIQAHQDVIGKLVDLIGITSIME  165



>ref|XP_008372228.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Malus domestica]
Length=776

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECKALNGRLINFLRER+QVEQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECKALNGRLINFLRERAQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EK+RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVEEAPEDAEKRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPNNSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKTVP + YI+ HQ++++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKTVPFLQYIQGHQDIVKKLVDLIGITSIME  165



>ref|XP_007213638.1| hypothetical protein PRUPE_ppa001709mg [Prunus persica]
 gb|EMJ14837.1| hypothetical protein PRUPE_ppa001709mg [Prunus persica]
Length=775

 Score =   276 bits (706),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECK+LNGRLINFLRER+QVEQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECKSLNGRLINFLRERAQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EK+RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVEEAPEDAEKRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPNNSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RK VP + YI+ HQE+++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKAVPFLTYIQGHQEIVKKLVDLIGITSIME  165



>ref|XP_009772965.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Nicotiana sylvestris]
Length=787

 Score =   276 bits (706),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +2

Query  167  FTMFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQL  346
              MFWRMAGLSTASPVETILDK+NF L+ELLDEDEIIQECKALNGRLINFLRER+QVEQL
Sbjct  1    MAMFWRMAGLSTASPVETILDKENFALDELLDEDEIIQECKALNGRLINFLRERAQVEQL  60

Query  347  VRYIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHS  526
            VRYIVEEA ++ EK+RTFKFPFIACEIFTCEVDIILKALV++EELMNLLFSFLEP   HS
Sbjct  61   VRYIVEEAPEDAEKRRTFKFPFIACEIFTCEVDIILKALVEEEELMNLLFSFLEPEHAHS  120

Query  527  ALLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
             LLAGYFSKVVICLL RKT P MNY+  HQ++I+KLVDLIGITSIME
Sbjct  121  TLLAGYFSKVVICLLLRKTTPFMNYVHAHQDIIKKLVDLIGITSIME  167



>gb|KDO75284.1| hypothetical protein CISIN_1g0034112mg, partial [Citrus sinensis]
 gb|KDO75285.1| hypothetical protein CISIN_1g0034112mg, partial [Citrus sinensis]
 gb|KDO75286.1| hypothetical protein CISIN_1g0034112mg, partial [Citrus sinensis]
 gb|KDO75287.1| hypothetical protein CISIN_1g0034112mg, partial [Citrus sinensis]
 gb|KDO75288.1| hypothetical protein CISIN_1g0034112mg, partial [Citrus sinensis]
Length=551

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTLEELLDED+IIQECKALNGRLINFLRER+QVEQL++
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLEELLDEDDIIQECKALNGRLINFLRERAQVEQLIQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV EA ++ EK+RTFKFPF+ACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVVEAPEDAEKRRTFKFPFVACEIFTCEVDIILKTLVEDEELMNLLFSFLEPKDSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKTVPLM+YI+ HQE++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTVPLMHYIKAHQEIMARLVDLIGITSIME  165



>ref|XP_002523200.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39231.1| conserved hypothetical protein [Ricinus communis]
Length=783

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTLEELLDEDEIIQECKALNGRLINFLRER+QVEQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLEELLDEDEIIQECKALNGRLINFLRERAQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EEA ++ EK+RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP + HS L
Sbjct  61   YIIEEAPEDAEKRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPTQTHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M+YI+ HQ+++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTIPFMHYIKAHQQILNQLVDLIGITSIME  165



>gb|KDO75283.1| hypothetical protein CISIN_1g0034112mg [Citrus sinensis]
Length=560

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTLEELLDED+IIQECKALNGRLINFLRER+QVEQL++
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLEELLDEDDIIQECKALNGRLINFLRERAQVEQLIQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV EA ++ EK+RTFKFPF+ACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVVEAPEDAEKRRTFKFPFVACEIFTCEVDIILKTLVEDEELMNLLFSFLEPKDSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKTVPLM+YI+ HQE++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTVPLMHYIKAHQEIMARLVDLIGITSIME  165



>ref|XP_009362241.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Pyrus x bretschneideri]
Length=778

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECKALNGRLINFLRER+QVEQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECKALNGRLINFLRERAQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ EK+RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVEEVPEDAEKRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPNNSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKTVP + YI+ HQ++++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKTVPFLQYIQGHQDIVKKLVDLIGITSIME  165



>ref|XP_006353024.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Solanum tuberosum]
Length=787

 Score =   275 bits (703),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +2

Query  167  FTMFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQL  346
              MFWRMAGLSTASPVETILDK+NF L+ELLDEDEIIQECKALNGRLINFLRER+QVEQL
Sbjct  1    MAMFWRMAGLSTASPVETILDKENFALDELLDEDEIIQECKALNGRLINFLRERAQVEQL  60

Query  347  VRYIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHS  526
            VRYIVEEA ++ EKKRTFKFPFIACEIFTCEVDIILKALV++EELMNLLFSFLEP   HS
Sbjct  61   VRYIVEEAPEDAEKKRTFKFPFIACEIFTCEVDIILKALVENEELMNLLFSFLEPEHTHS  120

Query  527  ALLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
             LLAGYFSKVVICLL RKT   MNY++ HQ++I+KLVDLIGITSIME
Sbjct  121  TLLAGYFSKVVICLLLRKTSAFMNYVQAHQDIIKKLVDLIGITSIME  167



>ref|XP_004233174.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Solanum lycopersicum]
Length=784

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +2

Query  167  FTMFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQL  346
              MFWRMAGLSTASPVETILDK+NF L+ELLDEDEIIQECKALNGRLINFLRER+QVEQL
Sbjct  1    MAMFWRMAGLSTASPVETILDKENFALDELLDEDEIIQECKALNGRLINFLRERAQVEQL  60

Query  347  VRYIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHS  526
            VRYIVEEA ++ EKKRTFKFPFIACEIFTCEVDIILKALV++EELMNLLFSFLEP   HS
Sbjct  61   VRYIVEEAPEDAEKKRTFKFPFIACEIFTCEVDIILKALVENEELMNLLFSFLEPEHTHS  120

Query  527  ALLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
             LLAGYFSKVVICLL RKT   MNY++ HQ++I+KLVDLIGITSIME
Sbjct  121  TLLAGYFSKVVICLLLRKTSAFMNYVQAHQDIIKKLVDLIGITSIME  167



>ref|XP_004293993.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Fragaria vesca subsp. vesca]
Length=773

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECKALNGRLINFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECKALNGRLINFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EK+RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVEEAPEDAEKRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPNHSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RK VP ++YI++HQ++++KLVDLIG TSIME
Sbjct  121  LAGYFSKVVVCLLLRKAVPFLHYIQSHQDIVKKLVDLIGTTSIME  165



>ref|XP_010687079.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Beta vulgaris subsp. vulgaris]
Length=781

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDKDNFTL+ELLDEDEIIQECKALN RLINFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKDNFTLDELLDEDEIIQECKALNARLINFLRERPQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EK+R FKFPFI+CEIFTCEVDIILK LV+DEELMNLLFSFL+    HSAL
Sbjct  61   YIVEEAPEDAEKQRNFKFPFISCEIFTCEVDIILKTLVEDEELMNLLFSFLDSEHSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+ LMNYI+ HQE+IR+L+DLIGITSIME
Sbjct  121  LAGYFSKVVICLLMRKTISLMNYIQAHQEIIRQLIDLIGITSIME  165



>ref|XP_008225588.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Prunus mume]
Length=775

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECK+LNGRLINFLRER+QVEQL++
Sbjct  1    MFWRMAGLSTASPVETILDKDNFTLEELLDEDEIIQECKSLNGRLINFLRERAQVEQLIQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EK+RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVEEAPEDAEKRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPNNSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RK VP + YI+ HQ +++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKAVPFLTYIQGHQGIVKKLVDLIGITSIME  165



>ref|XP_009592305.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Nicotiana tomentosiformis]
Length=787

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  167  FTMFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQL  346
              MFWRMAGLSTASPVETILDK+NF L+ELLDEDEIIQECKALNGRLINFLRER+QVEQL
Sbjct  1    MAMFWRMAGLSTASPVETILDKENFALDELLDEDEIIQECKALNGRLINFLRERAQVEQL  60

Query  347  VRYIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHS  526
            VRYIVEEA ++ EK+RTFKFPFIACEIFTCEVDIILK LV+D+ELMNLLFSFLEP   HS
Sbjct  61   VRYIVEEAPEDAEKRRTFKFPFIACEIFTCEVDIILKTLVEDDELMNLLFSFLEPEHAHS  120

Query  527  ALLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
             LLAGYFSKVVICLL RKT P M Y+  HQ++I+KLVDLIGITSIME
Sbjct  121  TLLAGYFSKVVICLLLRKTTPFMKYVHAHQDIIKKLVDLIGITSIME  167



>ref|XP_006468292.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Citrus sinensis]
 ref|XP_006468293.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Citrus sinensis]
 ref|XP_006468294.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Citrus sinensis]
Length=813

 Score =   272 bits (695),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTLEELLDED+IIQECKALNGRLINFLRER+QVEQL++
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLEELLDEDDIIQECKALNGRLINFLRERAQVEQLIQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV EA ++ EK+RTFKFPF+ACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVVEAPEDAEKRRTFKFPFVACEIFTCEVDIILKTLVEDEELMNLLFSFLEPKDSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKTVPLM+YI+ HQE++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTVPLMHYIKAHQEIMARLVDLIGITSIME  165



>ref|XP_006448922.1| hypothetical protein CICLE_v10014271mg [Citrus clementina]
 gb|ESR62162.1| hypothetical protein CICLE_v10014271mg [Citrus clementina]
Length=831

 Score =   272 bits (696),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTLEELLDED+IIQECKALNGRLINFLRER+QVEQL++
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLEELLDEDDIIQECKALNGRLINFLRERAQVEQLIQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV EA ++ EK+RTFKFPF+ACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVVEAPEDAEKRRTFKFPFVACEIFTCEVDIILKTLVEDEELMNLLFSFLEPKDSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKTVPLM+YI+ HQE++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTVPLMHYIKAHQEIMARLVDLIGITSIME  165



>ref|XP_006448920.1| hypothetical protein CICLE_v10014271mg [Citrus clementina]
 ref|XP_006448921.1| hypothetical protein CICLE_v10014271mg [Citrus clementina]
 gb|ESR62160.1| hypothetical protein CICLE_v10014271mg [Citrus clementina]
 gb|ESR62161.1| hypothetical protein CICLE_v10014271mg [Citrus clementina]
Length=822

 Score =   272 bits (695),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTLEELLDED+IIQECKALNGRLINFLRER+QVEQL++
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLEELLDEDDIIQECKALNGRLINFLRERAQVEQLIQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV EA ++ EK+RTFKFPF+ACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVVEAPEDAEKRRTFKFPFVACEIFTCEVDIILKTLVEDEELMNLLFSFLEPKDSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKTVPLM+YI+ HQE++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTVPLMHYIKAHQEIMARLVDLIGITSIME  165



>ref|XP_010241190.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 2 [Nelumbo nucifera]
Length=786

 Score =   271 bits (693),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTLEELLDEDEIIQECKALNGRLINFLRER+QVEQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLEELLDEDEIIQECKALNGRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVE+A ++ EK+RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFL+P   HS L
Sbjct  61   YIVEQAPEDAEKRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLQPNHSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVP MN+++ HQE+  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPFMNFVQAHQEIFHQLVDLIGITSIME  165



>ref|XP_008383415.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 1-like isoform X2 [Malus domestica]
Length=776

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VETILDKD+FTLEELLDEDEIIQECKALNGRLINFLRER+QVEQL+R
Sbjct  1    MFWRMAGLSTASAVETILDKDHFTLEELLDEDEIIQECKALNGRLINFLRERAQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ E +RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVEEAPEDAENRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPNNSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RK VP + YI+ HQ++++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKAVPFLQYIQGHQDIVKKLVDLIGITSIME  165



>ref|XP_011096673.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Sesamum indicum]
Length=790

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTLEELLDEDEIIQECKALNGRLINFLRE++ V+QL++
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLEELLDEDEIIQECKALNGRLINFLREKNTVKQLIQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA  + EK+RTFKFPFIACEIFTCEVDIILKALV+DEELM+LLFSFL+P RPH  L
Sbjct  61   YIVEEAPVDAEKQRTFKFPFIACEIFTCEVDIILKALVEDEELMDLLFSFLDPERPHGTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKT PLMNYIR H ++I +LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKTTPLMNYIRAHPDIISRLVDLIGITSIME  165



>ref|XP_008383414.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 1-like isoform X1 [Malus domestica]
Length=783

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VETILDKD+FTLEELLDEDEIIQECKALNGRLINFLRER+QVEQL+R
Sbjct  1    MFWRMAGLSTASAVETILDKDHFTLEELLDEDEIIQECKALNGRLINFLRERAQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ E +RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVEEAPEDAENRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPNNSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RK VP + YI+ HQ++++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKAVPFLQYIQGHQDIVKKLVDLIGITSIME  165



>ref|XP_012075635.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 2 [Jatropha curcas]
 gb|KDP34941.1| hypothetical protein JCGZ_09229 [Jatropha curcas]
Length=786

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTLEELLDEDEIIQECKA+NGRLINFLRE+ QVEQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLEELLDEDEIIQECKAMNGRLINFLREKPQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV EA ++ EK+RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVVEAPEDAEKRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPKHSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKTVPLM+Y++ H++++ +LVDLIGITS+ME
Sbjct  121  LAGYFSKVVICLLLRKTVPLMHYVKAHRQILNQLVDLIGITSLME  165



>ref|XP_007147492.1| hypothetical protein PHAVU_006G129000g [Phaseolus vulgaris]
 gb|ESW19486.1| hypothetical protein PHAVU_006G129000g [Phaseolus vulgaris]
Length=764

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDKDNFTL+ELLDEDEIIQECKALN RLINFL  R+QV+QL+R
Sbjct  1    MFWRMAGLSTASPVETILDKDNFTLDELLDEDEIIQECKALNSRLINFLSARAQVDQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EEA D+ EKKR+FKFPFIACEIFTCEVDIILK L++DEELMNLLFSFL+    HS L
Sbjct  61   YIIEEAPDDAEKKRSFKFPFIACEIFTCEVDIILKTLIEDEELMNLLFSFLDLNHSHSNL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKTVP M Y++ HQE+++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKTVPFMQYVQAHQEIVKKLVDLIGITSIME  165



>ref|XP_006846020.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Amborella trichopoda]
 gb|ERN07695.1| hypothetical protein AMTR_s00155p00077490 [Amborella trichopoda]
Length=824

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVE+ILDK+NFTLEELLDEDEIIQECKA+N RLINFLRER+QVEQL+R
Sbjct  1    MFWRMAGLSTASPVESILDKENFTLEELLDEDEIIQECKAINSRLINFLRERTQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ EK+R FKFPFI+CE+FTCEVD+ILK LV+DEELMNLLFSFLEP R HS L
Sbjct  61   YIVEEPPEDAEKRRIFKFPFISCEVFTCEVDVILKTLVEDEELMNLLFSFLEPNRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGY+SKVVICL+ RKTV LMNY+  HQE++ KLVDLIGITSIME
Sbjct  121  LAGYYSKVVICLMARKTVLLMNYVHAHQEILHKLVDLIGITSIME  165



>ref|XP_002529943.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32451.1| conserved hypothetical protein [Ricinus communis]
Length=845

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSASSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EEA ++TE KR FKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIIEEAPEDTESKRAFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMVRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_008245668.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Prunus mume]
Length=849

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDKDNFTL+ELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSASSPVESVLDKDNFTLDELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ E KR FKFPFIACE+FTCE+D+ILK LVD+EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPPEDAESKRAFKFPFIACEVFTCEIDVILKTLVDEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_010941543.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Elaeis guineensis]
Length=793

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLSTASPV+TILDK++FTLEELLDEDEIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWRMTGLSTASPVDTILDKESFTLEELLDEDEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EKKR FKFPFIACEIFTCEVDIIL+ LV+DEELMNLLFSFL+P  PHS L
Sbjct  61   YIVEEAPEDAEKKRAFKFPFIACEIFTCEVDIILRTLVEDEELMNLLFSFLKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPL++YI+ H E+IR+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLISYIQGHPEIIRQLVDLIGITSIME  165



>ref|XP_008245669.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Prunus mume]
Length=848

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDKDNFTL+ELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSASSPVESVLDKDNFTLDELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ E KR FKFPFIACE+FTCE+D+ILK LVD+EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPPEDAESKRAFKFPFIACEVFTCEIDVILKTLVDEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>gb|EYU19129.1| hypothetical protein MIMGU_mgv1a001633mg [Erythranthe guttata]
Length=781

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTL+ELLDEDEIIQECKALNGRLINFLRER  ++QL++
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLDELLDEDEIIQECKALNGRLINFLRERDNIKQLIQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E++RTFKFPFIACEIFTCEVDIILKALV+DEELM+LLFSFL+  RPHS L
Sbjct  61   YIMEEPPEDAERQRTFKFPFIACEIFTCEVDIILKALVEDEELMDLLFSFLDSERPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKT PLM+YI  HQ++I++LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKTNPLMHYIGAHQDIIKRLVDLIGITSIME  165



>ref|XP_010941542.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Elaeis guineensis]
Length=803

