BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7624

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230817.1|  PREDICTED: presequence protease 1, chloropla...    291   4e-88   Solanum lycopersicum
ref|XP_009760273.1|  PREDICTED: presequence protease 1, chloropla...    291   5e-88   Nicotiana sylvestris
ref|XP_009628645.1|  PREDICTED: presequence protease 1, chloropla...    291   7e-88   Nicotiana tomentosiformis
ref|XP_006346464.1|  PREDICTED: presequence protease 1, chloropla...    286   6e-86   Solanum tuberosum [potatoes]
ref|XP_011088279.1|  PREDICTED: presequence protease 1, chloropla...    282   1e-84   Sesamum indicum [beniseed]
ref|XP_010269115.1|  PREDICTED: presequence protease 2, chloropla...    271   1e-80   Nelumbo nucifera [Indian lotus]
gb|AFW73556.1|  hypothetical protein ZEAMMB73_636378                    251   2e-79   
ref|XP_006423050.1|  hypothetical protein CICLE_v10029929mg             256   8e-79   
ref|XP_009417618.1|  PREDICTED: presequence protease 1, chloropla...    265   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417619.1|  PREDICTED: presequence protease 1, chloropla...    265   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002518788.1|  zinc metalloprotease, putative                     249   2e-78   
ref|XP_006423048.1|  hypothetical protein CICLE_v10027722mg             262   2e-78   
ref|XP_006423047.1|  hypothetical protein CICLE_v10027722mg             265   2e-78   Citrus clementina [clementine]
ref|XP_006487082.1|  PREDICTED: LOW QUALITY PROTEIN: presequence ...    263   1e-77   Citrus sinensis [apfelsine]
ref|XP_008454934.1|  PREDICTED: presequence protease 1, chloropla...    261   3e-77   Cucumis melo [Oriental melon]
ref|XP_007042387.1|  Presequence protease 2 isoform 4                   259   4e-77   
ref|XP_010939450.1|  PREDICTED: presequence protease 1, chloropla...    261   5e-77   Elaeis guineensis
ref|XP_004136986.1|  PREDICTED: presequence protease 1, chloropla...    260   7e-77   Cucumis sativus [cucumbers]
ref|XP_010939451.1|  PREDICTED: presequence protease 1, chloropla...    260   7e-77   Elaeis guineensis
ref|XP_007042388.1|  Presequence protease 2 isoform 5                   259   8e-77   
ref|XP_010481056.1|  PREDICTED: presequence protease 2, chloropla...    256   9e-77   Camelina sativa [gold-of-pleasure]
ref|XP_007042385.1|  Presequence protease 2 isoform 2                   259   1e-76   
ref|XP_004296078.2|  PREDICTED: presequence protease 1, chloropla...    259   2e-76   Fragaria vesca subsp. vesca
ref|XP_007042384.1|  Presequence protease 2 isoform 1                   259   2e-76   
ref|XP_003570577.1|  PREDICTED: presequence protease 1, chloropla...    259   2e-76   Brachypodium distachyon [annual false brome]
ref|XP_007042386.1|  Presequence protease 2 isoform 3                   259   2e-76   
ref|XP_010500508.1|  PREDICTED: presequence protease 2, chloropla...    258   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_009339454.1|  PREDICTED: LOW QUALITY PROTEIN: presequence ...    258   5e-76   Pyrus x bretschneideri [bai li]
ref|XP_002282024.1|  PREDICTED: presequence protease 2, chloropla...    258   5e-76   Vitis vinifera
ref|XP_010466048.1|  PREDICTED: presequence protease 1, chloropla...    258   6e-76   
emb|CBI32433.3|  unnamed protein product                                258   6e-76   Vitis vinifera
ref|XP_008373169.1|  PREDICTED: presequence protease 1, chloropla...    257   8e-76   
gb|KJB77681.1|  hypothetical protein B456_012G150300                    256   1e-75   Gossypium raimondii
ref|XP_010691032.1|  PREDICTED: presequence protease 2, chloropla...    257   1e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008236531.1|  PREDICTED: presequence protease 1, chloropla...    257   1e-75   Prunus mume [ume]
ref|XP_008647214.1|  PREDICTED: presequence protease 1, chloropla...    254   2e-75   
emb|CDO97160.1|  unnamed protein product                                256   3e-75   Coffea canephora [robusta coffee]
gb|KJB77680.1|  hypothetical protein B456_012G150300                    256   3e-75   Gossypium raimondii
gb|KJB77679.1|  hypothetical protein B456_012G150300                    256   3e-75   Gossypium raimondii
ref|XP_011006471.1|  PREDICTED: presequence protease 1, chloropla...    256   3e-75   Populus euphratica
ref|XP_010066034.1|  PREDICTED: presequence protease 2, chloropla...    256   3e-75   
ref|XP_010466047.1|  PREDICTED: presequence protease 1, chloropla...    255   4e-75   
ref|XP_006384425.1|  hypothetical protein POPTR_0004s14960g             255   4e-75   
ref|XP_010523209.1|  PREDICTED: presequence protease 1, chloropla...    255   6e-75   
gb|KHG07949.1|  Presequence protease 1, chloroplastic/mitochondrial     254   6e-75   Gossypium arboreum [tree cotton]
gb|KHG07948.1|  Presequence protease 2, chloroplastic/mitochondrial     254   8e-75   Gossypium arboreum [tree cotton]
gb|AAG13049.1|AC011807_8  Putative zinc metalloprotease                 254   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175386.2|  presequence protease 2                                254   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004954002.1|  PREDICTED: presequence protease 1, chloropla...    253   2e-74   Setaria italica
ref|XP_002885298.1|  ATPREP1                                            253   2e-74   
ref|XP_012066896.1|  PREDICTED: presequence protease 2, chloropla...    253   2e-74   Jatropha curcas
gb|KDP42318.1|  hypothetical protein JCGZ_01642                         253   3e-74   Jatropha curcas
ref|XP_010507479.1|  PREDICTED: presequence protease 1, chloropla...    253   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_002894203.1|  ATPREP2                                            253   3e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_010487842.1|  PREDICTED: presequence protease 1, chloropla...    253   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006296881.1|  hypothetical protein CARUB_v10012870mg             253   4e-74   Capsella rubella
dbj|BAB02957.1|  zinc metalloprotease (insulinase family)               252   4e-74   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188548.2|  zinc metalloprotease pitrilysin subfamily A           252   5e-74   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189932.1|  zinc metalloprotease pitrilysin subfamily A        252   5e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304560.1|  hypothetical protein CARUB_v10011558mg             252   6e-74   
dbj|BAJ89923.1|  predicted protein                                      251   6e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85497.1|  predicted protein                                      252   6e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK39237.1|  hypothetical protein AALP_AA3G218200                    252   7e-74   Arabis alpina [alpine rockcress]
ref|XP_009135620.1|  PREDICTED: presequence protease 1, chloropla...    252   7e-74   Brassica rapa
ref|XP_010691033.1|  PREDICTED: presequence protease 2, chloropla...    251   1e-73   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX82307.1|  BnaA03g35140D                                          250   2e-73   
ref|XP_009112103.1|  PREDICTED: presequence protease 1, chloropla...    250   2e-73   Brassica rapa
ref|XP_011000205.1|  PREDICTED: presequence protease 1, chloropla...    250   2e-73   Populus euphratica
gb|EAY87618.1|  hypothetical protein OsI_09029                          250   3e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_006393232.1|  hypothetical protein EUTSA_v10011199mg             250   3e-73   Eutrema salsugineum [saltwater cress]
ref|XP_011000182.1|  PREDICTED: presequence protease 1, chloropla...    250   3e-73   Populus euphratica
emb|CDY18572.1|  BnaA01g26230D                                          250   4e-73   Brassica napus [oilseed rape]
ref|XP_006406530.1|  hypothetical protein EUTSA_v10019955mg             249   5e-73   Eutrema salsugineum [saltwater cress]
ref|XP_006649067.1|  PREDICTED: presequence protease 1, chloropla...    249   5e-73   Oryza brachyantha
ref|XP_010546463.1|  PREDICTED: presequence protease 1, chloropla...    248   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_007200813.1|  hypothetical protein PRUPE_ppa025698mg             248   1e-72   
emb|CDY67652.1|  BnaC01g43760D                                          248   1e-72   Brassica napus [oilseed rape]
ref|XP_006829680.1|  PREDICTED: presequence protease 1, chloropla...    248   1e-72   Amborella trichopoda
emb|CDY22983.1|  BnaC03g40860D                                          247   3e-72   Brassica napus [oilseed rape]
gb|EEE57849.1|  hypothetical protein OsJ_08475                          246   6e-72   Oryza sativa Japonica Group [Japonica rice]
gb|KHN30412.1|  Presequence protease 2, chloroplastic/mitochondrial     246   8e-72   Glycine soja [wild soybean]
ref|XP_003517606.1|  PREDICTED: presequence protease 2, chloropla...    246   8e-72   Glycine max [soybeans]
ref|XP_004511282.1|  PREDICTED: presequence protease 1, chloropla...    244   2e-71   Cicer arietinum [garbanzo]
gb|KEH27308.1|  presequence protease                                    244   4e-71   Medicago truncatula
ref|XP_009417620.1|  PREDICTED: presequence protease 1, chloropla...    244   4e-71   
ref|XP_003636020.1|  Presequence protease                               244   6e-71   
ref|XP_002313107.1|  hypothetical protein POPTR_0009s10650g             243   8e-71   
ref|XP_001764982.1|  predicted protein                                  241   3e-70   
gb|KFK35994.1|  hypothetical protein AALP_AA4G064300                    238   9e-69   Arabis alpina [alpine rockcress]
emb|CDY28099.1|  BnaC06g02800D                                          237   1e-68   Brassica napus [oilseed rape]
ref|XP_009147876.1|  PREDICTED: presequence protease 2, chloropla...    237   1e-68   Brassica rapa
emb|CDY50957.1|  BnaA06g37530D                                          237   1e-68   Brassica napus [oilseed rape]
pdb|2FGE|A  Chain A, Crystal Structure Of Presequence Protease Pr...    235   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007157239.1|  hypothetical protein PHAVU_002G054400g             235   6e-68   Phaseolus vulgaris [French bean]
ref|XP_002452870.1|  hypothetical protein SORBIDRAFT_04g033980          235   1e-67   
ref|XP_002979622.1|  hypothetical protein SELMODRAFT_419272             230   3e-66   
ref|XP_006423049.1|  hypothetical protein CICLE_v10030315mg             213   5e-63   
ref|XP_007514955.1|  putative peptidase                                 208   3e-58   Bathycoccus prasinos
ref|XP_005651052.1|  hypothetical protein COCSUDRAFT_35102              202   4e-56   Coccomyxa subellipsoidea C-169
ref|WP_043601248.1|  peptidase M16                                      201   4e-56   Desulfovibrio magneticus
dbj|BAH77801.1|  peptidase M16C family protein                          202   4e-56   Desulfovibrio magneticus RS-1
ref|XP_005842187.1|  hypothetical protein GUITHDRAFT_83724              201   1e-55   Guillardia theta CCMP2712
ref|WP_019999861.1|  peptidase M16                                      200   1e-55   Desulfovibrionaceae
ref|WP_027361259.1|  peptidase M16                                      200   2e-55   Halodesulfovibrio aestuarii
ref|WP_009110736.1|  peptidase M16                                      200   2e-55   Desulfovibrio sp. U5L
ref|WP_005990555.1|  peptidase M16                                      200   2e-55   Desulfovibrio fructosivorans
ref|XP_002501992.1|  predicted protein                                  199   3e-55   Micromonas commoda
ref|WP_012805698.1|  peptidase M16                                      199   3e-55   Desulfomicrobium baculatum
ref|WP_024824358.1|  peptidase M16                                      199   4e-55   Desulfovibrio magneticus
ref|XP_005844172.1|  hypothetical protein CHLNCDRAFT_139318             199   4e-55   Chlorella variabilis
ref|WP_009182029.1|  peptidase M16                                      199   5e-55   Desulfovibrio sp. FW1012B
ref|WP_015751993.1|  peptidase M16                                      197   2e-54   Desulfohalobium retbaense
gb|KDO42491.1|  hypothetical protein CISIN_1g0037001mg                  183   4e-54   Citrus sinensis [apfelsine]
ref|WP_035261705.1|  peptidase M16                                      196   4e-54   Desulfonatronum lacustre
ref|WP_031388389.1|  peptidase M16                                      196   5e-54   Desulfonatronum thiodismutans
ref|WP_006921332.1|  putative Zn-dependent peptidase, insulinase        196   5e-54   
ref|WP_029456797.1|  peptidase M16                                      196   5e-54   Desulfovibrio alcoholivorans
ref|WP_045219069.1|  peptidase M16                                      196   7e-54   Desulfonatronum thioautotrophicum
ref|WP_027181841.1|  peptidase M16                                      195   8e-54   Desulfovibrio alaskensis
ref|WP_011368505.1|  peptidase M16                                      195   9e-54   Desulfovibrio alaskensis
gb|KKB82630.1|  peptidase M16                                           195   1e-53   Devosia limi DSM 17137
emb|CEG00022.1|  Metalloenzyme, LuxS/M16 peptidase-like                 195   2e-53   Ostreococcus tauri
ref|WP_027177039.1|  peptidase M16                                      194   2e-53   Desulfovibrio aminophilus
ref|WP_028577615.1|  peptidase M16                                      194   2e-53   Desulfomicrobium escambiense
ref|WP_022661974.1|  peptidase M16                                      194   2e-53   Desulfovibrio longus
ref|XP_003082508.1|  putative metalloprotease (ISS)                     194   3e-53   
ref|XP_001420892.1|  predicted protein                                  194   3e-53   Ostreococcus lucimarinus CCE9901
ref|WP_043637762.1|  peptidase M16                                      194   3e-53   Desulfovibrio sp. TomC
ref|XP_005538148.1|  presequence protease                               194   3e-53   Cyanidioschyzon merolae strain 10D
gb|EJK74078.1|  hypothetical protein THAOC_04268                        187   4e-53   Thalassiosira oceanica
gb|KDD73441.1|  hypothetical protein H632_c2174p0                       183   4e-53   Helicosporidium sp. ATCC 50920
ref|WP_046105547.1|  peptidase M16                                      193   6e-53   Devosia chinhatensis
ref|XP_002952139.1|  hypothetical protein VOLCADRAFT_81738              193   8e-53   Volvox carteri f. nagariensis
ref|WP_018124477.1|  hypothetical protein                               192   1e-52   Desulfovibrio oxyclinae
gb|KKB76061.1|  peptidase M16                                           192   1e-52   Devosia soli
ref|WP_006425491.1|  peptidase M16                                      192   1e-52   delta proteobacterium NaphS2
ref|WP_035098694.1|  peptidase M16                                      192   2e-52   Devosia sp. LC5
gb|KKB79681.1|  peptidase M16                                           192   2e-52   
ref|WP_041454536.1|  peptidase M16                                      192   2e-52   
dbj|BAJ62543.1|  putative M16C family peptidase                         192   2e-52   Anaerolinea thermophila UNI-1
ref|WP_035093689.1|  peptidase M16                                      191   2e-52   Devosia sp. 17-2-E-8
ref|WP_035035576.1|  peptidase M16                                      191   2e-52   Devosia sp. DBB001
ref|WP_006562562.1|  peptidase M16                                      191   4e-52   Oscillochloris trichoides
ref|WP_035086012.1|  peptidase M16                                      190   6e-52   Devosia riboflavina
ref|WP_011698518.1|  peptidase M16                                      190   6e-52   Syntrophobacter fumaroxidans
ref|WP_014258900.1|  peptidase M16                                      190   8e-52   Desulfovibrio africanus
ref|XP_011396191.1|  Presequence protease 2, chloroplastic/mitoch...    189   1e-51   Auxenochlorella protothecoides
gb|EMT26044.1|  Presequence protease 1, chloroplastic/mitochondrial     189   1e-51   
gb|EMS56412.1|  Presequence protease 1, chloroplastic/mitochondrial     189   1e-51   Triticum urartu
ref|WP_015940539.1|  peptidase M16                                      189   1e-51   Chloroflexus aggregans
ref|WP_015415436.1|  Presequence protease 1, chloroplastic/mitoch...    189   2e-51   Pseudodesulfovibrio piezophilus
ref|WP_014323044.1|  peptidase M16                                      189   2e-51   Desulfovibrio desulfuricans
ref|WP_012119247.1|  peptidase M16                                      189   2e-51   Roseiflexus castenholzii
ref|XP_005716826.1|  presequence protease                               188   4e-51   Chondrus crispus [carageen]
gb|ADU64271.1|  Peptidase M16C associated domain protein                187   4e-51   Pseudodesulfovibrio aespoeensis Aspo-2
ref|WP_041271892.1|  peptidase M16                                      187   4e-51   
ref|WP_005986746.1|  pre-sequence protease                              187   6e-51   Desulfovibrio africanus
ref|WP_012257471.1|  MULTISPECIES: peptidase M16                        187   6e-51   Chloroflexus aurantiacus
ref|WP_011954953.1|  peptidase M16                                      187   6e-51   Roseiflexus sp. RS-1
ref|WP_014431903.1|  peptidase M16                                      187   7e-51   Caldilinea aerophila
ref|WP_031458128.1|  peptidase M16                                      187   7e-51   Chloroflexus sp. MS-G
ref|WP_028458346.1|  peptidase M16                                      187   7e-51   Chloroflexus sp. Y-396-1
ref|WP_045426615.1|  peptidase M16                                      187   9e-51   
ref|XP_008236552.1|  PREDICTED: presequence protease 1, chloropla...    187   1e-50   Prunus mume [ume]
ref|WP_027366525.1|  peptidase M16                                      187   1e-50   Desulfovibrio africanus
ref|WP_012612497.1|  peptidase M16                                      186   1e-50   Desulfovibrio vulgaris
ref|XP_007200093.1|  hypothetical protein PRUPE_ppa019970mg             187   1e-50   
ref|XP_002290387.1|  hypothetical protein THAPSDRAFT_22863              187   1e-50   Thalassiosira pseudonana CCMP1335
ref|WP_035066446.1|  peptidase M16                                      186   2e-50   Desulfovibrio termitidis
gb|EYU37693.1|  hypothetical protein MIMGU_mgv1a000907mg                186   2e-50   Erythranthe guttata [common monkey flower]
ref|WP_015335587.1|  Presequence protease 1, chloroplastic/mitoch...    186   2e-50   Desulfovibrio hydrothermalis
ref|WP_012765630.1|  peptidase M16                                      186   2e-50   Desulfovibrio salexigens
ref|WP_046109512.1|  peptidase M16                                      186   3e-50   Devosia geojensis
ref|WP_035042323.1|  peptidase M16                                      185   3e-50   
gb|EPR39784.1|  Peptidase M16C associated domain protein                185   4e-50   Desulfovibrio sp. X2
ref|WP_029435916.1|  peptidase M16                                      185   4e-50   Bilophila wadsworthia
ref|WP_045511667.1|  peptidase M16                                      185   4e-50   
ref|WP_005028290.1|  peptidase M16                                      185   4e-50   Bilophila wadsworthia
ref|WP_028319851.1|  peptidase M16                                      185   4e-50   Desulfatiglans anilini
ref|WP_027185458.1|  hypothetical protein                               185   5e-50   Desulfovibrio inopinatus
ref|WP_009380390.1|  peptidase M16                                      185   5e-50   Bilophila sp. 4_1_30
ref|WP_010938240.1|  peptidase M16                                      184   5e-50   Desulfovibrio vulgaris
ref|WP_011792619.1|  peptidase M16                                      184   6e-50   Desulfovibrio vulgaris
gb|EPS67763.1|  hypothetical protein M569_07010                         184   6e-50   Genlisea aurea
ref|WP_029896470.1|  peptidase M16                                      184   7e-50   Desulfovibrio sp. L21-Syr-AB
ref|WP_027720526.1|  peptidase M16                                      184   8e-50   Desulfovibrio zosterae
ref|WP_006007833.1|  peptidase M16                                      184   1e-49   Desulfovibrio piger
ref|WP_027178402.1|  peptidase M16                                      183   2e-49   Desulfovibrio bastinii
ref|WP_028573857.1|  peptidase M16                                      183   2e-49   Desulfonatronovibrio hydrogenovorans
ref|WP_007523808.1|  peptidase M16                                      183   3e-49   Desulfovibrio sp. A2
ref|WP_012623989.1|  peptidase M16                                      183   3e-49   Desulfovibrio desulfuricans
ref|XP_005761276.1|  peptidase M16                                      183   3e-49   Emiliania huxleyi CCMP1516
ref|WP_027187627.1|  peptidase M16                                      182   3e-49   Desulfovibrio cuneatus
ref|WP_016483219.1|  pre-sequence protease. Metallo peptidase. ME...    182   3e-49   Chthonomonas calidirosea
ref|WP_035377087.1|  peptidase M16                                      182   4e-49   Fervidicella metallireducens
ref|XP_005782033.1|  peptidase M16                                      182   5e-49   Emiliania huxleyi CCMP1516
ref|WP_025577207.1|  peptidase M16                                      182   6e-49   Blautia wexlerae
ref|WP_033333819.1|  hypothetical protein                               169   6e-49   
ref|WP_026649281.1|  peptidase M16                                      182   7e-49   Blautia wexlerae
ref|WP_020993684.1|  MULTISPECIES: hypothetical protein                 181   7e-49   Clostridiales
ref|WP_021760305.1|  putative peptidase M16C                            181   8e-49   Desulfovibrio gigas
ref|WP_022657642.1|  peptidase M16                                      181   9e-49   Desulfovibrio desulfuricans
ref|WP_043643858.1|  peptidase M16                                      181   1e-48   Desulfovibrio putealis
ref|XP_002177646.1|  predicted protein                                  181   1e-48   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_014129848.1|  peptidase M16                                      181   1e-48   Pelagibacterium halotolerans
emb|CCJ33994.1|  Protein hypA                                           174   1e-48   Caloramator australicus RC3
ref|WP_019161133.1|  peptidase M16                                      181   1e-48   
ref|WP_009302747.1|  peptidase M16                                      181   2e-48   Desulfovibrio sp. 6_1_46AFAA
ref|WP_008683425.1|  peptidase M16                                      181   2e-48   Desulfovibrio sp. 3_1_syn3
ref|WP_017751909.1|  hypothetical protein                               180   2e-48   Clostridium tyrobutyricum
ref|WP_017895385.1|  hypothetical protein                               180   2e-48   Clostridium tyrobutyricum
ref|XP_005706792.1|  Zn-dependent peptidase                             181   3e-48   Galdieria sulphuraria
ref|WP_020887440.1|  Peptidase M16C associated domain protein           180   3e-48   Desulfovibrio alkalitolerans
ref|WP_027369289.1|  peptidase M16                                      179   4e-48   Desulfovermiculus halophilus
emb|CCY32009.1|  putative uncharacterized protein                       179   4e-48   Ruminococcus sp. CAG:60
gb|AKA71691.1|  Peptidase M16C associated domain protein                179   5e-48   Clostridium scatologenes
ref|WP_032078808.1|  peptidase M16                                      179   5e-48   Clostridium drakei
ref|WP_044943560.1|  peptidase M16                                      179   6e-48   Blautia schinkii
ref|WP_028588391.1|  peptidase M16                                      179   7e-48   Desulfocurvus vexinensis
ref|WP_018702572.1|  hypothetical protein                               179   7e-48   Anaeromusa acidaminophila
ref|WP_027938345.1|  peptidase M16                                      179   7e-48   Anaeroarcus burkinensis
ref|WP_007061507.1|  peptidase M16                                      179   8e-48   Clostridium carboxidivorans
ref|WP_031481722.1|  peptidase M16                                      179   8e-48   Desulfovibrio frigidus
ref|WP_011526733.1|  peptidase M16                                      179   8e-48   Lawsonia intracellularis
ref|WP_021651012.1|  peptidase M16 inactive domain protein              178   9e-48   Blautia sp. KLE 1732
ref|WP_022655669.1|  peptidase M16                                      178   1e-47   
ref|WP_021720806.1|  peptidase M16 inactive domain protein              178   1e-47   
emb|CBL19941.1|  Predicted Zn-dependent peptidases, insulinase-like     178   1e-47   Ruminococcus sp. SR1/5
ref|XP_002977652.1|  hypothetical protein SELMODRAFT_152047             178   1e-47   
ref|WP_028988397.1|  peptidase M16                                      177   2e-47   Thermicanus aegyptius
ref|WP_027871447.1|  peptidase M16 [                                    177   2e-47   [Eubacterium] cellulosolvens
ref|WP_004603088.1|  peptidase M16 [                                    177   4e-47   [Eubacterium] cellulosolvens
ref|WP_006568065.1|  peptidase M16                                      177   4e-47   Anaerostipes caccae
ref|WP_009290271.1|  peptidase M16                                      176   5e-47   Anaerostipes
ref|WP_022261301.1|  peptidase                                          176   5e-47   
ref|WP_022215422.1|  peptidase M16 inactive domain protein              176   5e-47   
emb|CBK80754.1|  Predicted Zn-dependent peptidases, insulinase-like     176   5e-47   Coprococcus catus GD/7
emb|CBL23820.1|  Predicted Zn-dependent peptidases, insulinase-like     176   5e-47   Blautia obeum A2-162
ref|WP_035355373.1|  peptidase M16                                      176   5e-47   
ref|WP_005584172.1|  Protein HypA                                       176   7e-47   
ref|WP_016440111.1|  hypothetical protein                               176   1e-46   Coprococcus sp. HPP0048
ref|WP_016439298.1|  hypothetical protein                               176   1e-46   Coprococcus sp. HPP0074
ref|WP_009262834.1|  peptidase M16                                      176   1e-46   Lachnospiraceae bacterium 9_1_43BFAA
ref|WP_009002339.1|  peptidase M16                                      176   1e-46   Clostridium sp. D5
ref|WP_008976346.1|  peptidase M16                                      176   1e-46   Lachnospiraceae bacterium 6_1_37FAA
ref|WP_022374165.1|  putative Zn-dependent peptidase insulinase-like    175   1e-46   
gb|AFA48231.1|  peptidase                                               175   1e-46   Acetobacterium woodii DSM 1030
ref|WP_042736266.1|  peptidase M16                                      175   1e-46   Lachnospiraceae bacterium TWA4
ref|WP_041670908.1|  peptidase M16                                      175   1e-46   Acetobacterium woodii
ref|WP_021642841.1|  peptidase M16 inactive domain protein [            175   2e-46   [Clostridium] symbiosum
ref|WP_029968780.1|  hypothetical protein                               175   2e-46   
ref|WP_044984429.1|  peptidase M16                                      175   2e-46   Lachnospiraceae bacterium M18-1
ref|WP_003508127.1|  peptidase M16 [                                    175   2e-46   [Clostridium] symbiosum
ref|WP_009296156.1|  peptidase M16                                      175   2e-46   Clostridium sp. 7_3_54FAA
ref|WP_005612121.1|  peptidase M16                                      175   2e-46   Ruminococcus lactaris
ref|WP_023921967.1|  hypothetical protein                               175   2e-46   Ruminococcus lactaris
gb|EOS40989.1|  hypothetical protein C808_00153                         175   2e-46   Lachnospiraceae bacterium M18-1
ref|WP_009144609.1|  peptidase M16                                      174   2e-46   Phascolarctobacterium succinatutens
ref|WP_022074565.1|  hypothetical protein                               174   2e-46   
ref|WP_022359738.1|  m16 family Peptidase                               174   3e-46   
ref|WP_013725059.1|  peptidase M16                                      174   3e-46   Clostridium botulinum
ref|WP_008870220.1|  peptidase M16                                      174   3e-46   Desulfonatronospira thiodismutans
ref|WP_027633171.1|  peptidase M16                                      174   3e-46   Clostridium hydrogeniformans
ref|WP_009757457.1|  peptidase M16                                      174   3e-46   Lachnospiraceae bacterium 2_1_46FAA
ref|WP_022262531.1|  peptidase M16 family                               174   4e-46   
ref|WP_044924421.1|  peptidase M16                                      174   4e-46   Anaerostipes hadrus
ref|WP_022092138.1|  putative Zn-dependent peptidase insulinase-like    174   4e-46   
ref|WP_008393275.1|  peptidase M16                                      174   4e-46   Clostridium sp. SS2/1
ref|WP_003367928.1|  peptidase M16                                      174   4e-46   Clostridium botulinum
ref|WP_039282799.1|  peptidase M16                                      174   5e-46   Clostridium
ref|WP_009265535.1|  peptidase M16                                      174   5e-46   Lachnospiraceae bacterium 5_1_63FAA
ref|WP_044925615.1|  peptidase M16 [                                    174   5e-46   Blautia obeum
ref|WP_039255922.1|  peptidase M16                                      174   5e-46   Clostridium novyi
ref|WP_005424455.1|  peptidase M16 [                                    174   6e-46   
ref|WP_039258210.1|  peptidase M16                                      173   6e-46   Clostridium botulinum
ref|WP_039280280.1|  peptidase M16                                      173   6e-46   Clostridium botulinum
ref|WP_039277219.1|  peptidase M16                                      173   6e-46   Clostridium botulinum
ref|WP_028087063.1|  peptidase M16                                      173   6e-46   Dorea longicatena
ref|WP_022389503.1|  peptidase M16 inactive domain protein              173   6e-46   
ref|WP_002602500.1|  peptidase [                                        173   6e-46   
ref|WP_013978117.1|  peptidase M16                                      173   7e-46   
ref|WP_038352608.1|  peptidase M16                                      173   8e-46   
ref|XP_003057543.1|  predicted protein                                  173   8e-46   
ref|WP_021169379.1|  protein HypA                                       173   9e-46   
ref|WP_022415087.1|  peptidase M16 inactive domain protein              173   9e-46   
ref|WP_006426364.1|  peptidase M16                                      173   9e-46   
ref|WP_013381560.1|  hypothetical protein                               173   1e-45   
ref|WP_034548915.1|  peptidase M16                                      172   1e-45   
ref|WP_034582737.1|  peptidase M16                                      172   1e-45   
ref|WP_018598322.1|  peptidase M16                                      172   1e-45   
ref|WP_023162326.1|  Peptidase M16C associated domain protein           172   1e-45   
ref|WP_010966288.1|  peptidase M16                                      172   1e-45   
ref|WP_009203647.1|  peptidase M16 inactive domain protein              172   1e-45   
ref|XP_009037871.1|  hypothetical protein AURANDRAFT_53944              172   1e-45   
ref|WP_013240340.1|  peptidase M16                                      172   1e-45   
ref|WP_026514263.1|  peptidase M16                                      172   1e-45   
ref|WP_009267857.1|  peptidase M16                                      172   1e-45   
ref|WP_022267732.1|  hypothetical protein                               172   1e-45   
ref|WP_033139292.1|  peptidase M16                                      172   2e-45   
ref|WP_029468370.1|  peptidase M16                                      172   2e-45   
ref|WP_006555004.1|  hypothetical protein                               172   2e-45   
ref|WP_044990717.1|  peptidase M16                                      172   2e-45   
ref|WP_008402837.1|  peptidase M16                                      172   2e-45   
ref|WP_025655146.1|  peptidase M16                                      172   2e-45   
emb|CCZ25963.1|  peptidase M16 inactive domain protein                  172   2e-45   
ref|WP_009243415.1|  MULTISPECIES: peptidase M16                        172   2e-45   
ref|WP_004847047.1|  peptidase M16 [                                    172   2e-45   
ref|WP_044988046.1|  peptidase M16                                      172   2e-45   
ref|WP_022250769.1|  hypothetical protein                               172   2e-45   
gb|EMZ26657.1|  hypothetical protein C824_02504                         172   2e-45   
gb|EEA80449.1|  hypothetical protein CLONEX_03654                       172   2e-45   
ref|WP_035148220.1|  peptidase M16                                      172   2e-45   
ref|WP_022345917.1|  peptidase M16 inactive domain protein              172   2e-45   
ref|WP_021840996.1|  peptidase M16 inactive domain protein              171   3e-45   
ref|WP_022302918.1|  peptidase M16 family                               171   3e-45   
ref|WP_005603795.1|  peptidase M16                                      171   3e-45   
ref|WP_040636855.1|  peptidase M16                                      171   3e-45   
ref|WP_002593286.1|  peptidase [                                        171   3e-45   
gb|ERL25529.1|  peptidase M16 inactive domain protein                   171   3e-45   
ref|WP_024733160.1|  peptidase M16                                      171   3e-45   
gb|EFE13743.1|  peptidase M16 inactive domain protein                   171   3e-45   
ref|WP_021960771.1|  peptidase M16 family                               171   3e-45   
ref|WP_002586228.1|  peptidase [                                        171   3e-45   
ref|WP_003524472.1|  MULTISPECIES: peptidase M16                        171   3e-45   
ref|WP_045092357.1|  peptidase M16                                      171   4e-45   
ref|WP_022200298.1|  hypothetical protein                               171   4e-45   
ref|WP_021893380.1|  hypothetical protein                               171   4e-45   
ref|WP_002577940.1|  peptidase [                                        171   4e-45   
ref|WP_039260764.1|  peptidase M16                                      171   4e-45   
ref|WP_002571826.1|  peptidase [                                        171   4e-45   
ref|WP_023437650.1|  zinc-dependent peptidase                           171   4e-45   
ref|WP_002567788.1|  peptidase M16 [                                    171   4e-45   
ref|WP_007867561.1|  peptidase M16 [                                    171   4e-45   
emb|CBL26761.1|  Predicted Zn-dependent peptidases, insulinase-like     171   4e-45   
emb|CDC14546.1|  predicted Zn-dependent peptidases insulinase-like      171   5e-45   
ref|WP_035110249.1|  peptidase M16                                      171   5e-45   
ref|WP_011099072.1|  peptidase M16                                      171   5e-45   
ref|WP_021943734.1|  peptidase M16 inactive domain protein              171   5e-45   
ref|WP_039205951.1|  peptidase M16                                      167   5e-45   
ref|WP_022220671.1|  MULTISPECIES: peptidase M16 inactive domain ...    171   5e-45   
ref|WP_002589733.1|  peptidase [                                        171   5e-45   
ref|WP_039232384.1|  peptidase M16                                      171   5e-45   
ref|WP_039217006.1|  peptidase M16                                      171   5e-45   
ref|WP_026654497.1|  peptidase M16                                      171   6e-45   
ref|WP_021106645.1|  peptidase family protein                           171   6e-45   
ref|WP_003375296.1|  peptidase M16                                      171   6e-45   
gb|AJD28281.1|  peptidase M16 inactive domain protein                   171   6e-45   
ref|WP_045540985.1|  peptidase M16                                      171   6e-45   
ref|WP_041347722.1|  peptidase M16                                      171   6e-45   
ref|WP_033066419.1|  peptidase M16                                      171   6e-45   
ref|WP_025775831.1|  peptidase M16                                      171   6e-45   
ref|WP_014521888.1|  peptidase M16                                      171   6e-45   
ref|WP_015957702.1|  peptidase M16                                      171   6e-45   
ref|WP_003360374.1|  peptidase M16                                      171   6e-45   
ref|WP_003357443.1|  peptidase M16                                      171   6e-45   
ref|WP_012101025.1|  peptidase M16                                      171   6e-45   
ref|WP_012048254.1|  peptidase                                          171   6e-45   
ref|WP_039229792.1|  peptidase M16                                      171   6e-45   
ref|WP_030036983.1|  peptidase M16                                      171   6e-45   
ref|WP_026667026.1|  MULTISPECIES: peptidase M16                        171   6e-45   
gb|EDN76339.1|  peptidase M16 inactive domain protein                   171   6e-45   
ref|WP_029543082.1|  peptidase M16                                      171   6e-45   
ref|WP_003483244.1|  MULTISPECIES: peptidase M16                        171   6e-45   
ref|WP_039237157.1|  peptidase M16                                      171   6e-45   
gb|EEG90319.1|  peptidase M16 inactive domain protein                   171   6e-45   
gb|EEC57947.1|  peptidase M16 inactive domain protein [                 171   6e-45   
ref|WP_039960074.1|  peptidase M16 [                                    171   7e-45   
ref|WP_009244525.1|  peptidase M16 [                                    171   7e-45   
ref|WP_027639774.1|  peptidase M16                                      170   7e-45   
ref|WP_022038272.1|  hypothetical protein                               170   7e-45   
ref|WP_045518680.1|  peptidase M16                                      170   7e-45   
ref|WP_040893250.1|  peptidase M16 [                                    170   7e-45   
ref|WP_022360886.1|  hypothetical protein                               170   7e-45   
ref|WP_007935353.1|  MULTISPECIES: peptidase M16                        170   8e-45   
ref|WP_003492319.1|  peptidase M16                                      170   8e-45   
ref|WP_029451452.1|  peptidase M16                                      170   8e-45   
ref|WP_027642273.1|  peptidase M16 [                                    170   8e-45   
ref|WP_040108719.1|  peptidase M16                                      170   9e-45   
ref|WP_021716196.1|  peptidase M16 inactive domain protein              170   9e-45   
gb|EGS35643.1|  peptidase M16 inactive domain protein                   170   9e-45   
ref|WP_036257306.1|  peptidase M16                                      170   1e-44   
ref|WP_033061370.1|  peptidase M16                                      170   1e-44   
emb|CBK78311.1|  Predicted Zn-dependent peptidases, insulinase-li...    170   1e-44   
ref|WP_044930643.1|  peptidase M16                                      170   1e-44   
ref|WP_022009643.1|  hypothetical protein                               170   1e-44   
ref|WP_011989018.1|  peptidase M16                                      170   1e-44   
ref|WP_021871045.1|  hypothetical protein                               170   1e-44   
ref|WP_025486298.1|  peptidase M16                                      170   1e-44   
ref|WP_039250259.1|  peptidase M16                                      169   1e-44   
ref|WP_011721750.1|  MULTISPECIES: peptidase M16                        169   1e-44   
ref|WP_039238861.1|  peptidase M16                                      169   1e-44   
gb|ERL22297.1|  peptidase M16 inactive domain protein                   169   2e-44   
ref|WP_034446831.1|  peptidase M16                                      169   2e-44   
gb|EFE92811.1|  peptidase M16 inactive domain protein                   169   2e-44   
ref|WP_036599779.1|  peptidase M16                                      169   2e-44   
ref|WP_022005098.1|  hypothetical protein                               169   2e-44   
ref|WP_026522649.1|  peptidase M16                                      169   2e-44   
ref|WP_022770452.1|  peptidase M16                                      169   2e-44   
ref|WP_040653312.1|  peptidase M16                                      169   2e-44   
ref|WP_027624167.1|  peptidase M16                                      169   2e-44   
ref|WP_022514727.1|  zn-dependent peptidase insulinase family pro...    169   2e-44   
ref|WP_012342935.1|  peptidase M16                                      169   2e-44   
ref|WP_045211972.1|  peptidase M16                                      169   2e-44   
ref|WP_036376441.1|  peptidase M16                                      169   2e-44   
ref|WP_018049849.1|  hypothetical protein                               169   2e-44   
ref|WP_033169024.1|  peptidase M16                                      169   2e-44   
ref|WP_032123638.1|  peptidase M16                                      169   2e-44   
ref|WP_007955448.1|  peptidase M16                                      169   2e-44   
ref|WP_016223337.1|  hypothetical protein                               169   2e-44   
ref|WP_025642732.1|  peptidase M16                                      169   2e-44   
ref|WP_035294970.1|  peptidase M16                                      169   2e-44   
ref|WP_035309946.1|  peptidase M16                                      169   2e-44   
ref|WP_034439641.1|  peptidase M16                                      169   2e-44   
ref|WP_006773397.1|  peptidase M16 [                                    169   3e-44   
ref|WP_022031851.1|  peptidase M16 family                               169   3e-44   
ref|WP_021966041.1|  peptidase M16 inactive domain protein              169   3e-44   
ref|WP_040379928.1|  peptidase M16                                      169   3e-44   
gb|EEQ57766.1|  peptidase M16 inactive domain protein                   169   3e-44   
ref|WP_022036330.1|  hypothetical protein                               168   3e-44   
ref|WP_044504232.1|  peptidase M16                                      168   3e-44   
ref|WP_019879338.1|  hypothetical protein                               168   3e-44   
ref|WP_021952485.1|  peptidase M16 inactive domain protein              168   4e-44   
ref|WP_031368022.1|  peptidase M16                                      168   4e-44   
ref|WP_036027214.1|  peptidase M16                                      168   4e-44   
ref|WP_040411513.1|  peptidase M16 [                                    168   4e-44   
ref|WP_024737232.1|  peptidase M16                                      168   4e-44   
gb|EEG56357.1|  peptidase M16 inactive domain protein [ [               168   4e-44   
ref|WP_005539104.1|  peptidase M16                                      168   4e-44   
ref|WP_006190827.1|  peptidase M16                                      168   4e-44   
ref|WP_009248783.1|  peptidase M16 [                                    168   4e-44   
ref|WP_022243043.1|  zn-dependent peptidase insulinase family pro...    168   4e-44   
ref|WP_022500937.1|  hypothetical protein                               168   5e-44   
ref|WP_009646386.1|  peptidase M16                                      168   5e-44   
ref|WP_027115174.1|  hypothetical protein                               168   5e-44   
ref|WP_006781853.1|  peptidase M16 [                                    168   5e-44   
ref|WP_024866717.1|  peptidase M16                                      168   5e-44   
gb|EDS07236.1|  peptidase M16 inactive domain protein [ [               168   5e-44   
ref|WP_044964379.1|  peptidase M16                                      168   5e-44   
ref|WP_031558104.1|  peptidase M16                                      168   5e-44   
ref|WP_021285711.1|  hypothetical protein                               168   5e-44   
ref|WP_026660066.1|  peptidase M16                                      168   5e-44   
gb|EFQ03705.1|  peptidase M16 inactive domain protein                   168   5e-44   
ref|WP_029506194.1|  peptidase M16                                      168   5e-44   
gb|ERK46711.1|  peptidase M16 inactive domain protein                   168   5e-44   
ref|WP_022766914.1|  peptidase M16                                      168   5e-44   
ref|WP_027432327.1|  peptidase M16                                      168   6e-44   
ref|WP_027405693.1|  peptidase M16                                      168   6e-44   
ref|WP_040774437.1|  peptidase M16                                      168   6e-44   
ref|WP_027104460.1|  peptidase M16                                      168   6e-44   
ref|WP_036607124.1|  peptidase M16                                      168   6e-44   
ref|WP_026520362.1|  peptidase M16                                      167   7e-44   
ref|WP_038669998.1|  peptidase M16                                      167   7e-44   
ref|WP_024346955.1|  peptidase M16 [                                    167   8e-44   
ref|WP_024854334.1|  peptidase M16 [                                    167   8e-44   
ref|WP_044292922.1|  peptidase M16                                      167   8e-44   
ref|WP_027293762.1|  peptidase M16                                      167   8e-44   
ref|WP_022351639.1|  hypothetical protein                               167   8e-44   
ref|WP_004223111.1|  peptidase M16                                      167   9e-44   
ref|WP_044918155.1|  peptidase M16                                      167   9e-44   
ref|WP_022239112.1|  hypothetical protein                               167   9e-44   
ref|WP_009246788.1|  peptidase M16                                      167   9e-44   
ref|WP_035640716.1|  peptidase M16                                      167   1e-43   
ref|WP_044994915.1|  peptidase M16                                      167   1e-43   
ref|WP_022367599.1|  peptidase M16 family                               167   1e-43   
ref|WP_012062915.1|  peptidase M16                                      167   1e-43   
ref|WP_021885887.1|  peptidase M16 inactive domain protein              167   1e-43   
ref|WP_021901371.1|  peptidase M16 family                               167   1e-43   
ref|WP_040783031.1|  peptidase M16                                      163   1e-43   
ref|WP_006444431.1|  peptidase M16 [                                    167   1e-43   
ref|WP_014079416.1|  peptidase M16                                      167   1e-43   
ref|WP_022318382.1|  peptidase M16 inactive domain protein              167   1e-43   
gb|EET61285.1|  peptidase M16 inactive domain protein                   163   1e-43   
ref|WP_024291571.1|  MULTISPECIES: peptidase M16                        167   1e-43   
ref|WP_022399794.1|  peptidase M16 family                               167   1e-43   
ref|WP_027396310.1|  peptidase M16                                      167   1e-43   
ref|WP_031583417.1|  hypothetical protein                               167   1e-43   
ref|WP_022313374.1|  hypothetical protein                               167   1e-43   
ref|WP_007556480.1|  peptidase M16                                      166   2e-43   
ref|WP_007553874.1|  peptidase M16                                      166   2e-43   
ref|WP_022106554.1|  hypothetical protein                               157   2e-43   
ref|WP_022449237.1|  hypothetical protein                               166   2e-43   
ref|WP_026884785.1|  peptidase M16                                      166   2e-43   
ref|WP_022088011.1|  putative Zn-dependent peptidase insulinase-like    166   2e-43   
ref|WP_035134584.1|  peptidase M16                                      166   2e-43   
ref|WP_007278732.1|  putative zinc metalloprotease                      166   2e-43   
ref|WP_044970856.1|  peptidase M16                                      166   2e-43   
ref|WP_016226596.1|  hypothetical protein                               166   3e-43   
ref|WP_021653846.1|  peptidase M16 inactive domain protein              166   3e-43   
ref|WP_027113718.1|  peptidase M16                                      166   3e-43   
ref|WP_028530302.1|  peptidase M16                                      166   3e-43   
ref|WP_023509403.1|  peptidase M16                                      166   3e-43   
ref|WP_022172571.1|  peptidase M16 family                               166   3e-43   
ref|WP_009533890.1|  peptidase M16                                      166   3e-43   
ref|WP_029200616.1|  peptidase M16                                      166   3e-43   
ref|WP_028977449.1|  peptidase M16                                      166   3e-43   
ref|WP_028129011.1|  peptidase M16                                      166   3e-43   
ref|WP_021914133.1|  hypothetical protein                               166   3e-43   
ref|WP_021718536.1|  peptidase M16 inactive domain protein              166   3e-43   
ref|WP_022461181.1|  peptidase M16 family                               166   4e-43   
ref|WP_008859142.1|  peptidase M16                                      166   4e-43   



