BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7695

Length=849
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007024113.1|  Heat shock protein 91 isoform 2                    412   3e-137   
ref|XP_011072334.1|  PREDICTED: heat shock 70 kDa protein 15-like       420   4e-137   Sesamum indicum [beniseed]
ref|XP_011080863.1|  PREDICTED: heat shock 70 kDa protein 14-like       417   6e-136   Sesamum indicum [beniseed]
ref|XP_007024112.1|  Heat shock protein 91 isoform 1                    414   6e-135   
gb|KJB35057.1|  hypothetical protein B456_006G098500                    407   7e-135   Gossypium raimondii
gb|KHG16619.1|  Heat shock 70 kDa 15 -like protein                      414   7e-135   Gossypium arboreum [tree cotton]
ref|XP_002528199.1|  Heat shock 70 kDa protein, putative                414   8e-135   Ricinus communis
gb|KDO51190.1|  hypothetical protein CISIN_1g003056mg                   410   1e-134   Citrus sinensis [apfelsine]
gb|KJB70511.1|  hypothetical protein B456_011G076800                    409   4e-134   Gossypium raimondii
ref|XP_006389708.1|  hypothetical protein EUTSA_v100181451mg            402   1e-133   
gb|KDO51188.1|  hypothetical protein CISIN_1g003056mg                   410   1e-133   Citrus sinensis [apfelsine]
ref|XP_006427039.1|  hypothetical protein CICLE_v10024883mg             410   1e-133   Citrus clementina [clementine]
gb|KDO51189.1|  hypothetical protein CISIN_1g003056mg                   410   1e-133   Citrus sinensis [apfelsine]
ref|XP_009624163.1|  PREDICTED: heat shock 70 kDa protein 15-like       410   1e-133   Nicotiana tomentosiformis
ref|XP_006465548.1|  PREDICTED: heat shock 70 kDa protein 14-like       410   2e-133   Citrus sinensis [apfelsine]
gb|KJB70509.1|  hypothetical protein B456_011G076800                    410   3e-133   Gossypium raimondii
ref|XP_003546366.1|  PREDICTED: heat shock 70 kDa protein 14-like       410   3e-133   Glycine max [soybeans]
gb|EPS63387.1|  hypothetical protein M569_11394                         395   3e-133   Genlisea aurea
gb|KJB35056.1|  hypothetical protein B456_006G098500                    409   4e-133   Gossypium raimondii
ref|XP_012073334.1|  PREDICTED: heat shock 70 kDa protein 15-like       409   5e-133   Jatropha curcas
gb|KHG16198.1|  Heat shock 70 kDa 15 -like protein                      409   5e-133   Gossypium arboreum [tree cotton]
gb|EYU24689.1|  hypothetical protein MIMGU_mgv1a001324mg                399   2e-132   Erythranthe guttata [common monkey flower]
gb|EYU21549.1|  hypothetical protein MIMGU_mgv1a001311mg                407   3e-132   Erythranthe guttata [common monkey flower]
ref|XP_010538015.1|  PREDICTED: heat shock 70 kDa protein 14            406   5e-132   Tarenaya hassleriana [spider flower]
ref|XP_004252333.1|  PREDICTED: heat shock 70 kDa protein 15-like       406   7e-132   Solanum lycopersicum
ref|XP_009610837.1|  PREDICTED: heat shock 70 kDa protein 14-like...    404   9e-132   Nicotiana tomentosiformis
gb|KHN32604.1|  Heat shock 70 kDa protein 14                            406   1e-131   Glycine soja [wild soybean]
ref|XP_003543647.1|  PREDICTED: heat shock 70 kDa protein 14-like       406   1e-131   Glycine max [soybeans]
ref|XP_007150665.1|  hypothetical protein PHAVU_005G171400g             406   1e-131   Phaseolus vulgaris [French bean]
ref|XP_010539495.1|  PREDICTED: heat shock 70 kDa protein 15-like       405   2e-131   Tarenaya hassleriana [spider flower]
ref|XP_010521527.1|  PREDICTED: heat shock 70 kDa protein 15            404   2e-131   Tarenaya hassleriana [spider flower]
ref|XP_006300740.1|  hypothetical protein CARUB_v10019803mg             404   2e-131   Capsella rubella
ref|XP_002279789.2|  PREDICTED: heat shock 70 kDa protein 14-like       405   2e-131   Vitis vinifera
ref|XP_004252334.1|  PREDICTED: heat shock 70 kDa protein 15-like       405   3e-131   Solanum lycopersicum
ref|XP_010915054.1|  PREDICTED: heat shock 70 kDa protein 14-like       405   3e-131   Elaeis guineensis
ref|XP_010254149.1|  PREDICTED: heat shock 70 kDa protein 15-like       404   3e-131   Nelumbo nucifera [Indian lotus]
ref|XP_010430044.1|  PREDICTED: heat shock 70 kDa protein 15            404   3e-131   
gb|ACF83633.1|  unknown                                                 386   4e-131   Zea mays [maize]
ref|XP_010249783.1|  PREDICTED: heat shock 70 kDa protein 15-like       404   5e-131   Nelumbo nucifera [Indian lotus]
ref|XP_010473008.1|  PREDICTED: heat shock 70 kDa protein 15-like       403   5e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010417777.1|  PREDICTED: heat shock 70 kDa protein 15-like...    403   6e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010417776.1|  PREDICTED: heat shock 70 kDa protein 15-like...    403   6e-131   Camelina sativa [gold-of-pleasure]
ref|XP_010473009.1|  PREDICTED: heat shock 70 kDa protein 15-like       403   6e-131   Camelina sativa [gold-of-pleasure]
ref|XP_009610834.1|  PREDICTED: heat shock 70 kDa protein 15-like...    404   8e-131   Nicotiana tomentosiformis
ref|XP_009801414.1|  PREDICTED: heat shock 70 kDa protein 15-like       403   8e-131   Nicotiana sylvestris
ref|XP_010098045.1|  Heat shock 70 kDa protein 15                       404   8e-131   Morus notabilis
ref|XP_010430043.1|  PREDICTED: heat shock 70 kDa protein 15-like       403   9e-131   Camelina sativa [gold-of-pleasure]
ref|XP_007217050.1|  hypothetical protein PRUPE_ppa001317mg             403   1e-130   Prunus persica
ref|XP_008354138.1|  PREDICTED: heat shock 70 kDa protein 15-like       394   1e-130   
gb|EYU24688.1|  hypothetical protein MIMGU_mgv1a001324mg                402   1e-130   Erythranthe guttata [common monkey flower]
ref|XP_006392781.1|  hypothetical protein EUTSA_v10011242mg             402   2e-130   Eutrema salsugineum [saltwater cress]
emb|CDO98063.1|  unnamed protein product                                403   2e-130   Coffea canephora [robusta coffee]
ref|XP_010925328.1|  PREDICTED: heat shock 70 kDa protein 14-like       402   2e-130   Elaeis guineensis
ref|XP_009587742.1|  PREDICTED: heat shock 70 kDa protein 15-like       402   2e-130   Nicotiana tomentosiformis
emb|CDX76065.1|  BnaA04g03290D                                          401   3e-130   
ref|XP_006346576.1|  PREDICTED: heat shock 70 kDa protein 15-like       402   3e-130   Solanum tuberosum [potatoes]
ref|XP_006287070.1|  hypothetical protein CARUB_v10000229mg             401   3e-130   Capsella rubella
ref|XP_006346577.1|  PREDICTED: heat shock 70 kDa protein 15-like...    402   4e-130   Solanum tuberosum [potatoes]
ref|XP_010691292.1|  PREDICTED: heat shock 70 kDa protein 15-like       402   4e-130   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY43337.1|  BnaC04g25190D                                          403   4e-130   Brassica napus [oilseed rape]
ref|XP_002887853.1|  hypothetical protein ARALYDRAFT_896005             401   5e-130   Arabidopsis lyrata subsp. lyrata
ref|XP_011000832.1|  PREDICTED: heat shock 70 kDa protein 14-like...    399   6e-130   Populus euphratica
ref|XP_009147592.1|  PREDICTED: heat shock 70 kDa protein 14            400   7e-130   Brassica rapa
ref|XP_009139126.1|  PREDICTED: heat shock 70 kDa protein 15            400   1e-129   Brassica rapa
ref|XP_008228510.1|  PREDICTED: heat shock 70 kDa protein 15-like       400   2e-129   Prunus mume [ume]
emb|CDY24089.1|  BnaA06g00870D                                          400   2e-129   Brassica napus [oilseed rape]
ref|XP_002304187.1|  heat shock protein 70                              400   3e-129   Populus trichocarpa [western balsam poplar]
ref|XP_009389931.1|  PREDICTED: heat shock 70 kDa protein 14-like       399   3e-129   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG52244.1|AC011717_12  putative heat-shock protein; 41956-44878     396   3e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011000830.1|  PREDICTED: heat shock 70 kDa protein 15-like...    399   3e-129   Populus euphratica
ref|XP_009388669.1|  PREDICTED: heat shock 70 kDa protein 14-like       398   7e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793460.1|  PREDICTED: heat shock 70 kDa protein 14-like       399   7e-129   Phoenix dactylifera
emb|CDY45119.1|  BnaC06g06400D                                          401   9e-129   Brassica napus [oilseed rape]
ref|NP_850984.4|  Heat shock protein 70                                 397   1e-128   
ref|XP_009408938.1|  PREDICTED: heat shock 70 kDa protein 15-like       398   1e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010033879.1|  PREDICTED: heat shock 70 kDa protein 14-like       398   1e-128   Eucalyptus grandis [rose gum]
gb|AAL38353.1|  putative heat-shock protein                             397   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011013254.1|  PREDICTED: heat shock 70 kDa protein 15-like       398   1e-128   Populus euphratica
ref|NP_178110.6|  Heat shock protein 70                                 397   1e-128   
ref|NP_001031305.1|  heat shock protein 91                              396   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178111.1|  heat shock protein 91                                 396   3e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010033884.1|  PREDICTED: heat shock 70 kDa protein 14-like       397   4e-128   Eucalyptus grandis [rose gum]
ref|XP_008786326.1|  PREDICTED: heat shock 70 kDa protein 15-like       396   7e-128   Phoenix dactylifera
gb|EPS59607.1|  hypothetical protein M569_15197                         385   1e-127   Genlisea aurea
emb|CAA94389.1|  heat-shock protein                                     394   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597778.1|  97 kDa heat shock protein                          394   3e-127   Medicago truncatula
emb|CCM07272.1|  Putative 97 kDa heat shock protein                     394   3e-127   Musa balbisiana [starchy banana]
ref|XP_004506856.1|  PREDICTED: heat shock 70 kDa protein 15-like       394   3e-127   Cicer arietinum [garbanzo]
ref|XP_002299641.1|  heat shock protein 70                              393   7e-127   Populus trichocarpa [western balsam poplar]
ref|XP_002439385.1|  hypothetical protein SORBIDRAFT_09g005580          392   2e-126   Sorghum bicolor [broomcorn]
ref|XP_004506857.1|  PREDICTED: heat shock 70 kDa protein 15-like       392   2e-126   Cicer arietinum [garbanzo]
ref|XP_003529646.1|  PREDICTED: heat shock 70 kDa protein 15-like...    392   2e-126   
ref|XP_006842242.1|  PREDICTED: heat shock 70 kDa protein 14            392   3e-126   Amborella trichopoda
ref|XP_009399777.1|  PREDICTED: heat shock 70 kDa protein 14-like       392   3e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009358190.1|  PREDICTED: heat shock 70 kDa protein 15-like       392   3e-126   Pyrus x bretschneideri [bai li]
ref|XP_008462146.1|  PREDICTED: heat shock 70 kDa protein 15-like       391   4e-126   Cucumis melo [Oriental melon]
ref|XP_009358191.1|  PREDICTED: heat shock 70 kDa protein 15-like       391   5e-126   Pyrus x bretschneideri [bai li]
ref|XP_008654914.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    390   5e-126   
ref|XP_006643833.1|  PREDICTED: heat shock 70 kDa protein 14-like       390   6e-126   Oryza brachyantha
ref|NP_001147805.1|  heat shock 70 kDa protein 4                        390   7e-126   Zea mays [maize]
gb|EAY72790.1|  hypothetical protein OsI_00654                          389   9e-126   Oryza sativa Indica Group [Indian rice]
ref|XP_004141777.1|  PREDICTED: heat shock 70 kDa protein 15-like       390   1e-125   Cucumis sativus [cucumbers]
ref|XP_008775317.1|  PREDICTED: heat shock 70 kDa protein 14-like       390   1e-125   Phoenix dactylifera
ref|NP_001042210.1|  Os01g0180800                                       390   1e-125   
ref|XP_004960855.1|  PREDICTED: heat shock 70 kDa protein 15-like...    389   2e-125   Setaria italica
ref|XP_008647466.1|  PREDICTED: uncharacterized protein LOC100217...    389   3e-125   
ref|XP_008371663.1|  PREDICTED: heat shock 70 kDa protein 15-like       388   6e-125   
ref|XP_003531683.1|  PREDICTED: heat shock 70 kDa protein 14-like...    388   6e-125   Glycine max [soybeans]
ref|XP_008362708.1|  PREDICTED: heat shock 70 kDa protein 15-like       388   6e-125   
ref|XP_010925584.1|  PREDICTED: heat shock 70 kDa protein 14-like       388   8e-125   Elaeis guineensis
ref|XP_004960853.1|  PREDICTED: heat shock 70 kDa protein 14-like...    388   8e-125   Setaria italica
gb|AFW81561.1|  hypothetical protein ZEAMMB73_352123                    379   8e-125   
ref|XP_006585595.1|  PREDICTED: heat shock 70 kDa protein 14-like...    388   9e-125   Glycine max [soybeans]
ref|XP_004960852.1|  PREDICTED: heat shock 70 kDa protein 14-like...    388   2e-124   
ref|XP_010231645.1|  PREDICTED: heat shock 70 kDa protein 14-like       386   3e-124   
gb|KEH28782.1|  heat shock 70 kDa protein                               386   3e-124   Medicago truncatula
gb|EMS61926.1|  Heat shock 70 kDa protein 4L                            385   6e-124   Triticum urartu
ref|XP_002440718.1|  hypothetical protein SORBIDRAFT_09g005570          385   7e-124   Sorghum bicolor [broomcorn]
ref|XP_010231644.1|  PREDICTED: heat shock 70 kDa protein 15-like       385   1e-123   Brachypodium distachyon [annual false brome]
ref|XP_007135698.1|  hypothetical protein PHAVU_010G150800g             385   1e-123   Phaseolus vulgaris [French bean]
ref|XP_004302913.1|  PREDICTED: heat shock 70 kDa protein 15-like       384   2e-123   Fragaria vesca subsp. vesca
gb|EMT31029.1|  Heat shock 70 kDa protein 4L                            384   3e-123   
gb|EMT09857.1|  Heat shock 70 kDa protein 4L                            384   5e-123   
ref|XP_008649434.1|  PREDICTED: heat shock 70 kDa protein 14-like       382   9e-123   Zea mays [maize]
ref|XP_008354139.1|  PREDICTED: heat shock 70 kDa protein 15-like       382   1e-122   
ref|NP_001151579.1|  heat shock 70 kDa protein 4                        382   2e-122   Zea mays [maize]
gb|ACG43420.1|  heat shock 70 kDa protein 4                             382   2e-122   Zea mays [maize]
ref|XP_008655087.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    382   4e-122   Zea mays [maize]
ref|XP_009761607.1|  PREDICTED: heat shock 70 kDa protein 15-like       356   6e-120   Nicotiana sylvestris
gb|AFW77408.1|  hypothetical protein ZEAMMB73_835876                    382   9e-120   
gb|EMS52665.1|  Heat shock 70 kDa protein 4L                            383   1e-119   Triticum urartu
dbj|BAJ90753.1|  predicted protein                                      373   4e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001764380.1|  predicted protein                                  365   2e-116   
ref|XP_001755636.1|  predicted protein                                  363   2e-116   
ref|XP_006654112.1|  PREDICTED: heat shock 70 kDa protein 15-like       363   2e-115   Oryza brachyantha
ref|NP_001054812.1|  Os05g0181000                                       362   7e-115   
gb|EAY96776.1|  hypothetical protein OsI_18700                          362   8e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_001760080.1|  predicted protein                                  359   5e-114   
ref|XP_002986462.1|  hypothetical protein SELMODRAFT_124091             353   3e-112   
ref|XP_002978946.1|  hypothetical protein SELMODRAFT_109750             352   1e-111   
gb|KHN47807.1|  Heat shock 70 kDa protein 14                            316   9e-98    Glycine soja [wild soybean]
ref|XP_008226915.1|  PREDICTED: heat shock 70 kDa protein 16            313   5e-97    Prunus mume [ume]
ref|XP_011030785.1|  PREDICTED: heat shock 70 kDa protein 16-like...    313   8e-97    Populus euphratica
ref|XP_011030786.1|  PREDICTED: heat shock 70 kDa protein 16-like...    313   8e-97    Populus euphratica
ref|XP_007213641.1|  hypothetical protein PRUPE_ppa001697mg             313   9e-97    Prunus persica
ref|XP_008363587.1|  PREDICTED: heat shock 70 kDa protein 16-like       300   1e-96    
ref|XP_002317001.1|  hypothetical protein POPTR_0011s14240g             311   3e-96    Populus trichocarpa [western balsam poplar]
gb|KCW67010.1|  hypothetical protein EUGRSUZ_F00767                     309   4e-96    Eucalyptus grandis [rose gum]
ref|XP_010060358.1|  PREDICTED: heat shock 70 kDa protein 16            310   1e-95    Eucalyptus grandis [rose gum]
ref|XP_008353314.1|  PREDICTED: heat shock 70 kDa protein 16-like       298   2e-95    
ref|XP_004500055.1|  PREDICTED: heat shock 70 kDa protein 16-like       305   7e-94    Cicer arietinum [garbanzo]
gb|AII99893.1|  heat shock protein                                      305   1e-93    Cicer arietinum [garbanzo]
ref|XP_009352450.1|  PREDICTED: heat shock 70 kDa protein 16-like       304   1e-93    Pyrus x bretschneideri [bai li]
gb|AET00484.2|  heat shock 70 kDa protein                               305   1e-93    Medicago truncatula
ref|XP_003617525.1|  97 kDa heat shock protein                          305   2e-93    
gb|ERN19664.1|  hypothetical protein AMTR_s00062p00170870               299   2e-93    Amborella trichopoda
ref|XP_009352433.1|  PREDICTED: heat shock 70 kDa protein 16-like       303   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_003600064.1|  Heat shock 70 kDa protein 4L                       303   3e-93    Medicago truncatula
ref|XP_007020850.1|  Heat shock protein 70 family protein               303   4e-93    
ref|XP_008366399.1|  PREDICTED: heat shock 70 kDa protein 16-like       303   4e-93    
ref|XP_002522946.1|  Heat-shock protein 105 kDa, putative               301   1e-92    
ref|XP_009760615.1|  PREDICTED: heat shock 70 kDa protein 16            301   1e-92    Nicotiana sylvestris
gb|EYU27798.1|  hypothetical protein MIMGU_mgv1a001740mg                300   2e-92    Erythranthe guttata [common monkey flower]
gb|EYU27799.1|  hypothetical protein MIMGU_mgv1a001740mg                301   2e-92    Erythranthe guttata [common monkey flower]
ref|XP_009372708.1|  PREDICTED: heat shock 70 kDa protein 16-like...    300   3e-92    Pyrus x bretschneideri [bai li]
ref|XP_004151979.1|  PREDICTED: heat shock 70 kDa protein 16            301   3e-92    Cucumis sativus [cucumbers]
ref|XP_007020851.1|  Heat shock protein 70 family protein               300   4e-92    
ref|XP_009614255.1|  PREDICTED: heat shock 70 kDa protein 16            300   4e-92    Nicotiana tomentosiformis
ref|XP_012070816.1|  PREDICTED: heat shock 70 kDa protein 16            300   5e-92    Jatropha curcas
ref|XP_010092150.1|  Heat shock 70 kDa protein 16                       300   6e-92    
ref|XP_009372707.1|  PREDICTED: heat shock 70 kDa protein 16-like...    300   7e-92    Pyrus x bretschneideri [bai li]
ref|XP_011628468.1|  PREDICTED: heat shock 70 kDa protein 16            299   1e-91    Amborella trichopoda
ref|XP_008465078.1|  PREDICTED: heat shock 70 kDa protein 16            298   2e-91    Cucumis melo [Oriental melon]
ref|XP_008355346.1|  PREDICTED: heat shock 70 kDa protein 16-like       291   3e-91    
ref|XP_008345050.1|  PREDICTED: heat shock 70 kDa protein 16-like       289   3e-91    
ref|XP_004232717.1|  PREDICTED: heat shock 70 kDa protein 16            297   7e-91    Solanum lycopersicum
gb|KJB69295.1|  hypothetical protein B456_011G014900                    297   8e-91    Gossypium raimondii
ref|XP_010278704.1|  PREDICTED: heat shock 70 kDa protein 16            296   2e-90    Nelumbo nucifera [Indian lotus]
gb|AII99889.1|  heat shock protein                                      296   3e-90    Cicer arietinum [garbanzo]
ref|XP_004491392.1|  PREDICTED: heat shock 70 kDa protein 16-like       295   3e-90    Cicer arietinum [garbanzo]
gb|KJB22069.1|  hypothetical protein B456_004G027900                    293   7e-90    Gossypium raimondii
ref|XP_010931798.1|  PREDICTED: heat shock 70 kDa protein 16            294   1e-89    Elaeis guineensis
ref|XP_004294376.1|  PREDICTED: heat shock 70 kDa protein 16            293   2e-89    Fragaria vesca subsp. vesca
ref|XP_006348107.1|  PREDICTED: heat shock 70 kDa protein 16-like...    292   3e-89    Solanum tuberosum [potatoes]
ref|XP_002278262.1|  PREDICTED: heat shock 70 kDa protein 16            293   3e-89    Vitis vinifera
ref|XP_011096072.1|  PREDICTED: heat shock 70 kDa protein 16            292   4e-89    Sesamum indicum [beniseed]
gb|KHG25442.1|  Heat shock 70 kDa 16 -like protein                      291   9e-89    Gossypium arboreum [tree cotton]
ref|XP_003553093.1|  PREDICTED: heat shock 70 kDa protein 16-like       291   9e-89    Glycine max [soybeans]
gb|KJB22068.1|  hypothetical protein B456_004G027900                    291   1e-88    Gossypium raimondii
gb|KHN45217.1|  Heat shock 70 kDa protein 16                            291   1e-88    Glycine soja [wild soybean]
ref|XP_002305580.2|  hypothetical protein POPTR_0004s01640g             290   3e-88    
ref|XP_011037663.1|  PREDICTED: heat shock 70 kDa protein 16            290   4e-88    Populus euphratica
ref|XP_007146461.1|  hypothetical protein PHAVU_006G042400g             290   4e-88    Phaseolus vulgaris [French bean]
ref|XP_008806739.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    290   6e-88    Phoenix dactylifera
ref|XP_008806738.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    290   7e-88    Phoenix dactylifera
ref|XP_006306833.1|  hypothetical protein CARUB_v10008380mg             287   3e-87    
gb|KHM99573.1|  Heat shock 70 kDa protein 16                            288   3e-87    Glycine soja [wild soybean]
ref|XP_003532123.1|  PREDICTED: heat shock 70 kDa protein 16-like       287   4e-87    Glycine max [soybeans]
ref|XP_006306834.1|  hypothetical protein CARUB_v10008380mg             287   5e-87    Capsella rubella
emb|CDP04389.1|  unnamed protein product                                286   6e-87    Coffea canephora [robusta coffee]
gb|KDO75458.1|  hypothetical protein CISIN_1g004211mg                   283   3e-86    Citrus sinensis [apfelsine]
ref|XP_006475182.1|  PREDICTED: heat shock 70 kDa protein 16-like...    283   3e-86    
ref|XP_006452327.1|  hypothetical protein CICLE_v10007538mg             283   1e-85    Citrus clementina [clementine]
ref|XP_006468028.1|  PREDICTED: heat shock 70 kDa protein 16-like       283   1e-85    Citrus sinensis [apfelsine]
ref|XP_006595737.1|  PREDICTED: heat shock 70 kDa protein 16-like...    283   2e-85    Glycine max [soybeans]
ref|XP_002889885.1|  hypothetical protein ARALYDRAFT_888478             282   4e-85    
ref|XP_006595736.1|  PREDICTED: heat shock 70 kDa protein 16-like...    283   4e-85    Glycine max [soybeans]
ref|XP_010665569.1|  PREDICTED: heat shock 70 kDa protein 16            282   4e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010493114.1|  PREDICTED: heat shock 70 kDa protein 16-like       281   5e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010476099.1|  PREDICTED: heat shock 70 kDa protein 16            281   6e-85    Camelina sativa [gold-of-pleasure]
ref|NP_172631.2|  heat shock protein 70 (Hsp 70) family protein         281   1e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458573.1|  PREDICTED: heat shock 70 kDa protein 16-like       280   1e-84    Camelina sativa [gold-of-pleasure]
emb|CDY49794.1|  BnaCnng18070D                                          278   1e-83    Brassica napus [oilseed rape]
ref|XP_006417329.1|  hypothetical protein EUTSA_v10006883mg             278   1e-83    Eutrema salsugineum [saltwater cress]
ref|XP_007142282.1|  hypothetical protein PHAVU_008G267400g             276   4e-83    Phaseolus vulgaris [French bean]
ref|XP_009148495.1|  PREDICTED: heat shock 70 kDa protein 16            276   5e-83    Brassica rapa
emb|CDX97975.1|  BnaA06g07260D                                          276   5e-83    
ref|XP_008365284.1|  PREDICTED: heat shock 70 kDa protein 16            274   7e-83    
ref|XP_010533816.1|  PREDICTED: heat shock 70 kDa protein 16            269   3e-80    Tarenaya hassleriana [spider flower]
gb|EPS74057.1|  hypothetical protein M569_00693                         265   4e-79    Genlisea aurea
ref|XP_003082170.1|  heat shock protein 91-Arabidopsis thaliana (...    263   9e-78    
emb|CEF99759.1|  Heat shock protein 70 family                           263   1e-77    Ostreococcus tauri
ref|XP_009420545.1|  PREDICTED: heat shock 70 kDa protein 16            262   1e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001695858.1|  heat shock protein 70E                             261   3e-77    Chlamydomonas reinhardtii
ref|XP_002949519.1|  heat shock protein Hsp70E                          258   7e-76    Volvox carteri f. nagariensis
ref|XP_006449032.1|  hypothetical protein CICLE_v10014383mg             254   1e-75    
ref|XP_006449031.1|  hypothetical protein CICLE_v10014383mg             254   7e-75    
ref|XP_002505210.1|  heat shock protein 70                              252   1e-73    Micromonas commoda
emb|CBI36157.3|  unnamed protein product                                251   3e-73    Vitis vinifera