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLSTASPV+TILDK++FTLEELLDEDEIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWRMTGLSTASPVDTILDKESFTLEELLDEDEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EKKR FKFPFIACEIFTCEVDIIL+ LV+DEELMNLLFSFL+P  PHS L
Sbjct  61   YIVEEAPEDAEKKRAFKFPFIACEIFTCEVDIILRTLVEDEELMNLLFSFLKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPL++YI+ H E+IR+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLISYIQGHPEIIRQLVDLIGITSIME  165



>ref|XP_006424559.1| hypothetical protein CICLE_v100278361mg, partial [Citrus clementina]
 gb|ESR37799.1| hypothetical protein CICLE_v100278361mg, partial [Citrus clementina]
Length=428

 Score =   254 bits (650),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R QVE+L+R
Sbjct  1    MFWKLTALSASSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDREQVEKLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA  + E K+ FKFPF+ACEIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEAPADAESKQAFKFPFVACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ H +V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQNHPDVFRRLVDLIGITSIME  165



>ref|XP_009344403.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 1-like [Pyrus x bretschneideri]
Length=775

 Score =   263 bits (671),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAG STAS VETILDKD+FTLEELLDEDEIIQECKALNGRLINFLRER+QVEQL+R
Sbjct  1    MFWRMAGGSTASAVETILDKDHFTLEELLDEDEIIQECKALNGRLINFLRERAQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA  + E +RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP   H  L
Sbjct  61   YIVEEAPKDAENRRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPNNSHITL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RK VP + YI+ HQ++++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKAVPFLQYIQGHQDIVKKLVDLIGITSIME  165



>gb|KEH37054.1| SIT4 phosphatase-associated family protein [Medicago truncatula]
Length=562

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILD+DNFT+EELLDEDEIIQECKALN RLINFL  ++QVEQLVR
Sbjct  1    MFWRMAGLSTASPVETILDRDNFTMEELLDEDEIIQECKALNSRLINFLSGKAQVEQLVR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EKKRTFKFPFIACEIFTCEVD ILK LV+DEELM+LLFSFL+P   H  L
Sbjct  61   YIVEEAPEDAEKKRTFKFPFIACEIFTCEVDSILKTLVEDEELMSLLFSFLDPNNSHGNL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKT P M Y++ HQE+++KLV+LIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKTGPFMQYVQAHQEIVKKLVELIGITSIME  165



>ref|XP_007022860.1| SIT4 phosphatase-associated family protein isoform 3 [Theobroma 
cacao]
 gb|EOY25482.1| SIT4 phosphatase-associated family protein isoform 3 [Theobroma 
cacao]
Length=782

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLSTASPVETILDK+NFTLEELLDEDEIIQECKALNGRLINFLRE++QVEQL++
Sbjct  1    MFWRMTGLSTASPVETILDKENFTLEELLDEDEIIQECKALNGRLINFLREKTQVEQLLQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV E  ++ EKKRTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFL+    HS L
Sbjct  61   YIVVEPPEDAEKKRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLDSNHSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M YI+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTLPFMQYIKGHQEIVKQLVDLIGITSIME  165



>ref|XP_007022859.1| SIT4 phosphatase-associated family protein isoform 2 [Theobroma 
cacao]
 gb|EOY25481.1| SIT4 phosphatase-associated family protein isoform 2 [Theobroma 
cacao]
Length=781

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLSTASPVETILDK+NFTLEELLDEDEIIQECKALNGRLINFLRE++QVEQL++
Sbjct  1    MFWRMTGLSTASPVETILDKENFTLEELLDEDEIIQECKALNGRLINFLREKTQVEQLLQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV E  ++ EKKRTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFL+    HS L
Sbjct  61   YIVVEPPEDAEKKRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLDSNHSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M YI+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTLPFMQYIKGHQEIVKQLVDLIGITSIME  165



>ref|XP_008363509.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
6 regulatory subunit 3-like [Malus domestica]
Length=852

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVET+LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRDQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ E KR FKFPFIACE+FTCE+D+ILK LVD+E+LMNLLFSFLEP RPHSA 
Sbjct  61   YIVEEAPEDAESKRAFKFPFIACEVFTCEIDVILKTLVDEEKLMNLLFSFLEPNRPHSAP  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMMRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_009367065.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Pyrus x bretschneideri]
Length=853

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVET+LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRDQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ E KR FKFPFIACE+FTCE+D+ILK LVD+E+LMNLLFSFLEP RPHSA 
Sbjct  61   YIVEEAPEDAESKRAFKFPFIACEVFTCEIDVILKTLVDEEKLMNLLFSFLEPNRPHSAP  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMMRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_012064813.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Jatropha curcas]
Length=849

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSASSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EEA ++ E KR FKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIIEEAPEDAESKRAFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMVRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_009367066.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Pyrus x bretschneideri]
Length=852

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVET+LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRDQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ E KR FKFPFIACE+FTCE+D+ILK LVD+E+LMNLLFSFLEP RPHSA 
Sbjct  61   YIVEEAPEDAESKRAFKFPFIACEVFTCEIDVILKTLVDEEKLMNLLFSFLEPNRPHSAP  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMMRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_012064812.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Jatropha curcas]
 gb|KDP44043.1| hypothetical protein JCGZ_05510 [Jatropha curcas]
Length=850

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSASSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EEA ++ E KR FKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIIEEAPEDAESKRAFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMVRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_009367067.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X3 [Pyrus x bretschneideri]
Length=851

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVET+LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRDQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ E KR FKFPFIACE+FTCE+D+ILK LVD+E+LMNLLFSFLEP RPHSA 
Sbjct  61   YIVEEAPEDAESKRAFKFPFIACEVFTCEIDVILKTLVDEEKLMNLLFSFLEPNRPHSAP  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMMRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>gb|KJB83838.1| hypothetical protein B456_013G267000 [Gossypium raimondii]
Length=821

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWR+  +S +SPVE+ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWRLTSMSASSPVESILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KRTFKFPFIACEIFTCE+D+ILK L++DEE MNLLFSFLEP R HSAL
Sbjct  61   YIVEEPSEDDDSKRTFKFPFIACEIFTCEIDVILKTLIEDEEFMNLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT+PLM+Y++THQEV+R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTIPLMHYVQTHQEVLRQLVDLIGITSIME  165



>ref|XP_010051963.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Eucalyptus grandis]
 gb|KCW75798.1| hypothetical protein EUGRSUZ_D00188 [Eucalyptus grandis]
Length=815

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDKDN+TLEELLDEDEIIQECKALN RLINFLRE+ QVEQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKDNYTLEELLDEDEIIQECKALNNRLINFLREKPQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA  + +KKRT KFPFIACEIFTCEVDIIL+ LVDD+ELM+LLFSFLEP R HS  
Sbjct  61   YIVEEADSDVDKKRTIKFPFIACEIFTCEVDIILRTLVDDQELMDLLFSFLEPDRNHSTQ  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT P MNYI+ H  ++R+L+DLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTTPFMNYIQDHLGLVRQLIDLIGITSIME  165



>gb|KJB83839.1| hypothetical protein B456_013G267000 [Gossypium raimondii]
Length=820

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWR+  +S +SPVE+ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWRLTSMSASSPVESILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KRTFKFPFIACEIFTCE+D+ILK L++DEE MNLLFSFLEP R HSAL
Sbjct  61   YIVEEPSEDDDSKRTFKFPFIACEIFTCEIDVILKTLIEDEEFMNLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT+PLM+Y++THQEV+R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTIPLMHYVQTHQEVLRQLVDLIGITSIME  165



>ref|XP_007208093.1| hypothetical protein PRUPE_ppa001347mg [Prunus persica]
 gb|EMJ09292.1| hypothetical protein PRUPE_ppa001347mg [Prunus persica]
Length=848

 Score =   262 bits (669),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTL+ELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSASSPVESVLDKENFTLDELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ E KR FKFPFIACE+FTCE+D+I K LVD+EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPPEDAESKRAFKFPFIACEVFTCEIDVIFKTLVDEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_008799096.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Phoenix dactylifera]
Length=803

 Score =   261 bits (666),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLSTASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+R+QVEQL+ 
Sbjct  1    MFWRMTGLSTASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDRTQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EKKR FKFPFIACEIFTCEVDIIL+ LV+DEELMNLLFSFL+P  PHS L
Sbjct  61   YIVEEAPEDAEKKRAFKFPFIACEIFTCEVDIILRTLVEDEELMNLLFSFLKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LM+Y++ H E+IR+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTSTLMSYVQGHPEIIRQLVDLIGITSIME  165



>tpg|DAA58712.1| TPA: hypothetical protein ZEAMMB73_844198 [Zea mays]
Length=244

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR++SQVEQL+ 
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNSRLINFLRDKSQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E+KR+FKFPFIACEIFTCE+D+IL+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YILEEVPEDAERKRSFKFPFIACEIFTCEIDVILRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLM+Y++ H +++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMSYVQGHPKIVVQLVDLIGITSIME  165



>gb|KHN22994.1| Serine/threonine-protein phosphatase 6 regulatory subunit 3 [Glycine 
soja]
Length=881

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTL+ELLDEDEIIQECKALN RLINFL  R+QVEQL R
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLDELLDEDEIIQECKALNSRLINFLSGRAQVEQLTR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EEA ++ EKKR+FKFPFIACEIFTCEVDIILK L++DEELMNLLFSFL+    HS L
Sbjct  61   YIIEEAPEDAEKKRSFKFPFIACEIFTCEVDIILKTLIEDEELMNLLFSFLDLNHSHSNL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKT+P M Y++ HQE+++KLV+LIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKTIPFMQYVQAHQEIVKKLVELIGITSIME  165



>ref|XP_006586832.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Glycine max]
Length=881

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTL+ELLDEDEIIQECKALN RLINFL  R+QVEQL R
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLDELLDEDEIIQECKALNSRLINFLSGRAQVEQLTR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EEA ++ EKKR+FKFPFIACEIFTCEVDIILK L++DEELMNLLFSFL+    HS L
Sbjct  61   YIIEEAPEDAEKKRSFKFPFIACEIFTCEVDIILKTLIEDEELMNLLFSFLDLNHSHSNL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKT+P M Y++ HQE+++KLV+LIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKTIPFMQYVQAHQEIVKKLVELIGITSIME  165



>ref|XP_011010054.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Populus euphratica]
Length=848

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTTLSTSSPVESVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE +++ E KRTFKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPSEDAESKRTFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRTHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_011010055.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Populus euphratica]
Length=847

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTTLSTSSPVESVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE +++ E KRTFKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPSEDAESKRTFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRTHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_007150196.1| hypothetical protein PHAVU_005G134600g [Phaseolus vulgaris]
 gb|ESW22190.1| hypothetical protein PHAVU_005G134600g [Phaseolus vulgaris]
Length=852

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE ILDK+NFTLEELLDE+E+IQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLASLSASSPVEAILDKENFTLEELLDEEEVIQECKALNSRLINFLRDQTQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KR FKFPFIACEIFTCE+D+ILK LVDD+ELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPPEDAENKRAFKFPFIACEIFTCEIDVILKTLVDDKELMNLLFSFLEPTRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_010253684.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Nelumbo nucifera]
 ref|XP_010253685.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Nelumbo nucifera]
Length=852

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWR+  LS +SPVE +LDKDNFTLEELLDE+EIIQECKALN RLINFLR+R+QV+QL+ 
Sbjct  1    MFWRITALSASSPVEAVLDKDNFTLEELLDEEEIIQECKALNSRLINFLRDRTQVDQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA +  + KRTFKFPFIACEIFTCE+D+ILK LV++EELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEAPEGADSKRTFKFPFIACEIFTCEIDVILKTLVEEEELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+VIR+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQVHQDVIRQLVDLIGITSIME  165



>gb|AFW83098.1| hypothetical protein ZEAMMB73_724275, partial [Zea mays]
Length=337

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ E+KR+FKFPFIA EIFTCE+D+IL+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YVVEEVPDDAERKRSFKFPFIASEIFTCEIDVILRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLM+Y++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLVLRKTAPLMSYVQGHPEIVVQLVDLIGITSIME  165



>ref|XP_010253686.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Nelumbo nucifera]
Length=851

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWR+  LS +SPVE +LDKDNFTLEELLDE+EIIQECKALN RLINFLR+R+QV+QL+ 
Sbjct  1    MFWRITALSASSPVEAVLDKDNFTLEELLDEEEIIQECKALNSRLINFLRDRTQVDQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA +  + KRTFKFPFIACEIFTCE+D+ILK LV++EELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEAPEGADSKRTFKFPFIACEIFTCEIDVILKTLVEEEELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+VIR+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQVHQDVIRQLVDLIGITSIME  165



>ref|XP_010519074.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Tarenaya hassleriana]
Length=717

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDKD FTLEELLDEDEIIQECK+LNGRL+NFLRER+QVEQL++
Sbjct  1    MFWRMAGLSTASPVETILDKDGFTLEELLDEDEIIQECKSLNGRLLNFLRERTQVEQLIK  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ EK RTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLEP + H+ L
Sbjct  61   YIIEEPPEDAEKNRTFKFPFIACEIFTCEIEMILKQLVEDEELMKLLFSFLEPKQAHNTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL  KTVP M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLVLKTVPFMQFIKEHQEILKQLVDLIGITSIME  165



>ref|XP_003547324.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Glycine max]
Length=838

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTL+ELLDEDEIIQECKALN RLINFL  R+QVEQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLDELLDEDEIIQECKALNSRLINFLSGRAQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EEA ++ EKKR+FKFPFIACEIFTCEVDIILK +++DEEL+NLLFSFL+    HS L
Sbjct  61   YIIEEAPEDAEKKRSFKFPFIACEIFTCEVDIILKTIIEDEELINLLFSFLDLNHSHSNL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKTVP M Y++ HQE+++KLV+LIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKTVPFMQYVQAHQEIVKKLVELIGITSIME  165



>ref|XP_004291712.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Fragaria vesca subsp. vesca]
Length=856

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVET+LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE   + E KRTFKFPFIACE+FTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIVEEPPADAESKRTFKFPFIACEVFTCEIDVILKTLVEEEELMNLLFSFLEPNRTHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_011459441.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Fragaria vesca subsp. vesca]
Length=855

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVET+LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE   + E KRTFKFPFIACE+FTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIVEEPPADAESKRTFKFPFIACEVFTCEIDVILKTLVEEEELMNLLFSFLEPNRTHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>emb|CDP07106.1| unnamed protein product [Coffea canephora]
Length=849

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSASSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y++EE  ++ + KRTFKFPFIACEIFTCE+D+ILK LV++EELM+LLFSFLEP RPHSAL
Sbjct  61   YVIEEPPEDADSKRTFKFPFIACEIFTCEIDVILKTLVEEEELMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>gb|KFK43112.1| hypothetical protein AALP_AA1G081700, partial [Arabis alpina]
Length=622

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQEC+ALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECRALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE+ D+ + KR FKFPFI+CEIFTCE+D+ILK LV+DEELM+LLFSFLEP RPHSAL
Sbjct  61   YIVEESPDDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEELMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTAALMNYVKGHQNVFGQLVDLIGITSIME  165



>ref|XP_006384907.1| SIT4 phosphatase-associated family protein [Populus trichocarpa]
 gb|ERP62704.1| SIT4 phosphatase-associated family protein [Populus trichocarpa]
Length=817

 Score =   258 bits (660),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDKDNFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSTSSPVESLLDKDNFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE +++ E K  FKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPSEDAESKLAFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_006384906.1| hypothetical protein POPTR_0004s22110g [Populus trichocarpa]
 gb|ABK95109.1| unknown [Populus trichocarpa]
 gb|ERP62703.1| hypothetical protein POPTR_0004s22110g [Populus trichocarpa]
Length=840

 Score =   258 bits (660),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDKDNFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSTSSPVESLLDKDNFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE +++ E K  FKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPSEDAESKLAFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_010519073.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Tarenaya hassleriana]
Length=758

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDKD FTLEELLDEDEIIQECK+LNGRL+NFLRER+QVEQL++
Sbjct  1    MFWRMAGLSTASPVETILDKDGFTLEELLDEDEIIQECKSLNGRLLNFLRERTQVEQLIK  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ EK RTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLEP + H+ L
Sbjct  61   YIIEEPPEDAEKNRTFKFPFIACEIFTCEIEMILKQLVEDEELMKLLFSFLEPKQAHNTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL  KTVP M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLVLKTVPFMQFIKEHQEILKQLVDLIGITSIME  165



>ref|XP_004134561.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 2 [Cucumis sativus]
 ref|XP_011658318.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 2 [Cucumis sativus]
 gb|KGN49455.1| hypothetical protein Csa_6G525410 [Cucumis sativus]
Length=769

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILD++NFTLEELLDEDEIIQECKALN RLINFLRER+Q+EQL+R
Sbjct  1    MFWRMAGLSTASPVETILDRENFTLEELLDEDEIIQECKALNSRLINFLRERTQIEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA +E EKKR+FKFPFIACEIFTCEVDIILKALV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVEEAPEEAEKKRSFKFPFIACEIFTCEVDIILKALVEDEELMNLLFSFLEPNSSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M Y++ HQ +++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTIPFMKYVQEHQAIVKKLVDLIGITSIME  165



>ref|XP_010926955.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Elaeis guineensis]
Length=793