>ref|XP_004230817.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Solanum lycopersicum]
 ref|XP_010315269.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Solanum lycopersicum]
Length=1072

 Score =   291 bits (746),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 176/223 (79%), Gaps = 15/223 (7%)
 Frame = +2

Query  2    MEGRDLLRSLSPPN----STLFARSS---LSFSKRPHCFANHLSNPRSTFRNRLLFTSTA  160
            ME   LLRSLS  +    S +F+RSS    S+S R H    +L   RS  R+ +   S+ 
Sbjct  1    MERAVLLRSLSSTSTLAFSRIFSRSSHRFASYSARRHRLLQNLQRRRSLVRSNVRGISS-  59

Query  161  ALPSLHLRTRFSPLSVRAVYTFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVL  328
               S++L+ +F PLSVRA+ T  P+ S    GA+D+VA K GFEKVSEQF+DECKS+AVL
Sbjct  60   ---SINLKRQFYPLSVRAIATSSPQSSQEFLGADDEVAEKFGFEKVSEQFIDECKSKAVL  116

Query  329  YKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVEL  508
            YKHKKTGAE+MSVSNDDENKVFG+ FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVEL
Sbjct  117  YKHKKTGAEVMSVSNDDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVEL  176

Query  509  LKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            LKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  177  LKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  219



>ref|XP_009760273.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Nicotiana sylvestris]
Length=1072

 Score =   291 bits (746),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 174/222 (78%), Gaps = 13/222 (6%)
 Frame = +2

Query  2    MEGRDLLRSLSPPNSTLFARSSLSFSKRPHCFANHLSNP----RSTFRNRLLFTSTAAL-  166
            ME   LLRSLS  ++  F+R    FS+  H  A++ +      ++ +R R L  S   L 
Sbjct  1    MEKAVLLRSLSSTSTLAFSRI---FSRSSHRLASYSAKRHRLLQNLYRRRSLIRSNGRLL  57

Query  167  -PSLHLRTRFSPLSVRAVYTFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
             PSL L+ +F PLSVRA+ T  P+ S    GA+D+VA K GFEKVSEQF+DECKS+AVLY
Sbjct  58   SPSLDLKRQFYPLSVRAIATSAPQSSQEFLGADDEVAEKYGFEKVSEQFIDECKSKAVLY  117

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTGAEIMSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELL
Sbjct  118  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELL  177

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSLNTFLNAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  178  KGSLNTFLNAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  219



>ref|XP_009628645.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Nicotiana tomentosiformis]
Length=1072

 Score =   291 bits (745),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 174/222 (78%), Gaps = 13/222 (6%)
 Frame = +2

Query  2    MEGRDLLRSLSPPNSTLFARSSLSFSKRPHCFANHLSNP----RSTFRNRLLFTSTAAL-  166
            ME   LLRSLS  ++  F+R    FS+  H  A++ +      ++ +R R L  S   L 
Sbjct  1    MEKAVLLRSLSSTSTLAFSRI---FSRSSHRLASYSAKRHRLLQNLYRRRSLIRSNGRLL  57