ref|XP_005642775.1|  heat shock protein 70E                             250   5e-73    Coccomyxa subellipsoidea C-169
ref|XP_002973871.1|  hypothetical protein SELMODRAFT_267697             244   6e-71    
ref|XP_002969191.1|  hypothetical protein SELMODRAFT_440676             243   9e-71    
ref|XP_003060408.1|  heat shock protein 70                              243   2e-70    Micromonas pusilla CCMP1545
ref|XP_001641799.1|  predicted protein                                  242   6e-70    Nematostella vectensis
ref|XP_002585532.1|  hypothetical protein BRAFLDRAFT_111895             228   4e-68    Branchiostoma floridae
ref|XP_011663241.1|  PREDICTED: 97 kDa heat shock protein isoform X1    237   6e-68    Strongylocentrotus purpuratus [purple urchin]
ref|NP_999695.1|  97 kDa heat shock protein                             237   6e-68    Strongylocentrotus purpuratus [purple urchin]
sp|Q06068.2|HSP97_STRPU  RecName: Full=97 kDa heat shock protein;...    237   7e-68    Strongylocentrotus purpuratus [purple urchin]
sp|Q94738.1|HSP97_STRFN  RecName: Full=97 kDa heat shock protein;...    237   8e-68    Mesocentrotus franciscanus
ref|XP_012138186.1|  PREDICTED: 97 kDa heat shock protein isoform X2    234   5e-67    Megachile rotundata
ref|XP_003702344.1|  PREDICTED: 97 kDa heat shock protein isoform X1    234   6e-67    Megachile rotundata
ref|XP_006615729.1|  PREDICTED: 97 kDa heat shock protein-like is...    233   1e-66    Apis dorsata [rock honeybee]
ref|XP_006561225.1|  PREDICTED: 97 kDa heat shock protein isoform X2    233   2e-66    Apis mellifera [bee]
ref|XP_003691374.1|  PREDICTED: heat shock 70 kDa protein 4L-like       233   2e-66    Apis florea [dwarf honeybee]
ref|XP_005846866.1|  hypothetical protein CHLNCDRAFT_35731              233   2e-66    Chlorella variabilis
ref|XP_623199.2|  PREDICTED: 97 kDa heat shock protein isoformX1        233   2e-66    Apis mellifera [bee]
ref|XP_006615728.1|  PREDICTED: 97 kDa heat shock protein-like is...    233   2e-66    Apis dorsata [rock honeybee]
gb|AFG63451.1|  hypothetical protein UMN_2640_01                        214   2e-66    Pinus taeda
ref|XP_011304595.1|  PREDICTED: 97 kDa heat shock protein isoform X2    232   2e-66    Fopius arisanus
ref|XP_011304586.1|  PREDICTED: 97 kDa heat shock protein isoform X1    232   3e-66    Fopius arisanus
ref|XP_003485911.1|  PREDICTED: heat shock 70 kDa protein 4L-like       232   5e-66    Bombus impatiens
gb|KJE91467.1|  hsp97-like protein                                      230   9e-66    Capsaspora owczarzaki ATCC 30864
ref|XP_011399703.1|  97 kDa heat shock protein                          227   1e-65    Auxenochlorella protothecoides
ref|XP_003394081.1|  PREDICTED: heat shock 70 kDa protein 4L-like       230   1e-65    Bombus terrestris [large earth bumblebee]
ref|XP_004349347.1|  hsp97-like protein                                 229   2e-65    Capsaspora owczarzaki ATCC 30864
ref|XP_011162513.1|  PREDICTED: 97 kDa heat shock protein isoform X2    229   4e-65    Solenopsis invicta [imported red fire ant]
ref|XP_011162512.1|  PREDICTED: 97 kDa heat shock protein isoform X1    229   4e-65    Solenopsis invicta [imported red fire ant]
ref|XP_011685266.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    228   5e-65    Wasmannia auropunctata
ref|XP_011685265.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    229   6e-65    Wasmannia auropunctata
ref|XP_011052836.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    229   6e-65    Acromyrmex echinatior
ref|XP_011052837.1|  PREDICTED: 97 kDa heat shock protein isoform X2    228   6e-65    Acromyrmex echinatior
ref|XP_012059400.1|  PREDICTED: 97 kDa heat shock protein               228   7e-65    Atta cephalotes
ref|XP_002585896.1|  hypothetical protein BRAFLDRAFT_256670             227   8e-65    Branchiostoma floridae
ref|XP_011641018.1|  PREDICTED: 97 kDa heat shock protein isoform X2    228   1e-64    Pogonomyrmex barbatus
ref|XP_011256245.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    228   1e-64    Camponotus floridanus
ref|XP_011641017.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    228   1e-64    Pogonomyrmex barbatus
ref|XP_011256244.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    228   1e-64    Camponotus floridanus
gb|EHJ64651.1|  hypothetical protein KGM_00738                          226   2e-64    
ref|XP_011870503.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    226   3e-64    Vollenhovia emeryi
ref|XP_011870502.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    227   3e-64    Vollenhovia emeryi
ref|XP_008557094.1|  PREDICTED: 97 kDa heat shock protein isoform X2    225   8e-64    
ref|XP_008557093.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    225   9e-64    Microplitis demolitor
ref|XP_011154271.1|  PREDICTED: heat shock 70 kDa protein 4L            225   1e-63    Harpegnathos saltator
gb|AEB26316.1|  heat shock protein 105                                  224   1e-63    Helicoverpa armigera [American bollworm]
ref|XP_002431004.1|  Heat-shock protein 105 kDa, putative               224   1e-63    Pediculus humanus corporis [human body lice]
ref|XP_011497941.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    223   5e-63    Ceratosolen solmsi marchali
ref|XP_011497950.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    223   5e-63    Ceratosolen solmsi marchali
ref|XP_004927888.1|  PREDICTED: 97 kDa heat shock protein-like          223   5e-63    Bombyx mori [silk moth]
gb|KFM56735.1|  heat shock protein                                      222   8e-63    Stegodyphus mimosarum
ref|XP_008191929.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    222   9e-63    
ref|XP_008191928.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    222   9e-63    
ref|XP_006003281.1|  PREDICTED: heat shock 70 kDa protein 4             221   1e-62    
ref|XP_011339673.1|  PREDICTED: 97 kDa heat shock protein isoform X2    221   3e-62    
ref|XP_011339672.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    221   3e-62    
ref|XP_005177158.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    220   4e-62    
ref|XP_005177155.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    220   5e-62    
gb|ELT92200.1|  hypothetical protein CAPTEDRAFT_221226                  220   7e-62    
dbj|BAC35620.1|  unnamed protein product                                206   3e-61    
gb|KDR19282.1|  Heat shock 70 kDa protein 4L                            218   5e-61    
ref|XP_005837933.1|  hypothetical protein GUITHDRAFT_103535             216   2e-60    
gb|ADG37835.1|  AT1G11660-like protein                                  201   3e-60    
gb|ADG37836.1|  AT1G11660-like protein                                  201   3e-60    
gb|ADG37833.1|  AT1G11660-like protein                                  201   4e-60    
ref|XP_008202915.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    215   4e-60    
ref|XP_008469279.1|  PREDICTED: heat shock protein 105 kDa-like         209   4e-60    
ref|XP_008202916.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    214   5e-60    
gb|ERL85506.1|  hypothetical protein D910_02925                         214   5e-60    
gb|ENN79035.1|  hypothetical protein YQE_04502                          214   5e-60    
gb|ADG37834.1|  AT1G11660-like protein                                  201   5e-60    
gb|EDM04372.1|  heat shock protein 4, isoform CRA_a                     205   9e-60    
gb|EDL33602.1|  heat shock protein 4, isoform CRA_b                     206   1e-59    
dbj|BAK07442.1|  predicted protein                                      213   1e-59    
ref|XP_005242837.1|  PREDICTED: heat shock 70 kDa protein 4             213   2e-59    
ref|XP_011190138.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    213   2e-59    
ref|XP_011190144.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    213   2e-59    
gb|KFH64507.1|  heat shock 70kDa protein 4                              212   2e-59    
ref|XP_004519098.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    212   3e-59    
ref|XP_004519096.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    212   4e-59    
ref|XP_001951792.1|  PREDICTED: heat shock 70 kDa protein 4             212   4e-59    
gb|AAH60431.1|  LOC398863 protein                                       203   4e-59    
ref|XP_011199483.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    212   5e-59    
ref|XP_002021371.1|  GL25289                                            209   5e-59    
gb|AEN80781.1|  AT1G11660-like protein                                  198   6e-59    
gb|AEN80776.1|  AT1G11660-like protein                                  197   6e-59    
ref|XP_011199479.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    211   6e-59    
gb|ADG37832.1|  AT1G11660-like protein                                  197   7e-59    
gb|KCW67009.1|  hypothetical protein EUGRSUZ_F00767                     210   9e-59    
emb|CDY32364.1|  BnaC01g36830D                                          201   1e-58    
gb|AEN80778.1|  AT1G11660-like protein                                  197   1e-58    
ref|XP_009015511.1|  hypothetical protein HELRODRAFT_106017             211   1e-58    
gb|AAH41515.1|  Hspa4 protein                                           202   1e-58    
ref|XP_005523757.1|  PREDICTED: heat shock 70 kDa protein 4             211   1e-58    
gb|EDM04373.1|  heat shock protein 4, isoform CRA_b                     205   1e-58    
emb|CAA47886.1|  HS24/P52                                               205   1e-58    
ref|XP_001366416.1|  PREDICTED: heat shock 70 kDa protein 4             210   2e-58    
gb|KFB38249.1|  AGAP010331-PA-like protein                              210   2e-58    
ref|XP_002193589.1|  PREDICTED: heat shock 70 kDa protein 4             210   2e-58    
ref|XP_010577101.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    210   2e-58    
emb|CDH59379.1|  heat shock protein                                     209   3e-58    
dbj|GAN04884.1|  heat shock protein                                     209   3e-58    
gb|KFQ96406.1|  Heat shock 70 kDa protein 4                             210   3e-58    
ref|XP_009462627.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   3e-58    
ref|XP_011569419.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    210   3e-58    
gb|KFQ04337.1|  Heat shock 70 kDa protein 4                             210   3e-58    
ref|XP_009462626.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    210   3e-58    
ref|XP_009959027.1|  PREDICTED: heat shock 70 kDa protein 4             209   3e-58    
ref|XP_005512494.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   3e-58    
ref|XP_007461413.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   3e-58    
ref|XP_004338433.1|  HSP91 (Heat shock protein 91), putative            209   3e-58    
gb|ADG37837.1|  AT1G11660-like protein                                  196   3e-58    
ref|XP_006065134.1|  PREDICTED: heat shock 70 kDa protein 4-like        209   3e-58    
ref|XP_007461414.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   3e-58    
gb|ETN61435.1|  Hsc70Cb                                                 209   3e-58    
ref|XP_009900615.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   4e-58    
ref|XP_004420257.1|  PREDICTED: heat shock 70 kDa protein 4             209   4e-58    
ref|XP_005147344.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    209   4e-58    
ref|XP_005053752.1|  PREDICTED: heat shock 70 kDa protein 4             209   4e-58    
gb|KFV68743.1|  Heat shock 70 kDa protein 4                             209   4e-58    
ref|XP_009900614.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   4e-58    
gb|KFO70037.1|  Heat shock 70 kDa protein 4                             209   4e-58    
ref|XP_004408329.1|  PREDICTED: heat shock 70 kDa protein 4             209   4e-58    
ref|XP_006734733.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   5e-58    
ref|XP_001956442.1|  GF24591                                            209   5e-58    
ref|XP_001984264.1|  GH15106                                            209   5e-58    
ref|XP_009089808.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   5e-58    
ref|XP_005890481.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   5e-58    
ref|XP_004456539.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   5e-58    
ref|XP_004456538.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   5e-58    
gb|ELR60264.1|  Heat shock 70 kDa protein 4                             209   6e-58    
ref|NP_001107664.1|  heat shock 70 kDa protein 4                        209   6e-58    
ref|XP_009089807.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   6e-58    
ref|XP_006734734.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   6e-58    
ref|XP_004745039.1|  PREDICTED: heat shock 70 kDa protein 4             209   6e-58    
ref|XP_010588220.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   6e-58    
ref|XP_004384781.1|  PREDICTED: heat shock 70 kDa protein 4             209   6e-58    
ref|XP_003405063.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   6e-58    
ref|XP_009089806.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   7e-58    
ref|XP_009560733.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    208   7e-58    
ref|XP_003980811.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   7e-58    
ref|XP_009560725.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    209   7e-58    
ref|XP_001353537.2|  GA19716                                            209   7e-58    
ref|XP_006923201.1|  PREDICTED: heat shock 70 kDa protein 4             208   8e-58    
ref|XP_004686775.1|  PREDICTED: heat shock 70 kDa protein 4             208   8e-58    
ref|NP_001041481.1|  heat shock 70 kDa protein 4                        208   8e-58    
ref|XP_002030454.1|  GM25449                                            208   8e-58    
ref|XP_005661711.1|  PREDICTED: heat shock 70 kDa protein 4             208   8e-58    
ref|XP_005819695.1|  hypothetical protein GUITHDRAFT_166641             208   8e-58    
ref|NP_648687.1|  Hsc70Cb, isoform A                                    208   9e-58    
ref|XP_004279965.1|  PREDICTED: heat shock 70 kDa protein 4             208   9e-58    
ref|XP_006212876.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    208   9e-58    
ref|XP_007106344.1|  PREDICTED: heat shock 70 kDa protein 4             208   9e-58    
ref|XP_006179671.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    208   9e-58    
ref|NP_001189103.1|  Hsc70Cb, isoform G                                 208   9e-58    
emb|CDS10615.1|  hypothetical protein LRAMOSA11101                      208   9e-58    
ref|XP_008140583.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    208   1e-57    
ref|XP_008140572.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    208   1e-57    
ref|XP_006179670.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    208   1e-57    
ref|XP_006759201.1|  PREDICTED: heat shock 70 kDa protein 4             208   1e-57    
ref|XP_008140579.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    208   1e-57    
ref|XP_004896768.1|  PREDICTED: heat shock 70 kDa protein 4             208   1e-57    
ref|XP_006212875.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    208   1e-57    
ref|XP_002048046.1|  GJ13748                                            208   1e-57    
gb|AAA02807.1|  heat shock protein 70                                   207   1e-57    
ref|XP_005493118.1|  PREDICTED: heat shock 70 kDa protein 4             207   1e-57    
ref|XP_005991355.1|  PREDICTED: heat shock 70 kDa protein 4L            207   1e-57    
emb|CDS05536.1|  hypothetical protein LRAMOSA08064                      207   1e-57    
gb|EPB87687.1|  heat shock 70kDa protein 4                              207   1e-57    
ref|XP_005865616.1|  PREDICTED: heat shock 70 kDa protein 4             207   2e-57    
ref|XP_007188635.1|  PREDICTED: heat shock 70 kDa protein 4             207   2e-57    
ref|XP_007519978.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    207   2e-57    
gb|ESA07580.1|  hypothetical protein GLOINDRAFT_349426                  207   2e-57    
ref|XP_007519977.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    207   2e-57    
ref|XP_001972702.1|  GG15669                                            207   2e-57    
ref|XP_008536519.1|  PREDICTED: heat shock 70 kDa protein 4             207   2e-57    
emb|CCL98188.1|  predicted protein                                      207   2e-57    
ref|XP_006872974.1|  PREDICTED: heat shock 70 kDa protein 4             207   2e-57    
ref|XP_006166926.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    207   3e-57    
ref|XP_005302898.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    207   3e-57    
ref|XP_007941941.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    207   3e-57    
ref|XP_002168044.1|  PREDICTED: heat shock protein 105 kDa-like         207   3e-57    
ref|XP_001918259.1|  PREDICTED: heat shock 70 kDa protein 4             207   3e-57    
ref|XP_006888134.1|  PREDICTED: heat shock 70 kDa protein 4-like        207   3e-57    
ref|XP_007941939.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    207   3e-57    
ref|XP_005067971.1|  PREDICTED: heat shock 70 kDa protein 4             206   4e-57    
ref|XP_007941940.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    206   4e-57    
ref|XP_414655.2|  PREDICTED: heat shock 70 kDa protein 4 isoformX2      206   4e-57    
dbj|BAD92388.1|  heat shock 70kDa protein 4 isoform a variant           206   5e-57    
gb|EDL33604.1|  heat shock protein 4, isoform CRA_d                     206   5e-57    
ref|XP_002061724.1|  GK17034                                            206   5e-57    
ref|XP_005376179.1|  PREDICTED: heat shock 70 kDa protein 4             206   5e-57    
ref|XP_008689839.1|  PREDICTED: heat shock 70 kDa protein 4             206   5e-57    
gb|KHN76490.1|  Uncharacterized protein C30C11.4                        204   5e-57    
ref|XP_004042548.1|  PREDICTED: heat shock 70 kDa protein 4             206   5e-57    
ref|XP_003464555.1|  PREDICTED: heat shock 70 kDa protein 4             206   5e-57    
gb|EDL33603.1|  heat shock protein 4, isoform CRA_c                     206   5e-57    
ref|XP_003738350.1|  PREDICTED: heat shock 70 kDa protein 4-like        206   5e-57    
ref|XP_004629409.1|  PREDICTED: heat shock 70 kDa protein 4             206   6e-57    
ref|NP_001125029.1|  heat shock 70 kDa protein 4                        206   6e-57    
ref|XP_005350156.1|  PREDICTED: heat shock 70 kDa protein 4             206   6e-57    
ref|NP_032326.3|  heat shock 70 kDa protein 4                           206   6e-57    
gb|EAW62295.1|  heat shock 70kDa protein 4, isoform CRA_b               206   6e-57    
sp|Q61316.1|HSP74_MOUSE  RecName: Full=Heat shock 70 kDa protein ...    206   6e-57    
gb|AAH03770.1|  Heat shock protein 4                                    206   6e-57    
ref|XP_003782375.1|  PREDICTED: heat shock 70 kDa protein 4             206   7e-57    
ref|XP_011806489.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    206   7e-57    
ref|XP_008398286.1|  PREDICTED: heat shock 70 kDa protein 4L            206   7e-57    
ref|NP_002145.3|  heat shock 70 kDa protein 4                           206   7e-57    
dbj|BAD90352.1|  mKIAA4025 protein                                      206   7e-57    
ref|XP_001106903.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    206   7e-57    
ref|XP_004666571.1|  PREDICTED: heat shock 70 kDa protein 4             206   7e-57    
ref|XP_008952902.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    206   8e-57    
ref|XP_008050650.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    206   8e-57    
ref|XP_008050645.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    206   8e-57    
ref|XP_006995942.1|  PREDICTED: heat shock 70 kDa protein 4             206   8e-57    
ref|XP_004586680.1|  PREDICTED: heat shock 70 kDa protein 4             206   8e-57    
ref|XP_008012600.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    206   8e-57    
ref|XP_003829335.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    206   8e-57    
ref|XP_011715037.1|  PREDICTED: heat shock 70 kDa protein 4             205   8e-57    
dbj|BAA75062.1|  apg-2                                                  206   8e-57    
ref|XP_003900145.1|  PREDICTED: heat shock 70 kDa protein 4             206   8e-57    
ref|XP_517930.2|  PREDICTED: heat shock 70 kDa protein 4                206   8e-57    
ref|XP_001106968.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    206   8e-57    
ref|XP_004008844.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    206   9e-57    
ref|XP_011971434.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    206   9e-57    
ref|XP_002804557.1|  PREDICTED: heat shock 70 kDa protein 4-like        205   9e-57    
ref|NP_705893.1|  heat shock 70 kDa protein 4                           205   9e-57    
ref|XP_005682987.1|  PREDICTED: heat shock 70 kDa protein 4             205   9e-57    
ref|XP_003920639.1|  PREDICTED: heat shock 70 kDa protein 4             205   1e-56    
ref|XP_002094757.1|  GE21998                                            205   1e-56    
ref|XP_006246294.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    205   1e-56    
emb|CAB38172.2|  heatshock protein cognate 70Cb                         205   1e-56    
gb|AGO01983.1|  heat shock 70kDa protein 4b                             205   1e-56    
ref|XP_002401154.1|  heat shock protein, putative                       205   1e-56    
gb|ETS60751.1|  hypothetical protein PaG_04658                          206   1e-56    
ref|XP_008588473.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    205   1e-56    
ref|XP_008588472.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    205   1e-56    
ref|XP_004609917.1|  PREDICTED: heat shock 70 kDa protein 4             205   1e-56    
emb|CEP19347.1|  hypothetical protein                                   204   1e-56    
ref|XP_002008922.1|  GI13757                                            205   1e-56    
ref|XP_010358263.1|  PREDICTED: heat shock 70 kDa protein 4             205   2e-56    
ref|XP_002744639.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    205   2e-56    
ref|XP_005944289.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    204   2e-56    
ref|XP_008989525.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    204   2e-56    
ref|XP_009547862.1|  hypothetical protein HETIRDRAFT_385937             204   2e-56    
dbj|GAK64151.1|  heat shock protein                                     205   2e-56    
ref|XP_004550423.1|  PREDICTED: heat shock 70 kDa protein 4-like        204   2e-56    
ref|XP_005727828.1|  PREDICTED: heat shock 70 kDa protein 4-like        204   2e-56    
ref|XP_008253224.1|  PREDICTED: heat shock 70 kDa protein 4             204   2e-56    
dbj|GAC72350.1|  molecular chaperones HSP105/HSP110/SSE1                205   2e-56    
ref|XP_006128593.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    204   2e-56    
ref|XP_005944288.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    204   2e-56    
ref|XP_006785040.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    204   2e-56    
ref|XP_005703010.1|  molecular chaperone DnaK                           204   2e-56    
ref|XP_008847562.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    204   2e-56    
ref|XP_007247088.1|  PREDICTED: heat shock 70 kDa protein 4             204   2e-56    
ref|XP_008102922.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    204   2e-56    
ref|XP_006631870.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    204   2e-56    
ref|XP_008847563.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    204   2e-56    
ref|XP_011392344.1|  putative heat shock protein Hsp88                  204   2e-56    
ref|XP_006631871.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    204   2e-56    
emb|CEG71289.1|  Putative Heat shock 70kDa protein 4                    204   2e-56    
ref|XP_002912954.1|  PREDICTED: heat shock 70 kDa protein 4             204   2e-56    
ref|XP_005335810.1|  PREDICTED: heat shock 70 kDa protein 4             204   3e-56    
dbj|BAG57963.1|  unnamed protein product                                204   3e-56    
ref|XP_007063691.1|  PREDICTED: heat shock 70 kDa protein 4             204   3e-56    
ref|XP_005801164.1|  PREDICTED: heat shock 70 kDa protein 4L-like       204   3e-56    
ref|XP_003217430.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    204   4e-56    
ref|XP_007576232.1|  PREDICTED: heat shock 70 kDa protein 4L            204   4e-56    
ref|XP_002084822.1|  GD14475                                            203   4e-56    
ref|XP_002642168.1|  Hypothetical protein CBG18133                      203   4e-56    