 Score =   258 bits (658),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLSTASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWRMTGLSTASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EKK+ FKFPFIACEIFTCEVDIIL+ LV+++ELMNLLFSFL+P  PHS L
Sbjct  61   YIVEEAPEDAEKKQAFKFPFIACEIFTCEVDIILRTLVEEDELMNLLFSFLKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT PLM+Y++ H E+I +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTAPLMSYVQGHPEIICQLVDLIGITSIME  165



>gb|KJB26206.1| hypothetical protein B456_004G229800 [Gossypium raimondii]
Length=851

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE+ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSASSPVESILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ + KR FKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YVVEEPPEDADSKRVFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVP+MNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPIMNYVQVHQDVFRQLVDLIGITSIME  165



>ref|XP_002314265.1| SIT4 phosphatase-associated family protein [Populus trichocarpa]
 gb|EEE88220.1| SIT4 phosphatase-associated family protein [Populus trichocarpa]
Length=830

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTTLSTSSPVESVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE +++ E KRTFKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPSEDAESKRTFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTV LMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVSLMNYVQAHQDVFRQLVDLIGITSIME  165



>gb|KJB26208.1| hypothetical protein B456_004G229800 [Gossypium raimondii]
Length=852

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE+ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSASSPVESILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ + KR FKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YVVEEPPEDADSKRVFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVP+MNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPIMNYVQVHQDVFRQLVDLIGITSIME  165



>ref|XP_010926954.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Elaeis guineensis]
Length=803

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLSTASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWRMTGLSTASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EKK+ FKFPFIACEIFTCEVDIIL+ LV+++ELMNLLFSFL+P  PHS L
Sbjct  61   YIVEEAPEDAEKKQAFKFPFIACEIFTCEVDIILRTLVEEDELMNLLFSFLKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT PLM+Y++ H E+I +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTAPLMSYVQGHPEIICQLVDLIGITSIME  165



>emb|CDM83054.1| unnamed protein product [Triticum aestivum]
 emb|CDM83069.1| unnamed protein product [Triticum aestivum]
Length=802

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  DE EKKR+FKFPFIACEIFTCE+D+IL+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YVVEEVPDEAEKKRSFKFPFIACEIFTCEIDVILRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLMNY++ H E++ +LVDLIGITS+ME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMNYVQEHPEIVVQLVDLIGITSVME  165



>ref|XP_006654872.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Oryza brachyantha]
Length=779

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  +++EKKR+FKFPFIACEIFTCE+DIIL+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YIVEEVPEDSEKKRSFKFPFIACEIFTCEIDIILRTLVEDEELMDLLFSFVKPGHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT PLMNY++ H E++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTSPLMNYVQEHPELVVQLVDLIGITSIME  165



>ref|XP_003540184.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Glycine max]
 gb|KHN11213.1| Serine/threonine-protein phosphatase 6 regulatory subunit 3 [Glycine 
soja]
Length=853

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVETILDK+NFTLEELLDE+E+IQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLASLSASSPVETILDKENFTLEELLDEEEVIQECKALNSRLINFLRDQAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KR FKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP R HS L
Sbjct  61   YIIEEPPEDAENKRAFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPNRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLM Y++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMKYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_008777093.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Phoenix dactylifera]
 ref|XP_008777094.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Phoenix dactylifera]
Length=803

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLSTASPV+TILDK++FTLEELLDEDEIIQECKALN RLINFLR+R+QVEQL+ 
Sbjct  1    MFWRMTGLSTASPVDTILDKESFTLEELLDEDEIIQECKALNTRLINFLRDRTQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EKK+ FKFPFIACEIFTCEVDIIL+ LV+DEELMNLLFSFL+P  PHS L
Sbjct  61   YIVEEAPEDAEKKQAFKFPFIACEIFTCEVDIILRTLVEDEELMNLLFSFLKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT PL++Y++ HQE+I +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTAPLISYVQGHQEIICQLVDLIGITSIME  165



>ref|XP_010540614.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Tarenaya hassleriana]
Length=764

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+ FTLEELLDEDEIIQECKALNGRL+NFLRER+QVEQL++
Sbjct  1    MFWRMAGLSTASPVETILDKEGFTLEELLDEDEIIQECKALNGRLLNFLRERTQVEQLIK  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  +  EKK+ FKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLEP + H+AL
Sbjct  61   YIIEEPPENAEKKQMFKFPFIACEIFTCEIEMILKPLVEDEELMKLLFSFLEPKQAHNAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV CLL RKTVP M +++ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVNCLLVRKTVPFMQFVKEHQEILKQLVDLIGITSIME  165



>gb|AES67505.2| SIT4 phosphatase-associated family protein [Medicago truncatula]
Length=851

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE ILDKDNFTLEELLDE+E+IQECKALN RLINFLR+ +QVEQL+R
Sbjct  1    MFWKLASLSASSPVEAILDKDNFTLEELLDEEEVIQECKALNSRLINFLRDPAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE   + E KRTFKFPFIACEIFTCE+D+ILK LVD+EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPPQDAESKRTFKFPFIACEIFTCEIDVILKTLVDEEELMNLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTV LMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVSLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_006594978.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-B-like isoform X2 [Glycine max]
Length=850

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE ILDK+NFTLEELLDE+E+IQECKALN RLINFLR++ QVEQL+R
Sbjct  1    MFWKLASLSASSPVEAILDKENFTLEELLDEEEVIQECKALNSRLINFLRDQVQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KR FKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP R HS L
Sbjct  61   YIIEEPPEDAENKRAFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPNRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_003543458.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-B-like isoformX1 [Glycine max]
Length=851

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE ILDK+NFTLEELLDE+E+IQECKALN RLINFLR++ QVEQL+R
Sbjct  1    MFWKLASLSASSPVEAILDKENFTLEELLDEEEVIQECKALNSRLINFLRDQVQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KR FKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP R HS L
Sbjct  61   YIIEEPPEDAENKRAFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPNRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMNYVQAHQNVFRQLVDLIGITSIME  165



>gb|KHG24330.1| Serine/threonine-protein phosphatase 6 regulatory subunit 3 [Gossypium 
arboreum]
Length=826

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE+ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSASSPVESILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ + KR FKFPFIACEIFTCE+D+ILK LV++E+LMNLLFSFLEP RPHSAL
Sbjct  61   YVVEEPPEDADSKRVFKFPFIACEIFTCEIDVILKTLVEEEQLMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVP+MNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPIMNYVQVHQDVFRQLVDLIGITSIME  165



>gb|KHN21514.1| Serine/threonine-protein phosphatase 6 regulatory subunit 1 [Glycine 
soja]
Length=851

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE ILDK+NFTLEELLDE+E+IQECKALN RLINFLR++ QVEQL+R
Sbjct  1    MFWKLASLSASSPVEAILDKENFTLEELLDEEEVIQECKALNSRLINFLRDQVQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KR FKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP R HS L
Sbjct  61   YIIEEPPEDAENKRAFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPNRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_008439556.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 2 [Cucumis melo]
Length=772

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTASPVETILDK+NFTL+ELLDEDEIIQECKALN RLINFLRER+Q+EQL+R
Sbjct  1    MFWRMAGLSTASPVETILDKENFTLDELLDEDEIIQECKALNSRLINFLRERTQIEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA +E EKKR+FKFPFIACEIFTCEVDIILKALV+DEELMNLLFSFLEP   HS L
Sbjct  61   YIVEEAPEEAEKKRSFKFPFIACEIFTCEVDIILKALVEDEELMNLLFSFLEPKPSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M Y++ H+ +++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTIPFMKYVQEHEAIVKKLVDLIGITSIME  165



>gb|KEH39331.1| SIT4 phosphatase-associated family protein [Medicago truncatula]
Length=850

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE ILDKDNFTLEELLDE+E+IQECKALN RLINFLR+ +QVEQL+R
Sbjct  1    MFWKLASLSASSPVEAILDKDNFTLEELLDEEEVIQECKALNSRLINFLRDPAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE   + E KRTFKFPFIACEIFTCE+D+ILK LVD+EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPPQDAESKRTFKFPFIACEIFTCEIDVILKTLVDEEELMNLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTV LMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVSLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_010313413.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Solanum lycopersicum]
Length=847

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS+ SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLPVLSSCSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRERTQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KRTFKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPSEDADSKRTFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ H +V +++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTAALMNYVQAHHDVFQQMVDLIGITSIME  165



>ref|XP_004251140.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Solanum lycopersicum]
Length=848

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS+ SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLPVLSSCSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRERTQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KRTFKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPSEDADSKRTFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ H +V +++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTAALMNYVQAHHDVFQQMVDLIGITSIME  165



>ref|XP_010313414.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Solanum lycopersicum]
Length=847

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS+ SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLPVLSSCSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRERTQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KRTFKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPSEDADSKRTFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ H +V +++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTAALMNYVQAHHDVFQQMVDLIGITSIME  165



>ref|XP_007016756.1| SIT4 phosphatase-associated family protein isoform 2 [Theobroma 
cacao]
 gb|EOY34375.1| SIT4 phosphatase-associated family protein isoform 2 [Theobroma 
cacao]
Length=850

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE+ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+ 
Sbjct  1    MFWKLTALSTSSPVESILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ + KR FKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIVEEPQEDADSKRAFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRLHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQEV R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQVHQEVFRQLVDLIGITSIME  165



>ref|XP_007016755.1| SIT4 phosphatase-associated family protein isoform 1 [Theobroma 
cacao]
 gb|EOY34374.1| SIT4 phosphatase-associated family protein isoform 1 [Theobroma 
cacao]
Length=851

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE+ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+ 
Sbjct  1    MFWKLTALSTSSPVESILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ + KR FKFPFIACEIFTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIVEEPQEDADSKRAFKFPFIACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRLHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQEV R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQVHQEVFRQLVDLIGITSIME  165



>ref|XP_009795038.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Nicotiana sylvestris]
Length=853

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS+ SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLRER+QVEQL+ 
Sbjct  1    MFWKLPVLSSCSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRERTQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE ++  + KRTFKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP RPHSAL
Sbjct  61   YIIEEPSEVADSKRTFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ H +V +++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTVPLMNYVQAHHDVFQQMVDLIGITSIME  165



>ref|XP_009795040.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X4 [Nicotiana sylvestris]
Length=852

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS+ SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLRER+QVEQL+ 
Sbjct  1    MFWKLPVLSSCSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRERTQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE ++  + KRTFKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP RPHSAL
Sbjct  61   YIIEEPSEVADSKRTFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ H +V +++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTVPLMNYVQAHHDVFQQMVDLIGITSIME  165



>gb|EMT30482.1| hypothetical protein F775_29416 [Aegilops tauschii]
Length=819

 Score =   256 bits (654),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ EKKR+FKFPFIACEIFTCE+D+IL+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YVVEEVPDDAEKKRSFKFPFIACEIFTCEIDVILRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLMNY++ H E++ +LVDLIGITS+ME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMNYVQEHPEIVVQLVDLIGITSVME  165



>gb|KHN38759.1| Serine/threonine-protein phosphatase 6 regulatory subunit 3 [Glycine 
soja]
Length=853

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A +S++SPVE ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLASISSSSPVEVILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KR FKFPFI+CEIFTCE+D+ILK LVD+EELMNLLFSFLEP R HS L
Sbjct  61   YIIEEPLEDDENKRVFKFPFISCEIFTCEIDVILKTLVDEEELMNLLFSFLEPDRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTVPLMNYVQAHQHVFRQLVDLIGITSIME  165



>ref|XP_009587813.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Nicotiana tomentosiformis]
Length=853

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS+ SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLRER+QVEQL+ 
Sbjct  1    MFWKLPVLSSCSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRERTQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE +++ + KRTFKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP  PHSAL
Sbjct  61   YIIEEPSEDADSKRTFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPSCPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++TH +V +++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTVPLMNYVQTHHDVFQQMVDLIGITSIME  165



>ref|XP_009613055.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score =   256 bits (655),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSACSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KR FKFPFIA EIFTCE+D+ILKALV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPSEDADNKRKFKFPFIASEIFTCEIDVILKALVEEEELMNLLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ H +V R++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVQAHHDVFRQMVDLIGITSIME  165



>ref|XP_009613054.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score =   256 bits (655),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSACSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KR FKFPFIA EIFTCE+D+ILKALV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPSEDADNKRKFKFPFIASEIFTCEIDVILKALVEEEELMNLLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ H +V R++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVQAHHDVFRQMVDLIGITSIME  165



>ref|XP_009587814.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Nicotiana tomentosiformis]
Length=852

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS+ SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLRER+QVEQL+ 
Sbjct  1    MFWKLPVLSSCSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRERTQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE +++ + KRTFKFPFIACEIFTCE+D+ILK LVDDEELMNLLFSFLEP  PHSAL
Sbjct  61   YIIEEPSEDADSKRTFKFPFIACEIFTCEIDVILKTLVDDEELMNLLFSFLEPSCPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++TH +V +++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTVPLMNYVQTHHDVFQQMVDLIGITSIME  165



>ref|XP_011656998.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Cucumis sativus]
Length=850

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWR+  LST+SPVE+ILDK+NF+LEELLDE+EIIQECKALN RL+NFLR+R+QVEQL+R
Sbjct  1    MFWRLTSLSTSSPVESILDKENFSLEELLDEEEIIQECKALNSRLVNFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  +++E KR FKFPFIACEIFTCE+D+ILK LV++EELM++LFSFLEP RPHSAL
Sbjct  61   YVVEEPPEDSESKRAFKFPFIACEIFTCEIDVILKTLVEEEELMDMLFSFLEPDRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKV+ICL+ RKTVPLM+Y++ H++V+R+LVDLIGITSIME
Sbjct  121  LAGYFSKVIICLMIRKTVPLMHYVQAHRDVLRQLVDLIGITSIME  165



>ref|XP_004145744.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Cucumis sativus]
 gb|KGN46841.1| hypothetical protein Csa_6G141380 [Cucumis sativus]
Length=851

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWR+  LST+SPVE+ILDK+NF+LEELLDE+EIIQECKALN RL+NFLR+R+QVEQL+R
Sbjct  1    MFWRLTSLSTSSPVESILDKENFSLEELLDEEEIIQECKALNSRLVNFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  +++E KR FKFPFIACEIFTCE+D+ILK LV++EELM++LFSFLEP RPHSAL
Sbjct  61   YVVEEPPEDSESKRAFKFPFIACEIFTCEIDVILKTLVEEEELMDMLFSFLEPDRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKV+ICL+ RKTVPLM+Y++ H++V+R+LVDLIGITSIME
Sbjct  121  LAGYFSKVIICLMIRKTVPLMHYVQAHRDVLRQLVDLIGITSIME  165



>ref|XP_008463950.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Cucumis melo]
Length=850

 Score =   256 bits (654),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWR+  LST+SPVE+ILDK+NF+LEELLDE+EIIQECKALN RL+NFLR+R+QVEQL+R
Sbjct  1    MFWRLTSLSTSSPVESILDKENFSLEELLDEEEIIQECKALNSRLVNFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  +++E KR FKFPFIACEIFTCE+D+ILK LV++EELM++LFSFLEP RPHSAL
Sbjct  61   YVVEEPPEDSESKRAFKFPFIACEIFTCEIDVILKTLVEEEELMDMLFSFLEPDRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKV+ICL+ RKTVPLM+Y++ H++V+R+LVDLIGITSIME
Sbjct  121  LAGYFSKVIICLMIRKTVPLMHYVQAHRDVLRQLVDLIGITSIME  165



>ref|XP_008463951.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Cucumis melo]
Length=849

 Score =   256 bits (654),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWR+  LST+SPVE+ILDK+NF+LEELLDE+EIIQECKALN RL+NFLR+R+QVEQL+R
Sbjct  1    MFWRLTSLSTSSPVESILDKENFSLEELLDEEEIIQECKALNSRLVNFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  +++E KR FKFPFIACEIFTCE+D+ILK LV++EELM++LFSFLEP RPHSAL
Sbjct  61   YVVEEPPEDSESKRAFKFPFIACEIFTCEIDVILKTLVEEEELMDMLFSFLEPDRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKV+ICL+ RKTVPLM+Y++ H++V+R+LVDLIGITSIME
Sbjct  121  LAGYFSKVIICLMIRKTVPLMHYVQAHRDVLRQLVDLIGITSIME  165



>ref|XP_010089978.1| hypothetical protein L484_008056 [Morus notabilis]
 gb|EXB38692.1| hypothetical protein L484_008056 [Morus notabilis]
Length=854

 Score =   256 bits (654),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSASSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ E KR FKFPFI+CEIFTCE+D+ILK LV++EELM LLFSFLEP RPHSAL
Sbjct  61   YIVEEPPEDAESKRAFKFPFISCEIFTCEIDVILKTLVEEEELMILLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVPLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_007132264.1| hypothetical protein PHAVU_011G080000g [Phaseolus vulgaris]
 gb|ESW04258.1| hypothetical protein PHAVU_011G080000g [Phaseolus vulgaris]
Length=856

 Score =   256 bits (654),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A +S++SPVE ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLAAISSSSPVEVILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRTQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KR FKFPFIACEIFTCE+D+ILK LVD+EELMNLLFSFL P R HS L
Sbjct  61   YIIEEPQEDAENKRVFKFPFIACEIFTCEIDVILKTLVDEEELMNLLFSFLAPDRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTVPLMNYVQAHQHVFRQLVDLIGITSIME  165