Query  167  -PSLHLRTRFSPLSVRAVYTFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
             PSL L+ +F PLSVRA+ T  P+ S    GA+D+VA K GFEKVSEQF+DECKS+AVLY
Sbjct  58   SPSLDLKRQFYPLSVRAIATSVPQSSQEFLGADDEVAEKYGFEKVSEQFIDECKSKAVLY  117

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTGAEIMSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELL
Sbjct  118  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELL  177

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSLNTFLNAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  178  KGSLNTFLNAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  219



>ref|XP_006346464.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Solanum tuberosum]
Length=1072

 Score =   286 bits (731),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 166/203 (82%), Gaps = 11/203 (5%)
 Frame = +2

Query  50   LFARSS---LSFSKRPHCFANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVY  220
            +F+RSS    S+S R H    +L   RS  R+ +   S+    S++L+ +F PLSVRA+ 
Sbjct  21   IFSRSSHRFASYSARRHRLLQNLHRRRSLVRSNVRGISS----SINLKRQFYPLSVRAIA  76

Query  221  TFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENK  388
            T  P+ S    GA+D+VA K GFEKVSEQF+DECKS+AVLYKHKKTGAE+MSVSNDDENK
Sbjct  77   TSSPQSSQEFLGADDEVAEKFGFEKVSEQFIDECKSKAVLYKHKKTGAEVMSVSNDDENK  136

Query  389  VFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCY  568
            VFG+ FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCY
Sbjct  137  VFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCY  196

Query  569  PVASTNTKDFYNLVDVYLDAVFF  637
            PVASTNTKDFYNLVDVYLDAVFF
Sbjct  197  PVASTNTKDFYNLVDVYLDAVFF  219



>ref|XP_011088279.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Sesamum indicum]
Length=1078

 Score =   282 bits (721),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 163/202 (81%), Gaps = 7/202 (3%)
 Frame = +2

Query  50   LFARSSLSFSKRP--HCFANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYT  223
            LF+RS    ++ P  H    ++ + RS  R  L F S  + PSL L   F  LSVRAV T
Sbjct  25   LFSRSVHRLARLPRRHRLVPNV-HQRSLLRRHLGFISAVSRPSLQLSRHFCSLSVRAVAT  83

Query  224  FP----PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKV  391
                  PE+ GA+DDVA KLGFEKVS++F++ECKSRAVLYKHKKTGAE+MSVSN+DENKV
Sbjct  84   SSVQSSPEVLGADDDVAEKLGFEKVSDEFIEECKSRAVLYKHKKTGAEVMSVSNEDENKV  143

Query  392  FGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYP  571
            FGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYP
Sbjct  144  FGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYP  203

Query  572  VASTNTKDFYNLVDVYLDAVFF  637
            VASTNTKDFYNLVDVYLDAVFF
Sbjct  204  VASTNTKDFYNLVDVYLDAVFF  225



>ref|XP_010269115.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial 
[Nelumbo nucifera]
Length=1080

 Score =   271 bits (693),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 154/182 (85%), Gaps = 9/182 (5%)
 Frame = +2

Query  110  SNPRSTFRN--RLLFTSTAALPSLHLRTRFSPLSVRAVYTFP----PELSGAEDDVARKL  271
            +N RS  R+  RL+ +S +   SLHL   FS L+ RA+ T P    P++ G+ D+VA KL
Sbjct  49   ANGRSALRHPCRLISSSPS---SLHLNRCFSSLTPRAIATSPQYASPDIGGSHDEVAEKL  105

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFEK+SEQ + ECKS+AVLYKHKKTGAE+MSVSNDDENKVFGI FRTPPK+STGIPHILE
Sbjct  106  GFEKISEQVIQECKSKAVLYKHKKTGAEVMSVSNDDENKVFGIVFRTPPKDSTGIPHILE  165

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV
Sbjct  166  HSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  225

Query  632  FF  637
            FF
Sbjct  226  FF  227



>gb|AFW73556.1| hypothetical protein ZEAMMB73_636378 [Zea mays]
Length=291

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 139/173 (80%), Gaps = 13/173 (8%)
 Frame = +2

Query  155  TAALPSLHLRTRFSP---------LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQF  298
             AA P LH   R+ P         LS  AV T P  +    DDV   A KLGFEKVSEQ 
Sbjct  60   VAAAP-LHCSGRYWPAAAPQLARRLSASAVSTSPSPVPYDTDDVHEYATKLGFEKVSEQT  118

Query  299  VDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRK  478
            +DECKS AVLYKHKKTGAE+MSVSNDDENKVFGI FRTPPKNSTGIPHILEHSVL GSRK
Sbjct  119  IDECKSIAVLYKHKKTGAEVMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRK  178

Query  479  YPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            YPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  179  YPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  231



>ref|XP_006423050.1| hypothetical protein CICLE_v10029929mg [Citrus clementina]
 gb|ESR36290.1| hypothetical protein CICLE_v10029929mg [Citrus clementina]
Length=495

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 157/200 (79%), Gaps = 6/200 (3%)
 Frame = +2

Query  53   FARSSLSFSKRPHC-FANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYT--  223
            F+ SS++ ++R H    N+L+  RS  R       + +  SL     FS LS RAV +  
Sbjct  31   FSSSSVAVARRNHHRLINNLTR-RSLLRGDSRLHLSLSSYSLQFNKHFSSLSPRAVASPS  89

Query  224  FPPELSGAE--DDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFG  397
             P    GAE  ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDENKVFG
Sbjct  90   TPSSPEGAEVSNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDENKVFG  149

Query  398  IDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVA  577
            I FRTPPK+STGIPHILEHSVL GSRKYPLK+ FVELLKGSLNTFLNAFTYPDRTCYPVA
Sbjct  150  IVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEQFVELLKGSLNTFLNAFTYPDRTCYPVA  209

Query  578  STNTKDFYNLVDVYLDAVFF  637
            STNTKDFYNLVDVYLDAVFF
Sbjct  210  STNTKDFYNLVDVYLDAVFF  229



>ref|XP_009417618.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=1075

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/224 (66%), Positives = 166/224 (74%), Gaps = 14/224 (6%)
 Frame = +2

Query  2    MEGRDLLRSLSPPNSTLFARSSLSFSKRPHCFANHLSNPR-STFRNRLLFTSTAA-----  163
            ME   LLRSLS  ++T + R           F+++L  PR    + R L  S A+     
Sbjct  1    MERVALLRSLSC-STTAYRRLLFRPRSASRLFSSNLCRPRPQELQLRALSCSGASRWRPG  59

Query  164  -LPSLHLRTRFSPLSVRAVYTFPPELSGAED-----DVARKLGFEKVSEQFVDECKSRAV  325
              P L LR RFSP S+RA+ T P  +S   D     D+A KLGFE +SEQ ++ECK+ AV
Sbjct  60   PAPPLRLRRRFSP-SIRAISTSPSPVSRGADIDSRNDIAEKLGFEIISEQTINECKATAV  118

Query  326  LYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVE  505
            LYKHKKTGAEIMSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVE
Sbjct  119  LYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVE  178

Query  506  LLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            LLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  179  LLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  222



>ref|XP_009417619.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=1073

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 167/222 (75%), Gaps = 12/222 (5%)
 Frame = +2

Query  2    MEGRDLLRSLSPPNSTLFARSSLSFSKRPHCFANHLSNPR-STFRNRLLFTSTAA-----  163
            ME   LLRSLS  ++T + R           F+++L  PR    + R L  S A+     
Sbjct  1    MERVALLRSLSC-STTAYRRLLFRPRSASRLFSSNLCRPRPQELQLRALSCSGASRWRPG  59

Query  164  -LPSLHLRTRFSPLSVRAVYTFPPELS---GAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
              P L LR RFSP S+RA+ T P  +S    + +D+A KLGFE +SEQ ++ECK+ AVLY
Sbjct  60   PAPPLRLRRRFSP-SIRAISTSPSPVSRDIDSRNDIAEKLGFEIISEQTINECKATAVLY  118

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTGAEIMSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELL
Sbjct  119  KHKKTGAEIMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELL  178

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  179  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  220



>ref|XP_002518788.1| zinc metalloprotease, putative [Ricinus communis]
 gb|EEF43713.1| zinc metalloprotease, putative [Ricinus communis]
Length=302

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 144/176 (82%), Gaps = 7/176 (4%)
 Frame = +2

Query  131  RNRLLFTSTAALPSLHLR--TRFSPLSVRAVYTFP----PELSGA-EDDVARKLGFEKVS  289
            RN  LF   A   S   R    FS LS  AV T P    P+++G    +VA KLGF+KVS
Sbjct  53   RNWRLFPVAATSSSSSSRFNKHFSSLSPAAVATHPAPSSPDVAGGVPSEVAEKLGFQKVS  112

Query  290  EQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSG  469
            E+F++ECKS+A L++HKKTGAEIMSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL G
Sbjct  113  EEFIEECKSKAELFRHKKTGAEIMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCG  172

Query  470  SRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            SRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  173  SRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  228



>ref|XP_006423048.1| hypothetical protein CICLE_v10027722mg [Citrus clementina]
 gb|ESR36288.1| hypothetical protein CICLE_v10027722mg [Citrus clementina]
Length=815

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 163/202 (81%), Gaps = 10/202 (5%)
 Frame = +2

Query  53   FARSSLSFSKRPHC-FANHLSNPRSTFR--NRLLFTSTAALPSLHLRTRFSPLSVRAVYT  223
            F+ SS++ ++R H    N+L+  RS  R  +RL F+ ++   SL     FS LS RAV +
Sbjct  31   FSSSSVAVARRNHHRLINNLTR-RSLLRGDSRLRFSLSSY--SLQFNKHFSSLSPRAVAS  87

Query  224  ----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKV  391
                  PE++   ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDENKV
Sbjct  88   PSTPSSPEVAEVSNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDENKV  147

Query  392  FGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYP  571
            FGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYP
Sbjct  148  FGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYP  207

Query  572  VASTNTKDFYNLVDVYLDAVFF  637
            VASTNTKDFYNLVDVYLDAVFF
Sbjct  208  VASTNTKDFYNLVDVYLDAVFF  229



>ref|XP_006423047.1| hypothetical protein CICLE_v10027722mg [Citrus clementina]
 gb|ESR36287.1| hypothetical protein CICLE_v10027722mg [Citrus clementina]
Length=1082

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 162/202 (80%), Gaps = 10/202 (5%)
 Frame = +2

Query  53   FARSSLSFSKRPHC-FANHLSNPRSTFRN--RLLFTSTAALPSLHLRTRFSPLSVRAVYT  223
            F+ SS++ ++R H    N+L+  RS  R   RL F+ ++   SL     FS LS RAV +
Sbjct  31   FSSSSVAVARRNHHRLINNLTR-RSLLRGDSRLRFSLSSY--SLQFNKHFSSLSPRAVAS  87

Query  224  ----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKV  391
                  PE++   ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDENKV
Sbjct  88   PSTPSSPEVAEVSNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDENKV  147

Query  392  FGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYP  571
            FGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYP
Sbjct  148  FGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYP  207

Query  572  VASTNTKDFYNLVDVYLDAVFF  637
            VASTNTKDFYNLVDVYLDAVFF
Sbjct  208  VASTNTKDFYNLVDVYLDAVFF  229



>ref|XP_006487082.1| PREDICTED: LOW QUALITY PROTEIN: presequence protease 2, chloroplastic/mitochondrial-like 
[Citrus sinensis]
Length=1082

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 158/200 (79%), Gaps = 6/200 (3%)
 Frame = +2

Query  53   FARSSLSFSKRPHC-FANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYT--  223
            F+ SS++ ++R H    N+L+  RS  R       + +  SL     FS LS RAV +  
Sbjct  31   FSSSSVAVARRNHHRLINNLTR-RSLLRGDSRLHLSLSSYSLQFNKHFSSLSPRAVASPS  89

Query  224  --FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFG  397
                PE++   ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+MSVSNDDENKVFG
Sbjct  90   TPSSPEVAEVSNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVMSVSNDDENKVFG  149

Query  398  IDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVA  577
            I FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYPVA
Sbjct  150  IVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYPVA  209

Query  578  STNTKDFYNLVDVYLDAVFF  637
            STNTKDFYNLVDVYLDAVFF
Sbjct  210  STNTKDFYNLVDVYLDAVFF  229



>ref|XP_008454934.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Cucumis melo]
Length=1084

 Score =   261 bits (668),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 159/208 (76%), Gaps = 17/208 (8%)
 Frame = +2

Query  44   STLFARSSLSFSKRPHCFANHLSNPRSTFRNRLLFTSTAALP------SLHLRTRFSPLS  205
            STL  RSS S S++ H   +  S      R  LL     +LP      S H R +FS L+
Sbjct  31   STLPLRSS-SVSRKLHRLNHSFS------RRSLLPRQLKSLPAYSQSCSFHFRKQFSSLA  83

Query  206  VRAVYT----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSN  373
             RAV +     PPE +   D+VA KLGFEKVSE+F+ ECKS+AVL++HKKTGAE+MSVSN
Sbjct  84   PRAVASPPAHSPPEFAEVSDEVAEKLGFEKVSEEFIGECKSKAVLFRHKKTGAEVMSVSN  143

Query  374  DDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYP  553
            DDENKVFGI FRTPP +STGIPHILEHSVL GSRKYP+K+PFVELLKGSL+TFLNAFTYP
Sbjct  144  DDENKVFGIVFRTPPSDSTGIPHILEHSVLCGSRKYPVKEPFVELLKGSLHTFLNAFTYP  203

Query  554  DRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            DRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  204  DRTCYPVASTNTKDFYNLVDVYLDAVFF  231



>ref|XP_007042387.1| Presequence protease 2 isoform 4 [Theobroma cacao]
 gb|EOX98218.1| Presequence protease 2 isoform 4 [Theobroma cacao]
Length=849

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 3/152 (2%)
 Frame = +2

Query  191  FSPLSVRAVY--TFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  361
            FS LS RAV   T P P+++G ED+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+M
Sbjct  81   FSSLSPRAVASPTQPSPDIAGVEDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVM  140

Query  362  SVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNA  541
            SVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  141  SVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  200

Query  542  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  201  FTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  232



>ref|XP_010939450.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=1072

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 141/161 (88%), Gaps = 5/161 (3%)
 Frame = +2

Query  167  PSLHLRTRFSPLSVRAVYTFPPELSGAE----DDVARKLGFEKVSEQFVDECKSRAVLYK  334
            PS+HLR  FS L+ RAV T P  +S A+     D+A KLGFEK+SEQ +DECKS AVLYK
Sbjct  60   PSVHLRRAFS-LTTRAVSTTPSPVSRADMDESHDIAEKLGFEKISEQTIDECKSTAVLYK  118

Query  335  HKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLK  514
            HKKTGAE+MS+SNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLK
Sbjct  119  HKKTGAEVMSLSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLK  178

Query  515  GSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            GSL+TFLNAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  179  GSLHTFLNAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  219



>ref|XP_004136986.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Cucumis sativus]
 gb|KGN43941.1| hypothetical protein Csa_7G073760 [Cucumis sativus]
Length=1084

 Score =   260 bits (665),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 156/202 (77%), Gaps = 5/202 (2%)
 Frame = +2

Query  44   STLFARSSLSFSKRPHCFANHLSNPRSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYT  223
            STL  RSS   S++ H F    S      R   L  + +   S H R +FS L+ RAV +
Sbjct  31   STLPPRSSF-VSRKLHRFNPSFSRRSLLPRQLKLLPAYSQSRSSHFRKQFSSLAPRAVAS  89

Query  224  ----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKV  391
                 PPE +   D+VA KLGFEKVSE+F+ ECKS+AVL++HKKTGAE+MSVSNDDENKV
Sbjct  90   PPAHSPPEFAEVSDEVAEKLGFEKVSEEFIGECKSKAVLFRHKKTGAEVMSVSNDDENKV  149

Query  392  FGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYP  571
            FGI FRTPP +STGIPHILEHSVL GSRKYP+K+PFVELLKGSL+TFLNAFTYPDRTCYP
Sbjct  150  FGIVFRTPPSDSTGIPHILEHSVLCGSRKYPVKEPFVELLKGSLHTFLNAFTYPDRTCYP  209

Query  572  VASTNTKDFYNLVDVYLDAVFF  637
            VASTNTKDFYNLVDVYLDAVFF
Sbjct  210  VASTNTKDFYNLVDVYLDAVFF  231



>ref|XP_010939451.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=1071

 Score =   260 bits (665),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +2

Query  167  PSLHLRTRFSPLSVRAVYTFPPELSGAED---DVARKLGFEKVSEQFVDECKSRAVLYKH  337
            PS+HLR  FS L+ RAV T P  +S   D   D+A KLGFEK+SEQ +DECKS AVLYKH
Sbjct  60   PSVHLRRAFS-LTTRAVSTTPSPVSRDMDESHDIAEKLGFEKISEQTIDECKSTAVLYKH  118

Query  338  KKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKG  517
            KKTGAE+MS+SNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKG
Sbjct  119  KKTGAEVMSLSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKG  178

Query  518  SLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            SL+TFLNAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  179  SLHTFLNAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  218



>ref|XP_007042388.1| Presequence protease 2 isoform 5 [Theobroma cacao]
 gb|EOX98219.1| Presequence protease 2 isoform 5 [Theobroma cacao]
Length=971

 Score =   259 bits (663),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 3/152 (2%)
 Frame = +2

Query  191  FSPLSVRAVY--TFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  361
            FS LS RAV   T P P+++G ED+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+M
Sbjct  81   FSSLSPRAVASPTQPSPDIAGVEDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVM  140

Query  362  SVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNA  541
            SVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  141  SVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  200

Query  542  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  201  FTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  232



>ref|XP_010481056.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=740

 Score =   256 bits (654),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 147/180 (82%), Gaps = 5/180 (3%)
 Frame = +2

Query  107  LSNPRSTFRNRLLFTSTAALPSLHLRT---RFSPLSVRAVYTFPPELSGAEDDVARKLGF  277
            LS P +  R RL  +    L S   R+   +FS LS+RAV T P      +DD A KLGF
Sbjct  41   LSTPEAAGR-RLFLSRGFKLRSATSRSLSGQFSRLSIRAVATQPAPSYLGQDD-AEKLGF  98

Query  278  EKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHS  457
            EKVSE+F+ ECKS+AVL+KHKKTG E+MSVSNDDENKVFGI FRTPPK+STGIPHILEHS
Sbjct  99   EKVSEEFISECKSKAVLFKHKKTGCEVMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHS  158

Query  458  VLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            VL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  159  VLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  218



>ref|XP_007042385.1| Presequence protease 2 isoform 2 [Theobroma cacao]
 gb|EOX98216.1| Presequence protease 2 isoform 2 [Theobroma cacao]
Length=1040

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 3/152 (2%)
 Frame = +2

Query  191  FSPLSVRAVY--TFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  361
            FS LS RAV   T P P+++G ED+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+M
Sbjct  81   FSSLSPRAVASPTQPSPDIAGVEDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVM  140

Query  362  SVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNA  541
            SVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  141  SVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  200

Query  542  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  201  FTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  232



>ref|XP_004296078.2| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=1105

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 146/180 (81%), Gaps = 9/180 (5%)
 Frame = +2

Query  119  RSTFRNRLL---FTSTAALPSLHLRTRFSPLSVRAVYT----FPPELSGAEDDVARKLGF  277
            R   R  LL   F   AA P  H   RFS LS RAV T     P E SG  D+VA KLGF
Sbjct  75   RQILRPSLLRRTFLLPAASP--HFSRRFSSLSPRAVATPLTPSPSESSGVSDEVAEKLGF  132

Query  278  EKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHS  457
            EKV+E+F+ ECKS+A+L++HKKTGA+++SVSNDDENKVFGI FRTPP +STGIPHILEHS
Sbjct  133  EKVTEEFIGECKSKALLFRHKKTGAQMISVSNDDENKVFGIVFRTPPNDSTGIPHILEHS  192

Query  458  VLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            VL GSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  193  VLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  252



>ref|XP_007042384.1| Presequence protease 2 isoform 1 [Theobroma cacao]
 gb|EOX98215.1| Presequence protease 2 isoform 1 [Theobroma cacao]
Length=1037

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 3/152 (2%)
 Frame = +2

Query  191  FSPLSVRAVY--TFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  361
            FS LS RAV   T P P+++G ED+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+M
Sbjct  81   FSSLSPRAVASPTQPSPDIAGVEDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVM  140

Query  362  SVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNA  541
            SVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  141  SVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  200

Query  542  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  201  FTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  232



>ref|XP_003570577.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Brachypodium distachyon]
Length=1083

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 144/181 (80%), Gaps = 16/181 (9%)
 Frame = +2

Query  131  RNRLLFTSTAALPSLHLRTRFSP---------LSVRAVYTFPPELSGAEDDV---ARKLG  274
            R+RLL    AA   LH   R+ P         LSV AV T P  +    DDV   A KLG
Sbjct  54   RSRLL----AAAAPLHCAGRYWPPYAPGLARRLSVPAVSTSPSPVPHDTDDVHEYAAKLG  109

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            FEKVSEQ +DECKS AVLYKHKKTGAE+MSV+NDDENKVFGI FRTPPKNSTGIPHILEH
Sbjct  110  FEKVSEQVIDECKSTAVLYKHKKTGAEVMSVANDDENKVFGIVFRTPPKNSTGIPHILEH  169

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  170  SVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  229

Query  635  F  637
            F
Sbjct  230  F  230



>ref|XP_007042386.1| Presequence protease 2 isoform 3 [Theobroma cacao]
 gb|EOX98217.1| Presequence protease 2 isoform 3 [Theobroma cacao]
Length=1041

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 3/152 (2%)
 Frame = +2

Query  191  FSPLSVRAVY--TFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  361
            FS LS RAV   T P P+++G ED+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+M
Sbjct  81   FSSLSPRAVASPTQPSPDIAGVEDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEVM  140

Query  362  SVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNA  541
            SVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  141  SVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  200

Query  542  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  201  FTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  232



>ref|XP_010500508.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial 
[Camelina sativa]
Length=1071

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 148/181 (82%), Gaps = 7/181 (4%)
 Frame = +2

Query  107  LSNPRSTFRNRLLFTSTAALPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLG  274
            LS P +  R RLL +    L S   R+   +FS LS+RAV T P P   G   D A KLG
Sbjct  41   LSTPEAAGR-RLLLSRGFKLRSAASRSLSGQFSRLSIRAVATQPAPSYHGQ--DEAEKLG  97

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            FEKVSE+F+ ECKS+AVL+KHKKTG E+MSVSNDDENKVFGI FRTPPK+STGIPHILEH
Sbjct  98   FEKVSEEFISECKSKAVLFKHKKTGCEVMSVSNDDENKVFGIVFRTPPKDSTGIPHILEH  157

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  158  SVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  217

Query  635  F  637
            F
Sbjct  218  F  218



>ref|XP_009339454.1| PREDICTED: LOW QUALITY PROTEIN: presequence protease 1, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
Length=1092

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 151/191 (79%), Gaps = 10/191 (5%)
 Frame = +2

Query  83   RPHCFANHLSNPRSTFRNRLLFTSTAALPSL--HLRTRFSPLSVRAVYT----FPPELSG  244
            R HC    + NP    R  LL  ++  LPS   ++   FS LS RAV       P E SG
Sbjct  53   RNHC-RRPILNPS---RRSLLRPASRLLPSSAPNVARSFSSLSARAVAIPFTQSPSEYSG  108

Query  245  AEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKN  424
             +DDV  KLGFEKVSE+F+ ECKS+A+L++HKKTGA+++SVSNDDENKVFGI FRTPP +
Sbjct  109  VQDDVVEKLGFEKVSEEFIGECKSKALLFRHKKTGAQVISVSNDDENKVFGIVFRTPPND  168

Query  425  STGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYN  604
            STGIPHILEHSVL GSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYN
Sbjct  169  STGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYN  228

Query  605  LVDVYLDAVFF  637
            LVDVYLDAVFF
Sbjct  229  LVDVYLDAVFF  239



>ref|XP_002282024.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
[Vitis vinifera]
Length=1080

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  FSPLSVRAVYTFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            FS LS +A+ T P + S    G++DD+A K GF+KVSEQF+ ECKS+AVLYKHKKTGAE+
Sbjct  75   FSSLSPKAIATSPEQASSDAVGSQDDLAEKYGFDKVSEQFIQECKSKAVLYKHKKTGAEV  134