>ref|XP_007024113.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
 gb|EOY26735.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
Length=575

 Score =   412 bits (1058),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 192/210 (91%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PFSVTEGPDG+PLIHARYLGEM+TFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFSVTEGPDGYPLIHARYLGEMKTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLS+LKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VLSDLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENE LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEQLNVAFVDIGHASMQVCI  210



>ref|XP_011072334.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
 ref|XP_011072335.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
Length=845

 Score =   420 bits (1079),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 197/210 (94%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAATSMMNP
Sbjct  1    MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAATSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDPELQRDLKS PF VTEGPDG+PLIHARYLGE RTFTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKSLPFLVTEGPDGYPLIHARYLGETRTFTPTQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRL HETTATALA
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENE +NVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENEAMNVAFVDVGHASMQVCI  210



>ref|XP_011080863.1| PREDICTED: heat shock 70 kDa protein 14-like [Sesamum indicum]
Length=856

 Score =   417 bits (1072),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 197/210 (94%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPALVCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPALVCFGDKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDPELQRDLKS PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKSLPFLVTEGPDGYPLIHARYLGENRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLNVAFVDVGHASLQVCI
Sbjct  181  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  210



>ref|XP_007024112.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
 gb|EOY26734.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
Length=860

 Score =   414 bits (1065),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 192/210 (91%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PFSVTEGPDG+PLIHARYLGEM+TFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFSVTEGPDGYPLIHARYLGEMKTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLS+LKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VLSDLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENE LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEQLNVAFVDIGHASMQVCI  210



>gb|KJB35057.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=628

 Score =   407 bits (1047),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V SNLKSIAE NL AAVVDCCIGIPVYFT+LQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VFSNLKSIAEQNLKAAVVDCCIGIPVYFTELQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>gb|KHG16619.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=855

 Score =   414 bits (1064),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 192/210 (91%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_002528199.1| Heat shock 70 kDa protein, putative [Ricinus communis]
 gb|EEF34206.1| Heat shock 70 kDa protein, putative [Ricinus communis]
Length=849

 Score =   414 bits (1064),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 205/210 (98%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GRQFSDPELQ+DLKS PF+VTEGPDGFPLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLVGRQFSDPELQKDLKSLPFAVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLS+LK IAE NLNAAVVDCCIGIP YFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  VLSDLKGIAEKNLNAAVVDCCIGIPAYFTDLQRRAVMDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>gb|KDO51190.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=726

 Score =   410 bits (1053),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 205/210 (98%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK+IAE+NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASLQVCI  210



>gb|KJB70511.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=749

 Score =   409 bits (1051),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRSFTPTQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VL NLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VLLNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_006389708.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
 gb|ESQ26994.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
Length=569

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA++CFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIICFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+P+IHARYLGEMR FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPMIHARYLGEMRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE N+NAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  MLSNLKGIAEKNMNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENE LNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEQLNVAFIDIGHASMQVCI  210



>gb|KDO51188.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=833

 Score =   410 bits (1055),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 205/210 (98%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK+IAE+NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASLQVCI  210



>ref|XP_006427039.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
 gb|ESR40279.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
Length=852

 Score =   410 bits (1055),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 205/210 (98%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK+IAE+NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASLQVCI  210



>gb|KDO51189.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=852

 Score =   410 bits (1055),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 205/210 (98%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK+IAE+NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASLQVCI  210



>ref|XP_009624163.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=854

 Score =   410 bits (1055),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/210 (91%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK+IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIPIYFTDLQRRAVMDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+PLNVAF+DVGHASLQVCI
Sbjct  181  YGIYKTDLPENDPLNVAFIDVGHASLQVCI  210



>ref|XP_006465548.1| PREDICTED: heat shock 70 kDa protein 14-like [Citrus sinensis]
Length=852

 Score =   410 bits (1055),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 205/210 (98%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK+IAE+NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASLQVCI  210



>gb|KJB70509.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
 gb|KJB70510.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=855

 Score =   410 bits (1054),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRSFTPTQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VL NLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VLLNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_003546366.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
 gb|KHM98765.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=863

 Score =   410 bits (1054),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLK+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKTFPFVVTEGPDGYPLIHARYLGEARTFTPTQVFGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIPLYFTDLQRRAVLDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>gb|EPS63387.1| hypothetical protein M569_11394, partial [Genlisea aurea]
Length=391

 Score =   395 bits (1014),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPALVCFG+KQRFLGTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPALVCFGDKQRFLGTAGAASSLMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+SQ+KRLIGR+FSDPELQ DLK  PFSV+EGPDGFPLIHARYL E + FTPTQVLGM
Sbjct  61   KNTVSQIKRLIGRKFSDPELQSDLKVLPFSVSEGPDGFPLIHARYLRENKAFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V SNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRL HETTATALA
Sbjct  121  VFSNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLLHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE+EPLNV FVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPEDEPLNVVFVDVGHASMQVCI  210



>gb|KJB35056.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
 gb|KJB35058.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=856

 Score =   409 bits (1052),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V SNLKSIAE NL AAVVDCCIGIPVYFT+LQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VFSNLKSIAEQNLKAAVVDCCIGIPVYFTELQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_012073334.1| PREDICTED: heat shock 70 kDa protein 15-like [Jatropha curcas]
 gb|KDP37205.1| hypothetical protein JCGZ_06261 [Jatropha curcas]
Length=847

 Score =   409 bits (1051),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+V+EGPDGFPLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQKDLKSLPFAVSEGPDGFPLIHARYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLNAAVVDCCIGIP YFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VLSNLKGIAEKNLNAAVVDCCIGIPAYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>gb|KHG16198.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=856

 Score =   409 bits (1052),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V SNLKSIAE NL AAVVDCCIGIPVYFT+LQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VFSNLKSIAEQNLKAAVVDCCIGIPVYFTELQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>gb|EYU24689.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=573

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDES R TPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESNRLTPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDPELQ D+KS PFSVTEGPDG+PLIHA YLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQHDIKSLPFSVTEGPDGYPLIHAHYLGESRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRL HETTATALA
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLN+AFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENEPLNIAFVDVGHASMQVCI  210



>gb|EYU21549.1| hypothetical protein MIMGU_mgv1a001311mg [Erythranthe guttata]
Length=842

 Score =   407 bits (1046),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/210 (91%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDPELQRD+KS PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKSLPFLVTEGPDGYPLIHARYLGETRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK IAE NLN AVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRL HETTATALA
Sbjct  121  VFSDLKIIAEKNLNTAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEP+NVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENEPMNVAFVDVGHASMQVCI  210



>ref|XP_010538015.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
 ref|XP_010538016.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
Length=829

 Score =   406 bits (1043),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 204/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+++SQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQV+GM
Sbjct  61   KSSVSQIKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGEMRTFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VLSNLKSIAENNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAF+D+GHA +QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFIDIGHAGMQVCI  210



>ref|XP_004252333.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=846

 Score =   406 bits (1043),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 191/210 (91%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDPELQRDLK+ PF VTEGPDG+PLIHARYLGEMRTFTPTQV+GM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKALPFLVTEGPDGYPLIHARYLGEMRTFTPTQVVGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK+IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASLQVCI  210



>ref|XP_009610837.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Nicotiana 
tomentosiformis]
Length=780

 Score =   404 bits (1038),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGR+FSDPELQRD+K+ PFSVTEGPDG+PLIHA YLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFSDPELQRDIKALPFSVTEGPDGYPLIHALYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK+IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAA IAGLHPL L HETTATALA
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIPIYFTDLQRRAVMDAAMIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+PLNVAF+DVGHASLQVCI
Sbjct  181  YGIYKTDLPENDPLNVAFIDVGHASLQVCI  210



>gb|KHN32604.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=862

 Score =   406 bits (1043),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQF+DPELQ+D+K+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFADPELQQDIKTFPFVVTEGPDGYPLIHARYLGESRTFTPTQVFGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIPLYFTDLQRRAVLDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_003543647.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
Length=863

 Score =   406 bits (1043),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQF+DPELQ+D+K+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFADPELQQDIKTFPFVVTEGPDGYPLIHARYLGESRTFTPTQVFGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIPLYFTDLQRRAVLDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_007150665.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
 gb|ESW22659.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
Length=865

 Score =   406 bits (1043),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAAT+MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAATTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+K LIGRQFSDPELQRDLK++PF VTEGPDG+PLIHARYLG+++TFTPTQV GM
Sbjct  61   KNSISQIKSLIGRQFSDPELQRDLKTYPFLVTEGPDGYPLIHARYLGDVKTFTPTQVFGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIPLYFTDLQRRAVLDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_010539495.1| PREDICTED: heat shock 70 kDa protein 15-like [Tarenaya hassleriana]
Length=866

 Score =   405 bits (1042),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 206/214 (96%), Gaps = 0/214 (0%)
 Frame = +3

Query  207  LATKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATS  386
            +  KMSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++
Sbjct  17   IKAKMSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAAST  76

Query  387  MMNPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQ  566
            MMNPK+++SQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQ
Sbjct  77   MMNPKSSVSQIKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGEMRTFTPTQ  136

Query  567  VLGMVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTA  746
            V+GMVLSNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L +ETTA
Sbjct  137  VMGMVLSNLKSIAENNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLINETTA  196

Query  747  TALAYGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            TALAYGIYKTDLPEN+ LNVAF+D+GHAS+QVCI
Sbjct  197  TALAYGIYKTDLPENDLLNVAFIDIGHASMQVCI  230



>ref|XP_010521527.1| PREDICTED: heat shock 70 kDa protein 15 [Tarenaya hassleriana]
Length=832

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 205/210 (98%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS P++VTEGPDG+PLIHAR+LGEMRTFTPTQV+GM
Sbjct  61   KNSISQMKRLIGRQFSDPELQRDIKSLPYTVTEGPDGYPLIHARFLGEMRTFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAETNLNAAVVDCCIGIPVYFT+LQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  VLSNLKSIAETNLNAAVVDCCIGIPVYFTELQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAF+D+GHASLQ+CI
Sbjct  181  YGIYKTDLPENDQLNVAFIDIGHASLQICI  210



>ref|XP_006300740.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
 gb|EOA33638.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
Length=828

 Score =   404 bits (1039),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGEMR FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEMRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTD+QRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDIQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEPLNVAFIDIGHASMQVCI  210



>ref|XP_002279789.2| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654673.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654674.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
Length=848

 Score =   405 bits (1040),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPDG+PLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNSISQMKRLIGRQFSDPELQQDLKSLPFTVTEGPDGYPLIHARYLGEVRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + SNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  MFSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLLHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_004252334.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
 ref|XP_010314276.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=852

 Score =   405 bits (1040),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDPELQRD+K+ PF VTEGPDG+PLIHARYLGE+RTFTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKTLPFLVTEGPDGYPLIHARYLGEVRTFTPTQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK+IAE NLNA VVDCCIGIP+YFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  VFSDLKTIAEKNLNAVVVDCCIGIPIYFTDLQRRAVMDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+PLNVAFVDVGHASLQVCI
Sbjct  181  YGIYKTDLPENDPLNVAFVDVGHASLQVCI  210



>ref|XP_010915054.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=853

 Score =   405 bits (1040),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFVGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQ+KRL+GR+FSDPELQRDL+S PF VTEGPDGFPLIHARYLGE RTFTPTQVL M
Sbjct  61   KNSVSQIKRLLGRKFSDPELQRDLQSLPFLVTEGPDGFPLIHARYLGEQRTFTPTQVLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLS+LKSIAE NL AAVVDCCIGIP YFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  VLSDLKSIAEKNLGAAVVDCCIGIPAYFTDLQRRAVLDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVC+
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCV  210



>ref|XP_010254149.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254150.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254151.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=851

 Score =   404 bits (1039),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FGEKQRF+GTAGAA++ MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVSFGEKQRFIGTAGAASTTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQLKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGESRVFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAE NLNAAVVDCCIGIP YFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIPAYFTDLQRRAVLDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_010430044.1| PREDICTED: heat shock 70 kDa protein 15 [Camelina sativa]
Length=830

 Score =   404 bits (1038),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEPLNVAFIDIGHASMQVCI  210



>gb|ACF83633.1| unknown [Zea mays]
Length=293

 Score =   386 bits (991),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QV +
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVSV  210



>ref|XP_010249783.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010249784.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=850

 Score =   404 bits (1038),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQ+DLK+ PF+VTEGPDG+PLIHARYLGE R FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQQDLKALPFTVTEGPDGYPLIHARYLGESRVFTPTQLLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLS+LKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VLSDLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_010473008.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=830

 Score =   403 bits (1036),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEPLNVAFIDIGHASMQVCI  210



>ref|XP_010417777.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Camelina 
sativa]
Length=829

 Score =   403 bits (1036),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEPLNVAFIDIGHASMQVCI  210



>ref|XP_010417776.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Camelina 
sativa]
Length=829

 Score =   403 bits (1036),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEPLNVAFIDIGHASMQVCI  210



>ref|XP_010473009.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   403 bits (1036),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEPLNVAFIDIGHASMQVCI  210



>ref|XP_009610834.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610835.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610836.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
Length=856

 Score =   404 bits (1037),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGR+FSDPELQRD+K+ PFSVTEGPDG+PLIHA YLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFSDPELQRDIKALPFSVTEGPDGYPLIHALYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK+IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAA IAGLHPL L HETTATALA
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIPIYFTDLQRRAVMDAAMIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+PLNVAF+DVGHASLQVCI
Sbjct  181  YGIYKTDLPENDPLNVAFIDVGHASLQVCI  210



>ref|XP_009801414.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana sylvestris]
Length=846

 Score =   403 bits (1036),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGR+F DPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMR+FTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFLDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRSFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_010098045.1| Heat shock 70 kDa protein 15 [Morus notabilis]
 gb|EXB74482.1| Heat shock 70 kDa protein 15 [Morus notabilis]
Length=860

 Score =   404 bits (1037),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLG 
Sbjct  61   KNSISQIKRLIGRQFSDPELQKDLKSLPFTVTEGPDGYPLIHARYLGEARTFTPTQVLGT  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V ++LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  VFADLKVIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_010430043.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   403 bits (1035),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFS+TEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSITEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEPLNVAFIDIGHASMQVCI  210



>ref|XP_007217050.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
 gb|EMJ18249.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
Length=855

 Score =   403 bits (1036),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFG+KQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGDKQRFIGTAGAASSLMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDP +QRD+KS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPVVQRDIKSLPFAVTEGPDGYPLIHARYLGESRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENE LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEQLNVAFVDIGHASMQVCI  210



>ref|XP_008354138.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=558

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IAGL+PLRLFHETTATALA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIAGLNPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>gb|EYU24688.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=840

 Score =   402 bits (1034),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDES R TPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESNRLTPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDPELQ D+KS PFSVTEGPDG+PLIHA YLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQHDIKSLPFSVTEGPDGYPLIHAHYLGESRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRL HETTATALA
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLN+AFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENEPLNIAFVDVGHASMQVCI  210



>ref|XP_006392781.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
 gb|ESQ30067.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
Length=829

 Score =   402 bits (1033),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGERRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE+EPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPESEPLNVAFIDIGHASMQVCI  210



>emb|CDO98063.1| unnamed protein product [Coffea canephora]
Length=858

 Score =   403 bits (1035),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGR FSDPELQRDLK+ PF+VTEGPDGFPLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNTISQMKRLIGRPFSDPELQRDLKALPFTVTEGPDGFPLIHARYLGELRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LKSIA+ NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VFSDLKSIAQKNLNAAVVDCCIGIPVYFTDLQRRAVVDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_010925328.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=851

 Score =   402 bits (1034),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQRDL+S PF VTEG DGFPLIHARYLGE RTFTPTQVL M
Sbjct  61   KNSISQIKRLVGRKFSDPELQRDLQSLPFLVTEGADGFPLIHARYLGEQRTFTPTQVLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAE NL+AAVVDCCIGIPVYFTDLQRRAV+DAA IAGL PLRLFHETTATALA
Sbjct  121  VLSNLKSIAEKNLSAAVVDCCIGIPVYFTDLQRRAVLDAAAIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_009587742.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=844

 Score =   402 bits (1033),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/210 (90%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGR+F DPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRKFVDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRSFTPTQLLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>emb|CDX76065.1| BnaA04g03290D [Brassica napus]
Length=814

 Score =   401 bits (1031),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE+EPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPESEPLNVAFIDIGHASMQVCI  210



>ref|XP_006346576.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum tuberosum]
Length=847

 Score =   402 bits (1032),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDPELQ+DLK+ PF VTEGPDG+PLIHA YLGEMRTFTPTQV+GM
Sbjct  61   KNTISQIKRLIGRQFSDPELQKDLKALPFLVTEGPDGYPLIHAHYLGEMRTFTPTQVVGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK+IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASLQVCI  210



>ref|XP_006287070.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
 gb|EOA19968.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
Length=828

 Score =   401 bits (1031),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVT+GPDG+PLIHA YLG+MR FTPTQ++GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTQGPDGYPLIHANYLGDMRAFTPTQLMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENEPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEPLNVAFIDIGHASMQVCI  210



>ref|XP_006346577.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346578.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Solanum 
tuberosum]
Length=849

 Score =   402 bits (1032),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE  VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNERGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDPELQRD+K+ PF VTEGPDG+PLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKTLPFLVTEGPDGYPLIHARYLGEVRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK+IAE NLNA VVDCCIGIP+YFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  VFSDLKTIAEKNLNAVVVDCCIGIPIYFTDLQRRAVMDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+P+NVAFVDVGHASLQVCI
Sbjct  181  YGIYKTDLPENDPVNVAFVDVGHASLQVCI  210



>ref|XP_010691292.1| PREDICTED: heat shock 70 kDa protein 15-like [Beta vulgaris subsp. 
vulgaris]
Length=850

 Score =   402 bits (1032),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQ+SDPELQRDLKS PF+V EGPDGFPLIHARYLGE R FTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQYSDPELQRDLKSLPFTVAEGPDGFPLIHARYLGETRAFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + SNLKSIA  NLNAAVVDCCIGIPVYFTDLQRRAV DAA IAGLHPL+L HETTATALA
Sbjct  121  LFSNLKSIAAQNLNAAVVDCCIGIPVYFTDLQRRAVQDAAVIAGLHPLQLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+P+NVAFVDVGH+SLQVCI
Sbjct  181  YGIYKTDLPENDPINVAFVDVGHSSLQVCI  210



>emb|CDY43337.1| BnaC04g25190D [Brassica napus]
Length=889

 Score =   403 bits (1035),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +3

Query  210  ATKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSM  389
            A +MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++M
Sbjct  73   ALRMSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTM  132

Query  390  MNPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQV  569
            MNPKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV
Sbjct  133  MNPKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQV  192

Query  570  LGMVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTAT  749
            +GM+LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTAT
Sbjct  193  MGMMLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTAT  252

Query  750  ALAYGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            ALAYGIYKTDLPE+EPLNVAF+D+GHAS+QVCI
Sbjct  253  ALAYGIYKTDLPESEPLNVAFIDIGHASMQVCI  285



>ref|XP_002887853.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64112.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
Length=830

 Score =   401 bits (1030),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVT+GPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTQGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENE LNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENEQLNVAFIDIGHASMQVCI  210



>ref|XP_011000832.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Populus 
euphratica]
Length=789

 Score =   399 bits (1026),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRLFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V ++LK I + NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASLQVCI  210



>ref|XP_009147592.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
 ref|XP_009147593.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
Length=818

 Score =   400 bits (1028),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GN++C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNDNCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE+EPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPESEPLNVAFIDIGHASMQVCI  210



>ref|XP_009139126.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
 ref|XP_009139127.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
Length=814

 Score =   400 bits (1027),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GRQFSDP+LQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPDLQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE+EPLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPESEPLNVAFIDIGHASMQVCI  210



>ref|XP_008228510.1| PREDICTED: heat shock 70 kDa protein 15-like [Prunus mume]
Length=855

 Score =   400 bits (1027),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFG+KQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGDKQRFIGTAGAASSLMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIGRQFSDP +QRD+KS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPVVQRDIKSLPFAVTEGPDGYPLIHARYLGESRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPEHDQLNVAFVDIGHASMQVCI  210



>emb|CDY24089.1| BnaA06g00870D [Brassica napus]
Length=858

 Score =   400 bits (1027),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +3

Query  216  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  395
            +MSVVGFD GN++C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMN
Sbjct  40   RMSVVGFDFGNDNCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMN  99

Query  396  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  575
            PKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+G
Sbjct  100  PKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMG  159

Query  576  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            M+LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATAL
Sbjct  160  MMLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATAL  219

Query  756  AYGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            AYGIYKTDLPE+EPLNVAF+D+GHAS+QVCI
Sbjct  220  AYGIYKTDLPESEPLNVAFIDIGHASMQVCI  250



>ref|XP_002304187.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE79166.1| heat shock protein 70 [Populus trichocarpa]
Length=858

 Score =   400 bits (1027),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK IA+ NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA LHPLRL HETTATALA
Sbjct  121  VFSDLKIIAQKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAELHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASLQVCI  210



>ref|XP_009389931.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=849

 Score =   399 bits (1026),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQ+KRL+GR+FSDPE+Q+D++SFPF VTEGPDGF LIHA YLGE R FTPTQ+L M
Sbjct  61   KNSVSQIKRLLGRKFSDPEVQKDIQSFPFRVTEGPDGFALIHANYLGEQRAFTPTQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAE NLNAAVVDCCIGIPVYF DLQRRAV+DAATIAGLHPLRLFHETTATALA
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIPVYFNDLQRRAVMDAATIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVC+
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCV  210



>gb|AAG52244.1|AC011717_12 putative heat-shock protein; 41956-44878 [Arabidopsis thaliana]
Length=736

 Score =   396 bits (1017),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFIDIGHASMQVCI  210



>ref|XP_011000830.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011000831.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
Length=859

 Score =   399 bits (1026),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRLFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V ++LK I + NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASLQVCI  210



>ref|XP_009388669.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   398 bits (1023),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+SQ+KRLIGR+FSDPELQRD++S PF VTEGPDGFPLIH  YLGE RTFTPTQ+L M
Sbjct  61   KNTVSQIKRLIGRKFSDPELQRDIQSLPFKVTEGPDGFPLIHVNYLGEQRTFTPTQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLS+LK IAE N++AAVVDCCIGIPVYFTD+QRRAV+DAATIAGLHPL+LFHETTATALA
Sbjct  121  VLSDLKGIAEKNMHAAVVDCCIGIPVYFTDIQRRAVLDAATIAGLHPLQLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD PEN+ LNVAFVDVGHAS+QVC+
Sbjct  181  YGIYKTDFPENDQLNVAFVDVGHASMQVCV  210