>ref|XP_003540757.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Glycine max]
Length=848

 Score =   256 bits (653),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A +S++SPVE ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLASISSSSPVEVILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KR FKFPFIACEIFTCE+D+ILK LVD+EELMNLLFSFLE  R HS L
Sbjct  61   YIIEEPPEDAENKRVFKFPFIACEIFTCEIDVILKTLVDEEELMNLLFSFLESDRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTVPLMNYVQAHQHVFRQLVDLIGITSIME  165



>gb|KHN05680.1| Serine/threonine-protein phosphatase 6 regulatory subunit 3 [Glycine 
soja]
Length=848

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A +S++SPVE ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLASISSSSPVEVILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KR FKFPFIACEIFTCE+D+ILK LVD+EELMNLLFSFLE  R HS L
Sbjct  61   YIIEEPPEDAENKRVFKFPFIACEIFTCEIDVILKTLVDEEELMNLLFSFLESDRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTVPLMNYVQAHQHVFRQLVDLIGITSIME  165



>gb|KHG15599.1| Serine/threonine-protein phosphatase 6 regulatory subunit 2 [Gossypium 
arboreum]
Length=773

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMA LSTASPVETILDK+NFTLEELLDEDEIIQECKALNGRLINFLRE++QVEQL+R
Sbjct  1    MFWRMAALSTASPVETILDKENFTLEELLDEDEIIQECKALNGRLINFLREKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV E  ++ E +RTFKFPFIACE+FTCEVDIILK LV+DEELMNLLFSFL+    HS  
Sbjct  61   YIVVEPPEDAENRRTFKFPFIACELFTCEVDIILKTLVEDEELMNLLFSFLDTNHSHSTP  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P + Y++ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLLRKTLPFVQYVKGHQEIVKRLVDLIGITSIME  165



>ref|XP_004969398.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Setaria italica]
Length=788

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ EKKR+FKFPFIACEIFTCE+D++L+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YVVEEVPEDNEKKRSFKFPFIACEIFTCEIDVVLRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLMNY++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMNYVQGHPEIVVQLVDLIGITSIME  165



>ref|XP_004969397.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Setaria italica]
Length=789

 Score =   254 bits (650),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ EKKR+FKFPFIACEIFTCE+D++L+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YVVEEVPEDNEKKRSFKFPFIACEIFTCEIDVVLRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLMNY++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMNYVQGHPEIVVQLVDLIGITSIME  165



>ref|XP_006488080.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Citrus sinensis]
Length=855

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R QVE+L+R
Sbjct  1    MFWKLTALSASSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDREQVEKLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA  + E K+ FKFPF+ACEIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEAPADAESKQAFKFPFVACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ H +V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQIHPDVFRRLVDLIGITSIME  165



>ref|XP_006488081.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Citrus sinensis]
Length=854

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R QVE+L+R
Sbjct  1    MFWKLTALSASSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDREQVEKLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA  + E K+ FKFPF+ACEIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEAPADAESKQAFKFPFVACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ H +V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQIHPDVFRRLVDLIGITSIME  165



>ref|XP_011040887.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Populus euphratica]
Length=841

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDKDNFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSTSSPVESLLDKDNFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE +++ E K  FKFPF+ACEIFTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPSEDAESKLAFKFPFVACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRTHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTV LMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVSLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_011040886.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Populus euphratica]
Length=842

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDKDNFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSTSSPVESLLDKDNFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE +++ E K  FKFPF+ACEIFTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPSEDAESKLAFKFPFVACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRTHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTV LMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVSLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_011040889.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X3 [Populus euphratica]
Length=841

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDKDNFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSTSSPVESLLDKDNFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE +++ E K  FKFPF+ACEIFTCE+D+ILK LV++EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPSEDAESKLAFKFPFVACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRTHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTV LMNY++ HQ+V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVSLMNYVQAHQDVFRQLVDLIGITSIME  165



>ref|XP_004969396.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Setaria italica]
Length=818

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ EKKR+FKFPFIACEIFTCE+D++L+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YVVEEVPEDNEKKRSFKFPFIACEIFTCEIDVVLRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLMNY++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMNYVQGHPEIVVQLVDLIGITSIME  165



>ref|XP_009776728.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Nicotiana sylvestris]
Length=852

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSACSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KR FKFPFIA EIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPSEDADNKRKFKFPFIASEIFTCEIDVILKTLVEEEELMNLLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ H +V R++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVQAHHDVFRQMVDLIGITSIME  165



>ref|XP_010541325.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Tarenaya hassleriana]
Length=780

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LSTASPVE+ILDK++FTLEELLDE++IIQECKALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLTALSTASPVESILDKEDFTLEELLDEEDIIQECKALNSRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEAA++ + KR FKFPFI+ E+F CE+D+IL  LV+ EELMNLLFSFLEP RPHS +
Sbjct  61   YIVEEAAEDADSKRAFKFPFISSEVFACEIDVILSTLVEAEELMNLLFSFLEPNRPHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKDHQNVFQQLVDLIGITSIME  165



>ref|XP_009776729.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Nicotiana sylvestris]
Length=851

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSACSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KR FKFPFIA EIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPSEDADNKRKFKFPFIASEIFTCEIDVILKTLVEEEELMNLLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ H +V R++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVQAHHDVFRQMVDLIGITSIME  165



>ref|NP_001056496.1| Os05g0592500 [Oryza sativa Japonica Group]
 gb|AAT44301.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18410.1| Os05g0592500 [Oryza sativa Japonica Group]
 dbj|BAG92742.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94198.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64899.1| hypothetical protein OsJ_19758 [Oryza sativa Japonica Group]
Length=770

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  +++EKKR+FKFPFIACEIFTCE+DIIL+ LV+DEELM+LLFSF+ P  PHS L
Sbjct  61   YIVEEVPEDSEKKRSFKFPFIACEIFTCEIDIILRTLVEDEELMDLLFSFVRPGHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT PLMNY++ H +++  LVDLIG TSIME
Sbjct  121  LAGYFSKVVICLMLRKTSPLMNYVQEHPDIVVHLVDLIGTTSIME  165



>ref|XP_006415470.1| hypothetical protein EUTSA_v10006836mg [Eutrema salsugineum]
 gb|ESQ33823.1| hypothetical protein EUTSA_v10006836mg [Eutrema salsugineum]
Length=798

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS +E ILDKD FTLEELLDEDE IQECKALNGRL+NFLRER+QVEQL+R
Sbjct  1    MFWRMAGLSTASAIEAILDKDGFTLEELLDEDEFIQECKALNGRLLNFLRERAQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  D+ EKKRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPLDDVEKKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSI+E
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSILE  165



>ref|XP_006340190.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Solanum tuberosum]
Length=848

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS+ SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLRER+QVEQL+ 
Sbjct  1    MFWKLPVLSSCSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRERTQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KRTFKFPFIACEIFTCE+D+ILK LVDDEELMN+LFSFLEP RPHSAL
Sbjct  61   YIVEEPSEDADSKRTFKFPFIACEIFTCEIDVILKTLVDDEELMNMLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ H +V +++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTAALMNYVQAHHDVFQQMVDLIGITSIME  165



>ref|XP_006340189.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Solanum tuberosum]
Length=849

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS+ SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLRER+QVEQL+ 
Sbjct  1    MFWKLPVLSSCSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRERTQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KRTFKFPFIACEIFTCE+D+ILK LVDDEELMN+LFSFLEP RPHSAL
Sbjct  61   YIVEEPSEDADSKRTFKFPFIACEIFTCEIDVILKTLVDDEELMNMLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ H +V +++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTAALMNYVQAHHDVFQQMVDLIGITSIME  165



>ref|XP_006340191.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Solanum tuberosum]
Length=848

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS+ SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLRER+QVEQL+ 
Sbjct  1    MFWKLPVLSSCSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRERTQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ + KRTFKFPFIACEIFTCE+D+ILK LVDDEELMN+LFSFLEP RPHSAL
Sbjct  61   YIVEEPSEDADSKRTFKFPFIACEIFTCEIDVILKTLVDDEELMNMLFSFLEPSRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ H +V +++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTAALMNYVQAHHDVFQQMVDLIGITSIME  165



>ref|XP_003569276.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Brachypodium distachyon]
Length=831

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ EKKR+FKFPFIACEIFTCE+D+IL+ LV+DEELM LLFSF++P  PHS L
Sbjct  61   YIVEEVPEDVEKKRSFKFPFIACEIFTCEIDVILRTLVEDEELMELLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLMNY++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMNYVQEHPEIVIQLVDLIGITSIME  165



>ref|XP_009115143.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Brassica rapa]
Length=792

 Score =   253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD+FTLEELLDEDEIIQECKALNGRL+NFLRER QVEQLVR
Sbjct  1    MFWRMAGLSTASAVEAILDKDHFTLEELLDEDEIIQECKALNGRLLNFLRERVQVEQLVR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E+KR FKFPFIACEIFTCE+D+ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPLEDGEQKRAFKFPFIACEIFTCEIDMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQE++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQEILNQLVDLIGITSIME  165



>gb|KJB56284.1| hypothetical protein B456_009G114900 [Gossypium raimondii]
Length=772

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMA LSTASPVETILDK+NFTLEELLDEDEIIQECKALNGRLINFLRE++QVEQL+R
Sbjct  1    MFWRMAALSTASPVETILDKENFTLEELLDEDEIIQECKALNGRLINFLREKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV E  ++ E +RTFKFPFIACE+FTCEVDIILK LV+DEELMNLLFSFL+    HS  
Sbjct  61   YIVVEPPEDAENRRTFKFPFIACELFTCEVDIILKTLVEDEELMNLLFSFLDTNHSHSTP  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P + Y++ HQE+++ LVDLIG+TS+ME
Sbjct  121  LAGYFSKVVICLLLRKTLPFLQYVKGHQEIVKHLVDLIGVTSVME  165



>ref|XP_008385322.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Malus domestica]
Length=849

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++   S ASPVET+LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLT--SAASPVETVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  58

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ E KR FKFPFIACE+FTCE+D+ILK LVD+EELMNLLFSFLEP RPHSA 
Sbjct  59   YIVEEPPEDAESKRAFKFPFIACEVFTCEIDVILKTLVDEEELMNLLFSFLEPNRPHSAP  118

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVV+CL+ RKT PLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  119  LAGYFGKVVVCLMIRKTAPLMNYVQAHQDVFRQLVDLIGITSIME  163



>ref|NP_001170695.1| uncharacterized protein LOC100384768 [Zea mays]
 gb|ACR34536.1| unknown [Zea mays]
Length=546

 Score =   248 bits (632),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ E+KR+FKFPFIA EIFTCE+D+IL+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YVVEEVPDDAERKRSFKFPFIASEIFTCEIDVILRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLM+Y++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLVLRKTAPLMSYVQGHPEIVVQLVDLIGITSIME  165



>ref|NP_174335.4| SIT4 phosphatase-associated family protein [Arabidopsis thaliana]
 gb|AEE31223.1| SIT4 phosphatase-associated family protein [Arabidopsis thaliana]
Length=811

 Score =   253 bits (645),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD+FTLE+LLDEDEIIQECKALNGRL+NFLRE+ QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDSFTLEDLLDEDEIIQECKALNGRLLNFLREKVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ EKKRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPLEDVEKKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  165



>ref|XP_008359132.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 2-like [Malus domestica]
Length=854

 Score =   253 bits (647),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++   S ASPVET+LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLT--SAASPVETVLDKENFTLEELLDEEEIIQECKALNTRLINFLRDRAQVEQLLR  58

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ E KR FKFPFIACE+FTCE+D+ILK LVD+EELMNLLFSFLEP RPHSA 
Sbjct  59   YIVEEPPEDAESKRAFKFPFIACEVFTCEIDVILKTLVDEEELMNLLFSFLEPNRPHSAP  118

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVV+CL+ RKT PLMNY++ HQ+V R+LVDLIGITSIME
Sbjct  119  LAGYFGKVVVCLMIRKTAPLMNYVQAHQDVFRQLVDLIGITSIME  163



>ref|XP_004487102.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Cicer arietinum]
Length=851

 Score =   253 bits (647),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE ILDK+NFTLEELLDE+E+IQECKALN RLINFLR+ +QVEQL+ 
Sbjct  1    MFWKLASLSASSPVEAILDKENFTLEELLDEEEVIQECKALNSRLINFLRDPAQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE   + E KRTFKFPFIACEIFTCE+D+ILK LVD+EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPPQDAENKRTFKFPFIACEIFTCEIDVILKTLVDEEELMNLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTV LMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVSLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_004487101.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Cicer arietinum]
Length=852

 Score =   253 bits (646),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE ILDK+NFTLEELLDE+E+IQECKALN RLINFLR+ +QVEQL+ 
Sbjct  1    MFWKLASLSASSPVEAILDKENFTLEELLDEEEVIQECKALNSRLINFLRDPAQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE   + E KRTFKFPFIACEIFTCE+D+ILK LVD+EELMNLLFSFLEP R HSAL
Sbjct  61   YIIEEPPQDAENKRTFKFPFIACEIFTCEIDVILKTLVDEEELMNLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTV LMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTVSLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_006846781.2| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Amborella trichopoda]
Length=718

 Score =   251 bits (641),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW M GLS ASPVE++LDK+NFTLEEL DE+EIIQECKALN RLINFLR+R+QV+Q++ 
Sbjct  1    MFWHMTGLSAASPVESVLDKENFTLEELFDEEEIIQECKALNSRLINFLRDRAQVKQMLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVE+  +++EK+R +KFPF+ACEIFTCE+D+ILK LV+DEELMNLLFSFLEP R H  L
Sbjct  61   YIVEDPPEDSEKRRAYKFPFVACEIFTCEIDVILKTLVEDEELMNLLFSFLEPNRSHCTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++ HQE+  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTIPLMNYVQAHQEIFGRLVDLIGITSIME  165



>ref|XP_002889677.1| SIT4 phosphatase-associated family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65936.1| SIT4 phosphatase-associated family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=805

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLRE++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLREKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE   + + KR FKFPFI+CEIFTCE+D+ILK LV+DEELM+LLFSFLEP RPHSAL
Sbjct  61   YIVEEPPQDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEELMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIME  165



>ref|XP_011085212.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 1-like [Sesamum indicum]
 ref|XP_011085213.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 1-like [Sesamum indicum]
Length=776

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW M GLST SPV+TILDK++FTLEELLDEDEIIQE KALNGRLI+FL+E+SQV QLV+
Sbjct  1    MFWHM-GLSTVSPVDTILDKEHFTLEELLDEDEIIQEVKALNGRLISFLQEKSQVNQLVQ  59

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ +K R FKFPF+ACEIFTCEVDIILKALV+D+ELM+LLFSFL+P RPHS L
Sbjct  60   YIVEEAPEDAKKPRIFKFPFVACEIFTCEVDIILKALVEDDELMDLLFSFLDPGRPHSTL  119

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKT PLMNYIR HQ++I KLVDLIGITSIME
Sbjct  120  LAGYFSKVVVCLLLRKTAPLMNYIRAHQDIINKLVDLIGITSIME  164



>ref|XP_004961011.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Setaria italica]
Length=763

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  +++EKKR+FKFPFIACEIFTCE+DIIL+ LV+D ELM+LLFSF++P  PHS L
Sbjct  61   YIMEEVPEDSEKKRSFKFPFIACEIFTCEIDIILRTLVEDVELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT PLMNY++ H +++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTAPLMNYVQEHPDIVVQLVDLIGITSIME  165



>ref|XP_004961012.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Setaria italica]
Length=762

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  +++EKKR+FKFPFIACEIFTCE+DIIL+ LV+D ELM+LLFSF++P  PHS L
Sbjct  61   YIMEEVPEDSEKKRSFKFPFIACEIFTCEIDIILRTLVEDVELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT PLMNY++ H +++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTAPLMNYVQEHPDIVVQLVDLIGITSIME  165



>ref|XP_006417742.1| hypothetical protein EUTSA_v10006825mg [Eutrema salsugineum]
 gb|ESQ36095.1| hypothetical protein EUTSA_v10006825mg [Eutrema salsugineum]
Length=805

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLRE++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLREKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE   +++ KR FKFPFI+CEIFTCE+D+ILK LV+DEELM+LLFSFLEP RPHSAL
Sbjct  61   YIVEEPPSDSDSKRAFKFPFISCEIFTCEIDVILKTLVEDEELMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIME  165



>emb|CDX98206.1| BnaC07g08920D [Brassica napus]
Length=784

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILD+D FTLE+LLDEDE+IQECKALNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDRDGFTLEDLLDEDELIQECKALNGRLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ EKKRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPPEDVEKKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  165



>gb|KJB56143.1| hypothetical protein B456_009G107700 [Gossypium raimondii]
 gb|KJB56144.1| hypothetical protein B456_009G107700 [Gossypium raimondii]
 gb|KJB56145.1| hypothetical protein B456_009G107700 [Gossypium raimondii]
Length=842

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPV++ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL++
Sbjct  1    MFWQLTALSASSPVDSILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ + KR+FKFPFIACEIFTCE+D+IL+ L ++EELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPPEDADNKRSFKFPFIACEIFTCEIDVILRTLAEEEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQVHQDVFCQLVDLIGITSIME  165