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  135  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  194

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAV F
Sbjct  195  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVLF  227



>ref|XP_010466048.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=1078

 Score =   258 bits (658),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 141/161 (88%), Gaps = 4/161 (2%)
 Frame = +2

Query  164  LPSLHLRT---RFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYK  334
            +PS  LR+   +FS LSVRAV T P  L    D+ A KLGFEKVSE+F+ ECKS+A+L+K
Sbjct  66   IPSTALRSVSGQFSRLSVRAVATQPAPLYPGRDE-AEKLGFEKVSEEFISECKSKAILFK  124

Query  335  HKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLK  514
            HKKTG E+MSVSN+DENKVFG+ FRTPPKNSTGIPHILEHSVL GSRKYPLK+PFVELLK
Sbjct  125  HKKTGCEVMSVSNEDENKVFGVVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLK  184

Query  515  GSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            GSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  185  GSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  225



>emb|CBI32433.3| unnamed protein product [Vitis vinifera]
Length=1098

 Score =   258 bits (658),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  FSPLSVRAVYTFPPELS----GAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            FS LS +A+ T P + S    G++DD+A K GF+KVSEQF+ ECKS+AVLYKHKKTGAE+
Sbjct  75   FSSLSPKAIATSPEQASSDAVGSQDDLAEKYGFDKVSEQFIQECKSKAVLYKHKKTGAEV  134

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  135  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  194

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAV F
Sbjct  195  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVLF  227



>ref|XP_008373169.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Malus domestica]
Length=1082

 Score =   257 bits (657),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 148/181 (82%), Gaps = 9/181 (5%)
 Frame = +2

Query  113  NPRSTFRNRLLFTSTAALPSL--HLRTRFSPLSVRAVYT----FPPELSGAEDDVARKLG  274
            NPR   R  LL  ++  LPS   ++   FS LS  AV T     P E SG +D+V  KLG
Sbjct  52   NPR---RRSLLHRASRLLPSSAPNVARSFSSLSPXAVATPFTQSPSEFSGVQDEVVEKLG  108

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            FEKVSE+F+ ECKS+A+L++HKKTGA+++SVSNDDENKVFGI FRTPP +STGIPHILEH
Sbjct  109  FEKVSEEFIGECKSKALLFRHKKTGAQVISVSNDDENKVFGIVFRTPPNDSTGIPHILEH  168

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  169  SVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  228

Query  635  F  637
            F
Sbjct  229  F  229



>gb|KJB77681.1| hypothetical protein B456_012G150300 [Gossypium raimondii]
Length=906

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  FSPLSVRAVYTFPPE----LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            FS LS RAV + P +    ++G  D+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  84   FSSLSPRAVASPPTQPSSDIAGVGDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEV  143

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  144  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  203

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTN+KDFYNLVDVYLDAVFF
Sbjct  204  AFTYPDRTCYPVASTNSKDFYNLVDVYLDAVFF  236



>ref|XP_010691032.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1076

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  182  RTRFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  361
            R  FS +S +A+ +   E+   + DVA KLGFEKVSEQF+DECKS+AVLYKHKKTGA++M
Sbjct  73   RRSFSSISPQAISSSASEVGKHDSDVAEKLGFEKVSEQFIDECKSKAVLYKHKKTGAQVM  132

Query  362  SVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNA  541
            SVSNDDENKVFGI  RTPP +STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  133  SVSNDDENKVFGIVLRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  192

Query  542  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  193  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>ref|XP_008236531.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Prunus mume]
Length=1086

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  182  RTRFSPLSVRAVYT----FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTG  349
            R  FS L+ RA+ T     P E SG ED+V  KLGFEKVSE+F+ ECKS+A+L++HKKTG
Sbjct  79   RRSFSSLAPRAIATPFTQSPSEFSGVEDEVVEKLGFEKVSEEFIGECKSKALLFRHKKTG  138

Query  350  AEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNT  529
            A+++SVSNDDENKVFGI FRTPP +STGIPHILEHSVL GSRKYPLK+PFVELLKGSLNT
Sbjct  139  AQVISVSNDDENKVFGIVFRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNT  198

Query  530  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  199  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  234



>ref|XP_008647214.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Zea mays]
Length=813

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 139/173 (80%), Gaps = 13/173 (8%)
 Frame = +2

Query  155  TAALPSLHLRTRFSP---------LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQF  298
             AA P LH   R+ P         LS  AV T P  +    DDV   A KLGFEKVSEQ 
Sbjct  60   VAAAP-LHCSGRYWPAAAPQLARRLSASAVSTSPSPVPYDTDDVHEYATKLGFEKVSEQT  118

Query  299  VDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRK  478
            +DECKS AVLYKHKKTGAE+MSVSNDDENKVFGI FRTPPKNSTGIPHILEHSVL GSRK
Sbjct  119  IDECKSIAVLYKHKKTGAEVMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRK  178

Query  479  YPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            YPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  179  YPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  231



>emb|CDO97160.1| unnamed protein product [Coffea canephora]
Length=1055

 Score =   256 bits (653),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +2

Query  233  ELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRT  412
            ++ GA+DDVA KLGF+KVSEQF++ECKSRA+LYKH+KTGAEIMS+SNDDENK FGI FRT
Sbjct  68   KMLGADDDVADKLGFDKVSEQFIEECKSRAILYKHRKTGAEIMSISNDDENKCFGIVFRT  127

Query  413  PPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTK  592
            PPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTK
Sbjct  128  PPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTK  187

Query  593  DFYNLVDVYLDAVFF  637
            DFYNLVDVYLDAVFF
Sbjct  188  DFYNLVDVYLDAVFF  202



>gb|KJB77680.1| hypothetical protein B456_012G150300 [Gossypium raimondii]
Length=1078

 Score =   256 bits (653),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  FSPLSVRAVYTFPPE----LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            FS LS RAV + P +    ++G  D+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  84   FSSLSPRAVASPPTQPSSDIAGVGDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEV  143

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  144  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  203

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTN+KDFYNLVDVYLDAVFF
Sbjct  204  AFTYPDRTCYPVASTNSKDFYNLVDVYLDAVFF  236



>gb|KJB77679.1| hypothetical protein B456_012G150300 [Gossypium raimondii]
Length=1089

 Score =   256 bits (653),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  FSPLSVRAVYTFPPE----LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            FS LS RAV + P +    ++G  D+VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  84   FSSLSPRAVASPPTQPSSDIAGVGDEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEV  143

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  144  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  203

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTN+KDFYNLVDVYLDAVFF
Sbjct  204  AFTYPDRTCYPVASTNSKDFYNLVDVYLDAVFF  236



>ref|XP_011006471.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Populus euphratica]
Length=1082

 Score =   256 bits (653),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = +2

Query  182  RTRFSPLSVRAVYT-FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            +  FS LS  A+ T + P++S   D+VA K GFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  77   KHHFSTLSPHAISTQYSPDVSNVSDEVAEKYGFEKVSEEFIGECKSKAVLFKHKKTGAEV  136

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  137  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  196

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  197  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  229



>ref|XP_010066034.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW63801.1| hypothetical protein EUGRSUZ_G01465 [Eucalyptus grandis]
Length=1090

 Score =   256 bits (653),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 134/152 (88%), Gaps = 4/152 (3%)
 Frame = +2

Query  194  SPLSVRAVYTFP----PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  361
            S L+ RA+ T P    PE+ G +D VA K GFEKVSE+F+ ECKSRA L++HKKTGAE+M
Sbjct  86   SSLAPRAIATPPTQPSPEVFGVQDGVAEKYGFEKVSEEFIKECKSRATLFRHKKTGAEVM  145

Query  362  SVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNA  541
            SVSNDDENKVFGI FRTPP NSTGIPHILEHSVL GSRKYPLK+PFVELLKGSLNTFLNA
Sbjct  146  SVSNDDENKVFGIVFRTPPNNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNA  205

Query  542  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  206  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  237



>ref|XP_010466047.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=1080

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 140/162 (86%), Gaps = 4/162 (2%)
 Frame = +2

Query  164  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
            +PS  LR+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSTALRSVSGQFSRLSVRAVATQPAPLYPDIGRDEAEKLGFEKVSEEFISECKSKAILF  125

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTG E+MSVSN+DENKVFG+ FRTPPKNSTGIPHILEHSVL GSRKYPLK+PFVELL
Sbjct  126  KHKKTGCEVMSVSNEDENKVFGVVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELL  185

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_006384425.1| hypothetical protein POPTR_0004s14960g [Populus trichocarpa]
 gb|ERP62222.1| hypothetical protein POPTR_0004s14960g [Populus trichocarpa]
Length=1091

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = +2

Query  182  RTRFSPLSVRAVYT-FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            +  FS LS  A+ T + P++S   D+VA K GFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  82   KHHFSTLSPHAISTQYSPDVSNVSDEVAAKYGFEKVSEEFIGECKSKAVLFKHKKTGAEV  141

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  142  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  201

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  202  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  234



>ref|XP_010523209.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010523210.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=1082

 Score =   255 bits (651),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = +2

Query  179  LRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  355
            L  +FS LSVRAV T P P       D A +LGFEKVSE+F+ ECKS+AVL+KHKKTG E
Sbjct  76   LNGQFSRLSVRAVATQPAPSYPDVGQDEAERLGFEKVSEEFISECKSKAVLFKHKKTGCE  135

Query  356  IMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFL  535
            +MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFL
Sbjct  136  VMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  195

Query  536  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  196  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  229



>gb|KHG07949.1| Presequence protease 1, chloroplastic/mitochondrial [Gossypium 
arboreum]
Length=1025

 Score =   254 bits (650),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  FSPLSVRAVYTFPPE----LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            FS LS RAV + P +    ++G  D+VA K GFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  84   FSSLSPRAVASPPTQPSSDIAGVGDEVAEKFGFEKVSEEFIGECKSKAVLFKHKKTGAEV  143

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  144  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  203

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTN+KDFYNLVDVYLDAVFF
Sbjct  204  AFTYPDRTCYPVASTNSKDFYNLVDVYLDAVFF  236



>gb|KHG07948.1| Presequence protease 2, chloroplastic/mitochondrial [Gossypium 
arboreum]
Length=1074

 Score =   254 bits (650),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  FSPLSVRAVYTFPPE----LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            FS LS RAV + P +    ++G  D+VA K GFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  84   FSSLSPRAVASPPTQPSSDIAGVGDEVAEKFGFEKVSEEFIGECKSKAVLFKHKKTGAEV  143

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  144  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  203

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTN+KDFYNLVDVYLDAVFF
Sbjct  204  AFTYPDRTCYPVASTNSKDFYNLVDVYLDAVFF  236



>gb|AAG13049.1|AC011807_8 Putative zinc metalloprotease [Arabidopsis thaliana]
Length=1077

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 157/210 (75%), Gaps = 6/210 (3%)
 Frame = +2

Query  11   RDLLRS-LSPPNSTLFARSSLSFSKRPHCFANHLSNPRSTFRNRLLFTSTAALPSLHLRT  187
            R L RS LSP +ST    +S    +R    +   +  R  F  R L   +AA  S  L  
Sbjct  22   RQLPRSYLSPSSSTTVVGASGRNIRR---LSTLEAAGRRLFLRRGLKLLSAA--SRGLNG  76

Query  188  RFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSV  367
            +FS LS+RAV T     S    D A KLGFEKVSE+F+ ECKS+AVL+KHKKTG E+MSV
Sbjct  77   QFSRLSIRAVATQSAPSSYPGQDEAEKLGFEKVSEEFISECKSKAVLFKHKKTGCEVMSV  136

Query  368  SNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFT  547
            SNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYP+K+PFVELLKGSL+TFLNAFT
Sbjct  137  SNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPMKEPFVELLKGSLHTFLNAFT  196

Query  548  YPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            YPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  197  YPDRTCYPVASTNKKDFYNLVDVYLDAVFF  226



>ref|NP_175386.2| presequence protease 2 [Arabidopsis thaliana]
 ref|NP_850961.1| presequence protease 2 [Arabidopsis thaliana]
 ref|NP_850962.1| presequence protease 2 [Arabidopsis thaliana]
 sp|Q8VY06.1|PREP2_ARATH RecName: Full=Presequence protease 2, chloroplastic/mitochondrial; 
Short=AtPreP2; Short=PreP 2; AltName: Full=Zinc metalloprotease 
2; Short=AtZnMP2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL67002.1| putative hydrogenase protein [Arabidopsis thaliana]
 gb|AAO42370.1| putative hydrogenase [Arabidopsis thaliana]
 gb|AEE32451.1| presequence protease 2 [Arabidopsis thaliana]
 gb|AEE32452.1| presequence protease 2 [Arabidopsis thaliana]
 gb|AEE32453.1| presequence protease 2 [Arabidopsis thaliana]
Length=1080

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 157/210 (75%), Gaps = 6/210 (3%)
 Frame = +2

Query  11   RDLLRS-LSPPNSTLFARSSLSFSKRPHCFANHLSNPRSTFRNRLLFTSTAALPSLHLRT  187
            R L RS LSP +ST    +S    +R    +   +  R  F  R L   +AA  S  L  
Sbjct  22   RQLPRSYLSPSSSTTVVGASGRNIRR---LSTLEAAGRRLFLRRGLKLLSAA--SRGLNG  76

Query  188  RFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSV  367
            +FS LS+RAV T     S    D A KLGFEKVSE+F+ ECKS+AVL+KHKKTG E+MSV
Sbjct  77   QFSRLSIRAVATQSAPSSYPGQDEAEKLGFEKVSEEFISECKSKAVLFKHKKTGCEVMSV  136

Query  368  SNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFT  547
            SNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYP+K+PFVELLKGSL+TFLNAFT
Sbjct  137  SNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPMKEPFVELLKGSLHTFLNAFT  196

Query  548  YPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            YPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  197  YPDRTCYPVASTNKKDFYNLVDVYLDAVFF  226



>ref|XP_004954002.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Setaria italica]
Length=1084

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 138/172 (80%), Gaps = 12/172 (7%)
 Frame = +2

Query  158  AALPSLHLRTRFSP---------LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQFV  301
            AA   LH   R+ P         LS  AV T P  +    DDV   A KLGFEKVSEQ +
Sbjct  60   AAAAPLHCSGRYWPAATPRLARRLSAPAVSTSPSPVPYDTDDVHEYAAKLGFEKVSEQII  119

Query  302  DECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKY  481
            DECKS AVLYKHKKTGAE+MSV+NDDENKVFGI FRTPPKNSTGIPHILEHSVL GS+KY
Sbjct  120  DECKSTAVLYKHKKTGAEVMSVANDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSKKY  179

Query  482  PLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            PLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  180  PLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  231



>ref|XP_002885298.1| ATPREP1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61557.1| ATPREP1 [Arabidopsis lyrata subsp. lyrata]
Length=1081

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 140/162 (86%), Gaps = 4/162 (2%)
 Frame = +2

Query  164  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSAAVRSVNGQFSRLSVRAVATQPAPLYPDVGQDEAEKLGFEKVSEEFISECKSKAILF  125

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTG E+MSVSN+DENKVFG+ FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELL
Sbjct  126  KHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELL  185

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_012066896.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
[Jatropha curcas]
Length=1093

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 135/153 (88%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  FSPLSVRAVYTFP----PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            FS LS  A+ T P    P +    ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  88   FSSLSTAAIGTHPAQSSPYVGSVPNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEV  147

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  148  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  207

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  208  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  240



>gb|KDP42318.1| hypothetical protein JCGZ_01642 [Jatropha curcas]
Length=1088

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 135/153 (88%), Gaps = 4/153 (3%)
 Frame = +2

Query  191  FSPLSVRAVYTFP----PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEI  358
            FS LS  A+ T P    P +    ++VA KLGFEKVSE+F+ ECKS+AVL+KHKKTGAE+
Sbjct  83   FSSLSTAAIGTHPAQSSPYVGSVPNEVAEKLGFEKVSEEFIGECKSKAVLFKHKKTGAEV  142

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  143  MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  202

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  203  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  235



>ref|XP_010507479.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Camelina sativa]
Length=1080

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 4/162 (2%)
 Frame = +2

Query  164  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSTAVRSVSGQFSRLSVRAVATQPAPLYPDVGRDEAEKLGFEKVSEEFISECKSKAILF  125

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTG E+MSV N+DENKVFG+ FRTPPKNSTGIPHILEHSVL GSRKYPLK+PFVELL
Sbjct  126  KHKKTGCEVMSVCNEDENKVFGVVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELL  185

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_002894203.1| ATPREP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70462.1| ATPREP2 [Arabidopsis lyrata subsp. lyrata]
Length=1076

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  170  SLHLRTRFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTG  349
            S  L  +FS LS+RAV T     S    D A KLGFEKVSE+F+ ECKS+AVL++HKKTG
Sbjct  68   SRGLNGQFSRLSIRAVATQSAPSSIPGQDEAEKLGFEKVSEEFISECKSKAVLFRHKKTG  127

Query  350  AEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNT  529
             E+MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+T
Sbjct  128  CEVMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHT  187

Query  530  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  188  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  223



>ref|XP_010487842.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=1080

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 4/162 (2%)
 Frame = +2

Query  164  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSTAVRSVSGQFSRLSVRAVATQPAPLYPDVGRDEAEKLGFEKVSEEFISECKSKAILF  125

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTG E+MSV N+DENKVFG+ FRTPPKNSTGIPHILEHSVL GSRKYPLK+PFVELL
Sbjct  126  KHKKTGCEVMSVCNEDENKVFGVVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELL  185

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_006296881.1| hypothetical protein CARUB_v10012870mg [Capsella rubella]
 gb|EOA29779.1| hypothetical protein CARUB_v10012870mg [Capsella rubella]
Length=1080

 Score =   253 bits (645),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 140/162 (86%), Gaps = 4/162 (2%)
 Frame = +2

Query  164  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   VPSTAVRSVNGQFSRLSVRAVATQPAPLYPDVGRDEAEKLGFEKVSEEFISECKSKAILF  125

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTG E+MSVSN+DENKVFG+ FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELL
Sbjct  126  KHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELL  185

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>dbj|BAB02957.1| zinc metalloprotease (insulinase family) [Arabidopsis thaliana]
Length=1052

 Score =   252 bits (644),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 140/162 (86%), Gaps = 4/162 (2%)
 Frame = +2

Query  164  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  38   IPSAAVRSVNGQFSRLSVRAVATQPAPLYPDVGQDEAEKLGFEKVSEEFISECKSKAILF  97

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTG E+MSVSN+DENKVFG+ FRTPPK+STGIPHILEHSVL GSRKYP+K+PFVELL
Sbjct  98   KHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPVKEPFVELL  157

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  158  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  199



>ref|NP_188548.2| zinc metalloprotease pitrilysin subfamily A [Arabidopsis thaliana]
 sp|Q9LJL3.2|PREP1_ARATH RecName: Full=Presequence protease 1, chloroplastic/mitochondrial; 
Short=AtPreP1; Short=PreP 1; AltName: Full=Zinc metalloprotease 
1; Short=AtZnMP1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL90904.1| AT3g19170/MVI11_8 [Arabidopsis thaliana]
 gb|AAM13872.1| putative metalloprotease [Arabidopsis thaliana]
 gb|AAN86205.1| putative metalloprotease [Arabidopsis thaliana]
 gb|AAP21170.1| At3g19170/MVI11_8 [Arabidopsis thaliana]
 gb|AEE76201.1| zinc metalloprotease pitrilysin subfamily A [Arabidopsis thaliana]
Length=1080

 Score =   252 bits (644),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 140/162 (86%), Gaps = 4/162 (2%)
 Frame = +2

Query  164  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSAAVRSVNGQFSRLSVRAVATQPAPLYPDVGQDEAEKLGFEKVSEEFISECKSKAILF  125

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTG E+MSVSN+DENKVFG+ FRTPPK+STGIPHILEHSVL GSRKYP+K+PFVELL
Sbjct  126  KHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPVKEPFVELL  185

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|NP_001189932.1| zinc metalloprotease pitrilysin subfamily A [Arabidopsis thaliana]
 gb|AEE76202.1| zinc metalloprotease pitrilysin subfamily A [Arabidopsis thaliana]
Length=1069

 Score =   252 bits (644),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 140/162 (86%), Gaps = 4/162 (2%)
 Frame = +2

Query  164  LPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
            +PS  +R+   +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+
Sbjct  66   IPSAAVRSVNGQFSRLSVRAVATQPAPLYPDVGQDEAEKLGFEKVSEEFISECKSKAILF  125

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTG E+MSVSN+DENKVFG+ FRTPPK+STGIPHILEHSVL GSRKYP+K+PFVELL
Sbjct  126  KHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPVKEPFVELL  185

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  186  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_006304560.1| hypothetical protein CARUB_v10011558mg [Capsella rubella]
 gb|EOA37458.1| hypothetical protein CARUB_v10011558mg [Capsella rubella]
Length=1082

 Score =   252 bits (644),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 145/182 (80%), Gaps = 9/182 (5%)
 Frame = +2

Query  107  LSNPRSTFRNRLLFTSTA----ALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKL  271
            LS P +    R LFT       +  S  L  +FS  S+RAV T P P   G   D A KL
Sbjct  45   LSTPEAA--GRRLFTRRGFNLRSAASRSLNGQFSRFSIRAVATQPAPSYPGQ--DEAEKL  100

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFEKVSE+F+ ECKS+AVL+KHKKTG E++SVSNDDENKVFGI FRTPPK+STGIPHILE
Sbjct  101  GFEKVSEEFISECKSKAVLFKHKKTGCEVISVSNDDENKVFGIVFRTPPKDSTGIPHILE  160

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV
Sbjct  161  HSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  220

Query  632  FF  637
            FF
Sbjct  221  FF  222



>dbj|BAJ89923.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=957

 Score =   251 bits (642),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 131/149 (88%), Gaps = 3/149 (2%)
 Frame = +2

Query  200  LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVS  370
            LSV AV T P  +    DDV   A  LGFEKVSEQ +DECKS AVLYKHKKTGAE+MSV+
Sbjct  80   LSVPAVSTSPSPVPSDTDDVHEYAATLGFEKVSEQVIDECKSAAVLYKHKKTGAEVMSVA  139

Query  371  NDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTY  550
            NDDENKVFGI FRTPPKNSTGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTY
Sbjct  140  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTY  199

Query  551  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            PDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  200  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  228



>dbj|BAJ85497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1081

 Score =   252 bits (643),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 131/149 (88%), Gaps = 3/149 (2%)
 Frame = +2

Query  200  LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVS  370
            LSV AV T P  +    DDV   A  LGFEKVSEQ +DECKS AVLYKHKKTGAE+MSV+
Sbjct  80   LSVPAVSTSPSPVPSDTDDVHEYAATLGFEKVSEQVIDECKSAAVLYKHKKTGAEVMSVA  139

Query  371  NDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTY  550
            NDDENKVFGI FRTPPKNSTGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTY
Sbjct  140  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTY  199

Query  551  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            PDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  200  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  228



>gb|KFK39237.1| hypothetical protein AALP_AA3G218200 [Arabis alpina]
Length=1077

 Score =   252 bits (643),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = +2

Query  188  RFSPLSVRAVYTFPPE-LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMS  364
            +FS LSVRAV T P +       D A KLGFEKVSE+F+ ECKS+A+L+KHKKTG E+MS
Sbjct  74   QFSSLSVRAVATQPAQSYPDVGQDEAEKLGFEKVSEEFISECKSKAILFKHKKTGCEVMS  133

Query  365  VSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAF  544
            V+N+DENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAF
Sbjct  134  VANEDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAF  193

Query  545  TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  194  TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>ref|XP_009135620.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Brassica rapa]
Length=1077

 Score =   252 bits (643),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 145/181 (80%), Gaps = 5/181 (3%)
 Frame = +2

Query  107  LSNPRSTFRNRLLFTSTAALPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLG  274
            +++P ST R R+       +PS  +R    + S LSVRAV T P P       D A KLG
Sbjct  45   VASPSSTGR-RVFLRRGLRVPSTAVRGVNRQLSRLSVRAVATQPAPSYPDVGQDEAEKLG  103

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            FEKVSE+F+ ECKS+A L+KHKKTG E+MSVSN+DENKVFGI  RTPPK+STGIPHILEH
Sbjct  104  FEKVSEEFISECKSKATLFKHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEH  163

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  164  SVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  223

Query  635  F  637
            F
Sbjct  224  F  224



>ref|XP_010691033.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1075

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +2

Query  182  RTRFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIM  361
            R  FS +S +A+ +    +   + DVA KLGFEKVSEQF+DECKS+AVLYKHKKTGA++M
Sbjct  73   RRSFSSISPQAISS-SASVGKHDSDVAEKLGFEKVSEQFIDECKSKAVLYKHKKTGAQVM  131