>ref|XP_008793460.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=854

 Score =   399 bits (1024),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLN+ESKRETPA+VCFGEKQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGEKQRFVGTAGAASSLMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQ+KRL+GR+FSDPELQRDL+S PF VTEGPDGFPLIHARYLGE R FTPTQVL M
Sbjct  61   KNSVSQIKRLLGRKFSDPELQRDLQSLPFLVTEGPDGFPLIHARYLGEQRAFTPTQVLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAE NL AAVVDCCIGIP YFTDLQRRAV+DAAT+AGLHPL+LFHETTATALA
Sbjct  121  VLSNLKSIAEKNLGAAVVDCCIGIPAYFTDLQRRAVLDAATVAGLHPLQLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            +GIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  FGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>emb|CDY45119.1| BnaC06g06400D [Brassica napus]
Length=956

 Score =   401 bits (1030),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +3

Query  216  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  395
            +MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMN
Sbjct  140  RMSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMN  199

Query  396  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  575
            PKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+G
Sbjct  200  PKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMG  259

Query  576  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            M+LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATAL
Sbjct  260  MMLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATAL  319

Query  756  AYGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            AYGIYKTDLPE+EPLNVAF+D+GHAS+QVCI
Sbjct  320  AYGIYKTDLPESEPLNVAFIDIGHASMQVCI  350



>ref|NP_850984.4| Heat shock protein 70 [Arabidopsis thaliana]
 sp|F4HQD4.1|HSP7P_ARATH RecName: Full=Heat shock 70 kDa protein 15; AltName: Full=Heat 
shock protein 70-15; Short=AtHsp70-15 [Arabidopsis thaliana]
 gb|AEE36325.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFIDIGHASMQVCI  210



>ref|XP_009408938.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408939.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   398 bits (1022),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 202/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSVMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+SQ+KRL+GR+FSDPELQRD++S PF VTEG DGFPLIHA YLGE+R FTPTQ+L M
Sbjct  61   KNTVSQIKRLVGRKFSDPELQRDIQSLPFKVTEGRDGFPLIHANYLGELRAFTPTQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK+IAETNL+AAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VLSNLKTIAETNLHAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLLHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPESDQLNVAFVDVGHASMQVCI  210



>ref|XP_010033879.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53729.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
 gb|KCW53730.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
Length=851

 Score =   398 bits (1022),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+V VARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVGVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+G++F+DPELQRDL+S PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNSISQMKRLVGQKFADPELQRDLQSLPFHVTEGPDGYPLIHARYLGEARTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + SNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL+L HETTATALA
Sbjct  121  MFSNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLQLLHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE +PLNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPEVDPLNVAFIDIGHASMQVCI  210



>gb|AAL38353.1| putative heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFIDIGHASMQVCI  210



>ref|XP_011013254.1| PREDICTED: heat shock 70 kDa protein 15-like [Populus euphratica]
Length=852

 Score =   398 bits (1022),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGR FSDPELQRDLKS PF+VTEGPDGFPLI ARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLKSLPFTVTEGPDGFPLIQARYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V ++LK I + NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|NP_178110.6| Heat shock protein 70 [Arabidopsis thaliana]
 gb|AEE36326.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   397 bits (1020),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFIDIGHASMQVCI  210



>ref|NP_001031305.1| heat shock protein 91 [Arabidopsis thaliana]
 dbj|BAE98929.1| putative heat shock protein [Arabidopsis thaliana]
 gb|AEE36328.1| heat shock protein 91 [Arabidopsis thaliana]
Length=789

 Score =   396 bits (1017),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPESDQLNVAFIDIGHASMQVCI  210



>ref|NP_178111.1| heat shock protein 91 [Arabidopsis thaliana]
 sp|Q9S7C0.1|HSP7O_ARATH RecName: Full=Heat shock 70 kDa protein 14; AltName: Full=Heat 
shock protein 70-14; Short=AtHsp70-14; AltName: Full=Heat 
shock protein 91 [Arabidopsis thaliana]
 gb|AAD55461.1|AC009322_1 Heat-shock protein [Arabidopsis thaliana]
 gb|AAG52240.1|AC011717_8 putative heat-shock protein; 37113-40399 [Arabidopsis thaliana]
 gb|AAL84971.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AAO11541.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AEE36327.1| heat shock protein 91 [Arabidopsis thaliana]
Length=831

 Score =   396 bits (1018),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPESDQLNVAFIDIGHASMQVCI  210



>ref|XP_010033884.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53736.1| hypothetical protein EUGRSUZ_J02991 [Eucalyptus grandis]
Length=874

 Score =   397 bits (1020),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDSGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGR+FSDPELQRDL+S PF VTEGP+G+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRKFSDPELQRDLQSLPFQVTEGPEGYPLIHARYLGESRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + SNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGL PLRL HETTATALA
Sbjct  121  MFSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLRPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPESDSLNVAFVDIGHASMQVCI  210



>ref|XP_008786326.1| PREDICTED: heat shock 70 kDa protein 15-like [Phoenix dactylifera]
Length=854

 Score =   396 bits (1017),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQ+KRL+GR+FSDPELQRDL+S  F V+EGPDGFPLIHARYLGE R FTPTQVL M
Sbjct  61   KNSVSQIKRLVGRKFSDPELQRDLQSLSFLVSEGPDGFPLIHARYLGEQRAFTPTQVLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAE NL AAVVDCCIGIPVYFTDLQRRAV+DAA IAGL PLRLFHETTATALA
Sbjct  121  VLSNLKSIAEKNLGAAVVDCCIGIPVYFTDLQRRAVLDAAAIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>gb|EPS59607.1| hypothetical protein M569_15197, partial [Genlisea aurea]
Length=534

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTA AA+S+MNP
Sbjct  6    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFLGTAAAASSLMNP  65

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+SQVKRLIGR+FSDPELQ DLK+ PFSV+EGPDG+PLIHARYLGE  TFTPTQVLGM
Sbjct  66   KNTVSQVKRLIGRKFSDPELQSDLKALPFSVSEGPDGYPLIHARYLGETTTFTPTQVLGM  125

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V SNLKSIAE NLNA V DCCIGIP+YF DLQRRAVIDAA IAGL PLRL HETTATALA
Sbjct  126  VFSNLKSIAEKNLNAVVADCCIGIPIYFADLQRRAVIDAARIAGLDPLRLLHETTATALA  185

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE EPLNV FVD+GHAS+QVCI
Sbjct  186  YGIYKTDLPEGEPLNVVFVDIGHASMQVCI  215



>emb|CAA94389.1| heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   394 bits (1013),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+GFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+ +RF+GTAGAA++MMNP
Sbjct  1    MSVIGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDNERFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQRD+KSFPFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSFPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAF+D+GHAS+QVCI
Sbjct  181  YGIYKTDLPESDQLNVAFIDIGHASMQVCI  210



>ref|XP_003597778.1| 97 kDa heat shock protein [Medicago truncatula]
 ref|XP_003597784.1| 97 kDa heat shock protein [Medicago truncatula]
 gb|AES68029.1| heat shock 70 kDa protein [Medicago truncatula]
Length=858

 Score =   394 bits (1013),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIG++F+DPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FT TQV GM
Sbjct  61   KNSISQIKRLIGKKFADPELQRDLKSLPFNVTEGPDGYPLIHARYLGESREFTATQVFGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IA+ NLNAAVVDCCIGIPVYFTDLQRR+V+DAATIAGLHPL L HETTATALA
Sbjct  121  MLSNLKEIAQKNLNAAVVDCCIGIPVYFTDLQRRSVLDAATIAGLHPLHLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPENE LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENEWLNVAFVDVGHASMQVCI  210



>emb|CCM07272.1| Putative 97 kDa heat shock protein [Musa balbisiana]
Length=845

 Score =   394 bits (1012),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+SQ+KRLIGR+FSDPELQRD++S PF VTEGPDGFPLIH  YLGE RTFTPTQ+L M
Sbjct  61   KNTVSQIKRLIGRKFSDPELQRDIQSLPFKVTEGPDGFPLIHVNYLGEQRTFTPTQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLS+LK IAE N++A VVDCCIGIPVYFTD+QRRAV+DAATIAGL PL+LFHETTATALA
Sbjct  121  VLSDLKRIAEKNMHATVVDCCIGIPVYFTDIQRRAVLDAATIAGLRPLQLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVC+
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCV  210



>ref|XP_004506856.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=851

 Score =   394 bits (1012),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIG+QFSDPE+Q DLKS PFSVTEGPDG+PLIHARYLGE++TFTPTQV  M
Sbjct  61   KNSISQIKRLIGKQFSDPEVQGDLKSLPFSVTEGPDGYPLIHARYLGEVKTFTPTQVFAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IA+ NLNA V DCCIGIPVYFTD+QRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  MLSNLKEIAQKNLNAGVNDCCIGIPVYFTDVQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_002299641.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE84446.1| heat shock protein 70 [Populus trichocarpa]
Length=852

 Score =   393 bits (1010),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+ +VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENSLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGR FSDPELQRDL+S PF+VTEGPDGFPLI ARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLRSLPFTVTEGPDGFPLIQARYLGEMRTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V ++LK I + NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_002439385.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
 gb|EES17815.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
Length=842

 Score =   392 bits (1007),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+HARYLGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHARYLGEERTFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QV +
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVSV  210



>ref|XP_004506857.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=849

 Score =   392 bits (1007),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIG+QFSDP++Q DLKS PFSVTEGPDG+PLIHARYLGE++TFTPTQV  M
Sbjct  61   KNSISQIKRLIGKQFSDPDVQGDLKSLPFSVTEGPDGYPLIHARYLGEVKTFTPTQVFAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLN  V DCCIGIPVYFTD+QRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  MLSNLKEIAEKNLNTGVNDCCIGIPVYFTDVQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_003529646.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Glycine 
max]
 ref|XP_006582999.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Glycine 
max]
 gb|KHN39337.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=857

 Score =   392 bits (1007),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGR+F+DPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQIKRLIGRKFADPELQRDLKSLPFLVTEGSDGYPLIHARYMGEAKTFTPTQVFGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HE TATALA
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHEMTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHASLQVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASLQVCI  210



>ref|XP_006842242.1| PREDICTED: heat shock 70 kDa protein 14 [Amborella trichopoda]
 ref|XP_011622541.1| PREDICTED: heat shock 70 kDa protein 14 [Amborella trichopoda]
 ref|XP_011622542.1| PREDICTED: heat shock 70 kDa protein 14 [Amborella trichopoda]
 ref|XP_011622543.1| PREDICTED: heat shock 70 kDa protein 14 [Amborella trichopoda]
 gb|ERN03917.1| hypothetical protein AMTR_s00078p00190750 [Amborella trichopoda]
Length=855

 Score =   392 bits (1006),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S+MN 
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSLMNI  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQ+KRLIGR+FSDPELQRDL++F F VTEGPDGFPLIH RYLGE + FTPTQVLGM
Sbjct  61   KNSVSQIKRLIGRRFSDPELQRDLQAFAFLVTEGPDGFPLIHVRYLGESKLFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  ILSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHA +QVC+
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHACMQVCV  210



>ref|XP_009399777.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=851

 Score =   392 bits (1006),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGA +S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGATSSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQ+KRL+GR+FSDPE+QRD++  PF VTEGPDGFPLIHA YLGE +TF+PTQ+L M
Sbjct  61   KNSVSQIKRLVGRKFSDPEVQRDIQLVPFKVTEGPDGFPLIHANYLGEQKTFSPTQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAE NLNAAV+DCCIG+PVYF DLQRRAVIDAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKSIAENNLNAAVMDCCIGVPVYFNDLQRRAVIDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_009358190.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   392 bits (1006),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IAGL+PLRLFHETTATALA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIAGLNPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_008462146.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
 ref|XP_008462147.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
Length=844

 Score =   391 bits (1005),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FG+KQRF+GTAGAA+ MMN 
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVSFGDKQRFIGTAGAASIMMNI  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQVKRLIGR+FSDP LQ+DL+S PFSVTEGPDGFPL+H RYLGE++TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPGLQKDLQSLPFSVTEGPDGFPLVHVRYLGELKTFTPTQLLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + SNLK IAETNLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  LFSNLKGIAETNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_009358191.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
 ref|XP_009358192.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   391 bits (1005),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IAGL+PLRLFHETTATALA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIAGLNPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_008654914.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=833

 Score =   390 bits (1003),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QV +
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVSV  210



>ref|XP_006643833.1| PREDICTED: heat shock 70 kDa protein 14-like [Oryza brachyantha]
Length=843

 Score =   390 bits (1003),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGR+FSDPELQ DL +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSISQIKRLIGRKFSDPELQSDLAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK+IAE+NLNAAV DCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETT+TALA
Sbjct  121  VLSNLKAIAESNLNAAVADCCIGIPVYFTDLQRRAVLDAATIAGLRPLRLFHETTSTALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPESDQLNVAFVDVGHASMQVCI  210



>ref|NP_001147805.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACG28747.1| heat shock 70 kDa protein 4 [Zea mays]
Length=833

 Score =   390 bits (1002),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QV +
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVSV  210



>gb|EAY72790.1| hypothetical protein OsI_00654 [Oryza sativa Indica Group]
Length=813

 Score =   389 bits (1000),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQ+KRL+GR++SDPELQRD+ +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSVSQIKRLLGRKYSDPELQRDIAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE+NLN AVVDCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAESNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLCPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_004141777.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis sativus]
 gb|KGN45354.1| hypothetical protein Csa_7G446710 [Cucumis sativus]
Length=843

 Score =   390 bits (1002),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FG+KQRF+GTAGAA+ MMN 
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVSFGDKQRFIGTAGAASIMMNI  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQVKRLIGR+FSDP LQ+DL+S PFSV+EGPDGFPL+H RYLGE++TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPGLQKDLQSLPFSVSEGPDGFPLVHVRYLGELKTFTPTQLLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + SNLK IAETNLNAAVVDCCIGIPVYFTDLQRRAV+DAAT+AGLHPLRL HETTATALA
Sbjct  121  LFSNLKGIAETNLNAAVVDCCIGIPVYFTDLQRRAVLDAATVAGLHPLRLIHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>ref|XP_008775317.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=852

 Score =   390 bits (1002),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQVKRLIGR+FSDPELQ D++S PFSVTEGPDG+PLIHA YLGE  TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPELQGDVQSLPFSVTEGPDGYPLIHASYLGEKGTFTPTQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NLN AV DCCIGIP YFTDLQRRAV+DAA IAGLHPLRLFHETTATALA
Sbjct  121  ILSNLKGIAEKNLNNAVADCCIGIPAYFTDLQRRAVMDAAAIAGLHPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ +NVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQMNVAFVDVGHASMQVCI  210



>ref|NP_001042210.1| Os01g0180800 [Oryza sativa Japonica Group]
 dbj|BAB32902.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAB33024.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAF04124.1| Os01g0180800 [Oryza sativa Japonica Group]
 gb|EAZ10794.1| hypothetical protein OsJ_00630 [Oryza sativa Japonica Group]
 gb|ADR66977.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=845

 Score =   390 bits (1001),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/210 (84%), Positives = 200/210 (95%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQ+KRL+GR++SDPELQRD+ +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSVSQIKRLLGRKYSDPELQRDIAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE+NLN AVVDCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAESNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLCPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_004960855.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Setaria 
italica]
Length=845

 Score =   389 bits (1000),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF V+EGPDGFPL+HARYLGE + FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVSEGPDGFPLVHARYLGEEQAFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLNAAVVDCCIGIPVYF DLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKVIAEGNLNAAVVDCCIGIPVYFNDLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QV I
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVSI  210



>ref|XP_008647466.1| PREDICTED: uncharacterized protein LOC100217188 isoform X1 [Zea 
mays]
 gb|AFW77385.1| heat shock protein 4 [Zea mays]
Length=841

 Score =   389 bits (999),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR++SDPE+QRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKYSDPEVQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIAGLQPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QV +
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVSV  210



>ref|XP_008371663.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   388 bits (997),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQRGIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IAGL+PLRLFHETTATALA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIAGLNPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDXGHASMQVCI  210



>ref|XP_003531683.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Glycine 
max]
Length=852

 Score =   388 bits (997),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL  E TATALA
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIQEMTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_008362708.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   388 bits (997),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQRGIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IAGL+PLRLFHETTATALA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIAGLNPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDXGHASMQVCI  210



>ref|XP_010925584.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
 ref|XP_010932975.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=852

 Score =   388 bits (996),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN++SQVKRLIGR+FSDPELQRDL+S PF VTEGPDG+PLIHA YLGE +TF PTQVLGM
Sbjct  61   KNSVSQVKRLIGRKFSDPELQRDLQSLPFLVTEGPDGYPLIHASYLGEKKTFMPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK +AE NLN AVVDCCIGIP YFTDLQRRAV+DAA IAGL PLRLFHETTATALA
Sbjct  121  ILSNLKGMAEKNLNNAVVDCCIGIPAYFTDLQRRAVMDAAAIAGLQPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYK+DLPEN+ +NVAFVDVGHAS+QVCI
Sbjct  181  YGIYKSDLPENDQMNVAFVDVGHASMQVCI  210



>ref|XP_004960853.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Setaria 
italica]
Length=850

 Score =   388 bits (996),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLNAAVVDCCIGIPVYF+DLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFSDLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE+E LNVAFVDVGHAS+QV I
Sbjct  181  YGIYKTDLPEHEQLNVAFVDVGHASMQVSI  210



>gb|AFW81561.1| hypothetical protein ZEAMMB73_352123 [Zea mays]
Length=564

 Score =   379 bits (974),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NL  AVVDCCIGIPVYF+DLQRRAV+DAATIAGL PL+LFHETTATALA
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIPVYFSDLQRRAVLDAATIAGLTPLQLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVDVGHASLQV I
Sbjct  181  YGIYKTDLPEHDQLNVAFVDVGHASLQVSI  210



>ref|XP_006585595.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Glycine 
max]
Length=850

 Score =   388 bits (996),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLRL  E TATALA
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIQEMTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_004960852.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Setaria 
italica]
Length=878

 Score =   388 bits (996),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLNAAVVDCCIGIPVYF+DLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFSDLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE+E LNVAFVDVGHAS+QV I
Sbjct  181  YGIYKTDLPEHEQLNVAFVDVGHASMQVSI  210



>ref|XP_010231645.1| PREDICTED: heat shock 70 kDa protein 14-like [Brachypodium distachyon]
Length=843

 Score =   386 bits (992),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+F+DPELQ DL+SFPF V+EGPDGFPL+HARYLGE R+FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFTDPELQHDLQSFPFHVSEGPDGFPLVHARYLGEERSFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLN+AV+DCCIGIPVYFT+LQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNSAVIDCCIGIPVYFTNLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QV I
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVSI  210



>gb|KEH28782.1| heat shock 70 kDa protein [Medicago truncatula]
Length=851

 Score =   386 bits (992),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIG+ +SDP+LQRDLKS PFSV EGPDG+PLI ARYLGE++ FTPTQV  M
Sbjct  61   KNSISQIKRLIGKLYSDPDLQRDLKSLPFSVAEGPDGYPLIQARYLGEVKMFTPTQVFAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L N+K IAE NLNAAV DCCIGIP YFTDLQRRAV+DAATIAGLHPLRL HETTATALA
Sbjct  121  MLGNMKEIAEKNLNAAVNDCCIGIPCYFTDLQRRAVLDAATIAGLHPLRLLHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVCI  210



>gb|EMS61926.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=841

 Score =   385 bits (990),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+HARYLGE   FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQRDLQSFPFRVSEGPDGFPLVHARYLGEEHAFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK+IAE NL +AVVDCCIGIPVYFTDLQRR+V+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKAIAEDNLKSAVVDCCIGIPVYFTDLQRRSVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QV I
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVSI  210



>ref|XP_002440718.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
 gb|EES19148.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
Length=851

 Score =   385 bits (990),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLN AVVDCCIGIPVYF+DLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNTAVVDCCIGIPVYFSDLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVDVGHAS+QV I
Sbjct  181  YGIYKTDLPEHDQLNVAFVDVGHASMQVSI  210



>ref|XP_010231644.1| PREDICTED: heat shock 70 kDa protein 15-like [Brachypodium distachyon]
Length=836

 Score =   385 bits (988),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+F+DPE+Q D++SFPF V+EGPDGFPL+HARYLGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFTDPEVQHDIQSFPFRVSEGPDGFPLVHARYLGEERTFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLN AV DCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNTAVSDCCIGIPVYFTDLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD+GHAS+QV I
Sbjct  181  YGIYKTDLPENDQLNVAFVDIGHASMQVSI  210



>ref|XP_007135698.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 ref|XP_007135699.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07692.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07693.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
Length=841

 Score =   385 bits (988),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLG+AGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGSAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIH +YLGE R FTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGNDGYPLIHVQYLGEARKFTPTQVFGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLK IAE NL  AVVDCCIGIP YFTDLQRRAV+DAATI GLHPL+L HE TATALA
Sbjct  121  MLSNLKEIAEKNLGTAVVDCCIGIPTYFTDLQRRAVLDAATIVGLHPLQLIHEMTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVCI  210



>ref|XP_004302913.1| PREDICTED: heat shock 70 kDa protein 15-like [Fragaria vesca 
subsp. vesca]
Length=848

 Score =   384 bits (986),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASSMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIG++FSDP LQRD+KS PF+V EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKKFSDPVLQRDIKSLPFAVLEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V S+LK IA+ NLNAAVVDCCIGIPVYFTDLQRRAV DAA IAGL+PLRLFHETTATALA
Sbjct  121  VFSDLKIIAQKNLNAAVVDCCIGIPVYFTDLQRRAVEDAAKIAGLNPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLPESDQLNVAFVDIGHASMQVCI  210



>gb|EMT31029.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=842

 Score =   384 bits (985),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+F+DPELQ D+K+FPF V+EGPDGFPL+H RYLGE R+FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQDDIKAFPFRVSEGPDGFPLVHVRYLGEERSFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK+IAE NLN+AV+DCCIGIPVYFTDLQRRAVIDAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKAIAEGNLNSAVIDCCIGIPVYFTDLQRRAVIDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVG+AS+QV I
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGNASMQVSI  210



>gb|EMT09857.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=901

 Score =   384 bits (987),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+HARYLGE   FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQRDLQSFPFRVSEGPDGFPLVHARYLGEEHAFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK+IAE NL +AVVDCCIGIPVYFTDLQRR+V+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKAIAEDNLKSAVVDCCIGIPVYFTDLQRRSVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVDVGHAS+QV I
Sbjct  181  YGIYKTDLPENDQLNVAFVDVGHASMQVSI  210



>ref|XP_008649434.1| PREDICTED: heat shock 70 kDa protein 14-like [Zea mays]
 gb|AFW77407.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=843

 Score =   382 bits (982),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +N+ISQ+KRL+GR+FSDPE+Q D+ SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   RNSISQIKRLLGRKFSDPEVQSDIASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLKSIAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETTATALA
Sbjct  121  VLSNLKSIAEGNLKTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVDVGHAS+QV I
Sbjct  181  YGIYKTDLPEHDQLNVAFVDVGHASMQVSI  210



>ref|XP_008354139.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=834

 Score =   382 bits (980),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNES +VAVARQ  IDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQXXIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IAGL+PLRLFHETTATALA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIAGLNPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAFVD GHAS+QVCI
Sbjct  181  YGIYKTDLPENDQLNVAFVDXGHASMQVCI  210



>ref|NP_001151579.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACN33614.1| unknown [Zea mays]
Length=848

 Score =   382 bits (980),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFHVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NL  AVVDCCIGIPVYF+DLQRRAV+DAATIAGL PL+LFHETTATALA
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIPVYFSDLQRRAVLDAATIAGLTPLQLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVDVGHASLQV I
Sbjct  181  YGIYKTDLPEHDQLNVAFVDVGHASLQVSI  210



>gb|ACG43420.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACL52695.1| unknown [Zea mays]
 gb|AFW81562.1| heat shock protein 4 [Zea mays]
Length=848

 Score =   382 bits (980),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NL  AVVDCCIGIPVYF+DLQRRAV+DAATIAGL PL+LFHETTATALA
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIPVYFSDLQRRAVLDAATIAGLTPLQLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVDVGHASLQV I
Sbjct  181  YGIYKTDLPEHDQLNVAFVDVGHASLQVSI  210