>ref|XP_002455854.1| hypothetical protein SORBIDRAFT_03g026240 [Sorghum bicolor]
 gb|EES00974.1| hypothetical protein SORBIDRAFT_03g026240 [Sorghum bicolor]
Length=781

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ E+KR+FKFPFIACEIFTCE+D+IL+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YVVEEVPEDAERKRSFKFPFIACEIFTCEIDVILRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLM+Y++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMSYVQGHPEIVVQLVDLIGITSIME  165



>gb|EPS64818.1| hypothetical protein M569_09960, partial [Genlisea aurea]
Length=473

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVET+LDK+NFTLEELL+E+EIIQECKALN RLINFLR+R QVEQL+ 
Sbjct  1    MFWKLTALSASSPVETVLDKENFTLEELLEEEEIIQECKALNSRLINFLRDRYQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI++EA ++ + +R FKFPF+ACEIFTCE+D+ILK LV++EELM LLFSFLEP R HSAL
Sbjct  61   YIIDEAPEDADSRRAFKFPFVACEIFTCEIDVILKTLVEEEELMTLLFSFLEPNRAHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RK++ LMNY++ HQ+V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKSIHLMNYVKAHQDVFVRLVDLIGITSIME  165



>emb|CDY09579.1| BnaC05g23400D [Brassica napus]
Length=789

 Score =   251 bits (640),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKDNFTLEELLDEDEIIQECKALNGRL+NFLRER QVEQL+ 
Sbjct  1    MFWRMAGLSTASAVEAILDKDNFTLEELLDEDEIIQECKALNGRLLNFLRERVQVEQLIS  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFL+    H+AL
Sbjct  61   YIIEEPLEDGELKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLQAKETHNAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  165



>ref|XP_009118397.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Brassica rapa]
Length=773

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK++FTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKESFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE+ D+ + KR FKFPFI+CEIFTCE+D+ILK+LV+D+ELM+LLFSFLEP R HSAL
Sbjct  61   YIVEESPDDADSKRAFKFPFISCEIFTCEIDVILKSLVEDDELMDLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  +MNY++ +Q V+R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTAAVMNYVKGNQNVLRRLVDLIGITSIME  165



>emb|CDY02294.1| BnaA09g26080D [Brassica napus]
Length=1309

 Score =   254 bits (650),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKDNFTLEELLDEDEIIQECKALNGRL+NFLRER QVEQLVR
Sbjct  534  MFWRMAGLSTASAVEAILDKDNFTLEELLDEDEIIQECKALNGRLLNFLRERVQVEQLVR  593

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E+KR FKFPFIACEIFTCE+D+ILK LV+DEELM LLFSFLE    H++L
Sbjct  594  YIIEEPLEDGEQKRAFKFPFIACEIFTCEIDMILKTLVEDEELMLLLFSFLEAKETHNSL  653

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQE++ +LVDLIGITSIME
Sbjct  654  LAGYFSKVVICLLVRKTIPFMQFIKDHQEILNQLVDLIGITSIME  698



>emb|CBI16320.3| unnamed protein product [Vitis vinifera]
Length=790

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVE L+R
Sbjct  1    MFWKLTALSTSSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVELLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++TE KR FKFPFIACEIFTCE+D+I K LV+++ELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEPPEDTENKRAFKFPFIACEIFTCEIDVIFKTLVEEDELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ R+TV LMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRRTVSLMNYVQAHQNVFRQLVDLIGITSIME  165



>emb|CDX77590.1| BnaA07g07280D [Brassica napus]
Length=792

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD FTLE+LLDEDE+IQECKALNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDGFTLEDLLDEDELIQECKALNGRLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPPEDVENKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  165



>ref|XP_009102696.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Brassica rapa]
Length=790

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD FTLE+LLDEDE+IQECKALNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDGFTLEDLLDEDELIQECKALNGRLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPPEDVENKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  165



>ref|XP_009102694.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Brassica rapa]
Length=792

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD FTLE+LLDEDE+IQECKALNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDGFTLEDLLDEDELIQECKALNGRLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPPEDVENKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  165



>ref|XP_009102695.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Brassica rapa]
Length=791

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD FTLE+LLDEDE+IQECKALNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDGFTLEDLLDEDELIQECKALNGRLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPPEDVENKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  165



>gb|EYU43237.1| hypothetical protein MIMGU_mgv1a002224mg [Erythranthe guttata]
Length=699

 Score =   248 bits (634),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW M+G S AS VETILDK++FTLEELLDEDEIIQECKA NGRL++FLRER+QV+QL+R
Sbjct  1    MFWHMSGFSAASAVETILDKESFTLEELLDEDEIIQECKAHNGRLVSFLRERAQVKQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EEA ++  K+ +FK PF+ACEIFTCEVDIILK LV+DEELM+LLFSFL+P RPHS L
Sbjct  61   YIMEEAPEDASKQFSFKLPFVACEIFTCEVDIILKTLVEDEELMDLLFSFLDPERPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKV +CLL RKT PLMNYI+ HQ++I KLVDLIGITSIME
Sbjct  121  LAGYFSKVFVCLLLRKTTPLMNYIQAHQDIITKLVDLIGITSIME  165



>emb|CBI30997.3| unnamed protein product [Vitis vinifera]
Length=785

 Score =   250 bits (638),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  212  VETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVRYIVEEAADETEKK  391
            VETILDK+NFTLEELLDEDEIIQECKALNGRLINFLRER+QVEQL+RYIVEEA ++ EKK
Sbjct  10   VETILDKENFTLEELLDEDEIIQECKALNGRLINFLRERAQVEQLIRYIVEEAPEDAEKK  69

Query  392  RTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSALLAGYFSKVVICLL  571
            RTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFLEP   HS LLAGYFSKVVICLL
Sbjct  70   RTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLEPKHSHSTLLAGYFSKVVICLL  129

Query  572  QRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
             RKTVPLM+YI+ HQE+ R++VDLIGITSIME
Sbjct  130  LRKTVPLMHYIQVHQEIFRQMVDLIGITSIME  161



>ref|XP_010651169.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X3 [Vitis vinifera]
Length=851

 Score =   251 bits (640),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVE L+R
Sbjct  1    MFWKLTALSTSSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVELLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++TE KR FKFPFIACEIFTCE+D+I K LV+++ELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEPPEDTENKRAFKFPFIACEIFTCEIDVIFKTLVEEDELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ R+TV LMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRRTVSLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_010460839.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Camelina sativa]
 ref|XP_010460840.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Camelina sativa]
Length=804

 Score =   250 bits (638),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD+FTLEELLDEDEIIQECKALNG+L+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDSFTLEELLDEDEIIQECKALNGKLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ EKKRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPLEDVEKKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQ+++++LVDLIG TSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQDILKQLVDLIGTTSIME  165



>ref|XP_010651167.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Vitis vinifera]
Length=858

 Score =   251 bits (640),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVE L+R
Sbjct  1    MFWKLTALSTSSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVELLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++TE KR FKFPFIACEIFTCE+D+I K LV+++ELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEPPEDTENKRAFKFPFIACEIFTCEIDVIFKTLVEEDELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ R+TV LMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRRTVSLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|NP_172277.2| SIT4 phosphatase-associated family protein [Arabidopsis thaliana]
 gb|AAM83251.1| At1g07990/T6D22_5 [Arabidopsis thaliana]
 gb|AAO42781.1| At1g07990/T6D22_5 [Arabidopsis thaliana]
 gb|AEE28224.1| SIT4 phosphatase-associated family protein [Arabidopsis thaliana]
Length=802

 Score =   250 bits (638),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVEIILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE   + + KR FKFPFI+CEIFTCE+D+ILK LV+DEELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPPQDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIME  165



>ref|XP_002285194.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X4 [Vitis vinifera]
Length=850

 Score =   251 bits (640),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVE L+R
Sbjct  1    MFWKLTALSTSSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVELLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++TE KR FKFPFIACEIFTCE+D+I K LV+++ELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEPPEDTENKRAFKFPFIACEIFTCEIDVIFKTLVEEDELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ R+TV LMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRRTVSLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_010478456.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Camelina sativa]
 ref|XP_010478457.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Camelina sativa]
Length=806

 Score =   250 bits (638),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD+FTLEELLDEDEIIQECKALNG+L+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDSFTLEELLDEDEIIQECKALNGKLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ EKKRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPLEDVEKKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQ+++++LVDLIG TSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQDILKQLVDLIGTTSIME  165



>ref|XP_010651168.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Vitis vinifera]
Length=857

 Score =   251 bits (640),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LST+SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVE L+R
Sbjct  1    MFWKLTALSTSSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVELLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++TE KR FKFPFIACEIFTCE+D+I K LV+++ELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEPPEDTENKRAFKFPFIACEIFTCEIDVIFKTLVEEDELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ R+TV LMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRRTVSLMNYVQAHQNVFRQLVDLIGITSIME  165



>ref|XP_010499578.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Camelina sativa]
Length=818

 Score =   250 bits (638),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD FTLEELLDEDEIIQECKALNG+L+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDGFTLEELLDEDEIIQECKALNGKLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ EKKRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPLEDVEKKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICLL RKT+P M +I+ HQ+++++LVDLIG TSIME
Sbjct  121  LAGYFSKVVICLLVRKTIPFMQFIKDHQDILKQLVDLIGTTSIME  165



>ref|XP_010689536.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 [Beta vulgaris subsp. vulgaris]
Length=847

 Score =   250 bits (639),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPV+ ILDKDNFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTALSASSPVDAILDKDNFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ + KRTFKFPF+A E+FTCE+D+IL+ LV++EE+M+LLFSFLEP RPHS L
Sbjct  61   YVVEEPPEDADSKRTFKFPFVASEVFTCEIDVILRTLVEEEEMMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKTVPLMNY++ HQ+V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTVPLMNYVQAHQDVFQQLVDLIGITSIME  165



>gb|EEC70972.1| hypothetical protein OsI_02602 [Oryza sativa Indica Group]
Length=772

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ EKKR+FKFPFIACEIFTCE+D+IL+ LV+DE+LM LLFSF++   PHS L
Sbjct  61   YVVEEVPDDAEKKRSFKFPFIACEIFTCEIDVILRTLVEDEQLMELLFSFVKSDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLM Y++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMAYVQGHPEIVVQLVDLIGITSIME  165



>ref|XP_006644315.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Oryza brachyantha]
Length=772

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ EKKR+FKFPFIACEIFTCE+D+IL+ LV+DEELM LLFSF++   PHS L
Sbjct  61   YVVEEVPEDAEKKRSFKFPFIACEIFTCEIDVILRTLVEDEELMELLFSFVKSDNPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLM Y++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMAYVQAHPEIVVQLVDLIGITSIME  165



>ref|XP_011089916.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Sesamum indicum]
Length=852

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL++
Sbjct  1    MFWKLTALSASSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLK  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ + KRTFK+PF+ACEIFTCE+D+ILK LV+DEELM+LLFSFLE    HSAL
Sbjct  61   YIIEEPLEDADSKRTFKYPFVACEIFTCEIDVILKTLVEDEELMDLLFSFLEANHAHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++ HQ+V+++LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTIPLMNYVKAHQDVLKQLVDLIGITSIME  165



>ref|XP_011089914.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Sesamum indicum]
Length=853

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL++
Sbjct  1    MFWKLTALSASSPVESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLK  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ + KRTFK+PF+ACEIFTCE+D+ILK LV+DEELM+LLFSFLE    HSAL
Sbjct  61   YIIEEPLEDADSKRTFKYPFVACEIFTCEIDVILKTLVEDEELMDLLFSFLEANHAHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++ HQ+V+++LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMLRKTIPLMNYVKAHQDVLKQLVDLIGITSIME  165



>ref|XP_006644316.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Oryza brachyantha]
Length=771

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ EKKR+FKFPFIACEIFTCE+D+IL+ LV+DEELM LLFSF++   PHS L
Sbjct  61   YVVEEVPEDAEKKRSFKFPFIACEIFTCEIDVILRTLVEDEELMELLFSFVKSDNPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLM Y++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMAYVQAHPEIVVQLVDLIGITSIME  165



>emb|CDY12058.1| BnaC03g59740D [Brassica napus]
Length=759

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD FTLEELLDEDEIIQECK+LNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDGFTLEELLDEDEIIQECKSLNGRLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  D+ EKK TFKFPF+ACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPLDDVEKKPTFKFPFVACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L GYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LVGYFSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  165



>ref|XP_007022858.1| SIT4 phosphatase-associated family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25480.1| SIT4 phosphatase-associated family protein isoform 1 [Theobroma 
cacao]
Length=802

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 150/186 (81%), Gaps = 21/186 (11%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLSTASPVETILDK+NFTLEELLDEDEIIQECKALNGRLINFLRE++QVEQL++
Sbjct  1    MFWRMTGLSTASPVETILDKENFTLEELLDEDEIIQECKALNGRLINFLREKTQVEQLLQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV E  ++ EKKRTFKFPFIACEIFTCEVDIILK LV+DEELMNLLFSFL+    HS L
Sbjct  61   YIVVEPPEDAEKKRTFKFPFIACEIFTCEVDIILKTLVEDEELMNLLFSFLDSNHSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIR---------------------THQEVIRKLVDLIG  649
            LAGYFSKVVICLL RKT+P M YI+                      HQE++++LVDLIG
Sbjct  121  LAGYFSKVVICLLLRKTLPFMQYIKHKYGCNQWCYIRCVSIWIRVNGHQEIVKQLVDLIG  180

Query  650  ITSIME  667
            ITSIME
Sbjct  181  ITSIME  186



>emb|CDX90252.1| BnaA08g17320D [Brassica napus]
Length=800

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD FTLEELLDEDEIIQECK+LNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDGFTLEELLDEDEIIQECKSLNGRLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  D+ EKKRTFKFPF+ACEIFTCE+++ILK LV+D ELM LLFSFLE    H++L
Sbjct  61   YIIEEPLDDVEKKRTFKFPFVACEIFTCEIEMILKTLVEDAELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L GYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  LVGYFSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  165



>ref|XP_010503168.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Camelina sativa]
Length=792

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS ASPVE+ILDKD+FTLEELLDE++IIQEC+ALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLTALSAASPVESILDKDDFTLEELLDEEDIIQECRALNSRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            +IVEE+ ++ + KR FKFPFI+ E+ TCE+D+ILK LVD+EELMNLLFSFLEP R HS +
Sbjct  61   FIVEESPEDADSKRAFKFPFISSEVLTCEIDVILKTLVDEEELMNLLFSFLEPNRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKAHQNVFQQLVDLIGITSIME  165



>emb|CDY22707.1| BnaC08g43410D [Brassica napus]
Length=786

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE+ D+ + KR +KFPFI+CEIFTCE+ +ILK LV+D++LM+LLFSFLEP R HSAL
Sbjct  61   YIVEESPDDADSKRAYKFPFISCEIFTCEIAVILKTLVEDDDLMDLLFSFLEPNRSHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMVRKTAALMNYVKGHQNVFRQLVDLIGITSIME  165



>ref|XP_008655348.1| PREDICTED: uncharacterized protein LOC100384768 isoform X1 [Zea 
mays]
Length=775

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ E+KR+FKFPFIA EIFTCE+D+IL+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YVVEEVPDDAERKRSFKFPFIASEIFTCEIDVILRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLM+Y++ H E++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLVLRKTAPLMSYVQGHPEIVVQLVDLIGITSIME  165



>emb|CDY06292.1| BnaA09g49110D [Brassica napus]
Length=880

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +2

Query  170  TMFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLV  349
             MFW++  LS +SPVETILDK++FTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+
Sbjct  101  AMFWKLTSLSASSPVETILDKESFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLL  160

Query  350  RYIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSA  529
            RYIVEE+ D+ + KR FKFPFI+CEIFTCE+D+ILK+LV+D+ELM+LLFSFLEP R HSA
Sbjct  161  RYIVEESPDDADSKRAFKFPFISCEIFTCEIDVILKSLVEDDELMDLLFSFLEPNRSHSA  220

Query  530  LLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LLAGYFSKVVICL+ RKT  +MNY++ +Q V+R+LVDLIGITSIME
Sbjct  221  LLAGYFSKVVICLMVRKTAAVMNYVKGNQNVLRRLVDLIGITSIME  266



>ref|XP_009109584.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Brassica rapa]
Length=797

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD FTLEELLDEDEIIQECK+LNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDGFTLEELLDEDEIIQECKSLNGRLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  D+ EKKRTFKFPF+ACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPLDDAEKKRTFKFPFVACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L GYFSK VICLL RKT+P M +I+  QE++++LVDLIGITSIME
Sbjct  121  LVGYFSKAVICLLVRKTIPFMQFIKDRQEILKQLVDLIGITSIME  165



>ref|XP_009109582.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Brassica rapa]
Length=799

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD FTLEELLDEDEIIQECK+LNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDGFTLEELLDEDEIIQECKSLNGRLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  D+ EKKRTFKFPF+ACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPLDDAEKKRTFKFPFVACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L GYFSK VICLL RKT+P M +I+  QE++++LVDLIGITSIME
Sbjct  121  LVGYFSKAVICLLVRKTIPFMQFIKDRQEILKQLVDLIGITSIME  165



>ref|XP_009109583.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Brassica rapa]
Length=798