Query  362  SVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNA  541
            SVSNDDENKVFGI  RTPP +STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNA
Sbjct  132  SVSNDDENKVFGIVLRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNA  191

Query  542  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  192  FTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  223



>emb|CDX82307.1| BnaA03g35140D [Brassica napus]
Length=1074

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 144/181 (80%), Gaps = 5/181 (3%)
 Frame = +2

Query  107  LSNPRSTFRNRLLFTSTAALPSLHLRT---RFSPLSVRAVYTFP-PELSGAEDDVARKLG  274
            +++P ST R R+       +PS   R    + S LSVRAV T P P       D A KLG
Sbjct  45   VASPASTGR-RVFLRRGLRVPSTAGRGVNRQLSRLSVRAVATQPAPSYPDVGQDEAEKLG  103

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            FEKVSE+F+ ECKS+A L+KHKKTG E+MSVSN+DENKVFGI  RTPPK+STGIPHILEH
Sbjct  104  FEKVSEEFISECKSKATLFKHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEH  163

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF
Sbjct  164  SVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  223

Query  635  F  637
            F
Sbjct  224  F  224



>ref|XP_009112103.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Brassica rapa]
Length=1075

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = +2

Query  155  TAALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
            ++A     +  +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A L+
Sbjct  61   SSAAAGRGVNGQFSRLSVRAVATQPAPSYPDVSQDEAEKLGFEKVSEEFISECKSKATLF  120

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTG E+MSVSN+DENKVFGI  RTPPK+STGIPHILEHSVL GSRKYP+K+PFVELL
Sbjct  121  KHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSRKYPVKEPFVELL  180

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  181  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  222



>ref|XP_011000205.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
isoform X2 [Populus euphratica]
Length=1070

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = +2

Query  179  LRTRFSPLSVRAVYT-FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  355
            ++  FS  S + + T   P++S   D+VA K GFEKVSE+F+ ECKSRAVL+KHKKTGAE
Sbjct  64   IKHHFSSSSPQTIATQCSPDVSTLTDEVAAKYGFEKVSEEFIRECKSRAVLFKHKKTGAE  123

Query  356  IMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFL  535
            +MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFL
Sbjct  124  VMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  183

Query  536  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  184  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  217



>gb|EAY87618.1| hypothetical protein OsI_09029 [Oryza sativa Indica Group]
Length=1078

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 130/149 (87%), Gaps = 3/149 (2%)
 Frame = +2

Query  200  LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVS  370
            LS  AV T P  +    DDV   A KLGFEKVSEQ +DECKS AVLYKHKKTGAE+MSVS
Sbjct  77   LSAPAVSTSPSPVPSDTDDVHEYAAKLGFEKVSEQSIDECKSTAVLYKHKKTGAEVMSVS  136

Query  371  NDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTY  550
            NDDENKVFGI FRTPPKNSTGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTY
Sbjct  137  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTY  196

Query  551  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            PDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  197  PDRTCYPVASTNAKDFYNLVDVYLDAVFF  225



>ref|XP_006393232.1| hypothetical protein EUTSA_v10011199mg [Eutrema salsugineum]
 gb|ESQ30518.1| hypothetical protein EUTSA_v10011199mg [Eutrema salsugineum]
Length=1076

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 142/174 (82%), Gaps = 3/174 (2%)
 Frame = +2

Query  119  RSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQ  295
            R  F  R L   +AA  SL+   +FS LS+RA  T P P  +    D A KLGFEK  E+
Sbjct  52   RQLFLRRGLRFPSAASGSLN--GQFSRLSLRAFATQPAPSYTELGQDEAEKLGFEKAREE  109

Query  296  FVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSR  475
            F+ ECKS+AVL++HKKTG E+MSVSNDDENKVFG+ FRTPPK+STGIPHILEHSVL GSR
Sbjct  110  FISECKSKAVLFRHKKTGCEVMSVSNDDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSR  169

Query  476  KYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  170  KYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  223



>ref|XP_011000182.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
isoform X1 [Populus euphratica]
 ref|XP_011000191.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
isoform X1 [Populus euphratica]
 ref|XP_011000200.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
isoform X1 [Populus euphratica]
Length=1087

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = +2

Query  179  LRTRFSPLSVRAVYT-FPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  355
            ++  FS  S + + T   P++S   D+VA K GFEKVSE+F+ ECKSRAVL+KHKKTGAE
Sbjct  81   IKHHFSSSSPQTIATQCSPDVSTLTDEVAAKYGFEKVSEEFIRECKSRAVLFKHKKTGAE  140

Query  356  IMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFL  535
            +MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFL
Sbjct  141  VMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  200

Query  536  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  201  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  234



>emb|CDY18572.1| BnaA01g26230D [Brassica napus]
Length=1140

 Score =   250 bits (638),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 136/162 (84%), Gaps = 1/162 (1%)
 Frame = +2

Query  155  TAALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLY  331
            ++A     +  +FS LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A L+
Sbjct  61   SSAAAGRGVNGQFSRLSVRAVATQPAPSYPDVSQDEAEKLGFEKVSEEFISECKSKATLF  120

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTG E+MSVSN+DENKVFGI  RTPPK+STGIPHILEHSVL GSRKYP+K+PFVELL
Sbjct  121  KHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSRKYPVKEPFVELL  180

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  181  KGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  222



>ref|XP_006406530.1| hypothetical protein EUTSA_v10019955mg [Eutrema salsugineum]
 gb|ESQ47983.1| hypothetical protein EUTSA_v10019955mg [Eutrema salsugineum]
Length=1080

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = +2

Query  188  RFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMS  364
            + S LSVRAV T P P       D A KLGFEKVSE+F+ ECKS+A+L+KHKKTG E+MS
Sbjct  77   QLSRLSVRAVATQPAPSYPDVGQDEAEKLGFEKVSEEFISECKSKAILFKHKKTGCEVMS  136

Query  365  VSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAF  544
            VSN+DENKVFGI  RTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAF
Sbjct  137  VSNEDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAF  196

Query  545  TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  197  TYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>ref|XP_006649067.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Oryza brachyantha]
Length=1095

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 130/149 (87%), Gaps = 3/149 (2%)
 Frame = +2

Query  200  LSVRAVYTFPPELSGAEDDV---ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVS  370
            LS  AV T P  +    DDV   A KLGFEKVSEQ +DECKS AVLYKHKKTG E+MSVS
Sbjct  94   LSAPAVSTSPSPVPQDTDDVHEYAAKLGFEKVSEQSIDECKSTAVLYKHKKTGTEVMSVS  153

Query  371  NDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTY  550
            NDDENKVFGI FRTPPKNSTGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTY
Sbjct  154  NDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTY  213

Query  551  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            PDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  214  PDRTCYPVASTNTKDFYNLVDVYLDAVFF  242



>ref|XP_010546463.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=1077

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +2

Query  179  LRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  355
            L  +F   SVRAV T P P       D A +LGFEKVSE+F+ ECKS  VL+KHKKTG E
Sbjct  71   LGGQFYGFSVRAVATQPAPSYPDVGQDEAERLGFEKVSEEFISECKSNVVLFKHKKTGCE  130

Query  356  IMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFL  535
            +MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFL
Sbjct  131  VMSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  190

Query  536  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  191  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>ref|XP_007200813.1| hypothetical protein PRUPE_ppa025698mg, partial [Prunus persica]
 gb|EMJ02012.1| hypothetical protein PRUPE_ppa025698mg, partial [Prunus persica]
Length=986

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +2

Query  239  SGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPP  418
            SG ED+V  KLGFEKVSE+F+ ECKS+A+L++HKKTGA+++SVSNDDENKVFGI FRTPP
Sbjct  2    SGVEDEVVEKLGFEKVSEEFIGECKSKALLFRHKKTGAQVISVSNDDENKVFGIVFRTPP  61

Query  419  KNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDF  598
             +STGIPHILEHSVL GSRKYPLK+PFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDF
Sbjct  62   NDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDF  121

Query  599  YNLVDVYLDAVFF  637
            YNLVDVYLDAVFF
Sbjct  122  YNLVDVYLDAVFF  134



>emb|CDY67652.1| BnaC01g43760D [Brassica napus]
Length=1139

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +2

Query  119  RSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQF  298
            R   R  L  +S A      +  +FS  SVRAV T  P       D A KLGFEKVSE+F
Sbjct  51   RVFLRRGLRVSSAATAGGGGVNGQFSRFSVRAVAT--PSYPDVGQDEAEKLGFEKVSEEF  108

Query  299  VDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRK  478
            + ECKS+A L+KHKKTG E+MSVSN+DENKVFGI  RTPPK+STGIPHILEHSVL GSRK
Sbjct  109  ISECKSKATLFKHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSRK  168

Query  479  YPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            YP+K+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  169  YPVKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  221



>ref|XP_006829680.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial 
[Amborella trichopoda]
 gb|ERM97096.1| hypothetical protein AMTR_s00126p00013900 [Amborella trichopoda]
Length=1075

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 164/225 (73%), Gaps = 16/225 (7%)
 Frame = +2

Query  2    MEGRDLLRSLSPPNS-----TLFARSSLSFSKRPHCFANHLSNPRS-----TFRNRLLFT  151
            ME   LLRSLS   +     +L  RSS   +  P      L +PR+        +R+ + 
Sbjct  1    MERVVLLRSLSCSTACMRFLSLKPRSSWKTASTP-LTQQLLISPRNRGLPLACGSRMRWV  59

Query  152  STAALPSLHLRTRFSPLSVRAVYTFPPELSGAED---DVARKLGFEKVSEQFVDECKSRA  322
            ST+     H R  FS +S +A+ T   + S   D   D+A +LGFEKVSEQ ++ECKS+A
Sbjct  60   STSRYAFQHKRG-FS-VSPQAIATPSKQASSGIDGSHDIAHELGFEKVSEQLIEECKSKA  117

Query  323  VLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFV  502
            +LYKHKKTGAE++SV NDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFV
Sbjct  118  ILYKHKKTGAEVISVVNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFV  177

Query  503  ELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            ELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  178  ELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  222



>emb|CDY22983.1| BnaC03g40860D [Brassica napus]
Length=1074

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = +2

Query  119  RSTFRNRLLFTSTAALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARKLGFEKVSEQ  295
            R  F  R L   +AA+  ++   + S L VRAV T P P       D A KLGFEKVSE+
Sbjct  53   RRVFLRRGLRVPSAAVRRVN--RQLSRLYVRAVATQPAPSYPDVGQDEAEKLGFEKVSEE  110

Query  296  FVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSR  475
            F+ ECKS+A L+KHKKTG E+MSVSN+DENKVFGI  RTPPK+STGIPHILEHSVL GSR
Sbjct  111  FISECKSKATLFKHKKTGCEVMSVSNEDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSR  170

Query  476  KYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  171  KYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>gb|EEE57849.1| hypothetical protein OsJ_08475 [Oryza sativa Japonica Group]
Length=1000

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 124/136 (91%), Gaps = 3/136 (2%)
 Frame = +2

Query  239  SGAEDDV---ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFR  409
            S   DDV   A KLGFEKVSEQ +DECKS AVLYKHKKTGAE+MSVSNDDENKVFGI FR
Sbjct  12   SAYTDDVHEYAAKLGFEKVSEQSIDECKSTAVLYKHKKTGAEVMSVSNDDENKVFGIVFR  71

Query  410  TPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNT  589
            TPPKNSTGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTN 
Sbjct  72   TPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNA  131

Query  590  KDFYNLVDVYLDAVFF  637
            KDFYNLVDVYLDAVFF
Sbjct  132  KDFYNLVDVYLDAVFF  147



>gb|KHN30412.1| Presequence protease 2, chloroplastic/mitochondrial [Glycine 
soja]
Length=1094

 Score =   246 bits (628),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  RTRFSPLSVRAVYTFPPELSGAE--DDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  355
            R  FS L+ RAV +  P    AE  D+VA KLGFEKVSE+F+ ECKS+AVL++H KTGA+
Sbjct  72   RKHFSSLAPRAVLSPSPSSGFAEVNDEVALKLGFEKVSEEFIPECKSKAVLFRHIKTGAQ  131

Query  356  IMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFL  535
            +MSVSNDD+NKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFL
Sbjct  132  VMSVSNDDDNKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  191

Query  536  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            NAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  192  NAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  225



>ref|XP_003517606.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial 
[Glycine max]
Length=1078

 Score =   246 bits (628),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = +2

Query  182  RTRFSPLSVRAVYTFPPELSGAE--DDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAE  355
            R  FS L+ RAV +  P    AE  D+VA KLGFEKVSE+F+ ECKS+AVL++H KTGA+
Sbjct  72   RKHFSSLAPRAVLSPSPSSGFAEVNDEVALKLGFEKVSEEFIPECKSKAVLFRHIKTGAQ  131

Query  356  IMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFL  535
            +MSVSNDD+NKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFL
Sbjct  132  VMSVSNDDDNKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFL  191

Query  536  NAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            NAFTYPDRTCYPVASTN KDFYNLVDVYLDAVFF
Sbjct  192  NAFTYPDRTCYPVASTNAKDFYNLVDVYLDAVFF  225



>ref|XP_004511282.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Cicer arietinum]
Length=1080

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 136/156 (87%), Gaps = 6/156 (4%)
 Frame = +2

Query  182  RTRFSPLSVRAVYTFPPELSGA----EDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTG  349
            R  FS  + RA     P++SG     +D+VAR+LGFEKVSE+F+ ECKS+AVL++H KTG
Sbjct  74   RNHFS--TSRASLVSSPDISGGGEVVKDEVARELGFEKVSEEFITECKSKAVLFRHLKTG  131

Query  350  AEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNT  529
            A++MSVSN+DENKVFGI FRTPP +STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+T
Sbjct  132  AQVMSVSNNDENKVFGIVFRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHT  191

Query  530  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  192  FLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  227



>gb|KEH27308.1| presequence protease [Medicago truncatula]
Length=1077

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 4/160 (3%)
 Frame = +2

Query  167  PSLHLRTRFSPLSVRAVYTFPPELSGAE---DDVARKLGFEKVSEQFVDECKSRAVLYKH  337
            P  + R R +  S RA     P++ G E   D+VAR+LGFEKVSE+F+ ECKS AVL+KH
Sbjct  66   PLFYFRNR-NHFSTRASLVSSPDIGGGEVVKDEVARELGFEKVSEEFIPECKSIAVLFKH  124

Query  338  KKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKG  517
             KTGA+++SVSN DENKVFGI FRTPP +STGIPHILEHSVL GSRKYPLK+PFVELLKG
Sbjct  125  VKTGAQVISVSNKDENKVFGIVFRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKG  184

Query  518  SLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            SL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  185  SLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>ref|XP_009417620.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=997

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  251  DDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNST  430
            +D+A KLGFE +SEQ ++ECK+ AVLYKHKKTGAEIMSVSNDDENKVFGI FRTPPK+ST
Sbjct  16   NDIAEKLGFEIISEQTINECKATAVLYKHKKTGAEIMSVSNDDENKVFGIVFRTPPKDST  75

Query  431  GIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLV  610
            GIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLV
Sbjct  76   GIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLV  135

Query  611  DVYLDAVFF  637
            DVYLDAVFF
Sbjct  136  DVYLDAVFF  144



>ref|XP_003636020.1| Presequence protease [Medicago truncatula]
Length=1124

 Score =   244 bits (622),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 4/160 (3%)
 Frame = +2

Query  167  PSLHLRTRFSPLSVRAVYTFPPELSGAE---DDVARKLGFEKVSEQFVDECKSRAVLYKH  337
            P  + R R +  S RA     P++ G E   D+VAR+LGFEKVSE+F+ ECKS AVL+KH
Sbjct  66   PLFYFRNR-NHFSTRASLVSSPDIGGGEVVKDEVARELGFEKVSEEFIPECKSIAVLFKH  124

Query  338  KKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKG  517
             KTGA+++SVSN DENKVFGI FRTPP +STGIPHILEHSVL GSRKYPLK+PFVELLKG
Sbjct  125  VKTGAQVISVSNKDENKVFGIVFRTPPNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKG  184

Query  518  SLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            SL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  185  SLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  224



>ref|XP_002313107.1| hypothetical protein POPTR_0009s10650g [Populus trichocarpa]
 gb|EEE87062.1| hypothetical protein POPTR_0009s10650g [Populus trichocarpa]
Length=1006

 Score =   243 bits (620),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            VA K GFEKVSE F+ ECKSRAVL KHKKTGAE+MSVSNDDENKVFGI FRTPPK+STGI
Sbjct  30   VAAKYGFEKVSEDFIGECKSRAVLLKHKKTGAEVMSVSNDDENKVFGIVFRTPPKDSTGI  89

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDV
Sbjct  90   PHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  149

Query  617  YLDAVFF  637
            YLDAVFF
Sbjct  150  YLDAVFF  156



>ref|XP_001764982.1| predicted protein [Physcomitrella patens]
 gb|EDQ70198.1| predicted protein [Physcomitrella patens]
Length=1060

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 143/188 (76%), Gaps = 7/188 (4%)
 Frame = +2

Query  92   CFANHLS-NPRSTFRNRLLFTSTAAL-----PSLHLRTRFSPLSVRAVYTFPPELSGAED  253
             FA H + N +  FR   L   + +      PS+ +R   S LS  AV    P  +GA+ 
Sbjct  22   SFAGHRTINSKIFFRGTGLRAGSISAQRWNPPSMTVRRELS-LSPVAVVAPSPAKTGADS  80

Query  254  DVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTG  433
            ++ ++LGFE+V EQFVDE KS A LY+HKKTGAEIMSV NDDENKVFGI FRTPP +STG
Sbjct  81   ELVKELGFEEVQEQFVDEYKSTATLYRHKKTGAEIMSVVNDDENKVFGIVFRTPPTDSTG  140

Query  434  IPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVD  613
            IPHILEHSVL GSRKYPLK+PFVELLKGSL TFLNAFTYPDRTCYPVASTN +DFYNLVD
Sbjct  141  IPHILEHSVLCGSRKYPLKEPFVELLKGSLQTFLNAFTYPDRTCYPVASTNLQDFYNLVD  200

Query  614  VYLDAVFF  637
            VYLDAVF+
Sbjct  201  VYLDAVFY  208



>gb|KFK35994.1| hypothetical protein AALP_AA4G064300 [Arabis alpina]
Length=1065

 Score =   238 bits (606),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  254  DVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTG  433
            D A K GFEKV E+F+ ECKS+A+L+KHKKTG E+MSVSNDDENKVFG+ FRTPPK+STG
Sbjct  85   DEAGKHGFEKVREEFISECKSKAILFKHKKTGCEVMSVSNDDENKVFGVVFRTPPKDSTG  144

Query  434  IPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVD  613
            IPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVD
Sbjct  145  IPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVD  204

Query  614  VYLDAVFF  637
            VYLDAVFF
Sbjct  205  VYLDAVFF  212



>emb|CDY28099.1| BnaC06g02800D [Brassica napus]
Length=1064

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  254  DVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTG  433
            D A KLGFEK  E+F+ ECKS+AVL++HKKTG E+MSVSNDDENKVFG+ FRTPPK+STG
Sbjct  87   DEAEKLGFEKAREEFISECKSKAVLFRHKKTGCEVMSVSNDDENKVFGVVFRTPPKDSTG  146

Query  434  IPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVD  613
            IPHILEHS+L GSRKYPLK+PFVELLKGSL TFLNAFTYPDRTCYPVASTNTKDFYNLVD
Sbjct  147  IPHILEHSILCGSRKYPLKEPFVELLKGSLYTFLNAFTYPDRTCYPVASTNTKDFYNLVD  206

Query  614  VYLDAVFF  637
            VYLDAVFF
Sbjct  207  VYLDAVFF  214



>ref|XP_009147876.1| PREDICTED: presequence protease 2, chloroplastic/mitochondrial 
[Brassica rapa]
Length=1067

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 132/160 (83%), Gaps = 7/160 (4%)
 Frame = +2

Query  161  ALPSLHLRTRFS-PLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKH  337
            A  S  L  +FS  +S +   ++P +      D A KLGFEK  E+F+ ECKS+AVL++H
Sbjct  61   AAASGCLSGQFSLAVSTQTATSYPGQ------DEAEKLGFEKSREEFISECKSKAVLFRH  114

Query  338  KKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKG  517
            KKTG E+MSVSNDDENKVFG+ FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKG
Sbjct  115  KKTGCEVMSVSNDDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKG  174

Query  518  SLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            SL TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  175  SLYTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  214



>emb|CDY50957.1| BnaA06g37530D [Brassica napus]
Length=1072

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 132/160 (83%), Gaps = 7/160 (4%)
 Frame = +2

Query  161  ALPSLHLRTRFS-PLSVRAVYTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKH  337
            A  S  L  +FS  +S +   ++P +      D A KLGFEK  E+F+ ECKS+AVL++H
Sbjct  61   AAASGCLSGQFSRAVSTQTATSYPGQ------DEAEKLGFEKSREEFISECKSKAVLFRH  114

Query  338  KKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKG  517
            KKTG E+MSVSNDDENKVFG+ FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKG
Sbjct  115  KKTGCEVMSVSNDDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKG  174

Query  518  SLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            SL TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  175  SLYTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  214



>pdb|2FGE|A Chain A, Crystal Structure Of Presequence Protease Prep From 
Arabidopsis Thaliana
 pdb|2FGE|B Chain B, Crystal Structure Of Presequence Protease Prep From 
Arabidopsis Thaliana
Length=995

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  254  DVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTG  433
            D A KLGFEKVSE+F+ ECKS+A+L+KHKKTG E+ SVSN+DENKVFG+ FRTPPK+STG
Sbjct  15   DEAEKLGFEKVSEEFISECKSKAILFKHKKTGCEVXSVSNEDENKVFGVVFRTPPKDSTG  74

Query  434  IPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVD  613
            IPHIL+HSVL GSRKYP+K+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVD
Sbjct  75   IPHILQHSVLCGSRKYPVKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVD  134

Query  614  VYLDAVFF  637
            VYLDAVFF
Sbjct  135  VYLDAVFF  142



>ref|XP_007157239.1| hypothetical protein PHAVU_002G054400g [Phaseolus vulgaris]
 gb|ESW29233.1| hypothetical protein PHAVU_002G054400g [Phaseolus vulgaris]
Length=1078

 Score =   235 bits (600),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 146/194 (75%), Gaps = 24/194 (12%)
 Frame = +2

Query  110  SNPRSTF---RNRLLFTSTAALPSLHLRT---RFSPLSVRAVY------------TFPPE  235
            S P S+F   R+  L  ++++ P  H RT   RF   S RAV              FP  
Sbjct  38   SRPSSSFLRRRSPRLLPASSSPP--HFRTSSNRFCSFSPRAVLSPSPSSSPSPPPAFPQ-  94

Query  236  LSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTP  415
                ED+VA + GF+ VSE+F+ ECKS+AVL++H KTGA++MSVSNDDENKVFGI FRTP
Sbjct  95   ---VEDEVALQFGFQIVSEEFIPECKSKAVLFRHIKTGAQVMSVSNDDENKVFGIVFRTP  151

Query  416  PKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKD  595
            P +STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTN+KD
Sbjct  152  PNDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNSKD  211

Query  596  FYNLVDVYLDAVFF  637
            FYNLVDVYLDAVFF
Sbjct  212  FYNLVDVYLDAVFF  225



>ref|XP_002452870.1| hypothetical protein SORBIDRAFT_04g033980 [Sorghum bicolor]
 gb|EES05846.1| hypothetical protein SORBIDRAFT_04g033980 [Sorghum bicolor]
Length=1125

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  281  KVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSV  460
            +VSEQ +DECKS AVLYKHKKTGAE+MSVSNDDENKVFGI FRTPPKNSTGIPHILEHSV
Sbjct  140  QVSEQTIDECKSTAVLYKHKKTGAEVMSVSNDDENKVFGIVFRTPPKNSTGIPHILEHSV  199

Query  461  LSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            L GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  200  LCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  258



>ref|XP_002979622.1| hypothetical protein SELMODRAFT_419272 [Selaginella moellendorffii]
 gb|EFJ19511.1| hypothetical protein SELMODRAFT_419272 [Selaginella moellendorffii]
Length=1040

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +2

Query  242  GAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPK  421
            GA  DV ++LGFE+V E+F+ E KS AVLY+HKKTGAE+MSV N+DENKVFGI FRTPPK
Sbjct  72   GANPDVVKELGFEEVREEFISEYKSTAVLYRHKKTGAEVMSVVNEDENKVFGIVFRTPPK  131