>ref|XP_008655087.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=875

 Score =   382 bits (980),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NL  AVVDCCIGIPVYF+DLQRRAV+DAATIAGL PL+LFHETTATALA
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIPVYFSDLQRRAVLDAATIAGLTPLQLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE++ LNVAFVDVGHASLQV I
Sbjct  181  YGIYKTDLPEHDQLNVAFVDVGHASLQVSI  210



>ref|XP_009761607.1| PREDICTED: heat shock 70 kDa protein 15-like, partial [Nicotiana 
sylvestris]
Length=263

 Score =   356 bits (914),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 193/223 (87%), Gaps = 8/223 (4%)
 Frame = +3

Query  99   EERVLEYTCALLLARSFRHFLL--CLLPVFRSVGL*LLLATKMSVVGFDVGNESCVVAVA  272
            + R LE+    +L   F+ F++  CL    R V L   +  KMSVVGFD GNES VVAVA
Sbjct  47   QSRTLEHRFQKILFYVFKEFVITDCLT---RGVAL---MPAKMSVVGFDFGNESGVVAVA  100

Query  273  RQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNPKNTISQVKRLIGRQFSDP  452
            RQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNPKNTISQ+KRLIGRQFSDP
Sbjct  101  RQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNPKNTISQIKRLIGRQFSDP  160

Query  453  ELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGMVLSNLKSIAETNLNAAVV  632
            ELQRDLK+ PFSVTEGPDG+PLIHARYLGEMRTFTPTQVLGMV S+LK+IAE NLNAAVV
Sbjct  161  ELQRDLKALPFSVTEGPDGYPLIHARYLGEMRTFTPTQVLGMVFSDLKTIAEKNLNAAVV  220

Query  633  DCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALAY  761
            DCCIGIP+YFTDLQRRAV+DAATIAGLHPL L HETTATALAY
Sbjct  221  DCCIGIPIYFTDLQRRAVMDAATIAGLHPLHLIHETTATALAY  263



>gb|AFW77408.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=1186

 Score =   382 bits (981),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = +3

Query  216  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  395
            KMSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MN
Sbjct  343  KMSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMN  402

Query  396  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  575
            P+N+ISQ+KRL+GR+FSDPE+Q D+ SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L 
Sbjct  403  PRNSISQIKRLLGRKFSDPEVQSDIASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLA  462

Query  576  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            MVLSNLKSIAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIAGL PLRLFHETTATAL
Sbjct  463  MVLSNLKSIAEGNLKTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLRPLRLFHETTATAL  522

Query  756  AYGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            AYGIYKTDLPE++ LNVAFVDVGHAS+QV I
Sbjct  523  AYGIYKTDLPEHDQLNVAFVDVGHASMQVSI  553



>gb|EMS52665.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=1269

 Score =   383 bits (983),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 200/212 (94%), Gaps = 0/212 (0%)
 Frame = +3

Query  213  TKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMM  392
            ++MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S M
Sbjct  159  SEMSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTM  218

Query  393  NPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVL  572
            NPKN+ISQ+KRL+GR+F+DPELQ D+K+FPF V+EGPDGFPL+H RYLGE R+FTPTQ+L
Sbjct  219  NPKNSISQIKRLLGRKFADPELQNDIKAFPFRVSEGPDGFPLVHVRYLGEERSFTPTQLL  278

Query  573  GMVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATA  752
             MVLSNLK+IAE NLN+AV+DCCIGIPVYFTDLQRRAVIDAATIAGL PLRLFHETTATA
Sbjct  279  AMVLSNLKAIAEGNLNSAVIDCCIGIPVYFTDLQRRAVIDAATIAGLRPLRLFHETTATA  338

Query  753  LAYGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            LAYGIYKTDLPEN+ LNVAFVDVG+AS+QV I
Sbjct  339  LAYGIYKTDLPENDQLNVAFVDVGNASMQVSI  370



>dbj|BAJ90753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=835

 Score =   373 bits (957),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/210 (82%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
             N+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+ ARYLGE   FTPTQ+L M
Sbjct  61   NNSISQIKRLLGRKFADPELQRDLQSFPFLVSEGPDGFPLVQARYLGEEHAFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK+IAE NL +AVVDCCIGIPVYFTDLQRR+V+DAATIAGL PLRL HETTATALA
Sbjct  121  VLSNLKAIAEDNLKSAVVDCCIGIPVYFTDLQRRSVLDAATIAGLRPLRLLHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDL EN+ LNVAFVDVGHAS+QV I
Sbjct  181  YGIYKTDLLENDQLNVAFVDVGHASMQVRI  210



>ref|XP_001764380.1| predicted protein [Physcomitrella patens]
 gb|EDQ70934.1| predicted protein [Physcomitrella patens]
Length=820

 Score =   365 bits (938),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+C+V VARQRGIDVVLNDESKRETP +V FGEKQRF+G AGAA+++MNP
Sbjct  1    MSVVGFDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFGEKQRFVGVAGAASALMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ+KR+IGR FSDPELQ DL+ FPFSVTEGPDGFP I+ +YLGE R FTPTQVLGM
Sbjct  61   KNTISQIKRMIGRPFSDPELQNDLRLFPFSVTEGPDGFPSINVQYLGEPRQFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLKSIAE NL  +VVDC IG+PVYFT+LQRRA +DAA IAGLHPLRL HETTATALA
Sbjct  121  LLSNLKSIAEKNLGTSVVDCVIGVPVYFTELQRRAYLDAAQIAGLHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDL + EP+NV FVDVGHAS+QVCI
Sbjct  181  YGIYKTDLSDTEPINVVFVDVGHASMQVCI  210



>ref|XP_001755636.1| predicted protein [Physcomitrella patens]
 gb|EDQ79696.1| predicted protein [Physcomitrella patens]
Length=770

 Score =   363 bits (933),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V F EKQRFLG AGAA++MMNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFAEKQRFLGVAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +NTISQ+KR+IGR FSDPE+Q DL+ FPFSVTEGPDGFPLI+ +YLGE R FTPTQVLGM
Sbjct  61   RNTISQIKRMIGRPFSDPEMQEDLRLFPFSVTEGPDGFPLINVQYLGEPRQFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLKSIAE NL  +VVDC IG+PVYFT+LQRRA +DAA +AGLHPLRL HETTATALA
Sbjct  121  LLSNLKSIAEKNLGTSVVDCVIGVPVYFTELQRRAYLDAAQVAGLHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDL + +P+NVAFVD+GHAS+QVCI
Sbjct  181  YGIYKTDLSDTDPINVAFVDIGHASMQVCI  210



>ref|XP_006654112.1| PREDICTED: heat shock 70 kDa protein 15-like [Oryza brachyantha]
Length=856

 Score =   363 bits (932),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESC+VAVAR RGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARLRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +N+ISQ+KRL+GR F+DPELQRDL SFPF V+EG  G+PL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSISQIKRLLGRSFADPELQRDLGSFPFRVSEGLGGYPLVHARYLGEDRAFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLN AVVDCCIGIP YFTDLQRRAV +AATI GL  LRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNCAVVDCCIGIPAYFTDLQRRAVAEAATIVGLRSLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPEN+ LNVAF+DVGHAS+QV I
Sbjct  181  YGIYKTDLPENDWLNVAFIDVGHASMQVSI  210



>ref|NP_001054812.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|AAW57812.1| putative heat shock protein Hsp70 [Oryza sativa Japonica Group]
 dbj|BAF16726.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|EEE62549.1| hypothetical protein OsJ_17347 [Oryza sativa Japonica Group]
Length=853

 Score =   362 bits (929),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNES +VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +N++SQ+KRL+GR F+DPELQRDL SFPF V+EGPDGFPL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSVSQIKRLLGRAFADPELQRDLASFPFRVSEGPDGFPLVHARYLGEDRAFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLNAAV DCCIGIP YFTDLQRRAV DAA IAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNAAVFDCCIGIPAYFTDLQRRAVADAAAIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE E LNVAF+DVGHAS+QV I
Sbjct  181  YGIYKTDLPEKEWLNVAFIDVGHASMQVSI  210



>gb|EAY96776.1| hypothetical protein OsI_18700 [Oryza sativa Indica Group]
Length=853

 Score =   362 bits (929),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNES +VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +N++SQ+KRL+GR F+DPELQRDL SFPF V+EGPDGFPL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSVSQIKRLLGRAFADPELQRDLASFPFRVSEGPDGFPLVHARYLGEDRAFTPTQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK IAE NLNAAV DCCIGIP YFTDLQRRAV DAA IAGL PLRLFHETTATALA
Sbjct  121  VLSNLKGIAEGNLNAAVFDCCIGIPAYFTDLQRRAVADAAAIAGLRPLRLFHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE E LNVAF+DVGHAS+QV I
Sbjct  181  YGIYKTDLPEKEWLNVAFIDVGHASMQVSI  210



>ref|XP_001760080.1| predicted protein [Physcomitrella patens]
 gb|EDQ75205.1| predicted protein [Physcomitrella patens]
Length=816

 Score =   359 bits (921),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V FGEKQRF+G AGAA+++MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGVVSFGEKQRFVGVAGAASALMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +NTISQ+KR+IGR FSDPELQ+DL  FPF+VTEGPDG PLI+ +YLGE R FTPTQVLGM
Sbjct  61   RNTISQIKRMIGRSFSDPELQKDLHLFPFTVTEGPDGSPLINVQYLGEPRQFTPTQVLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LSNLKSIAE NL  +VVDC IG+PVYFT+LQRRA +DAA +AGLHPLRL HETTATALA
Sbjct  121  LLSNLKSIAEKNLGTSVVDCVIGVPVYFTELQRRAYLDAAQVAGLHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDL + EP+NV FVDVGHAS+QVCI
Sbjct  181  YGIYKTDLSDTEPINVVFVDVGHASMQVCI  210



>ref|XP_002986462.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
 gb|EFJ12319.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
Length=774

 Score =   353 bits (906),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETPA+V F EKQRFLGTA AA++ MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPAMVSFSEKQRFLGTAAAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +NT+SQ+KRLIGR+F+DPE+Q+DL+  PF+VTE  DG  LIH RYLGE++ FTPTQ+LGM
Sbjct  61   RNTVSQIKRLIGRRFADPEVQKDLQLLPFNVTEAADGTCLIHVRYLGEVKAFTPTQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK+IAETNL   VVDC IGIPVYF+DLQRRA +DAA+IAGLHPLRL HETTATALA
Sbjct  121  VLSNLKTIAETNLGTHVVDCVIGIPVYFSDLQRRAYLDAASIAGLHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE +P++VAFVDVGHAS QVCI
Sbjct  181  YGIYKTDLPEGDPVHVAFVDVGHASTQVCI  210



>ref|XP_002978946.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
 gb|EFJ19903.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
Length=779

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V F EKQRFLGTA AA++ MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFSEKQRFLGTAAAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +NT+SQ+KRLIGR+F+DPE+Q+DL+  PF+VTE  DG  LIH RYLGE++ FTPTQ+LGM
Sbjct  61   RNTVSQIKRLIGRRFADPEVQKDLQLLPFNVTEAADGTCLIHVRYLGEVKAFTPTQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            VLSNLK+IAETNL   VVDC IGIPVYF+DLQRRA +DAA+IAGLHPLRL HETTATALA
Sbjct  121  VLSNLKTIAETNLGTHVVDCVIGIPVYFSDLQRRAYLDAASIAGLHPLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE +P++VAFVDVGHAS QVCI
Sbjct  181  YGIYKTDLPEGDPVHVAFVDVGHASTQVCI  210



>gb|KHN47807.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=816

 Score =   316 bits (810),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRL  728
            +LSNLK IAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIAGLHPLR+
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRM  170



>ref|XP_008226915.1| PREDICTED: heat shock 70 kDa protein 16 [Prunus mume]
Length=777

 Score =   313 bits (803),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 172/210 (82%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+FS+P++QRDL+  PF  +E PDG  LIH +YLGE  TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFSEPDVQRDLRMLPFQTSEAPDGGILIHLKYLGETHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+AGL PLRL H+ TATAL+
Sbjct  121  LFAHLKDLIEKNQEIPISDCVIGIPSYFTDLQRRAYLDAATVAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD P + P  VAFVD+GH   QV I
Sbjct  181  YGIYKTDFPSSGPTYVAFVDIGHCDTQVTI  210



>ref|XP_011030785.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Populus 
euphratica]
Length=771

 Score =   313 bits (801),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MN 
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNL  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TI QVKRLIGR F DPE Q +LK  PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEFQNELKLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + SNLK++ E NL   V DC IGIP YFTDLQRRA +DAATIAGL PLRL H+  ATAL+
Sbjct  121  LFSNLKNVTEKNLEIPVTDCVIGIPSYFTDLQRRAYLDAATIAGLKPLRLMHDCAATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD  +  P  VAFVD+GH   QV I
Sbjct  181  YGIYKTDFSKTGPTYVAFVDIGHCDTQVSI  210



>ref|XP_011030786.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Populus 
euphratica]
Length=770

 Score =   313 bits (801),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MN 
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNL  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TI QVKRLIGR F DPE Q +LK  PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEFQNELKLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + SNLK++ E NL   V DC IGIP YFTDLQRRA +DAATIAGL PLRL H+  ATAL+
Sbjct  121  LFSNLKNVTEKNLEIPVTDCVIGIPSYFTDLQRRAYLDAATIAGLKPLRLMHDCAATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD  +  P  VAFVD+GH   QV I
Sbjct  181  YGIYKTDFSKTGPTYVAFVDIGHCDTQVSI  210



>ref|XP_007213641.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
 gb|EMJ14840.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
Length=777

 Score =   313 bits (801),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 172/210 (82%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+FS+P++QRDL+  PF  +E PDG  LIH +YLGE  TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFSEPDVQRDLRMLPFQTSEAPDGGILIHLKYLGETHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+AGL PLRL H+ TATAL+
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDLQRRAYLDAATVAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYK+D P + P  VAFVD+GH   QV I
Sbjct  181  YGIYKSDFPSSGPTYVAFVDIGHCDTQVTI  210



>ref|XP_008363587.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=342

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F++P++QRDL+  P   +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLQILPLDTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+AGL PLRL H+ TATAL+
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDLQRRAYLDAATVAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD   + P  VAF+D+G    QV I
Sbjct  181  YGIYKTDFSTSGPTYVAFIDIGQCDTQVSI  210



>ref|XP_002317001.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
 gb|EEE97613.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
Length=770

 Score =   311 bits (797),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TI QVKRLIGR F DPE+Q +L   PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEVQNELTLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + SNLK I E NL   V DC IG+P YFTDLQRRA +DAATIAGL PLRL H+  A AL+
Sbjct  121  LFSNLKDITEKNLEIPVTDCVIGVPSYFTDLQRRAYLDAATIAGLKPLRLMHDCAAIALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD  +  P  VAFVD+GH   QV I
Sbjct  181  YGIYKTDCSKTGPTYVAFVDIGHCDTQVSI  210



>gb|KCW67010.1| hypothetical protein EUGRSUZ_F00767 [Eucalyptus grandis]
Length=711

 Score =   309 bits (792),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESNRETPAIVCFGEKQRFLGSAGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F+DP++QR+LK  P    EGPDG  LI  +Y GE  TF+PTQV+ M
Sbjct  61   KSTVSQVKRLIGRKFADPDVQRELKMLPVETCEGPDGGILIRIQYAGEKHTFSPTQVMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK IAE NL   V DC IGIP YFTDLQRRA ++AATIAGL PLRL H+ TATAL+
Sbjct  121  LFAHLKDIAEKNLEIPVSDCVIGIPSYFTDLQRRAYLNAATIAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P  VAFVD+GH   QVCI
Sbjct  181  YGIYKTDFSSRGPTFVAFVDIGHCDTQVCI  210



>ref|XP_010060358.1| PREDICTED: heat shock 70 kDa protein 16 [Eucalyptus grandis]
Length=774

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESNRETPAIVCFGEKQRFLGSAGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F+DP++QR+LK  P    EGPDG  LI  +Y GE  TF+PTQV+ M
Sbjct  61   KSTVSQVKRLIGRKFADPDVQRELKMLPVETCEGPDGGILIRIQYAGEKHTFSPTQVMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK IAE NL   V DC IGIP YFTDLQRRA ++AATIAGL PLRL H+ TATAL+
Sbjct  121  LFAHLKDIAEKNLEIPVSDCVIGIPSYFTDLQRRAYLNAATIAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P  VAFVD+GH   QVCI
Sbjct  181  YGIYKTDFSSRGPTFVAFVDIGHCDTQVCI  210



>ref|XP_008353314.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=395

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F++P++QRDL+  P   +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLQILPLDTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+AGL PLRL H+ TATAL+
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDLQRRAYLDAATVAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD   + P  VAF+D+G    QV I
Sbjct  181  YGIYKTDFSTSGPTYVAFIDIGXCDTQVSI  210



>ref|XP_004500055.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=770

 Score =   305 bits (781),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG++GAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSSGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR+F DP+++RDLK  P   +EGPDG  LIH +YL    TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFQDPDMERDLKMLPLETSEGPDGGILIHLKYLEGTHTFTPVQIMSM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK++ E +L  ++ DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL+
Sbjct  121  LFAHLKTMTEKDLETSISDCVIGIPSYFTDLQRRAYLDAAKIAGLKPLRLIHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKT+   +   NV F+D+GH   QVC+
Sbjct  181  YGIYKTNFQSSGSTNVVFIDIGHCDTQVCV  210



>gb|AII99893.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   305 bits (780),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG++GAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSSGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR+F DP+++RDLK  P   +EGPDG  LIH +YL    TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFQDPDMERDLKMLPLETSEGPDGGILIHLKYLEGTHTFTPVQIMSM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK++ E +L  ++ DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL+
Sbjct  121  LFAHLKTMTEKDLETSISDCVIGIPSYFTDLQRRAYLDAAKIAGLKPLRLIHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKT+   +   NV F+D+GH   QVC+
Sbjct  181  YGIYKTNFQSSGSTNVVFIDIGHCDTQVCV  210



>ref|XP_009352450.1| PREDICTED: heat shock 70 kDa protein 16-like, partial [Pyrus 
x bretschneideri]
Length=736

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQHDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+AGL PLRL H+ TATAL 
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDLQRRAYLDAATVAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD   + P  VAF+D+GH   QV I
Sbjct  181  YGIYKTDFSTSGPTYVAFIDIGHCDTQVSI  210



>gb|AET00484.2| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score =   305 bits (780),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AVA+Q G+DV+LN+ES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQGGVDVLLNNESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+ +SQVKRLIGR+F DP++Q DLK FPF   EG DG  LIH  YL E   FTP Q+LGM
Sbjct  61   KSIVSQVKRLIGRRFDDPDVQNDLKMFPFETFEGSDGGILIHLEYLNETHKFTPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK+IAE +L +AV DC IG+P YFTDLQRRA +DAATI GL PL L H+ TAT L 
Sbjct  121  LFAHLKTIAENDLGSAVSDCVIGVPSYFTDLQRRAYLDAATIVGLKPLMLIHDCTATGLG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YKTD P+ +P+ VAFVD+GH   QV I
Sbjct  181  YGVYKTDFPQGDPIYVAFVDIGHCDTQVSI  210



>ref|XP_003617525.1| 97 kDa heat shock protein [Medicago truncatula]
Length=789

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AVA+Q G+DV+LN+ES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQGGVDVLLNNESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+ +SQVKRLIGR+F DP++Q DLK FPF   EG DG  LIH  YL E   FTP Q+LGM
Sbjct  61   KSIVSQVKRLIGRRFDDPDVQNDLKMFPFETFEGSDGGILIHLEYLNETHKFTPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK+IAE +L +AV DC IG+P YFTDLQRRA +DAATI GL PL L H+ TAT L 
Sbjct  121  LFAHLKTIAENDLGSAVSDCVIGVPSYFTDLQRRAYLDAATIVGLKPLMLIHDCTATGLG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YKTD P+ +P+ VAFVD+GH   QV I
Sbjct  181  YGVYKTDFPQGDPIYVAFVDIGHCDTQVSI  210



>gb|ERN19664.1| hypothetical protein AMTR_s00062p00170870 [Amborella trichopoda]
Length=568

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+G+E+CVVAVA+QRGI+VVLNDESKRETPA+V FGEKQRFLG++G A++ MNP
Sbjct  1    MSVVGFDIGDENCVVAVAKQRGIEVVLNDESKRETPAIVSFGEKQRFLGSSGLASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQ+KRLIGR+F+ P  QRDL   PF+ +E PDG  LIH  Y+GE R FTP QVL M
Sbjct  61   KSTVSQIKRLIGRKFNCPYAQRDLHFLPFATSEAPDGGILIHIPYMGETRVFTPVQVLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK IA  NL   V DC IGIP YFTDLQRRA ++AA IAGL PLRL H+ TATALA
Sbjct  121  LLSHLKQIAAKNLELGVTDCVIGIPSYFTDLQRRAYLEAAAIAGLKPLRLMHDGTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD   +   NV FVD+GH   QVC+
Sbjct  181  YGIYKTDFASSGGTNVVFVDIGHCDTQVCV  210



>ref|XP_009352433.1| PREDICTED: heat shock 70 kDa protein 16-like [Pyrus x bretschneideri]
Length=762

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQHDLQILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+AGL PLRL H+ TATAL+
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDLQRRAYLDAATVAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD   + P  VAF+D+GH   QV I
Sbjct  181  YGIYKTDFSTSGPTYVAFIDIGHCDTQVSI  210



>ref|XP_003600064.1| Heat shock 70 kDa protein 4L [Medicago truncatula]
 gb|AES70315.1| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score =   303 bits (777),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKR IGR+F DP++++DLK  P   +EGPDG  LIH +YL  + TFTP Q++ M
Sbjct  61   KSTISQVKRFIGRKFLDPDMEKDLKMLPLETSEGPDGGVLIHLKYLDGIHTFTPVQIMSM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK++ E +L A + DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL+
Sbjct  121  LFAHLKTMTEKDLEAPISDCVIGIPSYFTDLQRRAYLDAAIIAGLKPLRLIHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKT+   + P  VAF+D+G    QVCI
Sbjct  181  YGIYKTNFNSDGPSYVAFIDIGQCDTQVCI  210



>ref|XP_007020850.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12375.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=765

 Score =   303 bits (776),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+A  +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            + T+SQVKRLIGR+F +P++Q++L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   QTTVSQVKRLIGRKFREPDVQKELRLLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK I ETNL  +V+DC IGIP YFTDLQRR  +DAA IAGL PLRL H+ TATAL 
Sbjct  121  LFAHLKYITETNLGVSVLDCVIGIPSYFTDLQRRVYLDAAAIAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDL    P  VAFVD+GH   QV I
Sbjct  181  YGIYKTDLSNAGPTYVAFVDIGHCDTQVSI  210



>ref|XP_008366399.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=777

 Score =   303 bits (776),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F++P++QRDL+  PF  +EGPDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLRILPFETSEGPDGGILIHLKYLGXTHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC I IP YF DLQRR  +DAAT+AGL PLRL H+ TATAL+
Sbjct  121  LFAHLKDLIEKNQEMPISDCVISIPSYFADLQRRXYLDAATVAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD   + P  VAFVD+GH   QV I
Sbjct  181  YGIYKTDFSTSGPTYVAFVDIGHCDTQVSI  210



>ref|XP_002522946.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
 gb|EEF39376.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
Length=740

 Score =   301 bits (771),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CVVA  +Q GIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVVATVKQGGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TI QVKRLIGR F+DP+++ +LK  PF ++ G DG  LIH +YLGEM TFTP Q++ M
Sbjct  61   KSTICQVKRLIGRNFADPDIRNELKLLPFEISGGKDGGILIHLKYLGEMYTFTPVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK I E NL   V DC IGIP YF+DLQRRA ++AATIAGL PLRL H+ TATAL+
Sbjct  121  LFSHLKEITEKNLEMPVTDCVIGIPSYFSDLQRRAYLNAATIAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKT+   + P  VAFVD+GH  +QV I
Sbjct  181  YGIYKTEFSNSGPTFVAFVDIGHCDMQVSI  210



>ref|XP_009760615.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
 ref|XP_009760616.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
Length=753