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD FTLEELLDEDEIIQECK+LNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKDGFTLEELLDEDEIIQECKSLNGRLLNFLRERVQVEQLIR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  D+ EKKRTFKFPF+ACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  61   YIIEEPLDDAEKKRTFKFPFVACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L GYFSK VICLL RKT+P M +I+  QE++++LVDLIGITSIME
Sbjct  121  LVGYFSKAVICLLVRKTIPFMQFIKDRQEILKQLVDLIGITSIME  165



>ref|XP_008647473.1| PREDICTED: uncharacterized protein LOC100217253 isoform X3 [Zea 
mays]
Length=696

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QV QL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVSQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  +++EKK++FKFPFIACEIF CE+DIIL+ LV+D ELM+LLFSF++P  PHS L
Sbjct  61   YIVEEVPEDSEKKQSFKFPFIACEIFACEIDIILRTLVEDVELMDLLFSFIKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT PLMNY++ H +++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTAPLMNYVQEHPDIVVQLVDLIGITSIME  165



>ref|XP_010458020.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Camelina sativa]
Length=806

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV E+  + + KR FKFPFI+CEIFTCE+D+ILK LV+DEELM+LLFSFLEP RPHSAL
Sbjct  61   YIVVESPQDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEELMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIME  165



>dbj|BAF01295.1| hypothetical protein [Arabidopsis thaliana]
Length=802

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE ILDK+NFTLEELLDE+EIIQECKALN RLINFLR++++VEQL+R
Sbjct  1    MFWKLTSLSASSPVEIILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKARVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE   + + KR FKFPFI+CEIFTCE+D+ILK LV+DEELMNLLFSFLEP RPHSAL
Sbjct  61   YIVEEPPQDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEELMNLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIME  165



>ref|XP_008647472.1| PREDICTED: uncharacterized protein LOC100217253 isoform X2 [Zea 
mays]
Length=734

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QV QL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVSQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  +++EKK++FKFPFIACEIF CE+DIIL+ LV+D ELM+LLFSF++P  PHS L
Sbjct  61   YIVEEVPEDSEKKQSFKFPFIACEIFACEIDIILRTLVEDVELMDLLFSFIKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT PLMNY++ H +++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTAPLMNYVQEHPDIVVQLVDLIGITSIME  165



>ref|XP_008647471.1| PREDICTED: uncharacterized protein LOC100217253 isoform X1 [Zea 
mays]
Length=735

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR+++QV QL+R
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNTRLINFLRDKAQVSQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  +++EKK++FKFPFIACEIF CE+DIIL+ LV+D ELM+LLFSF++P  PHS L
Sbjct  61   YIVEEVPEDSEKKQSFKFPFIACEIFACEIDIILRTLVEDVELMDLLFSFIKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT PLMNY++ H +++ +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTAPLMNYVQEHPDIVVQLVDLIGITSIME  165



>ref|XP_009148052.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Brassica rapa]
Length=808

 Score =   248 bits (632),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEA-ADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSA  529
            YIVEE+  D  + KR FKFPFI+CE+FTCE+D+ILK LV++EELM+LLFSFLEP RPHSA
Sbjct  61   YIVEESPNDADDSKRAFKFPFISCEVFTCEIDVILKTLVEEEELMDLLFSFLEPSRPHSA  120

Query  530  LLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LLAGYFSKVVICL+ RKT  LMNY++ HQ V+ +LVDLIGITSIME
Sbjct  121  LLAGYFSKVVICLMVRKTAALMNYVKGHQSVLCQLVDLIGITSIME  166



>ref|XP_009148053.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Brassica rapa]
Length=807

 Score =   248 bits (632),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEA-ADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSA  529
            YIVEE+  D  + KR FKFPFI+CE+FTCE+D+ILK LV++EELM+LLFSFLEP RPHSA
Sbjct  61   YIVEESPNDADDSKRAFKFPFISCEVFTCEIDVILKTLVEEEELMDLLFSFLEPSRPHSA  120

Query  530  LLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LLAGYFSKVVICL+ RKT  LMNY++ HQ V+ +LVDLIGITSIME
Sbjct  121  LLAGYFSKVVICLMVRKTAALMNYVKGHQSVLCQLVDLIGITSIME  166



>ref|XP_003594506.1| Serine/threonine protein phosphatase 6 regulatory subunit [Medicago 
truncatula]
Length=794

 Score =   247 bits (631),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 148/178 (83%), Gaps = 13/178 (7%)
 Frame = +2

Query  173  MFWRMAGLSTASPV---ETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQ  343
            MFWRMAGLSTASPV   ETILD+DNFT+EELLDEDEIIQECKALN RLINFL  ++QVEQ
Sbjct  1    MFWRMAGLSTASPVSSVETILDRDNFTMEELLDEDEIIQECKALNSRLINFLSGKAQVEQ  60

Query  344  LVRYIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPH  523
            LVRYIVEEA ++ EKKRTFKFPFIACEIFTCEVD ILK LV+DEELM+LLFSFL+P   H
Sbjct  61   LVRYIVEEAPEDAEKKRTFKFPFIACEIFTCEVDSILKTLVEDEELMSLLFSFLDPNNSH  120

Query  524  SALLAGYFSK----------VVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
              LLAGYFSK          VV+CLL RKT P M Y++ HQE+++KLV+LIGITSIME
Sbjct  121  GNLLAGYFSKVLILIFLKYTVVVCLLLRKTGPFMQYVQAHQEIVKKLVELIGITSIME  178



>ref|XP_008676369.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 2-like [Zea mays]
Length=803

 Score =   247 bits (631),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM GLS ASPV+TILDK+NFTLEELLDEDEIIQECKALN RLINFLR++SQVEQL+ 
Sbjct  1    MFWRMTGLSAASPVDTILDKENFTLEELLDEDEIIQECKALNSRLINFLRDKSQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E+KR+FKFPFIACEIFTCE+D+IL+ LV+DEELM+LLFSF++P  PHS L
Sbjct  61   YILEEVPEDAERKRSFKFPFIACEIFTCEIDVILRTLVEDEELMDLLFSFVKPDHPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L+GYFSKVVICL+ RKT PLM+Y++ H +++ +LVDLIGITSIME
Sbjct  121  LSGYFSKVVICLMLRKTAPLMSYVQGHPKIVVQLVDLIGITSIME  165



>ref|XP_010475582.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Camelina sativa]
 ref|XP_010475584.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Camelina sativa]
Length=802

 Score =   247 bits (631),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV E   + + KR FKFPFI+CEIFTCE+D+ILK LV+DEELM+LLFSFLEP RPHSAL
Sbjct  61   YIVVEPPQDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEELMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIME  165



>ref|XP_010514860.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Camelina sativa]
Length=792

 Score =   247 bits (630),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS ASPVE+ILDK++FTLEELLDE++IIQEC+ALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLTALSAASPVESILDKEDFTLEELLDEEDIIQECRALNSRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            +IVEE+ ++ + KR FKFPFI+ E+ TCE+D+ILK LVD+EELMNLLFSFLEP R HS +
Sbjct  61   FIVEESPEDADSKRAFKFPFISSEVLTCEIDVILKTLVDEEELMNLLFSFLEPNRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKAHQNVFQQLVDLIGITSIME  165



>ref|NP_190105.3| SIT4 phosphatase-associated family protein [Arabidopsis thaliana]
 gb|AEE78002.1| SIT4 phosphatase-associated family protein [Arabidopsis thaliana]
Length=789

 Score =   247 bits (630),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS ASPVE+ILDK++FTLEELLDE++IIQEC+ALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLTALSAASPVESILDKEDFTLEELLDEEDIIQECRALNSRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            +IVEE+ ++ + KR FKFPFI+ E+ TCE+D+ILK LVD+EELMNLLFSFLEP R HS +
Sbjct  61   FIVEESPEDADSKRAFKFPFISSEVLTCEIDVILKTLVDEEELMNLLFSFLEPNRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKAHQNVFQQLVDLIGITSIME  165



>ref|XP_006290616.1| hypothetical protein CARUB_v10016707mg [Capsella rubella]
 gb|EOA23514.1| hypothetical protein CARUB_v10016707mg [Capsella rubella]
Length=792

 Score =   247 bits (630),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS ASPVE+ILDK++FTLEELLDE++IIQEC+ALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLTALSAASPVESILDKEDFTLEELLDEEDIIQECRALNSRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            +IVEE+ ++ + KR FKFPFI+ E+ TCE+D+ILK LVD+EELMNLLFSFLEP R HS +
Sbjct  61   FIVEESPEDADSKRAFKFPFISSEVLTCEIDVILKTLVDEEELMNLLFSFLEPNRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKAHQNVFQQLVDLIGITSIME  165



>ref|XP_002877390.1| SIT4 phosphatase-associated family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH53649.1| SIT4 phosphatase-associated family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=792

 Score =   247 bits (630),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS ASPVE+ILDK++FTLEELLDE++IIQEC+ALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLTALSAASPVESILDKEDFTLEELLDEEDIIQECRALNSRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            +IVEE+ ++ + KR FKFPFI+ E+ TCE+D+ILK LVD+EELMNLLFSFLEP R HS +
Sbjct  61   FIVEESPEDADSKRAFKFPFISSEVLTCEIDVILKTLVDEEELMNLLFSFLEPNRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKAHQNVFQQLVDLIGITSIME  165



>ref|XP_010495852.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Camelina sativa]
Length=792

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS ASPVE+ILDK++FTLEELLDE++IIQEC+ALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLTALSAASPVESILDKEDFTLEELLDEEDIIQECRALNSRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            +IVEE+ ++ + KR FKFPFI+ E+ TCE+D+ILK LVD+EELMNLLFSFLEP R HS +
Sbjct  61   FIVEESPEDADSKRAFKFPFISSEVLTCEIDVILKTLVDEEELMNLLFSFLEPNRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKAHQNVFQQLVDLIGITSIME  165



>ref|XP_010488251.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X2 [Camelina sativa]
Length=802

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV E   + + KR FKFPFI+CEIFTCE+D+ILK LV+DEELM+LLFSFLEP RPHSAL
Sbjct  61   YIVVEPPQDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEELMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIME  165



>ref|XP_010414535.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 1-like isoform X1 [Camelina sativa]
Length=780

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE+ILDKD+FTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLASLSASSPVESILDKDSFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ + KR FKFPFI+CEIFTCE+D+I K LV+DE+LM+LLFSFLEP RPHSAL
Sbjct  61   YVVEEPQDDADSKRAFKFPFISCEIFTCEIDVIFKTLVEDEKLMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVVICL+ RKT  LM+YI+ H  V  +LVDLIGITSIME
Sbjct  121  LAGYFGKVVICLMIRKTAALMSYIKGHGNVFSQLVDLIGITSIME  165



>gb|KFK43115.1| hypothetical protein AALP_AA1G082000, partial [Arabis alpina]
Length=621

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK++FTLEELLDE+EIIQ+CKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKEDFTLEELLDEEEIIQDCKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE+ D+ + KR FKFPFI+CEIFTCE+D+IL+ L +DEELM+LLFSFLEP RPHSAL
Sbjct  61   YIVEESPDDADSKRAFKFPFISCEIFTCEIDVILRTLEEDEELMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RK   LMNY++ H  V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKAAALMNYVKGHPNVFCQLVDLIGITSIME  165



>ref|XP_010488242.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Camelina sativa]
Length=802

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV E   + + KR FKFPFI+CEIFTCE+D+ILK LV+DEELM+LLFSFLEP RPHSAL
Sbjct  61   YIVVEPPQDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEELMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIME  165



>ref|XP_009787317.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Nicotiana sylvestris]
Length=831

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTNLS-CSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  59

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ +    FKFPFIACEIFTCE+D+ILK LVD+EELM+LLFSFLEP RPHSAL
Sbjct  60   YIVEEPSEDADSNWKFKFPFIACEIFTCEIDVILKTLVDEEELMDLLFSFLEPNRPHSAL  119

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++ H +V R++VDLIGITSIME
Sbjct  120  LAGYFSKVVVCLMLRKTIPLMNYVQAHHDVFRQMVDLIGITSIME  164



>ref|XP_006409861.1| hypothetical protein EUTSA_v10016277mg [Eutrema salsugineum]
 gb|ESQ51314.1| hypothetical protein EUTSA_v10016277mg [Eutrema salsugineum]
Length=776

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE+ILDK++FTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLASLSASSPVESILDKEHFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ + KR FKFPFI+CEIFTCE+D+ILK LV+DE+LM+LLF+FLEP RPHSAL
Sbjct  61   YVVEEPQDDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEKLMDLLFAFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVVICL+ RKT  LMNYI+ H+    +LVDLIGITSIME
Sbjct  121  LAGYFGKVVICLMVRKTAALMNYIKGHENFFSQLVDLIGITSIME  165



>ref|XP_009787316.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Nicotiana sylvestris]
Length=841

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTNLS-CSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  59

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ +    FKFPFIACEIFTCE+D+ILK LVD+EELM+LLFSFLEP RPHSAL
Sbjct  60   YIVEEPSEDADSNWKFKFPFIACEIFTCEIDVILKTLVDEEELMDLLFSFLEPNRPHSAL  119

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++ H +V R++VDLIGITSIME
Sbjct  120  LAGYFSKVVVCLMLRKTIPLMNYVQAHHDVFRQMVDLIGITSIME  164



>ref|XP_009787315.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Nicotiana sylvestris]
Length=846

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTNLS-CSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  59

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ +    FKFPFIACEIFTCE+D+ILK LVD+EELM+LLFSFLEP RPHSAL
Sbjct  60   YIVEEPSEDADSNWKFKFPFIACEIFTCEIDVILKTLVDEEELMDLLFSFLEPNRPHSAL  119

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++ H +V R++VDLIGITSIME
Sbjct  120  LAGYFSKVVVCLMLRKTIPLMNYVQAHHDVFRQMVDLIGITSIME  164



>gb|KHG09664.1| Serine/threonine-protein phosphatase 6 regulatory subunit 3 [Gossypium 
arboreum]
Length=827

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  194  LSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVRYIVEEAA  373
            +S +SPVE+ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+RYIVEE +
Sbjct  1    MSASSPVESILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLRYIVEEPS  60

Query  374  DETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSALLAGYFSK  553
            ++ + KRTFKFPFIACEIFTCE+D+ILK L++DEE MNLLFSFLE  R HSALLAGYFSK
Sbjct  61   EDDDSKRTFKFPFIACEIFTCEIDVILKTLIEDEEFMNLLFSFLETNRSHSALLAGYFSK  120

Query  554  VVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            VVICL+ RKT+PLM+Y++THQEV+R+LVDLIGITSIME
Sbjct  121  VVICLMLRKTIPLMHYVQTHQEVLRQLVDLIGITSIME  158



>gb|KDO73307.1| hypothetical protein CISIN_1g0361043mg, partial [Citrus sinensis]
Length=325

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  212  VETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVRYIVEEAADETEKK  391
            VE++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R QVE+L+RYIVEEA  + E K
Sbjct  1    VESVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDREQVEKLLRYIVEEAPADAESK  60

Query  392  RTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSALLAGYFSKVVICLL  571
            + FKFPF+ACEIFTCE+D+ILK LV++EELMNLLFSFLEP RPHSALLAGYFSKVV+CL+
Sbjct  61   QAFKFPFVACEIFTCEIDVILKTLVEEEELMNLLFSFLEPNRPHSALLAGYFSKVVVCLM  120

Query  572  QRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
             RKTVPLMNY++ H +V R+LVDLIGITSIME
Sbjct  121  LRKTVPLMNYVQIHPDVFRRLVDLIGITSIME  152



>ref|XP_006305894.1| hypothetical protein CARUB_v10011058mg [Capsella rubella]
 gb|EOA38792.1| hypothetical protein CARUB_v10011058mg [Capsella rubella]
Length=803

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINF+R+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFVRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV E  ++ + KR FK+PFI+CEIFTCE+D+ILK LV+DEELM+LLFSFLEP RPHSAL
Sbjct  61   YIVVEPPEDADSKRAFKYPFISCEIFTCEIDVILKTLVEDEELMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIME  165



>ref|XP_010510633.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 1-like isoform X2 [Camelina sativa]
Length=778

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE+ILDKD+FTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLASLSASSPVESILDKDSFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ + KR FKFPFI+CEIFTCE+D+I K LV+D++LM+LLFSFLEP RPHSAL
Sbjct  61   YVVEEPQDDADSKRAFKFPFISCEIFTCEIDVIFKTLVEDDKLMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVVICL+ RKT  LM+YI+ H  V  +LVDLIGITSIME
Sbjct  121  LAGYFGKVVICLMIRKTAALMSYIKGHGNVFSQLVDLIGITSIME  165



>gb|KJB20296.1| hypothetical protein B456_003G142400 [Gossypium raimondii]
Length=848

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS + PVE+ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLPSLSASCPVESILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ + KR FKFPFIACE+FTCE+D+ILK L +DEELMNLLFSFL+P RPHSA 
Sbjct  61   YVVEEPPEDADSKRAFKFPFIACEVFTCEIDVILKTLAEDEELMNLLFSFLQPNRPHSAF  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKV ICL+ RK+V LMNYI+ HQ+V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVFICLMLRKSVQLMNYIQVHQDVFHQLVDLIGITSIME  165



>gb|KJB20294.1| hypothetical protein B456_003G142400 [Gossypium raimondii]
 gb|KJB20295.1| hypothetical protein B456_003G142400 [Gossypium raimondii]
Length=847