Query  422  NSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFY  601
            +S GIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLNAFTYPDRTCYPVASTN KDFY
Sbjct  132  DSKGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLNAFTYPDRTCYPVASTNLKDFY  191

Query  602  NLVDVYLDAVF  634
            NLVDVYLDAVF
Sbjct  192  NLVDVYLDAVF  202



>ref|XP_006423049.1| hypothetical protein CICLE_v10030315mg [Citrus clementina]
 gb|ESR36289.1| hypothetical protein CICLE_v10030315mg [Citrus clementina]
Length=416

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 148/222 (67%), Gaps = 30/222 (14%)
 Frame = +2

Query  2    MEGRDLLRSLSPPNSTL-----FARSSLSFSKRPHC-FANHLSNPRSTFRNRLLFTSTAA  163
            ME   LLRSLS    +      F+ SS++ ++R H    N+L+  RS  R       + +
Sbjct  1    MERAALLRSLSYSTFSFVPRAKFSSSSVAVARRNHHRLINNLTR-RSLLRGDSRLHLSLS  59

Query  164  LPSLHLRTRFSPLSVRAVYT--FPPELSGAE--DDVARKLGFEKVSEQFVDECKSRAVLY  331
              SL     FS LS RAV +   P    GAE  ++VA KLGFEKVSE+F+ ECKS+AVL+
Sbjct  60   SYSLQFNKHFSSLSPRAVASPSTPSSPEGAEVSNEVAEKLGFEKVSEEFIGECKSKAVLF  119

Query  332  KHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELL  511
            KHKKTGAE+MSVSNDDENKVFGI FRTPPK                   YPLK+ FVELL
Sbjct  120  KHKKTGAEVMSVSNDDENKVFGIVFRTPPK-------------------YPLKEQFVELL  160

Query  512  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  161  KGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  202



>ref|XP_007514955.1| putative peptidase [Bathycoccus prasinos]
 emb|CCO15195.1| putative peptidase [Bathycoccus prasinos]
Length=1060

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ V E+FV E  ++  L+KHKKTGAE+MS+SNDDENK FG+ FRTPP NSTGIPHILE
Sbjct  87   GFDLVKEEFVPEYNAKGFLFKHKKTGAEVMSLSNDDENKSFGVTFRTPPANSTGIPHILE  146

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVEL+KGSLNTFLNA TYPDRTCYPVAS N  DFYNLVDVYLDAV
Sbjct  147  HSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTYPDRTCYPVASCNLADFYNLVDVYLDAV  206

Query  632  F  634
            F
Sbjct  207  F  207



>ref|XP_005651052.1| hypothetical protein COCSUDRAFT_35102 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26508.1| hypothetical protein COCSUDRAFT_35102 [Coccomyxa subellipsoidea 
C-169]
Length=998

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 110/135 (81%), Gaps = 3/135 (2%)
 Frame = +2

Query  242  GAEDDVARK---LGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRT  412
            GA   VA++    GFE V E FV E  S+ ++Y+HKKTGAE+MS+ N DENK FG  FRT
Sbjct  12   GALSQVAQRPELHGFELVREHFVSEYDSQVLMYRHKKTGAEVMSLINKDENKTFGAVFRT  71

Query  413  PPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTK  592
            P  NS GIPHILEHSVL GS+KYP+K+PFVEL+KGSLNTFLNAFTYPDRTCYPVASTN +
Sbjct  72   PVDNSKGIPHILEHSVLCGSKKYPIKEPFVELMKGSLNTFLNAFTYPDRTCYPVASTNLQ  131

Query  593  DFYNLVDVYLDAVFF  637
            DFYNLVDVYLDAV +
Sbjct  132  DFYNLVDVYLDAVLY  146



>ref|WP_043601248.1| peptidase M16 [Desulfovibrio magneticus]
Length=970

 Score =   201 bits (512),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 91/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            +++K GF  + ++ V+E  +RA+LY+H +TGAE++S+ +DDENKVFG  FRTPP  STG+
Sbjct  1    MSKKYGFSVLRDEIVEEYAARAILYRHDRTGAELLSLISDDENKVFGAAFRTPPACSTGV  60

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GS+KYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  61   PHILEHSVLCGSQKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASTNLRDFYNLVDV  120

Query  617  YLDAVFF  637
            YLDAVFF
Sbjct  121  YLDAVFF  127



>dbj|BAH77801.1| peptidase M16C family protein [Desulfovibrio magneticus RS-1]
Length=990

 Score =   202 bits (513),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 91/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            +++K GF  + ++ V+E  +RA+LY+H +TGAE++S+ +DDENKVFG  FRTPP  STG+
Sbjct  21   MSKKYGFSVLRDEIVEEYAARAILYRHDRTGAELLSLISDDENKVFGAAFRTPPACSTGV  80

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GS+KYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  81   PHILEHSVLCGSQKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASTNLRDFYNLVDV  140

Query  617  YLDAVFF  637
            YLDAVFF
Sbjct  141  YLDAVFF  147



>ref|XP_005842187.1| hypothetical protein GUITHDRAFT_83724 [Guillardia theta CCMP2712]
 gb|EKX55207.1| hypothetical protein GUITHDRAFT_83724 [Guillardia theta CCMP2712]
Length=1049

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 126/178 (71%), Gaps = 13/178 (7%)
 Frame = +2

Query  119  RSTFRNRLLFTSTAALPSLHLR--TRFSPLS-VRAVYTFPPELSGAEDDVARKLGFEK--  283
            R +   R+   ++  LP    R   R +P S VR V T       +  DV     F+K  
Sbjct  21   RGSAGARMSKVASFKLPQASFRRPGRLAPFSNVRMVAT-------SSVDVKSSAIFQKYD  73

Query  284  -VSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSV  460
             V E  +DE  ++ VL+KHKKTGAE+MSVS  DENKVFGI FRTPP +STG+PHILEHSV
Sbjct  74   IVKEDHIDEYGAKVVLFKHKKTGAEVMSVSVPDENKVFGITFRTPPNDSTGVPHILEHSV  133

Query  461  LSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            L GSR+YP+K+PFVELLKGS+NTFLNAFTYPDRTCYPVAS N KDFYNL++VYLDAV 
Sbjct  134  LCGSRRYPVKEPFVELLKGSMNTFLNAFTYPDRTCYPVASQNLKDFYNLINVYLDAVL  191



>ref|WP_019999861.1| peptidase M16 [Desulfovibrio desulfuricans]
Length=970

 Score =   200 bits (509),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 88/127 (69%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            +  + GFE V EQ V+E  + A L+KH+KTGA+++S++N DENKVFG+ FRTPP +STG+
Sbjct  1    MTEQFGFELVDEQRVEELATTARLWKHRKTGAQVLSMNNADENKVFGVSFRTPPSDSTGV  60

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
             HILEHSVL GS K+P+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNL+DV
Sbjct  61   AHILEHSVLCGSEKFPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLQDFYNLIDV  120

Query  617  YLDAVFF  637
            YLDA FF
Sbjct  121  YLDAAFF  127



>ref|WP_027361259.1| peptidase M16 [Desulfovibrio acrylicus]
Length=970

 Score =   200 bits (508),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 88/127 (69%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            +  + GFE V EQ V+E  + A L+KH+KTGA+++S++N DENKVFG+ FRTPP +STG+
Sbjct  1    MTEQFGFELVDEQRVEELATTARLWKHRKTGAQVLSMNNADENKVFGVSFRTPPSDSTGV  60

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
             HILEHSVL GS K+P+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNL+DV
Sbjct  61   AHILEHSVLCGSEKFPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLQDFYNLIDV  120

Query  617  YLDAVFF  637
            YLDA FF
Sbjct  121  YLDAAFF  127



>ref|WP_009110736.1| peptidase M16 [Desulfovibrio sp. U5L]
 gb|EIG55675.1| putative Zn-dependent peptidase, insulinase [Desulfovibrio sp. 
U5L]
Length=968

 Score =   200 bits (508),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 91/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            ++R  GF  ++++ + E  +RAV Y+H +TGAE++S+S DD NKVFG+ FRTPP NSTG+
Sbjct  1    MSRSHGFTVLTDETLTEYAARAVRYRHDRTGAEVLSLSLDDANKVFGVAFRTPPANSTGV  60

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  61   PHILEHSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLRDFYNLVDV  120

Query  617  YLDAVFF  637
            YLDAVFF
Sbjct  121  YLDAVFF  127



>ref|WP_005990555.1| peptidase M16 [Desulfovibrio fructosivorans]
 gb|EFL52739.1| Peptidase M16C associated domain protein [Desulfovibrio fructosivorans 
JJ]
Length=968

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  + ++ +DE  +RAVL +H +TGA+++S+S DD NKVFGI FRTPP NSTG+PHILE
Sbjct  6    GFTVLRDETLDEYAARAVLARHDRTGAQVLSLSLDDANKVFGISFRTPPANSTGVPHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLRDFYNLIDVYLDAV  125

Query  632  FF  637
            F+
Sbjct  126  FY  127



>ref|XP_002501992.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63250.1| predicted protein [Micromonas sp. RCC299]
Length=1042

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE V E +V E  S+   ++H KTGAE+MS+SNDDENK FG+  RTPP NSTGIPHILE
Sbjct  69   GFELVREDYVAEYDSKVFFFRHAKTGAEVMSLSNDDENKCFGVTLRTPPANSTGIPHILE  128

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVEL+KGSLNTFLNA TYPDRTCYPVAS N +DF NLVDVYLDAV
Sbjct  129  HSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTYPDRTCYPVASCNLQDFRNLVDVYLDAV  188

Query  632  F  634
            F
Sbjct  189  F  189



>ref|WP_012805698.1| peptidase M16 [Desulfomicrobium baculatum]
 gb|ACU88615.1| Peptidase M16C associated domain protein [Desulfomicrobium baculatum 
DSM 4028]
Length=969

 Score =   199 bits (506),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 91/122 (75%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF +VS  +V E  SRA ++ H +TGA I+SV NDDENKVFGI FRTPP +STG+ HILE
Sbjct  4    GFTRVSTTYVQEISSRADIFVHDRTGARILSVVNDDENKVFGISFRTPPSDSTGVAHILE  63

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFV+LLKGSL TFLNA TYPD+TCYPVAS N KDFYNLVDVYLDAV
Sbjct  64   HSVLCGSRKYPVKEPFVDLLKGSLQTFLNAMTYPDKTCYPVASQNLKDFYNLVDVYLDAV  123

Query  632  FF  637
            FF
Sbjct  124  FF  125



>ref|WP_024824358.1| peptidase M16 [Desulfovibrio magneticus]
Length=970

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            ++R  GF  + ++ +DE  +RA+LY+H +TGA+++S+  DD NKVFG  FRTPP+ STG+
Sbjct  1    MSRMHGFSVLRDETLDEYAARAILYRHDRTGAQLLSLVLDDTNKVFGAAFRTPPECSTGV  60

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GSRKYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  61   PHILEHSVLCGSRKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASTNLRDFYNLVDV  120

Query  617  YLDAVFF  637
            YLDAVF+
Sbjct  121  YLDAVFY  127



>ref|XP_005844172.1| hypothetical protein CHLNCDRAFT_139318 [Chlorella variabilis]
 gb|EFN52070.1| hypothetical protein CHLNCDRAFT_139318 [Chlorella variabilis]
Length=980

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 1/127 (1%)
 Frame = +2

Query  257  VARKL-GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTG  433
            V +KL GF  V +Q+V E  S+ ++Y+H KTGA++MSV N DENK FG+ FRTP  NS G
Sbjct  8    VPQKLHGFSLVEQQYVTEYASQVLMYRHDKTGAQLMSVINSDENKTFGVTFRTPVANSRG  67

Query  434  IPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVD  613
            +PHILEHSVL GSRKYP+K+PFVEL+KGSLNTFLNAFTYPDRTCYPVAS N +DFYNLVD
Sbjct  68   VPHILEHSVLCGSRKYPIKEPFVELMKGSLNTFLNAFTYPDRTCYPVASINLQDFYNLVD  127

Query  614  VYLDAVF  634
            VYLDAVF
Sbjct  128  VYLDAVF  134



>ref|WP_009182029.1| peptidase M16 [Desulfovibrio sp. FW1012B]
 gb|EHJ48664.1| Peptidase M16C associated domain protein [Desulfovibrio sp. FW1012B]
Length=968

 Score =   199 bits (505),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 91/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            ++R  GF  ++++ + E  +RAV Y+H +TGAE++S+S DD NKVFG+ FRTPP NSTG+
Sbjct  1    MSRSHGFTVLADETLTEYAARAVRYRHDRTGAEVLSLSLDDANKVFGVAFRTPPANSTGV  60

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN  DFYNLVDV
Sbjct  61   PHILEHSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLPDFYNLVDV  120

Query  617  YLDAVFF  637
            YLDAVFF
Sbjct  121  YLDAVFF  127



>ref|WP_015751993.1| peptidase M16 [Desulfohalobium retbaense]
 gb|ACV68849.1| Peptidase M16C associated domain protein [Desulfohalobium retbaense 
DSM 5692]
Length=968

 Score =   197 bits (500),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 87/121 (72%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  + + +VDE +S+  +Y+H +TGAE++SV N D NKVFGI FRTPPK+STG+ HILE
Sbjct  6    GFTCLRDTYVDEIRSQCRVYRHDQTGAEVLSVENQDTNKVFGISFRTPPKDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYPLK+PFVELLKGSL TFLNA T+PD+TCYPVAS NT+DFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPLKEPFVELLKGSLQTFLNAMTFPDKTCYPVASQNTQDFYNLIDVYLDAV  125

Query  632  F  634
            F
Sbjct  126  F  126



>gb|KDO42491.1| hypothetical protein CISIN_1g0037001mg, partial [Citrus sinensis]
 gb|KDO42492.1| hypothetical protein CISIN_1g0037001mg, partial [Citrus sinensis]
 gb|KDO42493.1| hypothetical protein CISIN_1g0037001mg, partial [Citrus sinensis]
 gb|KDO42494.1| hypothetical protein CISIN_1g0037001mg, partial [Citrus sinensis]
 gb|KDO42495.1| hypothetical protein CISIN_1g0037001mg, partial [Citrus sinensis]
Length=204

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSLNTFLN
Sbjct  1    MSVSNDDENKVFGIVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLNTFLN  60

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVY DAVFF
Sbjct  61   AFTYPDRTCYPVASTNTKDFYNLVDVYFDAVFF  93



>ref|WP_035261705.1| peptidase M16 [Desulfonatronum lacustre]
Length=979

 Score =   196 bits (498),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            F  + E F+ E +SRA LY+H +TGA ++S+ N+DENKVFGI FRTPP +STG+ HILEH
Sbjct  5    FTLLKETFITELQSRAFLYRHDRTGARLLSLVNNDENKVFGISFRTPPADSTGVAHILEH  64

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N+KDFYNL+DVYLDAVF
Sbjct  65   SVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASQNSKDFYNLIDVYLDAVF  124



>ref|WP_031388389.1| peptidase M16 [Desulfonatronum thiodismutans]
Length=979

 Score =   196 bits (498),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 89/120 (74%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            F  + E F+ E +SRA LY+H  TGA ++S+ NDDENKVFGI FRTPP +STG+ HILEH
Sbjct  5    FTLLKETFITELQSRAFLYRHDHTGARLLSLVNDDENKVFGISFRTPPADSTGVAHILEH  64

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N KDFYNL+DVYLDAVF
Sbjct  65   SVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASQNIKDFYNLIDVYLDAVF  124



>ref|WP_006921332.1| putative Zn-dependent peptidase, insulinase [Desulfovibrio magneticus]
 gb|EKO38312.1| putative Zn-dependent peptidase, insulinase [Desulfovibrio magneticus 
str. Maddingley MBC34]
Length=970

 Score =   196 bits (498),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 89/127 (70%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            +++  GF  + ++ ++E  +RAVLY+H +TGA+++S+ +DDENKVFG  FRTPP  STG+
Sbjct  1    MSKHHGFSVLRDEILEEYAARAVLYRHDRTGAQLLSLISDDENKVFGAAFRTPPACSTGV  60

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GS+KYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  61   PHILEHSVLCGSQKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASTNLRDFYNLVDV  120

Query  617  YLDAVFF  637
            YLDAVFF
Sbjct  121  YLDAVFF  127



>ref|WP_029456797.1| peptidase M16 [Desulfovibrio alcoholivorans]
Length=968

 Score =   196 bits (497),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  266  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHI  445
            K GF  + ++ + E  +RAVL +H +TGA+++S+S DD NKVFG+ FRTPP NSTG+PHI
Sbjct  4    KYGFTVLCDEDLAEYAARAVLCRHDRTGAQVLSLSLDDANKVFGVSFRTPPANSTGVPHI  63

Query  446  LEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  625
            LEHSVL GSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNLVDVYLD
Sbjct  64   LEHSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLRDFYNLVDVYLD  123

Query  626  AVFF  637
            AVF+
Sbjct  124  AVFY  127



>ref|WP_045219069.1| peptidase M16 [Desulfonatronum thioautotrophicum]
Length=974

 Score =   196 bits (497),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            F  + E F+ E +S+A LY+H +TGA ++S+ NDDENKVFGI FRTPP +STG+ HILEH
Sbjct  5    FTLLKETFITEIQSQARLYRHDRTGARVLSLVNDDENKVFGISFRTPPADSTGVAHILEH  64

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS NT DFYNL+DVYLDAVF
Sbjct  65   SVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASQNTTDFYNLIDVYLDAVF  124



>ref|WP_027181841.1| peptidase M16 [Desulfovibrio alaskensis]
Length=965

 Score =   195 bits (496),  Expect = 8e-54, Method: Composition-based stats.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  266  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHI  445
            K GF  V E+ + E  SRA L++H  TGA ++S+SNDDENKVFG+ FRTPP +STG+ HI
Sbjct  3    KHGFTLVEEREIKELSSRARLWRHDATGAALLSMSNDDENKVFGVSFRTPPHDSTGVAHI  62

Query  446  LEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  625
            LEHSVL GS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN  DFYNLVDVYLD
Sbjct  63   LEHSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLADFYNLVDVYLD  122

Query  626  AVFF  637
            A FF
Sbjct  123  AAFF  126



>ref|WP_011368505.1| peptidase M16 [Desulfovibrio alaskensis]
 gb|ABB39473.2| metalloprotease, iron regulated [Desulfovibrio alaskensis G20]
Length=965

 Score =   195 bits (496),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  266  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHI  445
            K GF  V E+ + E  SRA L++H  TGA ++S+SNDDENKVFG+ FRTPP +STG+ HI
Sbjct  3    KHGFTLVEEREIKELSSRARLWRHDATGAALLSMSNDDENKVFGVSFRTPPHDSTGVAHI  62

Query  446  LEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  625
            LEHSVL GS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN  DFYNLVDVYLD
Sbjct  63   LEHSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLADFYNLVDVYLD  122

Query  626  AVFF  637
            A FF
Sbjct  123  AAFF  126



>gb|KKB82630.1| peptidase M16 [Devosia limi DSM 17137]
Length=969

 Score =   195 bits (495),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 89/122 (73%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             FE + ++ + E  S+A LY+HKKTGAE++S+ NDDENKVFGI F+TPP++STGI HILE
Sbjct  6    AFELIRDEQIAEVNSQARLYRHKKTGAEVLSLVNDDENKVFGITFKTPPEDSTGIAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+KKPFVELLKGSL+TFLNA T+PD+T YPVAS N KDFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKKPFVELLKGSLHTFLNAMTFPDKTAYPVASQNLKDFYNLVDVYLDAV  125

Query  632  FF  637
            +F
Sbjct  126  YF  127



>emb|CEG00022.1| Metalloenzyme, LuxS/M16 peptidase-like [Ostreococcus tauri]
Length=1055

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE V E ++ E  ++A L++H KTGAE+MS+SN+DENK FG+ FRTPP NSTGIPHILE
Sbjct  85   GFELVREDYISEYDAKAFLFRHAKTGAEVMSLSNEDENKTFGVTFRTPPSNSTGIPHILE  144

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVEL+KGSLNTFLNA T+PD+T YPVAS N +DF NL DVYLDAV
Sbjct  145  HSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTWPDKTAYPVASCNLQDFRNLTDVYLDAV  204

Query  632  F  634
            F
Sbjct  205  F  205



>ref|WP_027177039.1| peptidase M16 [Desulfovibrio aminophilus]
Length=967

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF K+ EQ + E ++RA +Y+H KTG  ++S+ N+DENKVFGI FRTPP++STG+ HILE
Sbjct  6    GFRKIREQDIPEIRTRAQVYEHVKTGGRLLSLLNEDENKVFGISFRTPPRDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+++PFVELLKGSL TFLNA T+PD+TCYPVASTN +DFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPVREPFVELLKGSLQTFLNALTFPDKTCYPVASTNVQDFYNLIDVYLDAV  125

Query  632  F  634
            F
Sbjct  126  F  126



>ref|WP_028577615.1| peptidase M16 [Desulfomicrobium escambiense]
Length=969

 Score =   194 bits (493),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 91/122 (75%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  VS   V E  S+A LY H +TGA I+SV NDDENKVFGI FRTPP +STG+ HILE
Sbjct  4    GFTLVSSTHVPEIASQADLYVHDRTGARILSVRNDDENKVFGITFRTPPADSTGVAHILE  63

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFV+LLKGSL TFLNA TYPD+TCYPVAS N KDFYNL DVYLDAV
Sbjct  64   HSVLCGSRKYPVKEPFVDLLKGSLQTFLNAMTYPDKTCYPVASQNLKDFYNLTDVYLDAV  123

Query  632  FF  637
            FF
Sbjct  124  FF  125



>ref|WP_022661974.1| peptidase M16 [Desulfovibrio longus]
Length=964

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            +A+K GF  V+++ + E  SRA+LY+H +TG  ++SV N DENKVFGI FRT P +STG+
Sbjct  1    MAKKHGFTLVADREIPEMSSRALLYEHDRTGGRVLSVVNSDENKVFGISFRTTPADSTGL  60

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GSRKYP+++PFVELLKGSL TFLNA T+PD+TCYPVAS N +DFYNLVDV
Sbjct  61   PHILEHSVLCGSRKYPVREPFVELLKGSLQTFLNALTFPDKTCYPVASANLQDFYNLVDV  120

Query  617  YLDAVFF  637
            YLDAVFF
Sbjct  121  YLDAVFF  127



>ref|XP_003082508.1| putative metalloprotease (ISS), partial [Ostreococcus tauri]
Length=1085

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE V E ++ E  ++A L++H KTGAE+MS+SN+DENK FG+ FRTPP NSTGIPHILE
Sbjct  9    GFELVREDYISEYDAKAFLFRHAKTGAEVMSLSNEDENKTFGVTFRTPPSNSTGIPHILE  68

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVEL+KGSLNTFLNA T+PD+T YPVAS N +DF NL DVYLDAV
Sbjct  69   HSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTWPDKTAYPVASCNLQDFRNLTDVYLDAV  128

Query  632  F  634
            F
Sbjct  129  F  129



>ref|XP_001420892.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99185.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=979

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  V E ++ E  ++A L+KH+KTGAE+MS+SN+DENK FG+ FRTPP NSTGIPHILE
Sbjct  9    GFRLVREDYIAEYDAKAFLFKHEKTGAEVMSLSNEDENKTFGVTFRTPPSNSTGIPHILE  68

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVEL+KGSLNTFLNA T+PD+T YPVAS N +DF NL DVYLDAV
Sbjct  69   HSVLCGSRKYPIKEPFVELIKGSLNTFLNAMTWPDKTAYPVASCNLQDFRNLTDVYLDAV  128

Query  632  F  634
            F
Sbjct  129  F  129



>ref|WP_043637762.1| peptidase M16 [Desulfovibrio sp. TomC]
 gb|KHK01438.1| peptidase, M16 family [Desulfovibrio sp. TomC]
Length=970

 Score =   194 bits (492),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            ++R  GF  + ++ +DE  +RA++ +H +TGAE++S+  DD NKVFG  FRTPP  STG+
Sbjct  1    MSRTHGFSVLRDESLDEYAARAMVLRHDRTGAELLSLVLDDANKVFGAAFRTPPDCSTGV  60

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GSRKYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVASTN +DFYNLVDV
Sbjct  61   PHILEHSVLCGSRKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASTNVRDFYNLVDV  120

Query  617  YLDAVFF  637
            YLDAVFF
Sbjct  121  YLDAVFF  127



>ref|XP_005538148.1| presequence protease [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82112.1| presequence protease [Cyanidioschyzon merolae strain 10D]
Length=1067

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 120/172 (70%), Gaps = 7/172 (4%)
 Frame = +2

Query  143  LFTSTAALPSLHLRTRFSPLSVRAVYTFP-PELSGAEDDVARK------LGFEKVSEQFV  301
            +F S+     +  + RF+   +RA    P P  +     V R+       GF  V  +FV
Sbjct  29   VFRSSRCKVGVQRQVRFTVPGLRATAVMPTPTQAPVRVQVPRRELGEKAFGFTLVRSEFV  88

Query  302  DECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKY  481
             E +S   +YKH + G E++SV NDDENK FG+ FRTPP +STG+PHILEHSVL GSRKY
Sbjct  89   PEIQSYVRVYKHDRYGTELISVVNDDENKTFGVAFRTPPSDSTGVPHILEHSVLCGSRKY  148

Query  482  PLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            P+K+PFVELLK S+NTFLNA T+PD+TCYPVASTN +DFYNLVDVYLDAVFF
Sbjct  149  PVKEPFVELLKTSMNTFLNAMTFPDKTCYPVASTNLRDFYNLVDVYLDAVFF  200



>gb|EJK74078.1| hypothetical protein THAOC_04268 [Thalassiosira oceanica]
Length=404

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            +E V    + E  + A+LYKHKKTGAE++S+S DD+NK FGI FRTPP +STG+PHILEH
Sbjct  225  YEVVQTDHITEFGANAILYKHKKTGAELLSLSTDDDNKCFGITFRTPPTDSTGVPHILEH  284

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKY  K PFV+LL+GSL TFLNAFTYPDRTCY VAS NTKDFYNL++VY DAVF
Sbjct  285  SVLCGSRKYTTKDPFVQLLQGSLQTFLNAFTYPDRTCYVVASQNTKDFYNLINVYADAVF  344



>gb|KDD73441.1| hypothetical protein H632_c2174p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=287

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  260  ARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIP  439
            A   GFE V  ++V E  S   LY+H  +GAE+MSV N DENK FG+ F TP  +S G P
Sbjct  15   ASSHGFELVRSEYVSESSSHVALYRHLASGAELMSVRNADENKTFGVTFCTPVHDSKGTP  74

Query  440  HILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVY  619
            HILEHSVL GS +YP K+PFVEL+KGSLNTFLNAFTYPDRTCYPVASTN +D+YNLVDVY
Sbjct  75   HILEHSVLCGSDRYPCKEPFVELMKGSLNTFLNAFTYPDRTCYPVASTNLRDYYNLVDVY  134

Query  620  LDAVF  634
            LDAVF
Sbjct  135  LDAVF  139



>ref|WP_046105547.1| peptidase M16 [Devosia chinhatensis]
 gb|KKB07518.1| peptidase M16 [Devosia chinhatensis]
Length=968

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            FE V ++ + E  S+A LY+HKKTGAE++S+ NDDENKVFGI F+TPP++STGI HILEH
Sbjct  6    FEIVRDENIAEINSQAKLYRHKKTGAEVLSLVNDDENKVFGITFKTPPEDSTGIAHILEH  65

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GS KYP+KKPFVELLKGS++TFLNA T+PD+T YPVAS N KDFYNLVDVYLDAV 
Sbjct  66   SVLCGSEKYPVKKPFVELLKGSMHTFLNAMTFPDKTAYPVASQNLKDFYNLVDVYLDAVL  125

Query  635  F  637
            F
Sbjct  126  F  126



>ref|XP_002952139.1| hypothetical protein VOLCADRAFT_81738 [Volvox carteri f. nagariensis]
 gb|EFJ46930.1| hypothetical protein VOLCADRAFT_81738 [Volvox carteri f. nagariensis]
Length=1034

 Score =   193 bits (490),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            V +  GF    +Q+V E  S  +LYKH KTGAE++SV N D NK FG+  RTP  +STGI
Sbjct  51   VEKAHGFTLQRQQYVKEYGSHVLLYKHDKTGAELISVLNSDLNKTFGVVLRTPVDDSTGI  110

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GSRKYP+K+PFVEL+K SLNTFLNAFTYPDRTCYPVASTNT+DFYNLVDV
Sbjct  111  PHILEHSVLCGSRKYPIKEPFVELMKSSLNTFLNAFTYPDRTCYPVASTNTQDFYNLVDV  170

Query  617  YLDAVF  634
            YLDAVF
Sbjct  171  YLDAVF  176



>ref|WP_018124477.1| hypothetical protein [Desulfovibrio oxyclinae]
Length=970

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+KV E  + E  S A +++H+KTG  ++S+ NDDENKVFG+ FRTPPK+STG+ HILE
Sbjct  4    GFDKVREMEIKELGSVAQIWRHRKTGGRVLSMINDDENKVFGLSFRTPPKDSTGVAHILE  63

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVELLKGSL TFLNA T+PD+TCYPVAS N  DFYNLVDVYLDA 
Sbjct  64   HSVLCGSRKYPVKEPFVELLKGSLQTFLNALTFPDKTCYPVASANHADFYNLVDVYLDAA  123

Query  632  FF  637
            FF
Sbjct  124  FF  125



>gb|KKB76061.1| peptidase M16 [Devosia soli]
Length=970

 Score =   192 bits (488),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 89/122 (73%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             FE V ++ V E  S+A L++HKKTGAE++S+ N+DENKVFGI F+TPP++STGI HILE
Sbjct  7    AFELVRDEKVAEINSQAQLFRHKKTGAEVLSLVNEDENKVFGITFKTPPEDSTGIAHILE  66

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+KKPFVELLKGS++TFLNA T+PD+T YPVAS N KDFYNLVDVYLDAV
Sbjct  67   HSVLCGSRKYPVKKPFVELLKGSMHTFLNAMTFPDKTAYPVASANLKDFYNLVDVYLDAV  126

Query  632  FF  637
            FF
Sbjct  127  FF  128



>ref|WP_006425491.1| peptidase M16 [delta proteobacterium NaphS2]
 gb|EFK05737.1| peptidase M16 inactive domain protein [delta proteobacterium 
NaphS2]
Length=977

 Score =   192 bits (487),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             FE + +Q + E K+ A LY+H+KTGA+I+S+  DDENKVFGI FRTPP +STG+ HILE
Sbjct  6    AFELIKKQEIAELKTEARLYRHRKTGAQILSMITDDENKVFGITFRTPPFDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS+KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DFYNL+DVYLDAV
Sbjct  66   HSVLCGSKKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASQNLQDFYNLMDVYLDAV  125

Query  632  FF  637
            F+
Sbjct  126  FY  127



>ref|WP_035098694.1| peptidase M16 [Devosia sp. LC5]
 gb|KFC69781.1| Peptidase M16C associated domain protein [Devosia sp. LC5]
Length=968

 Score =   192 bits (487),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             FE + ++ + E  S+  L++HKKTGAE++S+ NDDENKVFG+ F+TPP++STGI HILE
Sbjct  5    AFELIRDEHIAEVNSQVQLFRHKKTGAEVLSLVNDDENKVFGVTFKTPPQDSTGIAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+KKPFVELLKGS++TFLNA T+PD+T YPVAS N KDFYNLVDVYLDAV
Sbjct  65   HSVLCGSRKYPVKKPFVELLKGSMHTFLNAMTFPDKTAYPVASQNLKDFYNLVDVYLDAV  124

Query  632  FF  637
            FF
Sbjct  125  FF  126



>gb|KKB79681.1| peptidase M16 [Devosia insulae DS-56]
Length=969

 Score =   192 bits (487),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             FE + ++ + E  SR  L++H KTGAE++S+ NDDENKVFG+ F+TPP++STGI HILE
Sbjct  6    AFELIRDEQIGEVNSRVQLFRHIKTGAEVLSLVNDDENKVFGVTFKTPPEDSTGIAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+KKPFVEL+KGSLNTFLNA T+PD+T YPVAS N KDFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKKPFVELIKGSLNTFLNAMTFPDKTAYPVASQNLKDFYNLVDVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_041454536.1| peptidase M16 [Anaerolinea thermophila]
Length=970

 Score =   192 bits (487),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 87/121 (72%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + ++ + E  SRA LY+H +TGAE++S+ NDDENKVFGI FRT P + TG+PHI+E
Sbjct  7    GFELLRDERIPEINSRARLYRHIRTGAELLSLENDDENKVFGITFRTLPMDDTGLPHIME  66

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  67   HSVLCGSRKYPVKEPFVELMKGSLNTFLNAMTYPDKTCYPVASQNLQDFYNLVDVYLDAV  126

Query  632  F  634
            F
Sbjct  127  F  127



>dbj|BAJ62543.1| putative M16C family peptidase [Anaerolinea thermophila UNI-1]
Length=1007

 Score =   192 bits (487),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 87/121 (72%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + ++ + E  SRA LY+H +TGAE++S+ NDDENKVFGI FRT P + TG+PHI+E
Sbjct  44   GFELLRDERIPEINSRARLYRHIRTGAELLSLENDDENKVFGITFRTLPMDDTGLPHIME  103

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  104  HSVLCGSRKYPVKEPFVELMKGSLNTFLNAMTYPDKTCYPVASQNLQDFYNLVDVYLDAV  163

Query  632  F  634
            F
Sbjct  164  F  164



>ref|WP_035093689.1| peptidase M16 [Devosia sp. 17-2-E-8]
 gb|KFL26101.1| peptidase M16 [Devosia sp. 17-2-E-8]
Length=970

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            FE + EQ + E  S A LY+HKKTGAE++S+ NDDENKVFG+  +TPP +STG+ HILEH
Sbjct  7    FELLQEQTIPEVNSLARLYRHKKTGAEVLSLVNDDENKVFGVTLKTPPSDSTGVAHILEH  66

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYP+KKPFVE+LKGSL+TFLNA TYPD+T YPVAS N +DFYNLVDVYLDAVF
Sbjct  67   SVLCGSRKYPVKKPFVEMLKGSLHTFLNAMTYPDKTTYPVASQNLRDFYNLVDVYLDAVF  126



>ref|WP_035035576.1| peptidase M16 [Devosia sp. DBB001]
 emb|CDP52867.1| Peptidase M16C associated domain protein [Devosia sp. DBB001]
Length=970

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            FE + EQ + E  S A LY+HKKTGAE++S+ NDDENKVFG+  +TPP +STG+ HILEH
Sbjct  7    FELLQEQTIPEVNSLARLYRHKKTGAEVLSLVNDDENKVFGVTLKTPPSDSTGVAHILEH  66

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYP+KKPFVE+LKGSL+TFLNA TYPD+T YPVAS N +DFYNLVDVYLDAVF
Sbjct  67   SVLCGSRKYPVKKPFVEMLKGSLHTFLNAMTYPDKTTYPVASQNLRDFYNLVDVYLDAVF  126



>ref|WP_006562562.1| peptidase M16 [Oscillochloris trichoides]
 gb|EFO80139.1| peptidase M16C associated domain-containing protein [Oscillochloris 
trichoides DG-6]
Length=970

 Score =   191 bits (484),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  + ++ + E  ++A +Y+H KTGAE++++SNDDENK FG+ FRTPP++STGI HILE
Sbjct  6    GFTLIRDEAIPELNTQARIYRHIKTGAELLALSNDDENKCFGVTFRTPPEDSTGIAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVELLK SL TFLNAFTY D+TCYPVASTN +DFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKSSLKTFLNAFTYADKTCYPVASTNLQDFYNLVDVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_035086012.1| peptidase M16 [Devosia riboflavina]
 gb|KFL29675.1| peptidase M16 [Devosia riboflavina]
Length=969

 Score =   190 bits (483),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             FE V ++ + E  S+A L++HKKTGAE++S+ NDDENKVFG+  +TPP +STGI HILE
Sbjct  6    AFELVRDESIAEINSQAQLFRHKKTGAEVLSLINDDENKVFGVTLKTPPDDSTGIAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+KKPFVELLKGS++TFLNA T+PD+T YPVAS N KDFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKKPFVELLKGSMHTFLNAMTFPDKTAYPVASANLKDFYNLVDVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_011698518.1| peptidase M16 [Syntrophobacter fumaroxidans]
 gb|ABK17348.1| PreP peptidase. Metallo peptidase. MEROPS family M16C [Syntrophobacter 
fumaroxidans MPOB]
Length=976

 Score =   190 bits (483),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + +Q+V E  +   + +H  TGA+++S+ NDDENKVFGI FRTPP++STG+ HILE
Sbjct  6    GFELLKQQYVPEISTEIKVLRHVGTGAQVLSLINDDENKVFGISFRTPPEDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRK+P+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N KDFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKFPVKEPFVELLKGSLKTFLNAFTYPDKTCYPVASQNDKDFYNLIDVYLDAV  125

Query  632  F  634
            F
Sbjct  126  F  126



>ref|WP_014258900.1| peptidase M16 [Desulfovibrio africanus]
 gb|EGJ49064.1| Peptidase M16C associated domain protein [Desulfovibrio africanus 
str. Walvis Bay]
Length=968

 Score =   190 bits (482),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF    E  V E  S   LY+H+KTGA +MSV   DENKVFGI FRTPPK+STG+ HILE
Sbjct  8    GFRLEREAEVAEISSTVRLYRHEKTGARLMSVIAPDENKVFGISFRTPPKDSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNLVDVYLDAV
Sbjct  68   HSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNVRDFYNLVDVYLDAV  127

Query  632  F  634
            F
Sbjct  128  F  128



>ref|XP_011396191.1| Presequence protease 2, chloroplastic/mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM23321.1| Presequence protease 2, chloroplastic/mitochondrial [Auxenochlorella 
protothecoides]
Length=957

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  V +Q++ E  S A+LY+HKKTGA++MSV N DENK FG  FRTP  +S G PHILE
Sbjct  43   GFTLVEQQYLAEYDSTALLYRHKKTGAQLMSVINKDENKTFGATFRTPVDDSKGTPHILE  102

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVEL+KGSLNTFLNAFTYPDRTCYPVAS N +DFYNLVDVYLD+V
Sbjct  103  HSVLCGSDKYPIKEPFVELMKGSLNTFLNAFTYPDRTCYPVASANLRDFYNLVDVYLDSV  162

Query  632  F  634
             
Sbjct  163  L  163



>gb|EMT26044.1| Presequence protease 1, chloroplastic/mitochondrial [Aegilops 
tauschii]
Length=961

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSV+NDDENKVFGI FRTPPKNSTGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  1    MSVANDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  60

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  61   AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  93



>gb|EMS56412.1| Presequence protease 1, chloroplastic/mitochondrial [Triticum 
urartu]
Length=974

 Score =   189 bits (480),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 88/93 (95%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSV+NDDENKVFGI FRTPPKNSTGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  1    MSVANDDENKVFGIVFRTPPKNSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  60

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  61   AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  93



>ref|WP_015940539.1| peptidase M16 [Chloroflexus aggregans]
 gb|ACL24680.1| Peptidase M16C associated domain protein [Chloroflexus aggregans 
DSM 9485]
Length=969

 Score =   189 bits (480),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + ++F+ E  +RA LY+H KTGAE++S+ NDDENK FGI FRTPP++STGI HILE
Sbjct  6    GFELLRDEFIPELNTRARLYRHIKTGAELLSLENDDENKCFGITFRTPPRDSTGIAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K PF  L+KGS++TFLNA TYPD+T YPVASTN KDFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPVKDPFFTLVKGSVHTFLNAMTYPDKTTYPVASTNLKDFYNLIDVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_015415436.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
piezophilus]
 emb|CCH49392.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
piezophilus C1TLV30]
Length=969

 Score =   189 bits (479),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF K+ E  + E  S A +Y+H KTGA ++SV NDDENKVFGI FRTPP++STG+ HILE
Sbjct  4    GFTKIQEMEITEMGSLAHVYRHDKTGARVLSVINDDENKVFGISFRTPPEDSTGVAHILE  63

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNA T+PD+TCYPVAS N +DFYNL+DVYLDAV
Sbjct  64   HSVLCGSDKYPIKEPFVELLKGSLQTFLNALTFPDKTCYPVASANVQDFYNLIDVYLDAV  123

Query  632  F  634
            F
Sbjct  124  F  124



>ref|WP_014323044.1| peptidase M16 [Desulfovibrio desulfuricans]
 gb|EGB15618.1| Peptidase M16C associated domain protein [Desulfovibrio desulfuricans 
ND132]
Length=969

 Score =   189 bits (479),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 85/123 (69%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +2

Query  269  LGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHIL  448
             GF K+ E  + E  + AV+Y+H KTGA ++S+ NDDENKVFGI FRTPP++STG+ HIL
Sbjct  3    FGFTKIREMEIAELATTAVVYRHDKTGARLLSMINDDENKVFGISFRTPPEDSTGVAHIL  62

Query  449  EHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDA  628
            EHSVL GS KYP+K+PFVELLKGSL TFLNA T+PD+TCYPVAS N +DFYNL+DVYLDA
Sbjct  63   EHSVLCGSDKYPVKEPFVELLKGSLQTFLNALTFPDKTCYPVASANVQDFYNLIDVYLDA  122

Query  629  VFF  637
            VF+
Sbjct  123  VFY  125



>ref|WP_012119247.1| peptidase M16 [Roseiflexus castenholzii]
 gb|ABU56817.1| Peptidase M16C associated domain protein [Roseiflexus castenholzii 
DSM 13941]
Length=968

 Score =   189 bits (479),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 91/121 (75%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + EQ + E  S A  Y+H  TGAE++S+ NDDENKVFGI FRTPP +STG+ HILE
Sbjct  6    GFELLREQQIAELNSLARWYRHVATGAELLSLINDDENKVFGITFRTPPPDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYPLKKPFVELLKGSL TFLNA TY D+T YPVASTNTKDFYNLVDVYLDAV
Sbjct  66   HSVLCGSEKYPLKKPFVELLKGSLKTFLNAMTYSDKTVYPVASTNTKDFYNLVDVYLDAV  125

Query  632  F  634
            F
Sbjct  126  F  126



>ref|XP_005716826.1| presequence protease [Chondrus crispus]
 emb|CDF37007.1| presequence protease [Chondrus crispus]
Length=996

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF    E++V E  S   L+ H++TG E+MSVSNDDENK FG+  RTPP +STG+PHILE
Sbjct  21   GFALRREEYVKEIGSVTRLWVHQRTGTELMSVSNDDENKTFGVVLRTPPNDSTGVPHILE  80

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVEL+K SLNTFLNAFTYPD+TCYPVAS N +DFYNLVDVY+DAV
Sbjct  81   HSVLCGSEKYPVKEPFVELIKCSLNTFLNAFTYPDKTCYPVASCNERDFYNLVDVYMDAV  140

Query  632  F  634
            F
Sbjct  141  F  141



>gb|ADU64271.1| Peptidase M16C associated domain protein [Desulfovibrio aespoeensis 
Aspo-2]
Length=969

 Score =   187 bits (476),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF K+ E  + E  + A LY+H KTGA ++S+ NDDENKVFGI FRTPP++STG+ HILE
Sbjct  4    GFTKIRELEIAEMAAFAHLYRHDKTGARVLSIVNDDENKVFGISFRTPPEDSTGVAHILE  63

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+++PFVELLKGSL TFLNA T+PD+TCYPVAS N  DFYNLVDVYLDAV
Sbjct  64   HSVLCGSEKYPVREPFVELLKGSLQTFLNALTFPDKTCYPVASANVSDFYNLVDVYLDAV  123

Query  632  FF  637
            F+
Sbjct  124  FY  125



>ref|WP_041271892.1| peptidase M16 [Desulfovibrio aespoeensis]
Length=970

 Score =   187 bits (476),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF K+ E  + E  + A LY+H KTGA ++S+ NDDENKVFGI FRTPP++STG+ HILE
Sbjct  5    GFTKIRELEIAEMAAFAHLYRHDKTGARVLSIVNDDENKVFGISFRTPPEDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+++PFVELLKGSL TFLNA T+PD+TCYPVAS N  DFYNLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVREPFVELLKGSLQTFLNALTFPDKTCYPVASANVSDFYNLVDVYLDAV  124

Query  632  FF  637
            F+
Sbjct  125  FY  126



>ref|WP_005986746.1| pre-sequence protease [Desulfovibrio africanus]
 gb|EMG37176.1| pre-sequence protease [Desulfovibrio africanus PCS]
Length=968

 Score =   187 bits (475),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 90/121 (74%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF    E  V E  S   LY+H+KTGA +MSV   DENKVFGI FRTPPK+STG+ HILE
Sbjct  8    GFRLEREAEVAEISSTVRLYRHEKTGARLMSVIAPDENKVFGISFRTPPKDSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNLVDVYLDAV
Sbjct  68   HSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNVRDFYNLVDVYLDAV  127

Query  632  F  634
            F
Sbjct  128  F  128



>ref|WP_012257471.1| MULTISPECIES: peptidase M16 [Chloroflexus]
 ref|YP_001635206.1| peptidase M16C associated domain-containing protein [Chloroflexus 
aurantiacus J-10-fl]
 gb|ABY34817.1| Peptidase M16C associated domain protein [Chloroflexus aurantiacus 
J-10-fl]
 gb|ACM53146.1| Peptidase M16C associated domain protein [Chloroflexus sp. Y-400-fl]
Length=969

 Score =   187 bits (475),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + ++F+ E  +RA LY+H KTGAE++S+ NDDENK FGI FRTPP++STGI HILE
Sbjct  6    GFELLRDEFIPELNTRARLYRHIKTGAELLSLENDDENKCFGITFRTPPRDSTGIAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K PF  L+KGS++TFLNA T+PD+T YPVASTN KDFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKDPFFTLVKGSVHTFLNAITFPDKTAYPVASTNLKDFYNLVDVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_011954953.1| peptidase M16 [Roseiflexus sp. RS-1]
 gb|ABQ88594.1| Peptidase M16C associated domain protein [Roseiflexus sp. RS-1]
Length=968

 Score =   187 bits (475),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 89/121 (74%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + EQ + E  + A LY+H  TGAE++S+ NDDENKVFGI FRTPP +STG+ HILE
Sbjct  6    GFELLREQQISELNTLARLYRHVATGAELLSLINDDENKVFGITFRTPPPDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYPLKKPFVELLKGSL TFLNA T+ D+T YPVASTNTKDFYNL+DVYLDAV
Sbjct  66   HSVLCGSEKYPLKKPFVELLKGSLKTFLNAITFSDKTVYPVASTNTKDFYNLIDVYLDAV  125

Query  632  F  634
            F
Sbjct  126  F  126



>ref|WP_014431903.1| peptidase M16 [Caldilinea aerophila]
 dbj|BAL98662.1| peptidase M16 family protein [Caldilinea aerophila DSM 14535 
= NBRC 104270]
Length=973

 Score =   187 bits (475),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + ++ + E K+RA LY+H KTGA+++S+ NDDENKVFG+ FRT P++STG+ HILE
Sbjct  8    GFELIRDEIIAELKTRARLYRHVKTGAQLLSLENDDENKVFGVSFRTLPEDSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            H+VL GSRKYPLK+PFV+L+KGSL+TFLNAFT PD+T YPVASTN KDFYNLV+VYLDAV
Sbjct  68   HAVLGGSRKYPLKEPFVQLIKGSLHTFLNAFTSPDKTTYPVASTNLKDFYNLVEVYLDAV  127

Query  632  F  634
            F
Sbjct  128  F  128



>ref|WP_031458128.1| peptidase M16 [Chloroflexus sp. MS-G]
Length=969

 Score =   187 bits (475),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + ++F+ E  +RA LY+H KTGAE++S+ NDDENK FGI FRTPP++STG+ HILE
Sbjct  6    GFELLRDEFIPELNTRARLYRHIKTGAEVLSLENDDENKCFGITFRTPPRDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K PF  L+KGS++TFLNA T+PD+T YPVASTN KDFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKDPFFTLVKGSVHTFLNAITFPDKTSYPVASTNLKDFYNLVDVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_028458346.1| peptidase M16 [Chloroflexus sp. Y-396-1]
Length=969

 Score =   187 bits (475),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + ++F+ E  +RA LY+H KTGAE++S+ NDDENK FGI FRTPP++STG+ HILE
Sbjct  6    GFELLRDEFIPELNTRARLYRHIKTGAEVLSLENDDENKCFGITFRTPPRDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K PF  L+KGS++TFLNA T+PD+T YPVASTN KDFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKDPFFTLVKGSVHTFLNAITFPDKTSYPVASTNLKDFYNLVDVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_045426615.1| peptidase M16 [bacterium UASB270]
 dbj|GAK55491.1| PreP peptidase [bacterium UASB270]
Length=972