 Score =   301 bits (771),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIAFAKQRGIDVILNDESKRETPAVVSFGEKQRFIGSAGAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR++ +P +Q+DLK  PF+ +EGPDG  LIH +Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLLPFTTSEGPDGGILIHLQYMNEKQSFTPVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK IAE NL   V DC IGIP YFTDLQRRA + AA IAGL PLRL H+ TATAL 
Sbjct  121  LFAHLKQIAEKNLEMDVSDCVIGIPSYFTDLQRRAYLYAAEIAGLKPLRLMHDGTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P NV FVDVGH   QV +
Sbjct  181  YGIYKTDFSAGGPTNVVFVDVGHCDTQVVV  210



>gb|EYU27798.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=722

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRFLG+AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQRGIDVLLNDESNRENPAVVSFGEKQRFLGSAGAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR FS+P +Q DL+  PF  +EGPDG  LIH RYL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRNFSEPTVQNDLRLLPFETSEGPDGGILIHLRYLEERQTFTPIQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L++LK IAE NL   + +C IGIP YFT LQRRA + AA IAGL PLRL H+ TATAL 
Sbjct  121  LLAHLKQIAEKNLETQISNCVIGIPSYFTALQRRAYLHAAEIAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD P   P NV FVD+GH   QV +
Sbjct  181  YGIYKTDYPTKGPTNVVFVDIGHCDTQVAV  210



>gb|EYU27799.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=766

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRFLG+AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQRGIDVLLNDESNRENPAVVSFGEKQRFLGSAGAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR FS+P +Q DL+  PF  +EGPDG  LIH RYL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRNFSEPTVQNDLRLLPFETSEGPDGGILIHLRYLEERQTFTPIQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L++LK IAE NL   + +C IGIP YFT LQRRA + AA IAGL PLRL H+ TATAL 
Sbjct  121  LLAHLKQIAEKNLETQISNCVIGIPSYFTALQRRAYLHAAEIAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD P   P NV FVD+GH   QV +
Sbjct  181  YGIYKTDYPTKGPTNVVFVDIGHCDTQVAV  210



>ref|XP_009372708.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Pyrus 
x bretschneideri]
Length=718

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQSDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC I IP YFTDLQR A +DAAT+AGL PLRL H+ TATAL+
Sbjct  121  LFAHLKDLIEKNQEMPISDCVISIPSYFTDLQRHAYLDAATVAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD   + P  VAFVD+GH   QV I
Sbjct  181  YGIYKTDFSTSGPTYVAFVDIGHCDTQVSI  210



>ref|XP_004151979.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis sativus]
 gb|KGN57923.1| hypothetical protein Csa_3G391900 [Cucumis sativus]
Length=762

 Score =   301 bits (770),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RETPA++ FGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETPAVIYFGEKQRFLGSAGAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            ++TISQVKRLIGR FS+P++Q +LK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFSEPDVQIELKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L++LK +AE NL A   DC IGIP YFTDLQRR    AA IAGL PLRL H+ TATAL+
Sbjct  121  LLAHLKDVAEKNLGAPFSDCVIGIPSYFTDLQRRLYWSAAVIAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P+ VAFVD+GH   QV I
Sbjct  181  YGIYKTDFSNTGPIYVAFVDIGHCDTQVSI  210



>ref|XP_007020851.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12376.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=764

 Score =   300 bits (769),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV++  +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVISAVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K  +SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LI  +YLGE   FTP Q++ M
Sbjct  61   KTMVSQVKRLIGRKFKDPDVQNELRLLPFETSEGQDGGILIQLKYLGETHRFTPLQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK IAE NL  +V+DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL 
Sbjct  121  LFAHLKYIAEANLGVSVLDCVIGIPSYFTDLQRRAYLDAAAIAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDL    P  VAFVD+GH   QV I
Sbjct  181  YGIYKTDLSNAGPTYVAFVDIGHCDTQVSI  210



>ref|XP_009614255.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana tomentosiformis]
Length=753

 Score =   300 bits (768),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIAFAKQRGIDVILNDESKRETPAVVSFGEKQRFIGSAGAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR++ +P +Q DLK  PF+ +EGPDG  LIH +Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQMDLKLLPFATSEGPDGGILIHLQYMNEKQSFTPVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK IAE NL   V DC IGIP YFTDLQRRA + AA IAGL PLRL H+ TATAL 
Sbjct  121  LFAHLKQIAEKNLEMDVSDCVIGIPSYFTDLQRRAYLYAAEIAGLKPLRLMHDGTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P NV FVDVGH   QV +
Sbjct  181  YGIYKTDFSAGGPTNVVFVDVGHCDTQVVV  210



>ref|XP_012070816.1| PREDICTED: heat shock 70 kDa protein 16 [Jatropha curcas]
 gb|KDP39123.1| hypothetical protein JCGZ_00880 [Jatropha curcas]
Length=771

 Score =   300 bits (769),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+A  +QRGIDV+LNDESKRETPA++CFGE+QR LG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGIDVLLNDESKRETPAVICFGERQRLLGSAGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR F DP++Q DLK  PF  + G DG  LIH RYLGE+ TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRNFKDPDVQNDLKLLPFETSGGQDGGILIHLRYLGEIHTFTPVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK I E +L   V DC IGIP YFTDLQRR+ ++AATIAGL PLRL H+ TATAL+
Sbjct  121  LFSHLKEITEKDLEMPVSDCVIGIPSYFTDLQRRSYLNAATIAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIY+TD     P  VAFVD+GH   QV I
Sbjct  181  YGIYRTDFDNAGPTYVAFVDIGHCDTQVSI  210



>ref|XP_010092150.1| Heat shock 70 kDa protein 16 [Morus notabilis]
 gb|EXB50301.1| Heat shock 70 kDa protein 16 [Morus notabilis]
Length=749

 Score =   300 bits (767),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA+++MNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAVMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIG +FS+P++Q +LK FPF  +E PDG  LIH +YLGE  TFT  Q++ M
Sbjct  61   KSTVSQVKRLIGTKFSEPDIQNELKLFPFETSEAPDGGILIHLKYLGETHTFTLVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++L+ +AE NL   V DC IGIP YF+DLQRRA +DAA+IAGL PLRL H+ TATAL+
Sbjct  121  LFAHLRELAEKNLEILVSDCVIGIPSYFSDLQRRAYLDAASIAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYK D   + P  VAFVD+G    QV I
Sbjct  181  YGIYKMDYSASGPTYVAFVDIGQCDTQVSI  210



>ref|XP_009372707.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Pyrus 
x bretschneideri]
Length=761

 Score =   300 bits (767),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQSDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC I IP YFTDLQR A +DAAT+AGL PLRL H+ TATAL+
Sbjct  121  LFAHLKDLIEKNQEMPISDCVISIPSYFTDLQRHAYLDAATVAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD   + P  VAFVD+GH   QV I
Sbjct  181  YGIYKTDFSTSGPTYVAFVDIGHCDTQVSI  210



>ref|XP_011628468.1| PREDICTED: heat shock 70 kDa protein 16 [Amborella trichopoda]
Length=768

 Score =   299 bits (766),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+G+E+CVVAVA+QRGI+VVLNDESKRETPA+V FGEKQRFLG++G A++ MNP
Sbjct  1    MSVVGFDIGDENCVVAVAKQRGIEVVLNDESKRETPAIVSFGEKQRFLGSSGLASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQ+KRLIGR+F+ P  QRDL   PF+ +E PDG  LIH  Y+GE R FTP QVL M
Sbjct  61   KSTVSQIKRLIGRKFNCPYAQRDLHFLPFATSEAPDGGILIHIPYMGETRVFTPVQVLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK IA  NL   V DC IGIP YFTDLQRRA ++AA IAGL PLRL H+ TATALA
Sbjct  121  LLSHLKQIAAKNLELGVTDCVIGIPSYFTDLQRRAYLEAAAIAGLKPLRLMHDGTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD   +   NV FVD+GH   QVC+
Sbjct  181  YGIYKTDFASSGGTNVVFVDIGHCDTQVCV  210



>ref|XP_008465078.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
 ref|XP_008465079.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
Length=762

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RET A++CFGEKQRFLG+A AA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETSAVICFGEKQRFLGSAAAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            ++TISQVKRLIGR F++P +Q DLK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFTEPGVQIDLKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L++L+ +AE NL A   DC IGIP YFTDLQRR   +AA IAGL PLRL H+ TATAL+
Sbjct  121  LLAHLRDVAEKNLGAPFSDCVIGIPSYFTDLQRRLYWNAAAIAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P+ VAFVD+GH   QV I
Sbjct  181  YGIYKTDFSNTGPIYVAFVDIGHCDTQVSI  210



>ref|XP_008355346.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=498

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPALVCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVNQWGVDVLLNDESKRETPALVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRL+GR+F++P++QRDL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLMGRKFTEPDVQRDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC IGIP YFTD QRRA +DAA +AGL PLRL H+ TATA +
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDXQRRAYLDAAXVAGLKPLRLMHDCTATAHS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+Y TD   + P  VAF+D+GH   QV I
Sbjct  181  YGVYXTDFSTSGPTYVAFIDIGHCDTQVSI  210



>ref|XP_008345050.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=440

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 163/210 (78%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPALVCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVNQWGVDVLLNDESKRETPALVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRL+GR+F++P++QRDL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLMGRKFTEPDVQRDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC IGIP YFTD QRRA +DAA +AGL  LRL H+ TATA +
Sbjct  121  LFAHLKDLIEKNQEMPIXDCVIGIPSYFTDXQRRAYLDAAXVAGLKXLRLMHDCTATAHS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+Y TD   + P  VAF+D+GH   QV I
Sbjct  181  YGVYXTDFSTSGPTYVAFIDIGHCDTQVSI  210



>ref|XP_004232717.1| PREDICTED: heat shock 70 kDa protein 16 [Solanum lycopersicum]
Length=753

 Score =   297 bits (760),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+ VA+QRGIDV+LNDES RETPA+V FGEKQRF+G AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIGVAKQRGIDVILNDESNRETPAVVSFGEKQRFIGAAGAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR++ +P +Q+DLK  PF+ +EGPDG  LI+  Y+ E  +FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLLPFATSEGPDGGILINLHYMDEKHSFTPVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK IAE NL   V DC IGIP YFTDLQRRA ++AA IAGL PLRL H+ TATAL 
Sbjct  121  LFAHLKQIAEKNLETDVSDCVIGIPSYFTDLQRRAYLNAAEIAGLKPLRLMHDGTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P NV FVDVGH   QV +
Sbjct  181  YGIYKTDFSAGGPTNVVFVDVGHCDTQVVV  210



>gb|KJB69295.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69296.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69297.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69298.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
Length=774

 Score =   297 bits (760),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVG D+GNE+C++AVA+QRGIDV+LNDESKRETPA V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGLDIGNENCIIAVAKQRGIDVLLNDESKRETPAAVSFGEKQRFIGSAGAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            ++TI QVKRLIGR+F++P L+++LK FPF   E PDG  LI  +++GE+  FTP Q+LGM
Sbjct  61   RSTILQVKRLIGRKFNEPGLEKELKLFPFETFESPDGGILIRLQFMGEVHEFTPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE NL   V +C IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL 
Sbjct  121  LFSHLKQIAEKNLEMPVSECVIGIPSYFTDLQRRAYLDAAAIAGLKPLRLLHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD+  + P+   FVD+GH   Q+CI
Sbjct  181  YGIYKTDISNSNPVYTVFVDIGHCDTQICI  210



>ref|XP_010278704.1| PREDICTED: heat shock 70 kDa protein 16 [Nelumbo nucifera]
Length=777

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNESCV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G +GAA+++MNP
Sbjct  1    MSVVGFDIGNESCVIAAAKQRGIDVLLNDESKRETPAVVSFGEKQRFIGASGAASALMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIG  F  P++Q++L++FPF  +EG DG  LIH +YLGE    TP Q+L M
Sbjct  61   KSTISQVKRLIGLNFRQPDVQKELRNFPFETSEGSDGNILIHLQYLGETLKLTPVQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE NL   V DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL 
Sbjct  121  LFSHLKQIAEKNLETPVSDCVIGIPSYFTDLQRRAYLDAAAIAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD+    P  V FVD+GH   QV +
Sbjct  181  YGIYKTDVFNAGPTYVVFVDIGHCDTQVSV  210



>gb|AII99889.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   296 bits (757),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV +Q G+DV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQGGVDVLLNDESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F+D ++Q DLK  P   +EG DG  LIH +YL E   FTP Q+L M
Sbjct  61   KSTVSQVKRLIGRRFADLDVQNDLKRLPIETSEGSDGGILIHLKYLKETHKFTPVQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK+IAE +L  AV DC IG+P YFTDLQRRA +DAATI GL PLRLFH+ TAT L 
Sbjct  121  LFAHLKTIAENDLGTAVSDCVIGVPSYFTDLQRRAYLDAATIVGLKPLRLFHDCTATGLG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YKTD P+  P+ V F+D+G    QV +
Sbjct  181  YGVYKTDFPQGGPIYVVFIDIGQCDTQVSV  210



>ref|XP_004491392.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=773

 Score =   295 bits (756),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV +Q G+DV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQGGVDVLLNDESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F+D ++Q DLK  P   +EG DG  LIH +YL E   FTP Q+L M
Sbjct  61   KSTVSQVKRLIGRRFADLDVQNDLKRLPIETSEGSDGGILIHLKYLKETHKFTPVQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK+IAE +L  AV DC IG+P YFTDLQRRA +DAATI GL PLRLFH+ TAT L 
Sbjct  121  LFAHLKTIAENDLGTAVSDCVIGVPSYFTDLQRRAYLDAATIVGLKPLRLFHDCTATGLG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YKTD P+  P+ V F+D+G    QV +
Sbjct  181  YGVYKTDFPQGGPIYVVFIDIGQCDTQVSV  210



>gb|KJB22069.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=686

 Score =   293 bits (749),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + ETNL   V+DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL 
Sbjct  121  LFAHLKYMTETNLGLPVLDCVIGIPSYFTDLQRRAYLDAAKIAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P NVAFVD+GH   QV I
Sbjct  181  YGIYKTDFSNAGPTNVAFVDIGHCDTQVSI  210



>ref|XP_010931798.1| PREDICTED: heat shock 70 kDa protein 16 [Elaeis guineensis]
Length=784

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 166/211 (79%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GN++CV+A  +QRGIDV+LNDESKRETPA+V FGEKQRFLGT GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESKRETPAVVSFGEKQRFLGTTGAASAAMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            ++T+SQVKRLIGR F  P++Q DL+  PF  ++ PDG  LIH RYL E R FTP Q+LGM
Sbjct  61   RSTVSQVKRLIGRAFDHPDVQADLRRLPFLTSQAPDGGILIHLRYLNEDRAFTPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L++LK +AE +L   V DC IGIP YFTDLQRRA +DAA IAGL PLRL H+T ATAL 
Sbjct  121  LLAHLKDVAEKSLETLVSDCVIGIPSYFTDLQRRAYLDAAAIAGLRPLRLMHDTAATALG  180

Query  759  YGIYKTDL-PENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDL P     +VAFVD+GH   QV +
Sbjct  181  YGIYKTDLAPPGAATSVAFVDIGHCDTQVSV  211



>ref|XP_004294376.1| PREDICTED: heat shock 70 kDa protein 16 [Fragaria vesca subsp. 
vesca]
Length=767

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVG D+GNE+CV+AV +QRGIDV+LN+ESKRETPA+VCFGEKQRFLG+A +A++MM+P
Sbjct  1    MSVVGIDIGNENCVIAVVKQRGIDVLLNEESKRETPAVVCFGEKQRFLGSAASASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F++ ++Q+DL+  PF  +EGPDG  LIH  YLG    FTP Q+  M
Sbjct  61   KSTVSQVKRLIGRRFNEADVQKDLRMLPFKTSEGPDGSILIHLSYLGGTHMFTPVQITAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++L+ I E NL   + DC IGIP YFTDLQRRA +DAAT+AGL PLRL H+ TATAL+
Sbjct  121  LFAHLREIIEKNLEMPISDCVIGIPSYFTDLQRRAYLDAATVAGLKPLRLMHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD  ++ P  VAFVD+GH   QV I
Sbjct  181  YGIYKTDFLKSGPTYVAFVDIGHCDTQVSI  210



>ref|XP_006348107.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Solanum 
tuberosum]
Length=753

 Score =   292 bits (748),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 165/210 (79%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+GFDVGNE+CV+ VA+QRGIDV+LNDES RETPA+V FG+KQRF+G AGAA++ MNP
Sbjct  1    MSVIGFDVGNENCVIGVAKQRGIDVILNDESNRETPAVVSFGDKQRFIGAAGAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR++ +P +Q+DLK FPF+ +EG DG  LI+  Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLFPFATSEGQDGGILINLHYMDEKQSFTPVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK IAE NL   V DC IGIP YFTDLQRRA + AA IAGL PLRL H+ TATAL 
Sbjct  121  LFAHLKQIAEKNLETDVSDCVIGIPSYFTDLQRRAYLYAAEIAGLKPLRLMHDGTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P NV FVDVGH   QV +
Sbjct  181  YGIYKTDFSAGGPTNVVFVDVGHCDTQVVV  210



>ref|XP_002278262.1| PREDICTED: heat shock 70 kDa protein 16 [Vitis vinifera]
Length=771

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV++V +QRGIDV+LNDESKRETP++VCFGEKQR LG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVISVVKQRGIDVLLNDESKRETPSVVCFGEKQRILGSAGAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            ++TI QVKRLIG  FS+P ++ +LK FPF  +EGPDG  LIH +YLGE  TFTP Q+L M
Sbjct  61   RSTIFQVKRLIGLNFSEPHIKDELKMFPFETSEGPDGGILIHLQYLGERHTFTPVQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK I E NL   ++DC IGIP YFTDLQRRA + AA IAGL PLRL H+ TATAL 
Sbjct  121  LFAHLKDITEKNLEFPILDCVIGIPSYFTDLQRRAYLYAAEIAGLKPLRLLHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P  + FVD+GH   QV I
Sbjct  181  YGIYKTDFSSAGPTYIVFVDIGHCDTQVSI  210



>ref|XP_011096072.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096074.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096075.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
Length=756

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AVA++RGIDV+LNDESKRE PA+V FGEKQRF+G AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKERGIDVLLNDESKRENPAVVSFGEKQRFIGCAGAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR +S+P +Q DL+  PF  +EGPDG  LIH +YL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRTYSEPTVQDDLRLLPFETSEGPDGGILIHLQYLDEKQTFTPIQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L++LK I E NL   + +C IGIP YFT LQRRA + AA IAGL PLRL H+ TA  L 
Sbjct  121  LLAHLKQITEKNLEKQITNCVIGIPSYFTALQRRAYLHAAEIAGLKPLRLMHDCTAIGLG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKT+ P   P NV FVDVGH+  QV I
Sbjct  181  YGIYKTEFPSKGPANVVFVDVGHSDTQVAI  210



>gb|KHG25442.1| Heat shock 70 kDa 16 -like protein [Gossypium arboreum]
Length=757

 Score =   291 bits (745),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + ETNL   V+DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL 
Sbjct  121  LFAHLKYMTETNLGLPVLDCVIGIPSYFTDLQRRAYLDAAKIAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P NVAFVD+GH   QV I
Sbjct  181  YGIYKTDFSNAGPTNVAFVDIGHCDTQVSI  210



>ref|XP_003553093.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=766

 Score =   291 bits (746),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCFGEKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFGEKQRILGSAGAASAMMHI  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y+GE+  FTP Q+L M
Sbjct  61   KSTISQIKRLIGRKFADPDVEKELKMLPVETSEGQDGGILIHLKYMGEIHVFTPVQLLSM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK++ E +L   + DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL+
Sbjct  121  LFAHLKTMTEKDLEMLISDCVIGIPSYFTDLQRRAYLDAAKIAGLKPLRLIHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YK D     P+NVAF+D+GH   QV I
Sbjct  181  YGMYKKDFGSAGPVNVAFIDIGHCDTQVSI  210



>gb|KJB22068.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
 gb|KJB22070.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=757

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + ETNL   V+DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL 
Sbjct  121  LFAHLKYMTETNLGLPVLDCVIGIPSYFTDLQRRAYLDAAKIAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P NVAFVD+GH   QV I
Sbjct  181  YGIYKTDFSNAGPTNVAFVDIGHCDTQVSI  210



>gb|KHN45217.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=766

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCFGEKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFGEKQRILGSAGAASAMMHI  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y+GE+  FTP Q+L M
Sbjct  61   KSTISQIKRLIGRKFADPDVEKELKMLPVETSEGQDGGILIHLKYMGEIHVFTPVQLLSM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK++ E +L   + DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL+
Sbjct  121  LFAHLKTMTEKDLEMPISDCVIGIPSYFTDLQRRAYLDAAKIAGLKPLRLIHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YK D     P+NVAF+D+GH   QV I
Sbjct  181  YGMYKKDFGSAGPVNVAFIDIGHCDTQVSI  210



>ref|XP_002305580.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
 gb|EEE86091.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
Length=757

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 163/210 (78%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+CV+AVA++RGIDV+LNDES RETPA+V F EKQRF+G+ GAA+  MNP
Sbjct  1    MSVVGFDFGNENCVIAVAKERGIDVLLNDESNRETPAVVSFFEKQRFMGSEGAASLTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F + E+Q DLK FPF + EG DG  LI  +YLGE+  F+P Q+LGM
Sbjct  61   KSTVSQVKRLIGRKFKEVEVQDDLKLFPFEIVEGHDGGILIKVQYLGEIHEFSPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE +L   + DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL 
Sbjct  121  LFSHLKQIAEKSLEMPISDCVIGIPCYFTDLQRRAYLDAAAIAGLRPLRLLHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYK D+    P  V FVD+GH   QVC+
Sbjct  181  YGIYKNDISNAGPTYVVFVDIGHCDTQVCL  210



>ref|XP_011037663.1| PREDICTED: heat shock 70 kDa protein 16 [Populus euphratica]
Length=769

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 163/210 (78%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNE+CV+AVA++RGIDV+LNDES RETPA+V F EKQRF+G+ GAA+  MNP
Sbjct  1    MSVVGFDFGNENCVIAVAKERGIDVLLNDESNRETPAVVSFFEKQRFMGSEGAASLTMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR+F + E+Q DLK FPF + EG DG  LI  +YLGE+  F+P Q+LGM
Sbjct  61   KSTVSQVKRLIGRKFKEVEVQDDLKLFPFEIVEGHDGGILIKVQYLGEIHEFSPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK IAE +L   + DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL 
Sbjct  121  LFSHLKQIAEKSLEMPISDCVIGIPCYFTDLQRRAYLDAAAIAGLRPLRLLHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYK D+    P  V FVD+GH   QVC+
Sbjct  181  YGIYKNDISNAGPTYVVFVDIGHCDTQVCL  210



>ref|XP_007146461.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
 gb|ESW18455.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
Length=771

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV R+RGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRERGIDVLLNYESKRETPAVVCFNEKQRLLGSAGAASAMMHI  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F+DP++ ++LK  P   +E PDG  LIH +YLGE+  FTP Q++ M
Sbjct  61   KSTISQIKRLIGRKFADPDVDKELKMLPLETSESPDGGILIHLKYLGEIHVFTPVQIMSM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK++ E +L   + DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL+
Sbjct  121  LFAHLKTMTEKDLEMPISDCVIGIPSYFTDLQRRAYLDAAKIAGLKPLRLIHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YKTD     P+ VAF+DVGH   QV I
Sbjct  181  YGMYKTDFTSTGPVYVAFIDVGHCDTQVSI  210



>ref|XP_008806739.1| PREDICTED: heat shock 70 kDa protein 16 isoform X2 [Phoenix dactylifera]
Length=782

 Score =   290 bits (741),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 166/211 (79%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GN++CV+A  +QRGIDV+LNDES+RETPA+V FGEKQRFLG+ GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESERETPAVVSFGEKQRFLGSTGAASAAMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            ++T+SQVKRL+GR F  P++Q DL+  PF  ++  DG  LIH RYL E RTFTP Q+LGM
Sbjct  61   RSTVSQVKRLVGRAFGHPDVQSDLRRLPFPTSQASDGGILIHIRYLNEDRTFTPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L++LK +AE +L  +V DC IGIP YFTDLQRRA +DAA IAGL PLRL H++ ATAL 
Sbjct  121  LLAHLKDVAEKSLETSVSDCVIGIPSYFTDLQRRAYLDAAAIAGLKPLRLMHDSAATALG  180