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS + PVE+ILDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLPSLSASCPVESILDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ + KR FKFPFIACE+FTCE+D+ILK L +DEELMNLLFSFL+P RPHSA 
Sbjct  61   YVVEEPPEDADSKRAFKFPFIACEVFTCEIDVILKTLAEDEELMNLLFSFLQPNRPHSAF  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKV ICL+ RK+V LMNYI+ HQ+V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVFICLMLRKSVQLMNYIQVHQDVFHQLVDLIGITSIME  165



>emb|CDX93601.1| BnaA06g04470D [Brassica napus]
Length=807

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEA-ADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSA  529
            YIVEE   D  + KR FKFPFI+CE+FTCE+D+ILK LV+DEELM+LLFSFLEP R HSA
Sbjct  61   YIVEEPPNDADDSKRAFKFPFISCEVFTCEIDVILKTLVEDEELMDLLFSFLEPSRSHSA  120

Query  530  LLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LLAGYFSKVVICL+ RKT  LMNY++ HQ V+ +LVDLIGITSIME
Sbjct  121  LLAGYFSKVVICLMVRKTAALMNYVKGHQSVLCQLVDLIGITSIME  166



>ref|XP_001775253.1| predicted protein [Physcomitrella patens]
 gb|EDQ59989.1| predicted protein, partial [Physcomitrella patens]
Length=593

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWR++GLST SPVE +LDKD +TLEELLDEDEIIQECKALN RLINF+R ++QV  L+R
Sbjct  1    MFWRISGLSTTSPVEAVLDKDAYTLEELLDEDEIIQECKALNSRLINFMRGKAQVHALLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  +  + KR++KFPFIACEIFTCE+D+I K LV+DEE MN LFSFLE  RPH  L
Sbjct  61   YVVEEPPEGADNKRSYKFPFIACEIFTCEIDVIFKTLVEDEESMNYLFSFLEAGRPHGTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CLL RKTVP+M Y++THQE+++KLVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLLLRKTVPVMQYLQTHQEMLKKLVDLIGITSIME  165



>ref|XP_011089293.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Sesamum indicum]
Length=852

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE +LDK+ FTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+ 
Sbjct  1    MFWKLTALSASSPVEAVLDKETFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+++  ++ + KRTFKFPF+ACEIFTCE+D+ILK LV++EELM+LLFSFLEP R H AL
Sbjct  61   YIIDDPPEDADSKRTFKFPFVACEIFTCEIDVILKTLVEEEELMDLLFSFLEPNRHHGAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT+PLMNY++ HQ+V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTIPLMNYVKAHQDVFKQLVDLIGITSIME  165



>ref|XP_010510632.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Camelina sativa]
Length=780

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE+ILDKD+FTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLASLSASSPVESILDKDSFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ + KR FKFPFI+CEIFTCE+D+I K LV+D++LM+LLFSFLEP RPHSAL
Sbjct  61   YVVEEPQDDADSKRAFKFPFISCEIFTCEIDVIFKTLVEDDKLMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVVICL+ RKT  LM+YI+ H  V  +LVDLIGITSIME
Sbjct  121  LAGYFGKVVICLMIRKTAALMSYIKGHGNVFSQLVDLIGITSIME  165



>ref|XP_011089292.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Sesamum indicum]
Length=853

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE +LDK+ FTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+ 
Sbjct  1    MFWKLTALSASSPVEAVLDKETFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+++  ++ + KRTFKFPF+ACEIFTCE+D+ILK LV++EELM+LLFSFLEP R H AL
Sbjct  61   YIIDDPPEDADSKRTFKFPFVACEIFTCEIDVILKTLVEEEELMDLLFSFLEPNRHHGAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT+PLMNY++ HQ+V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTIPLMNYVKAHQDVFKQLVDLIGITSIME  165



>gb|EMS55914.1| hypothetical protein TRIUR3_26440 [Triticum urartu]
Length=826

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 150/182 (82%), Gaps = 17/182 (9%)
 Frame = +2

Query  173  MFWRMAGLSTASPV-----------------ETILDKDNFTleelldedeIIQECKALNG  301
            MFWRM GLS ASPV                 +TILDK+NFTLEELLDEDEIIQECKALN 
Sbjct  1    MFWRMTGLSAASPVSSLLVAPPIPLRSLRLVDTILDKENFTLEELLDEDEIIQECKALNT  60

Query  302  RLINFLRERSQVEQLVRYIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEEL  481
            RLINFLR+++QVEQL+RY+VEE  D+ EKKR+FKFPFIACEIFTCE+D+IL+ LV+DEEL
Sbjct  61   RLINFLRDKAQVEQLLRYVVEEVPDDAEKKRSFKFPFIACEIFTCEIDVILRTLVEDEEL  120

Query  482  MNLLFSFLEPVRPHSALLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSI  661
            M+LLFSF++P  PHS LL+GYFSKVVICL+ RKT PLMNY++ H E++ +LVDLIGITS+
Sbjct  121  MDLLFSFVKPDHPHSTLLSGYFSKVVICLMLRKTAPLMNYVQEHPEIVVQLVDLIGITSV  180

Query  662  ME  667
            ME
Sbjct  181  ME  182



>ref|XP_006293709.1| hypothetical protein CARUB_v10022667mg [Capsella rubella]
 gb|EOA26607.1| hypothetical protein CARUB_v10022667mg [Capsella rubella]
Length=792

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE+ILDKD+FTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLASLSASSPVESILDKDSFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  ++ + KR FKFPFI+CEIFTCE+D+ILK LV+DE+LM+LLFSFLEP RPHSAL
Sbjct  61   YVVEEPQEDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEKLMDLLFSFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVVICL+ RKT  LM+YI+ H  V  +LVDLIGITSIME
Sbjct  121  LAGYFGKVVICLMIRKTAALMSYIKGHGNVFSQLVDLIGITSIME  165



>emb|CDY32814.1| BnaC08g02360D [Brassica napus]
Length=810

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEA-ADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSA  529
            YIVEE  +D  + KR FKFPFI+CEIFTCE+D+ILK LV+++ELM+LLFSFLEP RPHSA
Sbjct  61   YIVEEPPSDADDSKRAFKFPFISCEIFTCEIDVILKTLVEEDELMDLLFSFLEPNRPHSA  120

Query  530  LLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LLAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LLAGYFSKVVICLMVRKTAALMNYVKGHQNVFCQLVDLIGITSIME  166



>ref|NP_180403.4| SIT4 phosphatase-associated family protein [Arabidopsis thaliana]
 gb|AEC08112.1| SIT4 phosphatase-associated family protein [Arabidopsis thaliana]
Length=788

 Score =   245 bits (625),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE+ILDKD+FTLEELLDE+EIIQECKALN RLINFLRE++QVE+L+R
Sbjct  1    MFWKLASLSASSPVESILDKDSFTLEELLDEEEIIQECKALNSRLINFLREKTQVEKLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ + KR FKFPFI+CEIFTCE+D+ILK LV+DE+LM+LLF FLEP RPHSAL
Sbjct  61   YVVEEPEDDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEKLMDLLFGFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVVICL+ RKT  LM+YI+ H  V  +LVDLIGITSIME
Sbjct  121  LAGYFGKVVICLMIRKTSALMSYIKGHGNVFSQLVDLIGITSIME  165



>ref|XP_006419062.1| hypothetical protein EUTSA_v10002405mg [Eutrema salsugineum]
 gb|ESQ37498.1| hypothetical protein EUTSA_v10002405mg [Eutrema salsugineum]
Length=800

 Score =   244 bits (624),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS ASPVE+ILDK++FTLEELLDE++IIQEC+ALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLTALSAASPVESILDKEDFTLEELLDEEDIIQECRALNSRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            +IVEE+ ++ + KR FKFPFI+ E+ TCE+D+ILK LV++EELMNLLFSFLEP R HS +
Sbjct  61   FIVEESPEDADSKRAFKFPFISSEVLTCEIDVILKTLVEEEELMNLLFSFLEPNRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKAHQNVFQQLVDLIGITSIME  165



>ref|XP_009598804.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Nicotiana tomentosiformis]
Length=834

 Score =   245 bits (625),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTNLS-CSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  59

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ +    FKFPFIACEIFTCE+D+ILK LVD+EELM+LLFSFLEP RPHSAL
Sbjct  60   YIVEEPSEDADSNCKFKFPFIACEIFTCEIDVILKTLVDEEELMDLLFSFLEPNRPHSAL  119

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++ H +V R++VDLIGITSIME
Sbjct  120  LAGYFSKVVVCLMLRKTIPLMNYVQAHHDVFRQMVDLIGITSIME  164



>ref|XP_009598803.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Nicotiana tomentosiformis]
Length=844

 Score =   245 bits (625),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTNLS-CSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  59

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ +    FKFPFIACEIFTCE+D+ILK LVD+EELM+LLFSFLEP RPHSAL
Sbjct  60   YIVEEPSEDADSNCKFKFPFIACEIFTCEIDVILKTLVDEEELMDLLFSFLEPNRPHSAL  119

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++ H +V R++VDLIGITSIME
Sbjct  120  LAGYFSKVVVCLMLRKTIPLMNYVQAHHDVFRQMVDLIGITSIME  164



>ref|XP_010520373.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3 isoform X1 [Tarenaya hassleriana]
Length=788

 Score =   244 bits (623),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW+++ LS ASPVE+ILDK++FTLEELLDE++IIQECKALN RLINFLR R+QVEQL+ 
Sbjct  1    MFWKLSALSAASPVESILDKEDFTLEELLDEEDIIQECKALNSRLINFLRGRTQVEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEAA++ + KR FKFPFI+ E+F CE+D+IL  LV+DEELMNLLFSFLEP R HS +
Sbjct  61   YIVEEAAEDADSKRAFKFPFISSEVFACEIDVILSTLVEDEELMNLLFSFLEPKRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY + HQ V ++LVDLIGIT+IME
Sbjct  121  LAGYFSKVVICLILRKTVPLMNYAKAHQNVFQQLVDLIGITAIME  165



>ref|XP_009598802.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Nicotiana tomentosiformis]
Length=849

 Score =   245 bits (625),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTNLS-CSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  59

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE +++ +    FKFPFIACEIFTCE+D+ILK LVD+EELM+LLFSFLEP RPHSAL
Sbjct  60   YIVEEPSEDADSNCKFKFPFIACEIFTCEIDVILKTLVDEEELMDLLFSFLEPNRPHSAL  119

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++ H +V R++VDLIGITSIME
Sbjct  120  LAGYFSKVVVCLMLRKTIPLMNYVQAHHDVFRQMVDLIGITSIME  164



>dbj|BAJ97543.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=804

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW + GLS ASPV+TILDK+NF LE+LLDEDEIIQECKALN RLINFLR++ QVE L+R
Sbjct  1    MFWHVPGLSAASPVDTILDKENFKLEDLLDEDEIIQECKALNTRLINFLRDKVQVELLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ EKKR F+FPFIACEIF CEVD+ILK LV+DE+LMNLLFSFL+P  PH  L
Sbjct  61   YIVEETPEDAEKKRIFRFPFIACEIFICEVDVILKTLVEDEDLMNLLFSFLKPDHPHGTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVVICL+ RKT+PLMNY+++H E++ +LVDLIGITSIME
Sbjct  121  LAGYFGKVVICLMMRKTLPLMNYVKSHPEIVSQLVDLIGITSIME  165



>ref|XP_010557326.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Tarenaya hassleriana]
Length=801

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVE+ILDK+NFTLEELLDE+EIIQECKALN RLINF+R+R+QVEQL+R
Sbjct  1    MFWKLTALSASSPVESILDKENFTLEELLDEEEIIQECKALNSRLINFIRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE   + + KR FKFPFI+CEIFTCE+D+ILK LV++EELM+LLFSFLEP  PH+AL
Sbjct  61   YIVEEPPQDADSKRAFKFPFISCEIFTCEIDVILKTLVEEEELMDLLFSFLEPNHPHTAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ H+ V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTAALMNYVKGHKNVFGQLVDLIGITSIME  165



>dbj|BAJ92006.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=804

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW + GLS ASPV+TILDK+NF LE+LLDEDEIIQECKALN RLINFLR++ QVE L+R
Sbjct  1    MFWHVPGLSAASPVDTILDKENFKLEDLLDEDEIIQECKALNTRLINFLRDKVQVELLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ EKKR F+FPFIACEIF CEVD+ILK LV+DE+LMNLLFSFL+P  PH  L
Sbjct  61   YIVEETPEDAEKKRIFRFPFIACEIFICEVDVILKTLVEDEDLMNLLFSFLKPDHPHGTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVVICL+ RKT+PLMNY+++H E++ +LVDLIGITSIME
Sbjct  121  LAGYFGKVVICLMMRKTLPLMNYVKSHPEIVSQLVDLIGITSIME  165



>gb|EYU36182.1| hypothetical protein MIMGU_mgv1a001475mg [Erythranthe guttata]
Length=812

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  L+++SPV+++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL++
Sbjct  1    MFWKLTSLASSSPVDSVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ + KRTFKFPF+ACEIFTCE+D+ILK LV++EELMNLLFSFLE   PHSAL
Sbjct  61   YIVEEPPEDADSKRTFKFPFVACEIFTCEIDVILKTLVEEEELMNLLFSFLEFNHPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+ L+ RKT+PLMNY++ H +V+++LVDLIGITSIME
Sbjct  121  LAGYFSKVVVSLMLRKTIPLMNYVKAHPDVLKQLVDLIGITSIME  165



>gb|EYU36183.1| hypothetical protein MIMGU_mgv1a001475mg [Erythranthe guttata]
Length=811

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  L+++SPV+++LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL++
Sbjct  1    MFWKLTSLASSSPVDSVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLQ  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE  ++ + KRTFKFPF+ACEIFTCE+D+ILK LV++EELMNLLFSFLE   PHSAL
Sbjct  61   YIVEEPPEDADSKRTFKFPFVACEIFTCEIDVILKTLVEEEELMNLLFSFLEFNHPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+ L+ RKT+PLMNY++ H +V+++LVDLIGITSIME
Sbjct  121  LAGYFSKVVVSLMLRKTIPLMNYVKAHPDVLKQLVDLIGITSIME  165



>ref|XP_010458019.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Camelina sativa]
Length=807

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEE-LMNLLFSFLEPVRPHSA  529
            YIV E+  + + KR FKFPFI+CEIFTCE+D+ILK LV+DEE LM+LLFSFLEP RPHSA
Sbjct  61   YIVVESPQDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEEQLMDLLFSFLEPNRPHSA  120

Query  530  LLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LLAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  121  LLAGYFSKVVICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIME  166



>ref|XP_010264671.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Nelumbo nucifera]
Length=849

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM  LS +SPVE +LDKDNFTLE+LLDE+EII ECKALN RLINFL +R+Q+EQL+ 
Sbjct  1    MFWRMTALSASSPVEAVLDKDNFTLEDLLDEEEIIHECKALNSRLINFLCDRAQLEQLLC  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ E+KR FKFPFIACEIF CE+D++L  LVD+EELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEAPEDAERKRAFKFPFIACEIFMCEIDVVLNTLVDEEELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV CL+ RKT+PLMNYI+ HQ+   +LVDLIGITSIME
Sbjct  121  LAGYFSKVVACLMLRKTIPLMNYIQVHQDAFCQLVDLIGITSIME  165



>ref|XP_010264673.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X4 [Nelumbo nucifera]
Length=848

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM  LS +SPVE +LDKDNFTLE+LLDE+EII ECKALN RLINFL +R+Q+EQL+ 
Sbjct  1    MFWRMTALSASSPVEAVLDKDNFTLEDLLDEEEIIHECKALNSRLINFLCDRAQLEQLLC  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ E+KR FKFPFIACEIF CE+D++L  LVD+EELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEAPEDAERKRAFKFPFIACEIFMCEIDVVLNTLVDEEELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV CL+ RKT+PLMNYI+ HQ+   +LVDLIGITSIME
Sbjct  121  LAGYFSKVVACLMLRKTIPLMNYIQVHQDAFCQLVDLIGITSIME  165



>ref|XP_010264672.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X3 [Nelumbo nucifera]
Length=849

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM  LS +SPVE +LDKDNFTLE+LLDE+EII ECKALN RLINFL +R+Q+EQL+ 
Sbjct  1    MFWRMTALSASSPVEAVLDKDNFTLEDLLDEEEIIHECKALNSRLINFLCDRAQLEQLLC  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ E+KR FKFPFIACEIF CE+D++L  LVD+EELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEAPEDAERKRAFKFPFIACEIFMCEIDVVLNTLVDEEELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV CL+ RKT+PLMNYI+ HQ+   +LVDLIGITSIME
Sbjct  121  LAGYFSKVVACLMLRKTIPLMNYIQVHQDAFCQLVDLIGITSIME  165



>ref|XP_010264670.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Nelumbo nucifera]
Length=850

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRM  LS +SPVE +LDKDNFTLE+LLDE+EII ECKALN RLINFL +R+Q+EQL+ 
Sbjct  1    MFWRMTALSASSPVEAVLDKDNFTLEDLLDEEEIIHECKALNSRLINFLCDRAQLEQLLC  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ E+KR FKFPFIACEIF CE+D++L  LVD+EELM+LLFSFLEP RPHS L
Sbjct  61   YIVEEAPEDAERKRAFKFPFIACEIFMCEIDVVLNTLVDEEELMDLLFSFLEPNRPHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV CL+ RKT+PLMNYI+ HQ+   +LVDLIGITSIME
Sbjct  121  LAGYFSKVVACLMLRKTIPLMNYIQVHQDAFCQLVDLIGITSIME  165