Query  759  YGIYKTDL-PENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDL P      VAFVD+GH   QV +
Sbjct  181  YGIYKTDLAPPGSATYVAFVDIGHCDTQVSV  211



>ref|XP_008806738.1| PREDICTED: heat shock 70 kDa protein 16 isoform X1 [Phoenix dactylifera]
Length=783

 Score =   290 bits (741),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 166/211 (79%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GN++CV+A  +QRGIDV+LNDES+RETPA+V FGEKQRFLG+ GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESERETPAVVSFGEKQRFLGSTGAASAAMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            ++T+SQVKRL+GR F  P++Q DL+  PF  ++  DG  LIH RYL E RTFTP Q+LGM
Sbjct  61   RSTVSQVKRLVGRAFGHPDVQSDLRRLPFPTSQASDGGILIHIRYLNEDRTFTPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L++LK +AE +L  +V DC IGIP YFTDLQRRA +DAA IAGL PLRL H++ ATAL 
Sbjct  121  LLAHLKDVAEKSLETSVSDCVIGIPSYFTDLQRRAYLDAAAIAGLKPLRLMHDSAATALG  180

Query  759  YGIYKTDL-PENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDL P      VAFVD+GH   QV +
Sbjct  181  YGIYKTDLAPPGSATYVAFVDIGHCDTQVSV  211



>ref|XP_006306833.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39731.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=737

 Score =   287 bits (734),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 168/211 (80%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGID++LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDILLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG  LI  RY+GEM+ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEGSDGGILIQLRYMGEMQGFSPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK IAE +L   V DC IGIP YFT+ QR A +DAA IAGL PLRL H++TATAL 
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATALG  180

Query  759  YGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
            YGIYKTDL  N  P  + F+D+GH   QVC+
Sbjct  181  YGIYKTDLAANASPTYIVFIDIGHCDTQVCV  211



>gb|KHM99573.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=769

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFSEKQRILGSAGAASAMMHI  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y GE+  FTP Q L M
Sbjct  61   KSTISQIKRLIGRKFADPDVKKELKMLPGKTSEGQDGGILIHLKYSGEIHVFTPVQFLSM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK++ E +L   + DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL+
Sbjct  121  LFAHLKTMTENDLEMPISDCVIGIPSYFTDLQRRAYLDAAKIAGLQPLRLIHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YKTD     P  VAF+D+GH   QVCI
Sbjct  181  YGMYKTDFGSAGPAYVAFIDIGHCDTQVCI  210



>ref|XP_003532123.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=769

 Score =   287 bits (735),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 166/210 (79%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFSEKQRILGSAGAASAMMHI  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y GE+  FTP Q L M
Sbjct  61   KSTISQIKRLIGRKFADPDVKKELKMLPGKTSEGQDGGILIHLKYSGEIHVFTPVQFLSM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK++ E +L   + DC IGIP YFTDLQRRA +DAA IAGL PLRL H+ TATAL+
Sbjct  121  LFAHLKTMTENDLEMPISDCVIGIPSYFTDLQRRAYLDAAKIAGLQPLRLIHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YKTD     P  VAF+D+GH   QVCI
Sbjct  181  YGMYKTDFGSAGPAYVAFIDIGHCDTQVCI  210



>ref|XP_006306834.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39732.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=763

 Score =   287 bits (734),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 168/211 (80%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGID++LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDILLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG  LI  RY+GEM+ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEGSDGGILIQLRYMGEMQGFSPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK IAE +L   V DC IGIP YFT+ QR A +DAA IAGL PLRL H++TATAL 
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATALG  180

Query  759  YGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
            YGIYKTDL  N  P  + F+D+GH   QVC+
Sbjct  181  YGIYKTDLAANASPTYIVFIDIGHCDTQVCV  211



>emb|CDP04389.1| unnamed protein product [Coffea canephora]
Length=767

 Score =   286 bits (733),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 162/210 (77%), Gaps = 1/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+G DVGNE+CVVAVA+QRGIDV+LNDESKRETPA+V FGEKQRF+G  GAA++ MNP
Sbjct  1    MSVLGLDVGNENCVVAVAKQRGIDVLLNDESKRETPAVVSFGEKQRFMGAVGAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            ++TISQVKRLIGR+F +P +Q DLK  PF  +EGPDG  LIH  YL E ++FTP Q++ M
Sbjct  61   RSTISQVKRLIGRKFREPSVQDDLKLVPFETSEGPDGGILIHLYYLDEKQSFTPFQIMVM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +  +LK I+E NL   V DC IGIP YFTDLQRRA + AA IAGL PLRL H+ TATAL 
Sbjct  121  LFGHLKQISEKNLETHVSDCVIGIPSYFTDLQRRAYLHAAEIAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P NV FVDVGH   QV +
Sbjct  181  YGIYKTDF-NGGPANVVFVDVGHCDTQVAV  209



>gb|KDO75458.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75459.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=692

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  395
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  396  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  575
            PK+TISQVKRL+GR+F + ++Q+DLK FPF   E  DG  LI   YLGE   FTP Q+LG
Sbjct  61   PKSTISQVKRLLGRKFREDDVQKDLKLFPFETCESHDGGILIMLEYLGETHKFTPVQILG  120

Query  576  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            M+LSNLK I E N+   + +C IG+P Y TD+QRRA +DAATIAGL PLRL H+ TATAL
Sbjct  121  MLLSNLKQITEKNIKIPISNCVIGVPCYLTDVQRRAYLDAATIAGLKPLRLMHDCTATAL  180

Query  756  AYGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
             YGIYKTD     P  V FVD+GH   QVC+
Sbjct  181  GYGIYKTDFSNVGPTYVVFVDIGHCDTQVCV  211



>ref|XP_006475182.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Citrus 
sinensis]
 gb|KDO62656.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=708

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 161/210 (77%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+A  + RG+DV+LN+ES RETP++VCFGEKQRF+G AG A++MM+P
Sbjct  1    MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR++ DP +Q+DL   PF   E PDG   I  +YLGE  TF P QV+GM
Sbjct  61   KSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK +AE NL   VVDC IG+P YFTDLQRR  ++AA+IAGL PLRL H+ TATAL 
Sbjct  121  LFSHLKDVAEKNLEMPVVDCVIGVPSYFTDLQRREYLNAASIAGLRPLRLIHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD        +AFVD+GH+  QV I
Sbjct  181  YGIYKTDFANGGKSYIAFVDIGHSDTQVSI  210



>ref|XP_006452327.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 ref|XP_006475181.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Citrus 
sinensis]
 gb|ESR65567.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 gb|KDO62654.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
 gb|KDO62655.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=763

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 161/210 (77%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+A  + RG+DV+LN+ES RETP++VCFGEKQRF+G AG A++MM+P
Sbjct  1    MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRLIGR++ DP +Q+DL   PF   E PDG   I  +YLGE  TF P QV+GM
Sbjct  61   KSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK +AE NL   VVDC IG+P YFTDLQRR  ++AA+IAGL PLRL H+ TATAL 
Sbjct  121  LFSHLKDVAEKNLEMPVVDCVIGVPSYFTDLQRREYLNAASIAGLRPLRLIHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD        +AFVD+GH+  QV I
Sbjct  181  YGIYKTDFANGGKSYIAFVDIGHSDTQVSI  210



>ref|XP_006468028.1| PREDICTED: heat shock 70 kDa protein 16-like [Citrus sinensis]
 gb|KDO75456.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75457.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=768

 Score =   283 bits (725),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  395
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  396  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  575
            PK+TISQVKRL+GR+F + ++Q+DLK FPF   E  DG  LI   YLGE   FTP Q+LG
Sbjct  61   PKSTISQVKRLLGRKFREDDVQKDLKLFPFETCESHDGGILIMLEYLGETHKFTPVQILG  120

Query  576  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            M+LSNLK I E N+   + +C IG+P Y TD+QRRA +DAATIAGL PLRL H+ TATAL
Sbjct  121  MLLSNLKQITEKNIKIPISNCVIGVPCYLTDVQRRAYLDAATIAGLKPLRLMHDCTATAL  180

Query  756  AYGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
             YGIYKTD     P  V FVD+GH   QVC+
Sbjct  181  GYGIYKTDFSNVGPTYVVFVDIGHCDTQVCV  211



>ref|XP_006595737.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Glycine 
max]
Length=773

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MS VG D+GNE+CV+A  +QR IDV+LNDESKRETP +VCFGEKQRF+G+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQRVIDVLLNDESKRETPGVVCFGEKQRFIGSAGAVSAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR+F+DP++Q DLK  P   +EGPDG  LI  +YL E+  FTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFTDPDVQNDLKLLPVETSEGPDGGILIRLKYLKEIHAFTPVQIVAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK+IAE +   AV DC IG+P YFT+LQR+A +DAA I GL PLRL H+ TAT L+
Sbjct  121  LFAHLKTIAEKDFGTAVSDCVIGVPSYFTNLQRQAYLDAAAIVGLKPLRLIHDCTATGLS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YKTD+P    + VAFVD+GH   QV I
Sbjct  181  YGVYKTDIPNAAHIYVAFVDIGHCDTQVSI  210



>ref|XP_002889885.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66144.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 167/211 (79%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +E  DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK IAE +L   V DC IGIP YFT+ QR A +DAA IAGL PLRL H++TATAL 
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATALG  180

Query  759  YGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
            YGIYKTDL  N  P  + F+D+GH   QVC+
Sbjct  181  YGIYKTDLAANSSPTYIVFIDIGHCDTQVCV  211



>ref|XP_006595736.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Glycine 
max]
 gb|KHN11927.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=802

 Score =   283 bits (723),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MS VG D+GNE+CV+A  +QR IDV+LNDESKRETP +VCFGEKQRF+G+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQRVIDVLLNDESKRETPGVVCFGEKQRFIGSAGAVSAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQVKRLIGR+F+DP++Q DLK  P   +EGPDG  LI  +YL E+  FTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFTDPDVQNDLKLLPVETSEGPDGGILIRLKYLKEIHAFTPVQIVAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK+IAE +   AV DC IG+P YFT+LQR+A +DAA I GL PLRL H+ TAT L+
Sbjct  121  LFAHLKTIAEKDFGTAVSDCVIGVPSYFTNLQRQAYLDAAAIVGLKPLRLIHDCTATGLS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YKTD+P    + VAFVD+GH   QV I
Sbjct  181  YGVYKTDIPNAAHIYVAFVDIGHCDTQVSI  210



>ref|XP_010665569.1| PREDICTED: heat shock 70 kDa protein 16 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 162/210 (77%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GNE+CV+A  +QRGIDV+LN+ESKRETP +V FGE QR  G+A AA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGIDVLLNEESKRETPGVVSFGENQRLFGSAAAASATMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
             +TISQVKRLIGR+F +P++Q DL+ FPF  +EGPDG+ LIH +YLGE++TFTP Q+L M
Sbjct  61   TSTISQVKRLIGRRFDNPKVQNDLRLFPFETSEGPDGYILIHLKYLGELQTFTPVQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + S+LK  A+ +L+  V DC IGIP YFT LQR   +DAA IAGL P+RL H+ TATAL 
Sbjct  121  LFSHLKETADKSLDVPVNDCVIGIPSYFTVLQRYLYMDAAKIAGLTPVRLLHDCTATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD     P   AFVD+GH+  QV +
Sbjct  181  YGIYKTDFLNKGPCYAAFVDIGHSDTQVAV  210



>ref|XP_010493114.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
 ref|XP_010493121.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=764

 Score =   281 bits (720),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 167/211 (79%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK  AE +L   V DC IGIP YFT+ QR A +DAA IAGL PLRL H++TATAL 
Sbjct  121  LLSHLKQTAEKSLKTPVSDCVIGIPSYFTNAQRLAYLDAAAIAGLRPLRLMHDSTATALG  180

Query  759  YGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
            YGIYKTDL  N  P  + F+D+GH   QVC+
Sbjct  181  YGIYKTDLVANSSPTYIVFIDIGHCDTQVCV  211



>ref|XP_010476099.1| PREDICTED: heat shock 70 kDa protein 16 [Camelina sativa]
Length=764

 Score =   281 bits (720),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 167/211 (79%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK  AE +L   V DC IGIP YFT+ QR A +DAA IAGL PLRL H++TATAL 
Sbjct  121  LLSHLKLTAEKSLKTPVSDCVIGIPSYFTNAQRLAYLDAAAIAGLRPLRLMHDSTATALG  180

Query  759  YGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
            YGIYKTDL  N  P  + F+D+GH   QVC+
Sbjct  181  YGIYKTDLAANSSPTYIVFIDIGHCDTQVCV  211



>ref|NP_172631.2| heat shock protein 70 (Hsp 70) family protein [Arabidopsis thaliana]
 sp|Q9SAB1.1|HSP7Q_ARATH RecName: Full=Heat shock 70 kDa protein 16; AltName: Full=Heat 
shock protein 70-16; Short=AtHsp70-16 [Arabidopsis thaliana]
 gb|AAD30257.1|AC007296_18 Strong similarity to gb|Z70314 heat-shock protein from Arabidopsis 
thaliana and is a member of the PF|00012 Hsp70 protein 
family [Arabidopsis thaliana]
 gb|AEE28767.1| heat shock protein 70 (Hsp 70) family protein [Arabidopsis thaliana]
Length=763

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 167/211 (79%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +E  DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEIQSFSPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK IAE +L   V DC IGIP YFT+ QR A +DAA IAGL PLRL H++TATAL 
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATALG  180

Query  759  YGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
            YGIYKTDL  N  P  + F+D+GH   QVC+
Sbjct  181  YGIYKTDLVANSSPTYIVFIDIGHCDTQVCV  211



>ref|XP_010458573.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=765

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE++ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQRFSPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK  AE +L   V DC IGIP YFT+ QR A +DAA IAGL PLRL H+ TATAL 
Sbjct  121  LLSHLKQTAEKSLKTPVSDCVIGIPSYFTNAQRLAYLDAAAIAGLRPLRLMHDPTATALG  180

Query  759  YGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
            YGIYKTDL  N  P  + F+D+GH   QVC+
Sbjct  181  YGIYKTDLAANSSPTYIVFIDIGHCDTQVCV  211



>emb|CDY49794.1| BnaCnng18070D [Brassica napus]
Length=761

 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 167/212 (79%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  575
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFREPDVQKDLKLFPFETSEDSADGGIQIRLRYMGEVQSFSPVQILG  120

Query  576  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            M+LS+LK +AE +LN  V DC IGIP YFT+ QR A +DAA IAGL PLRL H+ TATAL
Sbjct  121  MLLSHLKQVAEKSLNTPVSDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDCTATAL  180

Query  756  AYGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
             YGIYKTDL  N  P  + FVD+GH   QVC+
Sbjct  181  GYGIYKTDLAANSSPTCIVFVDIGHCDTQVCV  212



>ref|XP_006417329.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
 gb|ESQ35682.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
Length=763

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 165/211 (78%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIG ++ +P++Q DL+ FPF  +E  DG   I  RY+GEM++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGMKYREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEMQSFSPVQLLGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK IAE +L   V DC IGIP YFT+ QR A +DAA IAGL PLRL H++TATAL 
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATALG  180

Query  759  YGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
            YGIYKTDL  N  P    F+D+GH   QVC+
Sbjct  181  YGIYKTDLAANSSPTYTVFIDIGHCDTQVCV  211



>ref|XP_007142282.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
 gb|ESW14276.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
Length=765

 Score =   276 bits (707),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 160/210 (76%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MS VG D+GNE+CV+A  +Q G+DV+LNDESKRETPA+VCFGEKQRFLG+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQGGVDVLLNDESKRETPAVVCFGEKQRFLGSAGADSAMMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+ ISQVKRLIGR+F+DP++Q +LK  P   +E  DG  LIH +Y+ E   FTP Q++ M
Sbjct  61   KSAISQVKRLIGRRFADPDVQNELKMLPVETSESADGGILIHLKYMKESHVFTPVQIVAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK+IAE      V DC IG+P YFT+LQR+  ++AA I GL PLRL H+ TATAL+
Sbjct  121  LFAHLKTIAEKGFGTTVSDCVIGVPSYFTNLQRQDYLNAAAIVGLKPLRLIHDCTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG+YKTD     P+ VAFVD+GH   QVCI
Sbjct  181  YGVYKTDFASEAPVYVAFVDIGHCDTQVCI  210



>ref|XP_009148495.1| PREDICTED: heat shock 70 kDa protein 16 [Brassica rapa]
 ref|XP_009148496.1| PREDICTED: heat shock 70 kDa protein 16 [Brassica rapa]
Length=761

 Score =   276 bits (706),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 166/212 (78%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  575
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFKEPDVQKDLKLFPFETSEDSADGGIQIQLRYMGEVQSFSPVQILG  120

Query  576  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            M+LS+LK +AE +L   V DC IGIP YFT+ QR A +DAA IAGL PLRL H+ TATAL
Sbjct  121  MLLSHLKQVAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDCTATAL  180

Query  756  AYGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
             YGIYKTDL  N  P  + FVD+GH   QVC+
Sbjct  181  GYGIYKTDLAANSSPTCIVFVDIGHCDTQVCV  212



>emb|CDX97975.1| BnaA06g07260D [Brassica napus]
Length=761

 Score =   276 bits (706),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 166/212 (78%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  575
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFKEPDVQKDLKLFPFETSEDSADGGIQIQLRYMGEVQSFSPVQILG  120

Query  576  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            M+LS+LK +AE +L   V DC IGIP YFT+ QR A +DAA IAGL PLRL H+ TATAL
Sbjct  121  MLLSHLKQVAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDCTATAL  180

Query  756  AYGIYKTDLPEN-EPLNVAFVDVGHASLQVCI  848
             YGIYKTDL  N  P  + FVD+GH   QVC+
Sbjct  181  GYGIYKTDLAANSSPTCIVFVDIGHCDTQVCV  212



>ref|XP_008365284.1| PREDICTED: heat shock 70 kDa protein 16, partial [Malus domestica]
Length=683

 Score =   274 bits (701),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 156/210 (74%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPA VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVXQXGVDVLLNDESKRETPAXVCFGEKQRFLGSAGAASAMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+T+SQVKRL GR+F++P++QRDL       +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLXGRKFTEPDVQRDLXILXXXTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + ++LK + E N    + DC IGIP YFTD QRRA +DAA +AGL  LRL H+ TATA +
Sbjct  121  LFAHLKDLIEKNQEMPIXDCVIGIPSYFTDXQRRAYLDAAXVAGLKXLRLMHDCTATAXS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YG Y TD   + P  VAF+D+G    QV I
Sbjct  181  YGXYXTDFSTSGPTYVAFIDIGXCDTQVSI  210



>ref|XP_010533816.1| PREDICTED: heat shock 70 kDa protein 16 [Tarenaya hassleriana]
Length=763

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 159/210 (76%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            M+VVGFDVGNE C++AVA+QRGIDV+LN+ES RETP++V FG+KQRF+G A AA++ M+P
Sbjct  1    MNVVGFDVGNEKCIIAVAKQRGIDVLLNEESNRETPSVVSFGDKQRFMGAAAAASATMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLIGR+F +P++Q DL+ FPF   EG DG   I  +Y G   +F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFGEPDVQNDLRLFPFETFEGSDGGVQIRLQYSGMTHSFSPVQILGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK I E NL   V DC IGIP YFT+LQR A +DAA IAGL PLRL H+  ATAL 
Sbjct  121  LLSHLKQITEKNLKMPVSDCVIGIPSYFTNLQRLAYLDAAAIAGLRPLRLMHDCAATALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD   + P  V FVD+G    QVC+
Sbjct  181  YGIYKTDFANSSPTYVVFVDIGQCDTQVCV  210



>gb|EPS74057.1| hypothetical protein M569_00693, partial [Genlisea aurea]
Length=738

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 153/210 (73%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GN++CV+AVA QRG+DV+LNDESKRETPA+V FG+KQRF+G++GAA++ M+P
Sbjct  1    MSVVGFDIGNDNCVIAVANQRGVDVLLNDESKRETPAVVSFGDKQRFMGSSGAASTTMHP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TISQ+KRLI   + DP +Q +L+  PF  +EG DG  LIH RYLG+   FTP QVL M
Sbjct  61   KSTISQIKRLITLSYRDPSVQNELQLLPFETSEGADGGILIHLRYLGQRHIFTPVQVLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L  LK + E NL   +  C I IP YFTD QR + + AA I GL PLRL H+ TA AL 
Sbjct  121  LLGYLKELTEKNLGMEIASCVISIPSYFTDSQRSSYLYAAEIVGLSPLRLMHDCTAIALG  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKT+ P     NV FVD+GH   QV +
Sbjct  181  YGIYKTEYPRGGEANVVFVDIGHCDTQVAV  210



>ref|XP_003082170.1| heat shock protein 91-Arabidopsis thaliana (ISS) [Ostreococcus 
tauri]
Length=779

 Score =   263 bits (671),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 160/210 (76%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVG D GN + VVA+AR++GIDVVLNDESKRETP++V FGEKQRF+G+A A    M P
Sbjct  29   MSVVGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKINMKP  88

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +NT++QVKRL+GR F DPE+QRDL+   + V +G +G  L    YLG+ + FTP Q +  
Sbjct  89   RNTVTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQCVAS  148

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK IAE +    V DC I +PVY TD  RRA++DAA++ GL+ LRL HETTATAL+
Sbjct  149  ILSDLKRIAEKDNGTKVTDCVISVPVYATDAHRRAMLDAASMCGLNVLRLLHETTATALS  208

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGI+KT    +EP+NVAFVDVGH+++QVCI
Sbjct  209  YGIFKTAEFTDEPVNVAFVDVGHSAMQVCI  238



>emb|CEF99759.1| Heat shock protein 70 family [Ostreococcus tauri]
Length=801

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 160/210 (76%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVG D GN + VVA+AR++GIDVVLNDESKRETP++V FGEKQRF+G+A A    M P
Sbjct  1    MSVVGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKINMKP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +NT++QVKRL+GR F DPE+QRDL+   + V +G +G  L    YLG+ + FTP Q +  
Sbjct  61   RNTVTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQCVAS  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK IAE +    V DC I +PVY TD  RRA++DAA++ GL+ LRL HETTATAL+
Sbjct  121  ILSDLKRIAEKDNGTKVTDCVISVPVYATDAHRRAMLDAASMCGLNVLRLLHETTATALS  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGI+KT    +EP+NVAFVDVGH+++QVCI
Sbjct  181  YGIFKTAEFTDEPVNVAFVDVGHSAMQVCI  210



>ref|XP_009420545.1| PREDICTED: heat shock 70 kDa protein 16 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 158/211 (75%), Gaps = 1/211 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGN+SCVVA  RQRGIDV+LNDES+RE PA+V FGEKQRFLG AGAA++   P
Sbjct  1    MSVVGFDVGNDSCVVAAVRQRGIDVLLNDESQRENPAVVSFGEKQRFLGAAGAASAARFP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            ++T+SQVKRL+GR F DP +Q DL+  PF  +E PDG  LI  R+L E R FTP Q+L M
Sbjct  61   RSTVSQVKRLLGRPFRDPAVQDDLRRLPFPTSEAPDGGILIRIRFLNEERVFTPVQILAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L++LK IAE +L   V DC IGIP Y TDLQRRA +DAATIAGL PLRL H+ TATAL 
Sbjct  121  LLAHLKLIAEKSLETLVSDCVIGIPSYLTDLQRRAYLDAATIAGLKPLRLMHDCTATALG  180

Query  759  YGIYKTDLP-ENEPLNVAFVDVGHASLQVCI  848
            YGIYKTD         V F+D+GH + QV +
Sbjct  181  YGIYKTDSSARGSSFCVVFIDIGHCNTQVSV  211



>ref|XP_001695858.1| heat shock protein 70E [Chlamydomonas reinhardtii]
 gb|EDP01195.1| heat shock protein 70E [Chlamydomonas reinhardtii]
Length=803

 Score =   261 bits (668),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 160/210 (76%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            +SVVGFDVGN++  VA+AR+RGIDV++N ESKRETPA + FGEK RFLGT GAA   + P
Sbjct  4    VSVVGFDVGNDTSCVALARKRGIDVIMNKESKRETPAAINFGEKMRFLGTDGAAKLGLQP  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +NT+ Q+KR++G++F DP++Q D+   PF+V EGPDG  LI  RY  E   FTP QV+ M
Sbjct  64   QNTVHQLKRILGKKFKDPQVQEDIARLPFAVIEGPDGGCLIKVRYCNEEAVFTPEQVMAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            V+ +LK IAE     AV DC + +P YF + +R A+++AA IAG++ LRL +ETTATALA
Sbjct  124  VIVDLKRIAEAEGGIAVTDCALSVPDYFVEAERYAMLNAAQIAGVNCLRLINETTATALA  183

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE +P++VAFVD+GH+  QV I
Sbjct  184  YGIYKTDLPETDPVHVAFVDIGHSHTQVAI  213



>ref|XP_002949519.1| heat shock protein Hsp70E [Volvox carteri f. nagariensis]
 gb|EFJ49538.1| heat shock protein Hsp70E [Volvox carteri f. nagariensis]
Length=809

 Score =   258 bits (659),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 158/210 (75%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            +SVVGFDVGN++  VA+AR+RGIDV++N ESKRETPA + FGEK RFLGT GAA   + P
Sbjct  4    VSVVGFDVGNDTSCVALARKRGIDVIMNKESKRETPAAINFGEKMRFLGTDGAAKLGLQP  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +NT+ Q+KR++G++F DP +Q D+   PF+V EGPDG  LI  RY  E   FTP QV+ M
Sbjct  64   QNTVHQLKRILGKKFQDPLVQADIAKLPFAVLEGPDGGCLIKVRYCNEDAIFTPEQVMAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L +LK IAE      V DC + +P YFT+ +R A+++AA IAG++ LRL +ETTATALA
Sbjct  124  ILVDLKRIAEAESGIPVTDCALSVPTYFTEAERYAMLNAAQIAGVNCLRLINETTATALA  183

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE +P++V FVDVGH+  QV +
Sbjct  184  YGIYKTDLPEADPVHVVFVDVGHSHTQVSV  213



>ref|XP_006449032.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62272.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=646

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 148/211 (70%), Gaps = 17/211 (8%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  395
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  396  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  575
            PK+TISQ                DLK FPF   E  DG  LI   YLGE+  FTP Q+LG
Sbjct  61   PKSTISQ----------------DLKLFPFETCESHDGGILIMLEYLGELHKFTPVQILG  104

Query  576  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            M+LSNLK I E N+   + +C IG+P Y TD+QRRA +DAATIAGL PLRL H+ TATAL
Sbjct  105  MLLSNLKQITEKNIKIPISNCVIGVPCYLTDVQRRAYLDAATIAGLKPLRLMHDCTATAL  164

Query  756  AYGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
             YGIYKTD     P  V FVD+GH   QVC+
Sbjct  165  GYGIYKTDFSNVGPTYVVFVDIGHCDTQVCV  195



>ref|XP_006449031.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62271.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=752

 Score =   254 bits (650),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 148/211 (70%), Gaps = 17/211 (8%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  395
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  396  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  575
            PK+TISQ                DLK FPF   E  DG  LI   YLGE+  FTP Q+LG
Sbjct  61   PKSTISQ----------------DLKLFPFETCESHDGGILIMLEYLGELHKFTPVQILG  104

Query  576  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            M+LSNLK I E N+   + +C IG+P Y TD+QRRA +DAATIAGL PLRL H+ TATAL
Sbjct  105  MLLSNLKQITEKNIKIPISNCVIGVPCYLTDVQRRAYLDAATIAGLKPLRLMHDCTATAL  164

Query  756  AYGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
             YGIYKTD     P  V FVD+GH   QVC+
Sbjct  165  GYGIYKTDFSNVGPTYVVFVDIGHCDTQVCV  195



>ref|XP_002505210.1| heat shock protein 70 [Micromonas sp. RCC299]
 gb|ACO66468.1| heat shock protein 70 [Micromonas sp. RCC299]
Length=811

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 161/210 (77%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVG D G+ + VVA+AR++GIDVVLN ESKRETPA+V FG+KQRF+G A A    M P
Sbjct  1    MSVVGLDFGSVNSVVALARRKGIDVVLNTESKRETPAMVNFGDKQRFIGCAAADKINMQP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTI Q+KRLIG +FSDPE+Q  + +F F ++ GP+   LI   YLGE +TFTP +++ M
Sbjct  61   KNTIVQLKRLIGLRFSDPEVQALVPAFLFPISGGPNDEILITVDYLGEKKTFTPERLVAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +LS+LK IAE +  A V D  I +PV+FTD QRRA++DAA+IAGL+ +RL HETTATALA
Sbjct  121  ILSDLKVIAEADHGAKVTDSVISVPVFFTDAQRRAMLDAASIAGLNVMRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGI+KT    ++P NV FVDVG +S+QVC+
Sbjct  181  YGIFKTAEFGDDPHNVVFVDVGASSMQVCV  210



>emb|CBI36157.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   251 bits (640),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 143/210 (68%), Gaps = 64/210 (30%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPD                        
Sbjct  61   KNSISQMKRLIGRQFSDPELQQDLKSLPFTVTEGPD------------------------  96

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
                             VDCCIGIPVYFTDLQRRAV+DAATIA                 
Sbjct  97   -----------------VDCCIGIPVYFTDLQRRAVLDAATIA-----------------  122

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
                  DLPEN+ LNVAFVD+GHAS+QVCI
Sbjct  123  ------DLPENDQLNVAFVDIGHASMQVCI  146



>ref|XP_005642775.1| heat shock protein 70E [Coccomyxa subellipsoidea C-169]
 gb|EIE18231.1| heat shock protein 70E [Coccomyxa subellipsoidea C-169]
Length=792

 Score =   250 bits (638),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV G D+G++   +AVAR+RGIDV++N ESKRETP+LV FG KQR LGT  A +  +NP
Sbjct  1    MSVAGIDIGDQKSCIAVARKRGIDVLMNKESKRETPSLVSFGTKQRQLGTDAAGSLTINP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+  +KRL+G+ FS+P++QRDL   P++V+EGPDG  LI+  YLGE ++FTP Q++  
Sbjct  61   KNTLFGLKRLLGKNFSNPDVQRDLPELPYNVSEGPDGGILINVDYLGERQSFTPEQIVAA  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            ++ ++K IAE +  + V DC + +P Y+ + +R A++ AA IAG++ LRL +ETTATALA
Sbjct  121  IIVDMKDIAEVD-GSPVTDCVLSVPTYYLETERYAMLAAAKIAGVNCLRLINETTATALA  179

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE +P+NV F+D GH + QV I
Sbjct  180  YGIYKTDLPETDPINVVFIDAGHTAFQVSI  209



>ref|XP_002973871.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
 gb|EFJ24826.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
Length=751

 Score =   244 bits (622),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 155/212 (73%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MS +G D+GNE   +A+ARQ G+DV L++ES RETP+++ F ++ R +G +GAA+++ N 
Sbjct  1    MSCLGLDLGNEHSRIAIARQGGVDVFLDEESSRETPSVISFTQRDRCIGASGAASALGNL  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+ Q+KR+IGR+F DPELQ DLK  P  VTEG  G+P IH  YLGE R F  T++LGM
Sbjct  61   KNTVWQIKRIIGRKFRDPELQSDLKLMPCLVTEGRGGWPAIHVSYLGEHRIFGATELLGM  120

Query  579  VLSNLKSIAETN-LNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            VL++LKSIA  N +  A  +C IG P +  D+QRRA +DAA IAGL PL+L HETTA A+
Sbjct  121  VLAHLKSIAAKNMMGVAPGECVIGTPAFMDDVQRRAYVDAAAIAGLRPLKLIHETTAAAI  180

Query  756  AYGIYKTD-LPENEPLNVAFVDVGHASLQVCI  848
            +YG+Y+TD L E   + VAFVDVGHA  QV I
Sbjct  181  SYGLYRTDLLHETREIFVAFVDVGHAHTQVAI  212



>ref|XP_002969191.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
 gb|EFJ30307.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
Length=743

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 155/212 (73%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MS +G D+GNE   +A+ARQ G+DV L++ES RETP+++ F ++ R +G +GAA+++ N 
Sbjct  1    MSCLGLDLGNEHSRIAIARQGGVDVFLDEESSRETPSVISFTQRDRCIGASGAASALGNL  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+ Q+KR+IGR+F DPELQ DLK  P  VTEG  G+P IH  YLGE R F  T++LGM
Sbjct  61   KNTVWQIKRIIGRKFRDPELQSDLKLMPCLVTEGRGGWPAIHVSYLGEHRIFGATELLGM  120

Query  579  VLSNLKSIAETN-LNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATAL  755
            VL++LKSIA  N +  A  +C IG P +  D+QRRA +DAA IAGL PL+L HETTA A+
Sbjct  121  VLAHLKSIAAKNMMGVAPGECVIGTPAFMDDVQRRAYVDAAAIAGLRPLKLIHETTAAAI  180

Query  756  AYGIYKTD-LPENEPLNVAFVDVGHASLQVCI  848
            +YG+Y+TD L E   + VAFVDVGHA  QV +
Sbjct  181  SYGLYRTDLLHETREIFVAFVDVGHAHTQVAV  212



>ref|XP_003060408.1| heat shock protein 70 [Micromonas pusilla CCMP1545]
 gb|EEH55177.1| heat shock protein 70 [Micromonas pusilla CCMP1545]
Length=819

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 155/210 (74%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVG D GN + V+A+AR++GIDVVLN ESKRETP++V FGEKQRFLG A A    M P
Sbjct  1    MSVVGLDFGNANSVIALARRKGIDVVLNGESKRETPSMVNFGEKQRFLGCAAADKINMKP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            K+TI Q+K LIG ++SDPE+Q  L +F F +  GP+   LI   Y+ E + FTP +++ M
Sbjct  61   KDTIVQLKSLIGLRYSDPEVQAMLPNFVFPIAGGPNDEILITVTYMNEKKAFTPERLVAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
             L++LK IAE +  + V D  I IPV+FTD QRRA++DAA+IA L+ LRL HETTATALA
Sbjct  121  ALADLKIIAEQDQGSKVTDAVISIPVFFTDAQRRAMLDAASIAQLNVLRLMHETTATALA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGI+KT+   + P NV FVDVGH+++Q C+
Sbjct  181  YGIFKTNEFTDTPTNVVFVDVGHSAMQACV  210



>ref|XP_001641799.1| predicted protein [Nematostella vectensis]
 gb|EDO49736.1| predicted protein [Nematostella vectensis]
Length=843

 Score =   242 bits (618),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 149/210 (71%), Gaps = 0/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGN+SC +AVAR  GI+ V N+ S R TP+ V  G+KQR +GT+G    + N 
Sbjct  1    MSVVGFDVGNQSCYIAVARGGGIETVANEFSDRCTPSFVSLGDKQRLIGTSGKNQMISNL  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTISQ KR IGR+FSDP +Q+++   P+ V E P+    I  +YLG+   F+P QV+ M
Sbjct  61   KNTISQFKRFIGRKFSDPAVQKEIPHLPYKVVELPNDSIGIQVQYLGKQEVFSPEQVMAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + + LK+ AE  L   V DC I +P Y+TD QRR ++DA+  AGL+ LRL ++TTA +LA
Sbjct  121  LFTRLKTTAEIALKTKVTDCVISVPSYYTDRQRRCMLDASATAGLNCLRLMNDTTAVSLA  180

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYK DLP ++P NV FVD+GH+SLQVCI
Sbjct  181  YGIYKQDLPTDKPRNVVFVDIGHSSLQVCI  210



>ref|XP_002585532.1| hypothetical protein BRAFLDRAFT_111895 [Branchiostoma floridae]
 gb|EEN41543.1| hypothetical protein BRAFLDRAFT_111895 [Branchiostoma floridae]
Length=385

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 145/210 (69%), Gaps = 2/210 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFD+GN SC + VARQ GI+ + N+ S R TP +V FGEKQR +GT      + N 
Sbjct  1    MSVVGFDLGNLSCYIGVARQGGIETIANEYSDRCTPTVVSFGEKQRSIGTPAKNQMVTNY  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+ Q KR +GR+F DP++Q +L+   +   E PDG   +   Y GE   F+  Q+ GM
Sbjct  61   KNTVYQFKRFLGRRFQDPQVQSELQHVQYRAAEMPDGSTGMKLHYQGEEHVFSTEQITGM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L+ LK ++E NL   VVDC I +P +FTD +RRAV+D+A+IAGL+ L+L ++TTA ALA
Sbjct  121  ILTKLKEVSEMNLKVKVVDCVISVPCFFTDAERRAVLDSASIAGLNVLKLMNDTTAAALA  180

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQV  842
            YGIYK DL  PE +P NV FVD+G+ SLQV
Sbjct  181  YGIYKQDLPAPEEKPRNVVFVDMGYKSLQV  210



>ref|XP_011663241.1| PREDICTED: 97 kDa heat shock protein isoform X1 [Strongylocentrotus 
purpuratus]
Length=889

 Score =   237 bits (605),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 149/212 (70%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+SQ KR I R+FSDP +Q+D K  P+ +T+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L+ LKS AE NL   VVDC I +P Y+TDL+RR VI AA IAGL+ LR+  +TTA ALA
Sbjct  121  ILTKLKSTAEINLCRKVVDCVISVPQYYTDLERRGVIHAAEIAGLNCLRVISDTTAVALA  180

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE +P NV FVD GH+SLQV +
Sbjct  181  YGIYKQDLPTPEEKPRNVVFVDCGHSSLQVSV  212



>ref|NP_999695.1| 97 kDa heat shock protein [Strongylocentrotus purpuratus]
 gb|AAB17669.1| egg receptor for sperm [Strongylocentrotus purpuratus]
Length=889

 Score =   237 bits (605),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 149/212 (70%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+SQ KR I R+FSDP +Q+D K  P+ +T+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L+ LKS AE NL   VVDC I +P Y+TDL+RR VI AA IAGL+ LR+  +TTA ALA
Sbjct  121  ILTKLKSTAEINLCRKVVDCVISVPQYYTDLERRGVIHAAEIAGLNCLRVISDTTAVALA  180

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE +P NV FVD GH+SLQV +
Sbjct  181  YGIYKQDLPTPEEKPRNVVFVDCGHSSLQVSV  212



>sp|Q06068.2|HSP97_STRPU RecName: Full=97 kDa heat shock protein; AltName: Full=Egg sperm 
receptor [Strongylocentrotus purpuratus]
 gb|AAB09737.1| sperm receptor [Strongylocentrotus purpuratus]
Length=889

 Score =   237 bits (604),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 149/212 (70%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+SQ KR I R+FSDP +Q+D K  P+ +T+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L+ LKS AE NL   VVDC I +P Y+TDL+RR VI AA IAGL+ LR+  +TTA ALA
Sbjct  121  ILTKLKSTAEINLCRKVVDCVISVPQYYTDLERRGVIHAAEIAGLNCLRVISDTTAVALA  180

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE +P NV FVD GH+SLQV +
Sbjct  181  YGIYKQDLPTPEEKPRNVVFVDCGHSSLQVSV  212



>sp|Q94738.1|HSP97_STRFN RecName: Full=97 kDa heat shock protein; AltName: Full=Heat shock 
protein 110 [Strongylocentrotus franciscanus]
 gb|AAB09038.1| heat shock protein 110 [Strongylocentrotus franciscanus]
Length=886

 Score =   237 bits (604),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 148/212 (70%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+SQ KR I RQFSDP +Q+D    P+ VT+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARQFSDPSVQKDAHVVPYKVTQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L+ LK+ AE NL   VVDC I +P Y+TDL+RR VI AA IAGL+ LR+  +TTA ALA
Sbjct  121  ILTKLKATAEVNLCRKVVDCVISVPQYYTDLERRGVIHAAEIAGLNCLRVISDTTAVALA  180

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE +P NV FVD GH+SLQV +
Sbjct  181  YGIYKQDLPTPEEKPRNVVFVDCGHSSLQVSV  212



>ref|XP_012138186.1| PREDICTED: 97 kDa heat shock protein isoform X2 [Megachile rotundata]
Length=829

 Score =   234 bits (597),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 146/212 (69%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTI   KRL+GR+++DP++QR++K  PF VT+  DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIYGFKRLLGRKYNDPQVQREIKMLPFKVTQQADGNIGIHVQYLGEEHIFSPEQITAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + + LK I+ET L   V DC I +P Y+T  +R+A++DAA IAGL+ LRLF+ETTATAL 
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYYTQAERQALLDAARIAGLNVLRLFNETTATALC  183

Query  759  YGIYKTDLPENE--PLNVAFVDVGHASLQVCI  848
            YGIYK DLP  +  P NV FVD G+ASLQVCI
Sbjct  184  YGIYKQDLPSPDAPPRNVVFVDCGYASLQVCI  215



>ref|XP_003702344.1| PREDICTED: 97 kDa heat shock protein isoform X1 [Megachile rotundata]
Length=865

 Score =   234 bits (597),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 146/212 (69%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTI   KRL+GR+++DP++QR++K  PF VT+  DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIYGFKRLLGRKYNDPQVQREIKMLPFKVTQQADGNIGIHVQYLGEEHIFSPEQITAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + + LK I+ET L   V DC I +P Y+T  +R+A++DAA IAGL+ LRLF+ETTATAL 
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYYTQAERQALLDAARIAGLNVLRLFNETTATALC  183

Query  759  YGIYKTDLPENE--PLNVAFVDVGHASLQVCI  848
            YGIYK DLP  +  P NV FVD G+ASLQVCI
Sbjct  184  YGIYKQDLPSPDAPPRNVVFVDCGYASLQVCI  215



>ref|XP_006615729.1| PREDICTED: 97 kDa heat shock protein-like isoform X2 [Apis dorsata]
Length=831

 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 144/212 (68%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + + LK I+ET L   V DC I +P YFT  +R+A++DAA IAGL+ LRLF+ETTATAL 
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYFTQAERQALLDAARIAGLNVLRLFNETTATALC  183

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE  P NV FVD G+ASLQV I
Sbjct  184  YGIYKQDLPAPETPPRNVVFVDCGYASLQVSI  215



>ref|XP_006561225.1| PREDICTED: 97 kDa heat shock protein isoform X2 [Apis mellifera]
Length=831

 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 144/212 (68%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + + LK I+ET L   V DC I +P YFT  +R+A++DAA IAGL+ LRLF+ETTATAL 
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYFTQAERQALLDAARIAGLNVLRLFNETTATALC  183

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE  P NV FVD G+ASLQV I
Sbjct  184  YGIYKQDLPAPETPPRNVVFVDCGYASLQVSI  215



>ref|XP_003691374.1| PREDICTED: heat shock 70 kDa protein 4L-like [Apis florea]
Length=866

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 144/212 (68%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + + LK I+ET L   V DC I +P YFT  +R+A++DAA IAGL+ LRLF+ETTATAL 
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYFTQAERQALLDAARIAGLNVLRLFNETTATALC  183

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE  P NV FVD G+ASLQV I
Sbjct  184  YGIYKQDLPAPETPPRNVVFVDCGYASLQVSI  215



>ref|XP_005846866.1| hypothetical protein CHLNCDRAFT_35731 [Chlorella variabilis]
 gb|EFN54764.1| hypothetical protein CHLNCDRAFT_35731 [Chlorella variabilis]
Length=832

 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 153/210 (73%), Gaps = 1/210 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            M+  G DVG+ +  +A+AR+ G+DV+LN ESKRETP++V F  KQR +GT  +     NP
Sbjct  1    MACAGIDVGDATSCIALARKGGVDVLLNKESKRETPSVVTFTHKQRMMGTDASGGMSTNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            +NTISQ+KRL+G++F+DP +Q DLK+FP+ V  GPDG  + +  Y  +   F+  Q+L M
Sbjct  61   RNTISQLKRLLGKKFNDPHVQEDLKNFPYKVEAGPDGECVFNVEYQDKQARFSAVQLLAM  120

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            +L +LK IAE    + V +C + +PVYFT+ +R A++ A+ IAGL+ LRL +ET+ATALA
Sbjct  121  LLVDLKLIAEAE-GSPVSECVLAVPVYFTEPERHAMLAASQIAGLNCLRLLNETSATALA  179

Query  759  YGIYKTDLPENEPLNVAFVDVGHASLQVCI  848
            YGIYKTDLPE +P+NV FVDVG AS QVC+
Sbjct  180  YGIYKTDLPEGDPVNVVFVDVGFASTQVCV  209



>ref|XP_623199.2| PREDICTED: 97 kDa heat shock protein isoformX1 [Apis mellifera]
Length=867

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 144/212 (68%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + + LK I+ET L   V DC I +P YFT  +R+A++DAA IAGL+ LRLF+ETTATAL 
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYFTQAERQALLDAARIAGLNVLRLFNETTATALC  183

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE  P NV FVD G+ASLQV I
Sbjct  184  YGIYKQDLPAPETPPRNVVFVDCGYASLQVSI  215



>ref|XP_006615728.1| PREDICTED: 97 kDa heat shock protein-like isoform X1 [Apis dorsata]
Length=867

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 144/212 (68%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + + LK I+ET L   V DC I +P YFT  +R+A++DAA IAGL+ LRLF+ETTATAL 
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYFTQAERQALLDAARIAGLNVLRLFNETTATALC  183

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE  P NV FVD G+ASLQV I
Sbjct  184  YGIYKQDLPAPETPPRNVVFVDCGYASLQVSI  215



>gb|AFG63451.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63452.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63453.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63454.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63455.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63456.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63457.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
Length=124

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGA++S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGASSSLMNP  60

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KN +SQ+KRLIG+QF DPE+QRDL+S P++V EGPDG   IHARYLG+ R FT TQ+L M
Sbjct  61   KNAVSQIKRLIGKQFRDPEVQRDLQSLPYTVDEGPDGGVRIHARYLGDSRAFTATQILAM  120

Query  579  VLSN  590
            +LSN
Sbjct  121  LLSN  124



>ref|XP_011304595.1| PREDICTED: 97 kDa heat shock protein isoform X2 [Fopius arisanus]
Length=806

 Score =   232 bits (592),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 144/212 (68%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+   KRL+GR+++DP++Q++L+S P+ VT  PDG   IH +YLGE   FTP Q+  M
Sbjct  64   KNTVFGFKRLLGRKYNDPQVQKELRSLPYKVTAQPDGTIGIHVQYLGEEHIFTPEQITAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + + LK I+ET L  AV DC I +P YFT  +R A+ DAA IAGL+ LRLF+ET ATAL 
Sbjct  124  LFTKLKEISETALQTAVNDCVISVPSYFTQSERLALFDAARIAGLNVLRLFNETAATALC  183

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE  P NV FVD G+ASLQV I
Sbjct  184  YGIYKQDLPAPEAPPRNVVFVDCGYASLQVSI  215



>ref|XP_011304586.1| PREDICTED: 97 kDa heat shock protein isoform X1 [Fopius arisanus]
Length=842

 Score =   232 bits (592),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 144/212 (68%), Gaps = 2/212 (1%)
 Frame = +3

Query  219  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  398
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  399  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  578
            KNT+   KRL+GR+++DP++Q++L+S P+ VT  PDG   IH +YLGE   FTP Q+  M
Sbjct  64   KNTVFGFKRLLGRKYNDPQVQKELRSLPYKVTAQPDGTIGIHVQYLGEEHIFTPEQITAM  123

Query  579  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALA  758
            + + LK I+ET L  AV DC I +P YFT  +R A+ DAA IAGL+ LRLF+ET ATAL 
Sbjct  124  LFTKLKEISETALQTAVNDCVISVPSYFTQSERLALFDAARIAGLNVLRLFNETAATALC  183

Query  759  YGIYKTDL--PENEPLNVAFVDVGHASLQVCI  848
            YGIYK DL  PE  P NV FVD G+ASLQV I
Sbjct  184  YGIYKQDLPAPEAPPRNVVFVDCGYASLQVSI  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1853757769455