>ref|XP_009150090.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Brassica rapa]
 ref|XP_009150091.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Brassica rapa]
Length=789

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS ASPVE+ILDK++FTLEELLDE++IIQEC+ALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLTALSAASPVESILDKEDFTLEELLDEEDIIQECRALNSRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            +IVEE+ ++ + KR FKFPFI+ E+ TCE+D+ILK LV++EELM+LLFSFLEP R HS +
Sbjct  61   FIVEESPEDADSKRAFKFPFISSEVLTCEIDVILKTLVEEEELMDLLFSFLEPNRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKAHQNVFQQLVDLIGITSIME  165



>gb|KFK44857.1| hypothetical protein AALP_AA1G311500 [Arabis alpina]
Length=820

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  185  MAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVRYIVE  364
            MAGLSTAS VE ILDKD+FTLEELLDEDEIIQECKALNGRL+NFLRER QVEQL++YI+E
Sbjct  1    MAGLSTASAVEAILDKDSFTLEELLDEDEIIQECKALNGRLLNFLRERVQVEQLIKYIIE  60

Query  365  EAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSALLAGY  544
            E  D+ EKKRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++LLAGY
Sbjct  61   EPLDDVEKKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLETKETHNSLLAGY  120

Query  545  FSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            FSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  FSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  161



>ref|XP_006357565.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Solanum tuberosum]
Length=854

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+RSQ+EQL+ 
Sbjct  1    MFWKLTSLSACSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRSQIEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV+E +++ + KR FKFPF+A EIFTCE+D+ILK LV++EELM LLFSFLEP  PHSAL
Sbjct  61   YIVDEPSEDADSKRKFKFPFLASEIFTCEIDVILKTLVEEEELMKLLFSFLEPSCPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ H +V R++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVQAHHDVFRQMVDLIGITSIME  165



>ref|XP_006357564.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Solanum tuberosum]
Length=855

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+RSQ+EQL+ 
Sbjct  1    MFWKLTSLSACSPVEAVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRSQIEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV+E +++ + KR FKFPF+A EIFTCE+D+ILK LV++EELM LLFSFLEP  PHSAL
Sbjct  61   YIVDEPSEDADSKRKFKFPFLASEIFTCEIDVILKTLVEEEELMKLLFSFLEPSCPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ H +V R++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVQAHHDVFRQMVDLIGITSIME  165



>emb|CDY31030.1| BnaC03g55050D [Brassica napus]
Length=639

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS ASPVE+ILDK++FTLEELLDE++IIQEC+ALN RLINFLRER+QVE+L+R
Sbjct  1    MFWKLTALSAASPVESILDKEDFTLEELLDEEDIIQECRALNSRLINFLRERAQVERLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            +IVEE+ ++ + KR FKFPFI+ E+ TCE+D+ILK LV++EELM+LLFSFLEP R HS +
Sbjct  61   FIVEESPEDADSKRAFKFPFISSEVLTCEIDVILKTLVEEEELMDLLFSFLEPNRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKAHQNVFQQLVDLIGITSIME  165



>emb|CDX99166.1| BnaA06g18570D [Brassica napus]
Length=789

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS ASPVE+ILDK++FTLEELLDE++IIQEC+ALN RLINFLRER+QVEQL+R
Sbjct  1    MFWKLTALSAASPVESILDKEDFTLEELLDEEDIIQECRALNSRLINFLRERAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            +IVEE+ ++ + KR FKFPFI+ E+ TCE+D+ILK LV++EELM+LLFSFLEP R HS +
Sbjct  61   FIVEESPEDADSKRAFKFPFISSEVLTCEIDVILKTLVEEEELMDLLFSFLEPNRSHSVM  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ HQ V ++LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVKAHQNVFQQLVDLIGITSIME  165



>ref|XP_004506011.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-B-like [Cicer arietinum]
Length=852

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  +S +SPVE +LDK+N++LEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLPSISASSPVEAVLDKENYSLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  +  E KR FKFPF+ACEIFTCE+D+ILK LVD+EELMNLLFSFLEP R HS L
Sbjct  61   YIIEEPPNNAENKRVFKFPFMACEIFTCEIDVILKTLVDEEELMNLLFSFLEPDRSHSTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT PL++Y++ HQ V R+LVDLIGITSIME
Sbjct  121  LAGYFSKVVVCLMIRKTGPLISYVQAHQHVFRQLVDLIGITSIME  165



>emb|CDY58827.1| BnaAnng15450D [Brassica napus]
Length=804

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 149/169 (88%), Gaps = 6/169 (4%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINF+R+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFVRDKAQVEQLLR  60

Query  353  YIVEE----AADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRP  520
            YIVEE    AAD++  KR FKFPFI+CEIFTCE+D+ILK LV+++ELM+LLFSFLEP RP
Sbjct  61   YIVEEPPSDAADDS--KRAFKFPFISCEIFTCEIDVILKTLVEEDELMDLLFSFLEPNRP  118

Query  521  HSALLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            HSALLAGYFSKVVICL+ RKT  LMNY++ HQ V  +LVDLIGITSIME
Sbjct  119  HSALLAGYFSKVVICLMVRKTAALMNYVKGHQNVFCQLVDLIGITSIME  167



>ref|XP_008667318.1| PREDICTED: uncharacterized protein LOC100216566 isoform X1 [Zea 
mays]
 tpg|DAA35966.1| TPA: hypothetical protein ZEAMMB73_700256 [Zea mays]
Length=736

 Score =   241 bits (615),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW + GLS ASPV+TILDK+NF LE LLDEDEIIQECKALN RLINFLR++ QVEQL+R
Sbjct  1    MFWHVPGLSAASPVDTILDKENFKLECLLDEDEIIQECKALNTRLINFLRDKVQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EKKR F+FPFIACEIFTCEVD+I+K LV+DE+LMNLLFSFL+P  PH  L
Sbjct  61   YIVEEAPEDAEKKRIFRFPFIACEIFTCEVDVIMKTLVEDEDLMNLLFSFLKPDHPHGTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
             AGYF+KVVICL+ RKT+PL++Y++ H E++ +LVDLIGITSIME
Sbjct  121  SAGYFAKVVICLMIRKTLPLVSYVQGHPEIVSQLVDLIGITSIME  165



>ref|XP_010314884.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X2 [Solanum lycopersicum]
Length=851

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+RSQ+EQL+ 
Sbjct  1    MFWKLTSLSACSPVEAVLDKENFTLEELLDEEEIIQECKALNNRLINFLRDRSQIEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV+E +++ + KR FKFPF+A EIFTCE+D+ILK LV++EELM LLFSFL+P  PHSAL
Sbjct  61   YIVDEPSEDADNKRKFKFPFLASEIFTCEIDVILKTLVEEEELMKLLFSFLKPSCPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ H +V R++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVQAHHDVYRQMVDLIGITSIME  165



>gb|KFK43114.1| hypothetical protein AALP_AA1G081900 [Arabis alpina]
Length=791

 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDKD+FTLEELLDE+EIIQ+C+ALN RLI FLR+R+QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKDDFTLEELLDEEEIIQDCRALNSRLIKFLRDRAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEE+ D+ + KR FKFPFI+CEIFTCE+D ILK L +DEELM+LLFSFL+P RPHSAL
Sbjct  61   YIVEESPDDADSKRAFKFPFISCEIFTCEIDAILKTLEEDEELMDLLFSFLDPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKT  LMNY++ H  V  +LVDLIGITSIME
Sbjct  121  LAGYFSKVVICLMIRKTAALMNYVKGHPNVFCQLVDLIGITSIME  165



>ref|XP_004253228.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Solanum lycopersicum]
Length=852

 Score =   242 bits (618),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+RSQ+EQL+ 
Sbjct  1    MFWKLTSLSACSPVEAVLDKENFTLEELLDEEEIIQECKALNNRLINFLRDRSQIEQLLH  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIV+E +++ + KR FKFPF+A EIFTCE+D+ILK LV++EELM LLFSFL+P  PHSAL
Sbjct  61   YIVDEPSEDADNKRKFKFPFLASEIFTCEIDVILKTLVEEEELMKLLFSFLKPSCPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVVICL+ RKTVPLMNY++ H +V R++VDLIGITSIME
Sbjct  121  LAGYFSKVVICLMLRKTVPLMNYVQAHHDVYRQMVDLIGITSIME  165



>emb|CDY52192.1| BnaAnng11330D [Brassica napus]
Length=444

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 133/165 (81%), Gaps = 15/165 (9%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWRMAGLSTAS VE ILDKD               ECK+LNGRL+NFLRER QVEQL+R
Sbjct  1    MFWRMAGLSTASAVEAILDKD---------------ECKSLNGRLLNFLRERVQVEQLIR  45

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  D+ EKKRTFKFPF+ACEIFTCE+++ILK LV+DEELM LLFSFLE    H++L
Sbjct  46   YIIEEPLDDVEKKRTFKFPFVACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSL  105

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            L GYFSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  106  LVGYFSKVVICLLVRKTIPFMLFIKDHQEILKQLVDLIGITSIME  150



>ref|XP_002890872.1| SIT4 phosphatase-associated family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH67131.1| SIT4 phosphatase-associated family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=816

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  185  MAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVRYIVE  364
            MAGLSTAS VE ILDKD+FTLE+LLDEDEIIQECKALNGRL+NFLRER QVEQL+RYI+E
Sbjct  1    MAGLSTASAVEAILDKDSFTLEDLLDEDEIIQECKALNGRLLNFLRERVQVEQLIRYIIE  60

Query  365  EAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSALLAGY  544
            E  ++ EKKRTFKFPF+ACEIFTCE+++ILK LV+DEELM LLFSFLE    H++LLAGY
Sbjct  61   EPLEDVEKKRTFKFPFVACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSLLAGY  120

Query  545  FSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            FSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  FSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  161



>ref|XP_010470094.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 1-like [Camelina sativa]
Length=781

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE+ILDKD+FTLEELLDE+EIIQECKALN RLI+FLR+R+QVE+L+R
Sbjct  1    MFWKLASLSASSPVESILDKDSFTLEELLDEEEIIQECKALNSRLISFLRDRTQVERLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+VEE  D+ + KR FKFPFI+CEIFTCE+D+I K LV+DE+LM+LLF+FLEP RPHSAL
Sbjct  61   YVVEEPQDDADSKRAFKFPFISCEIFTCEIDVIFKTLVEDEKLMDLLFAFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVVICL+ RKT  LM+YI+ H  V  +LVDLIGITSIME
Sbjct  121  LAGYFGKVVICLMIRKTAALMSYIKGHGNVFSQLVDLIGITSIME  165



>ref|XP_009110912.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Brassica rapa]
Length=804

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 149/169 (88%), Gaps = 6/169 (4%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS +SPVETILDK+NFTLEELLDE+EIIQECKALN RLINF+R+++QVEQL+R
Sbjct  1    MFWKLTSLSASSPVETILDKENFTLEELLDEEEIIQECKALNSRLINFVRDKAQVEQLLR  60

Query  353  YIVEE----AADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRP  520
            YIVEE    AAD++  KR FKFPFI+CEIFTCE+D+ILK LV+++ELM+LLFSFLEP RP
Sbjct  61   YIVEEPPSDAADDS--KRAFKFPFISCEIFTCEIDVILKTLVEEDELMDLLFSFLEPNRP  118

Query  521  HSALLAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            HSALLAGYFSKVVICL+ RKT  LMNY++ H+ V  +LVDLIGITSIME
Sbjct  119  HSALLAGYFSKVVICLMVRKTAALMNYVKGHENVFCQLVDLIGITSIME  167



>ref|XP_003580575.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Brachypodium distachyon]
 ref|XP_010240441.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Brachypodium distachyon]
Length=802

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW + GLS ASPV+TILDK+NF LE+LLDEDEIIQECKALN RLINFLR++ QVE L+R
Sbjct  1    MFWHVPGLSAASPVDTILDKENFKLEDLLDEDEIIQECKALNTRLINFLRDKVQVELLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVEEA ++ EKKR F+FPFIACEIF CEVD+I+K LV+DE+LMNLLFSFL+P  PH  L
Sbjct  61   YIVEEAPEDAEKKRIFRFPFIACEIFICEVDVIMKTLVEDEDLMNLLFSFLKPDHPHGTL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF KVVICL+ RKT+PL+NY++ H E++ +LVDLIGITSIME
Sbjct  121  LAGYFGKVVICLMLRKTLPLVNYVQGHPEIVGQLVDLIGITSIME  165



>ref|XP_006365733.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Solanum tuberosum]
Length=844

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 1/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTHLS-CSPVEEVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  59

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVE  +++ + K  FKFPFIACEIFTCE+D+ILK LVDDEELM+LLFSFLE  RPH AL
Sbjct  60   YIVEVPSEDADSKWKFKFPFIACEIFTCEIDVILKTLVDDEELMDLLFSFLETDRPHCAL  119

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++TH +V R++VDLIGITSIME
Sbjct  120  LAGYFSKVVVCLMLRKTIPLMNYVQTHHDVFRQMVDLIGITSIME  164



>ref|XP_004241276.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like [Solanum lycopersicum]
Length=842

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 1/165 (1%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++  LS  SPVE +LDK+NFTLEELLDE+EIIQECKALN RLINFLR+R+QVEQL+R
Sbjct  1    MFWKLTHLS-CSPVEEVLDKENFTLEELLDEEEIIQECKALNSRLINFLRDRAQVEQLLR  59

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YIVE  +++ + K  FKFPFIACEIFTCE+D+ILK LVDDEELM+LLFSFLE  RPH AL
Sbjct  60   YIVEVPSEDADSKWKFKFPFIACEIFTCEIDVILKTLVDDEELMDLLFSFLETDRPHCAL  119

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYFSKVV+CL+ RKT+PLMNY++TH +V R++VDLIGITSIME
Sbjct  120  LAGYFSKVVVCLMLRKTIPLMNYVQTHHDVFRQMVDLIGITSIME  164



>ref|NP_001185116.1| SIT4 phosphatase-associated family protein [Arabidopsis thaliana]
 gb|AEE31225.1| SIT4 phosphatase-associated family protein [Arabidopsis thaliana]
Length=805

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  185  MAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVRYIVE  364
            MAGLSTAS VE ILDKD+FTLE+LLDEDEIIQECKALNGRL+NFLRE+ QVEQL+RYI+E
Sbjct  1    MAGLSTASAVEAILDKDSFTLEDLLDEDEIIQECKALNGRLLNFLREKVQVEQLIRYIIE  60

Query  365  EAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSALLAGY  544
            E  ++ EKKRTFKFPFIACEIFTCE+++ILK LV+DEELM LLFSFLE    H++LLAGY
Sbjct  61   EPLEDVEKKRTFKFPFIACEIFTCEIEMILKTLVEDEELMLLLFSFLEAKETHNSLLAGY  120

Query  545  FSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            FSKVVICLL RKT+P M +I+ HQE++++LVDLIGITSIME
Sbjct  121  FSKVVICLLVRKTIPFMQFIKDHQEILKQLVDLIGITSIME  161



>ref|XP_010538265.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
subunit 3-like isoform X1 [Tarenaya hassleriana]
Length=749

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFWR+AGLSTASPVETILDK+ FTLEELLDEDEIIQECKALNGRL+NFLRE++QVEQL++
Sbjct  1    MFWRIAGLSTASPVETILDKEGFTLEELLDEDEIIQECKALNGRLLNFLREKTQVEQLIK  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            YI+EE  ++ E KR FKFPFIA EIFTCE+++ILK LV+DEELM LLFSFLE  + H   
Sbjct  61   YIIEEPPEDAENKRMFKFPFIASEIFTCEIEMILKPLVEDEELMILLFSFLESKQAHDTS  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LA YFSKV+ICLL RKTVP M +++ HQE++++LVDLIGITSIME
Sbjct  121  LAAYFSKVIICLLVRKTVPFMQFVKDHQEILKQLVDLIGITSIME  165



>gb|KFK32305.1| hypothetical protein AALP_AA6G225000 [Arabis alpina]
Length=772

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  173  MFWRMAGLSTASPVETILDKDNFTleelldedeIIQECKALNGRLINFLRERSQVEQLVR  352
            MFW++A LS +SPVE+ILDK+NF+LEELLDE+EIIQECKALN RLINFLR+++QVEQL+R
Sbjct  1    MFWKLASLSASSPVESILDKENFSLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR  60

Query  353  YIVEEAADETEKKRTFKFPFIACEIFTCEVDIILKALVDDEELMNLLFSFLEPVRPHSAL  532
            Y+V+E   + + KR FKFPFI+CEIFTCE+D+ILK LV+D+++M+LLF+FLEP RPHSAL
Sbjct  61   YVVQEPHHDADSKRAFKFPFISCEIFTCEIDVILKTLVEDDKMMDLLFTFLEPNRPHSAL  120

Query  533  LAGYFSKVVICLLQRKTVPLMNYIRTHQEVIRKLVDLIGITSIME  667
            LAGYF K+VICLL RKT PL+NYI+ H  V  +L+DLIGITSIME
Sbjct  121  LAGYFGKLVICLLIRKTAPLINYIKGHPNVFSQLIDLIGITSIME  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091433822726