 Score =   187 bits (474),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ V+E+ + E ++ A L+ H KTGAE+ S+ NDDENKVFGI FRTPP +STG+PHI+E
Sbjct  6    GFKLVAERDILEIQTHARLFCHVKTGAELFSLENDDENKVFGITFRTPPTDSTGLPHIME  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVEL+KGSLNTFLNA T+PD+T YPVAS N KD YNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELMKGSLNTFLNAMTFPDKTSYPVASQNVKDLYNLIDVYLDAV  125

Query  632  FF  637
            F+
Sbjct  126  FY  127



>ref|XP_008236552.1| PREDICTED: presequence protease 1, chloroplastic/mitochondrial-like 
[Prunus mume]
Length=1079

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 124/176 (70%), Gaps = 6/176 (3%)
 Frame = +2

Query  122  STFRNRLLFTSTAALPSLHLRTRFSPLSVRAV----YTFPPELSGAEDDVARKLGFEKVS  289
            S  R+ ++   +++ P  H+ T F  LS RAV     T P E    +D+V  KLGFEKV+
Sbjct  49   SLLRSHIILLPSSSHP--HVTTHFRCLSSRAVPASSDTPPSECPEVKDEVLDKLGFEKVT  106

Query  290  EQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSG  469
            E+F+ ECKS+A+L++HKKTGA+++S+SNDDE KVF I FR P K+STGI  IL+ SV  G
Sbjct  107  EEFIGECKSKALLFRHKKTGAQVISMSNDDEQKVFSIIFRNPLKDSTGISQILQRSVYCG  166

Query  470  SRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            SRKYP+K PF E++ G+L  F   F Y DRTCY V S +TKDFYNLVD+ LDAVFF
Sbjct  167  SRKYPVKNPFEEVIGGTLGNFSEKFIYSDRTCYVVTSAHTKDFYNLVDMNLDAVFF  222



>ref|WP_027366525.1| peptidase M16 [Desulfovibrio africanus]
Length=968

 Score =   187 bits (474),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 90/121 (74%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF    E  V E  S   LY+H KTGA +MSV   DENKVFGI FRTPPK+STG+ HILE
Sbjct  8    GFRLEREAEVAEISSTVRLYRHDKTGARLMSVIAPDENKVFGISFRTPPKDSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DFYNLVDVYLDAV
Sbjct  68   HSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNVRDFYNLVDVYLDAV  127

Query  632  F  634
            F
Sbjct  128  F  128



>ref|WP_012612497.1| peptidase M16 [Desulfovibrio vulgaris]
 gb|ACL08314.1| Peptidase M16C associated domain protein [Desulfovibrio vulgaris 
str. 'Miyazaki F']
Length=968

 Score =   186 bits (473),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ V E+ V E  SR  L++H  TGA+++S  N DENKVFG+ FRTPP +STG+ HILE
Sbjct  5    GFDLVFERTVHELNSRIRLWRHDATGAQLLSCCNADENKVFGVTFRTPPSDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DF NLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASANLQDFRNLVDVYLDAV  124

Query  632  FF  637
            FF
Sbjct  125  FF  126



>ref|XP_007200093.1| hypothetical protein PRUPE_ppa019970mg, partial [Prunus persica]
 gb|EMJ01292.1| hypothetical protein PRUPE_ppa019970mg, partial [Prunus persica]
Length=1095

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 116/158 (73%), Gaps = 4/158 (3%)
 Frame = +2

Query  176  HLRTRFSPLSVRAV----YTFPPELSGAEDDVARKLGFEKVSEQFVDECKSRAVLYKHKK  343
            HL T F  LS RAV     T P E S  +D+V  KLGFEKV+E+++ ECKS+A+L++HKK
Sbjct  65   HLTTHFRCLSSRAVPASSDTPPSECSEVKDEVLDKLGFEKVTEEYIGECKSKALLFRHKK  124

Query  344  TGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSL  523
            TGA+++S+SNDDE KVF I FR P  +STGI  IL+ SV  GSRKYP+K PF E++ G+L
Sbjct  125  TGAQVISMSNDDEEKVFSIIFRNPLMDSTGISQILQRSVYCGSRKYPVKNPFEEVIGGTL  184

Query  524  NTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
              F   F Y DRTCY V ST+TKDFYNLVD+ LDAVFF
Sbjct  185  GNFSEKFIYSDRTCYVVTSTHTKDFYNLVDMNLDAVFF  222



>ref|XP_002290387.1| hypothetical protein THAPSDRAFT_22863 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED92139.1| hypothetical protein THAPSDRAFT_22863 [Thalassiosira pseudonana 
CCMP1335]
Length=1186

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE +S   V+E  +   LY+HKK+GAE++SV+ DD+NK FGI FRTPP +STG+PHILE
Sbjct  177  GFEVISTDVVNEFGAYCTLYRHKKSGAELLSVATDDDNKCFGITFRTPPSDSTGVPHILE  236

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKY  K PFV+LL+GSL TFLNAFTYPDRTCY VAS NTKDFYNL++VY DAV
Sbjct  237  HSVLCGSRKYKTKDPFVQLLQGSLQTFLNAFTYPDRTCYVVASQNTKDFYNLINVYSDAV  296

Query  632  F  634
            F
Sbjct  297  F  297



>ref|WP_035066446.1| peptidase M16 [Desulfovibrio termitidis]
Length=971

 Score =   186 bits (473),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ V E+ V E  SR  L++H  TGA+++S  N DENKVFG+ FRTPP +STG+ HILE
Sbjct  5    GFDLVFERTVHELNSRIRLWRHGATGAQLLSCCNADENKVFGVTFRTPPSDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DF NLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASANLQDFRNLVDVYLDAV  124

Query  632  FF  637
            FF
Sbjct  125  FF  126



>gb|EYU37693.1| hypothetical protein MIMGU_mgv1a000907mg [Erythranthe guttata]
Length=946

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +2

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSVSNDDENKVFGI  RTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  1    MSVSNDDENKVFGIVLRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  60

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF
Sbjct  61   AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  93



>ref|WP_015335587.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
hydrothermalis]
 ref|YP_007325083.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
hydrothermalis AM13 = DSM 14728]
 emb|CCO22982.1| Presequence protease 1, chloroplastic/mitochondrial [Desulfovibrio 
hydrothermalis AM13 = DSM 14728]
Length=961

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+++S +++ E    AV+Y+H+KTG  ++SV N+DENK FGI FRTPP+NSTG+PHILE
Sbjct  6    GFKEISREYLTELNGEAVIYEHEKTGGRVLSVINNDENKTFGISFRTPPENSTGLPHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVELLK SL TFLNA TYPD+T YPVAS N +DF NLV VYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKCSLQTFLNAMTYPDKTVYPVASPNEQDFRNLVGVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_012765630.1| peptidase M16 [Desulfovibrio salexigens]
 gb|ACS78104.1| Peptidase M16C associated domain protein [Desulfovibrio salexigens 
DSM 2638]
Length=961

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+++S ++++E    AV+Y+H+KTG  ++SV N+DENK FGI FRTPP+NSTG+PHILE
Sbjct  6    GFKEISREYLNELNGEAVIYEHEKTGGRVLSVINNDENKTFGISFRTPPENSTGLPHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS+KYP+K+PFVELLK SL TFLNA TYPD+T YPVAS N +DF NLV VYLDAV
Sbjct  66   HSVLCGSKKYPVKEPFVELLKCSLQTFLNAMTYPDKTVYPVASPNEQDFRNLVGVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_046109512.1| peptidase M16 [Devosia geojensis]
 gb|KKB10944.1| peptidase M16 [Devosia geojensis]
Length=969

 Score =   186 bits (471),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             F+ V E+ + E  S A  Y+H+KTGAE++S+ NDDENKVFGI F+TPP +STGI HILE
Sbjct  6    AFDLVREETIPEVNSLARHYRHRKTGAEVVSLVNDDENKVFGITFKTPPDDSTGIAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+KKPFVEL+KGS++TFLNA T+PD+T YPVAS N  DFYNLVDVYLD+V
Sbjct  66   HSVLCGSRKYPVKKPFVELIKGSMHTFLNAMTFPDKTAYPVASQNLADFYNLVDVYLDSV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_035042323.1| peptidase M16 [Desulfovibrio sp. X2]
Length=967

 Score =   185 bits (470),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  + E+ V E +S A +Y+H  TGA ++SV   DENKVFGI FRTPP++STG+ HILE
Sbjct  5    GFTLLREENVPEIQSTARIYRHDATGARLLSVIAPDENKVFGIAFRTPPRDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  65   HSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASANLQDFYNLVDVYLDAV  124

Query  632  FF  637
            F+
Sbjct  125  FY  126



>gb|EPR39784.1| Peptidase M16C associated domain protein [Desulfovibrio sp. X2]
Length=966

 Score =   185 bits (470),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  + E+ V E +S A +Y+H  TGA ++SV   DENKVFGI FRTPP++STG+ HILE
Sbjct  4    GFTLLREENVPEIQSTARIYRHDATGARLLSVIAPDENKVFGIAFRTPPRDSTGVAHILE  63

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  64   HSVLCGSRKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASANLQDFYNLVDVYLDAV  123

Query  632  FF  637
            F+
Sbjct  124  FY  125



>ref|WP_029435916.1| peptidase M16 [Bilophila wadsworthia]
Length=965

 Score =   185 bits (470),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  V E+ + E      L++H  TGAE++S+ N+DENK FG  FRTPPK+STG+ HILE
Sbjct  5    GFSLVREERLSEVSGTVKLWRHDATGAELLSIVNNDENKCFGATFRTPPKDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLQDFYNLVDVYLDAV  124

Query  632  FF  637
            FF
Sbjct  125  FF  126



>ref|WP_045511667.1| peptidase M16 [bacterium UASB14]
 dbj|GAK53338.1| peptidase M16C associated domain protein [bacterium UASB14]
Length=972

 Score =   185 bits (470),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  + +Q + E  +RA L++H K+GAE++SV N DENK FGI FRTPP +STG+ HI+E
Sbjct  6    GFTLIKDQTIPELNARAKLFRHDKSGAELLSVENSDENKAFGISFRTPPADSTGVAHIME  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVEL+KGSLNTFLNA T+PD+T YPVAS N KD Y+L+DVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELMKGSLNTFLNAMTFPDKTSYPVASQNVKDLYHLIDVYLDAV  125

Query  632  FF  637
            F+
Sbjct  126  FY  127



>ref|WP_005028290.1| peptidase M16 [Bilophila wadsworthia]
 gb|EFV43748.1| hypothetical protein HMPREF0179_02440 [Bilophila wadsworthia 
3_1_6]
Length=965

 Score =   185 bits (469),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  V E+ + E      L++H  TGAE++S+ N+DENK FG  FRTPPK+STG+ HILE
Sbjct  5    GFSLVREERLSEVSGTVKLWRHDATGAELLSIVNNDENKCFGATFRTPPKDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLQDFYNLVDVYLDAV  124

Query  632  FF  637
            FF
Sbjct  125  FF  126



>ref|WP_028319851.1| peptidase M16 [Desulfatiglans anilini]
Length=972

 Score =   185 bits (469),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + E+ + E K+   +Y+H +TGA+++ + N+DENKVFGI FRTPP +STG+PHILE
Sbjct  6    GFELIHERDIHEIKTHGRMYEHTRTGAKLLYLLNEDENKVFGITFRTPPADSTGLPHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYPLK+PFVELLKGSL TFLNAFTYPDRTCYPVAS N +DF NL+DVYLDAV
Sbjct  66   HSVLCGSRKYPLKEPFVELLKGSLQTFLNAFTYPDRTCYPVASQNRQDFLNLIDVYLDAV  125

Query  632  F  634
             
Sbjct  126  L  126



>ref|WP_027185458.1| hypothetical protein [Desulfovibrio inopinatus]
Length=965

 Score =   185 bits (469),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            G+E + ++ + E  + A+  +H  TGAEI+S+   DENKVFG+ F+TPP +STG+ HILE
Sbjct  6    GYEVIRQEHIAEYAADALYCRHIVTGAEILSIQCADENKVFGVSFKTPPSDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVELLKGSLNTFLNAFTYPD+TCYPVAS N +DFYNL+DVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKGSLNTFLNAFTYPDKTCYPVASANEEDFYNLIDVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_009380390.1| peptidase M16 [Bilophila sp. 4_1_30]
 gb|EGW45410.1| hypothetical protein HMPREF0178_01889 [Bilophila sp. 4_1_30]
Length=965

 Score =   185 bits (469),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  V E+ + E      L++H  TGAE++S+ N+DENK FG  FRTPPK+STG+ HILE
Sbjct  5    GFSLVREERLSEVSGTVKLWRHDATGAELLSIVNNDENKCFGATFRTPPKDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLQDFYNLVDVYLDAV  124

Query  632  FF  637
            FF
Sbjct  125  FF  126



>ref|WP_010938240.1| peptidase M16 [Desulfovibrio vulgaris]
 ref|YP_010162.1| M16 family peptidase [Desulfovibrio vulgaris str. Hildenborough]
 gb|AAS95421.1| peptidase, M16 family [Desulfovibrio vulgaris str. Hildenborough]
 gb|ADP86034.1| Peptidase M16C associated domain protein [Desulfovibrio vulgaris 
RCH1]
Length=964

 Score =   184 bits (468),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + E  ++E  SR   ++H  TGA+++S  N DENKVFG+ FRTPP +STG+ HILE
Sbjct  5    GFELIDETNLEELSSRVRRWRHVVTGAQLLSFCNADENKVFGVSFRTPPGDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS +YP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DF NLVDVYLDAV
Sbjct  65   HSVLCGSERYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLQDFRNLVDVYLDAV  124

Query  632  FF  637
            FF
Sbjct  125  FF  126



>ref|WP_011792619.1| peptidase M16 [Desulfovibrio vulgaris]
 gb|ABM29060.1| pre-sequence protease, Metallo peptidase, MEROPS family M16C 
[Desulfovibrio vulgaris DP4]
Length=964

 Score =   184 bits (468),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + E  ++E  SR   ++H  TGA+++S  N DENKVFG+ FRTPP +STG+ HILE
Sbjct  5    GFELIDETNLEELSSRVRRWRHVVTGAQLLSFCNADENKVFGVSFRTPPGDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS +YP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +DF NLVDVYLDAV
Sbjct  65   HSVLCGSERYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNLQDFRNLVDVYLDAV  124

Query  632  FF  637
            FF
Sbjct  125  FF  126



>gb|EPS67763.1| hypothetical protein M569_07010, partial [Genlisea aurea]
Length=947

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +2

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MS+SNDDENKVFG+ FRTPPK+STGIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  1    MSLSNDDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  60

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
            AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF+
Sbjct  61   AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFY  93



>ref|WP_029896470.1| peptidase M16 [Desulfovibrio sp. L21-Syr-AB]
Length=973

 Score =   184 bits (468),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 83/121 (69%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  + E+ + E ++ A LY+H KTGA ++S++NDDENKVFG  FRTPP++STG+ HILE
Sbjct  5    GFSLLREEEISEYQTVARLYRHDKTGARVLSLANDDENKVFGAAFRTPPRDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL+GSRKYP+K+PFVELLKGSL TFLNAFT+PD+TCYPV+S N +DF NLVDVYLDA 
Sbjct  65   HSVLNGSRKYPVKEPFVELLKGSLKTFLNAFTFPDKTCYPVSSCNLQDFRNLVDVYLDAA  124

Query  632  F  634
            F
Sbjct  125  F  125



>ref|WP_027720526.1| peptidase M16 [Desulfovibrio zosterae]
Length=961

 Score =   184 bits (467),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF ++S +++ E    AV+YKH KTG  ++S+ N+DENK FGI FRTPP+NSTG+PHILE
Sbjct  6    GFIEISREYLTELNGEAVIYKHAKTGGRLLSIINNDENKTFGISFRTPPENSTGLPHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVELLK SL TFLNA TYPD+T YPVAS N +DF NLV VYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKCSLQTFLNAMTYPDKTVYPVASPNEQDFRNLVGVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_006007833.1| peptidase M16 [Desulfovibrio piger]
 gb|EEB32816.1| peptidase M16 inactive domain protein [Desulfovibrio piger ATCC 
29098]
Length=971

 Score =   184 bits (467),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE V+E+ + E    A L+KH  TGA+++SVSN DENK FG+ FRTPP +STG+ HILE
Sbjct  5    GFELVTERRLHEVGGTARLWKHSVTGAQLLSVSNADENKCFGVSFRTPPTDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNL+DVY+DAV
Sbjct  65   HSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLQDFYNLIDVYIDAV  124

Query  632  F  634
            F
Sbjct  125  F  125



>ref|WP_027178402.1| peptidase M16 [Desulfovibrio bastinii]
Length=960

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF++VS + + E    AV+Y+H KTG  ++S+ N DENK FGI FRTPP+NSTG+ HILE
Sbjct  6    GFKEVSREKLAEVGGDAVVYEHIKTGGRVLSIINADENKTFGISFRTPPENSTGLAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVELLKGSL TFLNA T+PD+T YPVAS N +DFYNLVDVYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKGSLQTFLNAMTFPDKTVYPVASPNVQDFYNLVDVYLDAV  125

Query  632  F  634
            F
Sbjct  126  F  126



>ref|WP_028573857.1| peptidase M16 [Desulfonatronovibrio hydrogenovorans]
Length=971

 Score =   183 bits (464),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  284  VSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVL  463
            + E+ + E  SRA L++HKKTGA ++S++N DENKVF I+FRTPPK++TG+PHILEHSVL
Sbjct  10   IEERDISEINSRARLFEHKKTGARVLSLTNQDENKVFSINFRTPPKDNTGVPHILEHSVL  69

Query  464  SGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
             GSRKY +K+PFVELLK SL TFLNA T+PD+TCYPVAS N +DFYNL+DVYLD+VFF
Sbjct  70   CGSRKYKVKEPFVELLKSSLQTFLNAVTFPDKTCYPVASQNLQDFYNLMDVYLDSVFF  127



>ref|WP_007523808.1| peptidase M16 [Desulfovibrio sp. A2]
 gb|EGY26196.1| presequence protease 1 [Desulfovibrio sp. A2]
Length=968

 Score =   183 bits (464),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ V E+ V E  SR  L++H  T A+++S  N DENKVFG+ FRTPP +STG+ HILE
Sbjct  5    GFDLVFERTVHELNSRIRLWRHGATSAQLLSCCNADENKVFGVTFRTPPADSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DF NLVDVYLDAV
Sbjct  65   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASANLQDFRNLVDVYLDAV  124

Query  632  FF  637
            FF
Sbjct  125  FF  126



>ref|WP_012623989.1| peptidase M16 [Desulfovibrio desulfuricans]
 gb|ACL48259.1| Peptidase M16C associated domain protein [Desulfovibrio desulfuricans 
subsp. desulfuricans str. ATCC 27774]
Length=970

 Score =   183 bits (464),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 81/121 (67%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  ++EQ + E    A L++H+ TGA+++S+SN DENK FG+ FRTPP +STG+ HILE
Sbjct  5    GFTLITEQQLREVDGTARLWRHEATGAQMLSISNTDENKCFGVSFRTPPTDSTGVAHILE  64

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNL+DVY+DAV
Sbjct  65   HSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASCNLRDFYNLIDVYIDAV  124

Query  632  F  634
            F
Sbjct  125  F  125



>ref|XP_005761276.1| peptidase M16 [Emiliania huxleyi CCMP1516]
 gb|EOD08847.1| peptidase M16 [Emiliania huxleyi CCMP1516]
Length=1043

 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             FE V  + VDE   +   Y+H+++GAE++S   DDENKVFGI FRTP ++STG+PHILE
Sbjct  68   AFELVRVEMVDEYTIKVATYRHRQSGAEVISAQADDENKVFGIAFRTPVEDSTGVPHILE  127

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KY  K+PF ELLKGSL TFLNAFTYPDRTCYPVAS NTKDFYNLV+VYLDAV
Sbjct  128  HSVLCGSAKYTSKEPFTELLKGSLQTFLNAFTYPDRTCYPVASCNTKDFYNLVNVYLDAV  187

Query  632  F  634
             
Sbjct  188  L  188



>ref|WP_027187627.1| peptidase M16 [Desulfovibrio cuneatus]
Length=964

 Score =   182 bits (463),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  V E  + E  S A L++H+KT A ++S +N DENKVFG+ FRTPP +STG+ HILE
Sbjct  6    GFSLVEETHIAELDSTARLWRHEKTQAVLLSFTNTDENKVFGVSFRTPPPDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVAS N +DF NL DVYLDAV
Sbjct  66   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASCNLRDFRNLTDVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_016483219.1| pre-sequence protease. Metallo peptidase. MEROPS family M16C 
[Chthonomonas calidirosea]
 emb|CCW35694.1| pre-sequence protease. Metallo peptidase. MEROPS family M16C 
[Chthonomonas calidirosea T49]
Length=971

 Score =   182 bits (463),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GFE + EQ + E  S A LY+H+KTGA  +S+ NDDENK FGI+FRTP  +STG+ HILE
Sbjct  6    GFELIREQNIPEINSLARLYRHEKTGALFLSLINDDENKSFGINFRTPVSDSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PF+EL K SLNTFLNAFTYPD+TCYPVAS N +DFYNL+DVYLD V
Sbjct  66   HSVLCGSRKYPVKEPFIELAKSSLNTFLNAFTYPDKTCYPVASQNLQDFYNLIDVYLDTV  125

Query  632  F  634
            F
Sbjct  126  F  126



>ref|WP_035377087.1| peptidase M16 [Fervidicella metallireducens]
 gb|EYE89773.1| peptidase M16 [Fervidicella metallireducens AeB]
Length=975

 Score =   182 bits (462),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  + E+ + E  S A L+ H+K+GA ++ +SNDD+NKVF I FRTPP+NSTG+PHILE
Sbjct  11   GFRLLEEKDLKEINSTARLFSHEKSGARLLYISNDDDNKVFSISFRTPPENSTGLPHILE  70

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRK+P+K+PFVEL+KGSLNTFLNA TYPD+T YPVAS N+KDF NL+DVYLDAV
Sbjct  71   HSVLCGSRKFPVKEPFVELVKGSLNTFLNAMTYPDKTMYPVASKNSKDFINLMDVYLDAV  130

Query  632  FF  637
            F+
Sbjct  131  FY  132



>ref|XP_005782033.1| peptidase M16 [Emiliania huxleyi CCMP1516]
 gb|EOD29604.1| peptidase M16 [Emiliania huxleyi CCMP1516]
Length=1096

 Score =   182 bits (463),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             FE V  + VDE   +   Y+H+++GAE++S   DDENKVFGI FRTP ++STG+PHILE
Sbjct  68   AFELVRVEMVDEYTIKVATYRHRQSGAEVISAQADDENKVFGIAFRTPVEDSTGVPHILE  127

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KY  K+PF ELLKGSL TFLNAFTYPDRTCYPVAS NTKDFYNLV+VYLDAV
Sbjct  128  HSVLCGSAKYTSKEPFTELLKGSLQTFLNAFTYPDRTCYPVASCNTKDFYNLVNVYLDAV  187

Query  632  F  634
             
Sbjct  188  L  188



>ref|WP_025577207.1| peptidase M16 [Blautia wexlerae]
Length=974

 Score =   182 bits (461),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E V+E+ + +  S   L +HKKTGA +M + NDDENKVF I FRTPPK+STG+ HILE
Sbjct  8    AYEVVTEENLTDIHSTGWLLRHKKTGARVMLIENDDENKVFNIAFRTPPKDSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N KDF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDKDFQNLMHVYLDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|WP_033333819.1| hypothetical protein, partial [Nitrospina sp. AB-629-B06]
Length=162

 Score =   169 bits (427),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            F+ +  + + E  S A+L+ H KTGAE++ + NDD+NKVF   F+TPP N  G+ HILEH
Sbjct  12   FQLLQRESISELNSLALLFTHLKTGAEVLVIENDDDNKVFSATFKTPPSNDRGVAHILEH  71

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYP+K+PF+ELLKGSL TFLNA T+PD+T YPVAS N KDF+NL+DVYLDAVF
Sbjct  72   SVLCGSRKYPVKEPFLELLKGSLQTFLNAMTFPDKTMYPVASRNKKDFFNLMDVYLDAVF  131

Query  635  F  637
            +
Sbjct  132  Y  132



>ref|WP_026649281.1| peptidase M16 [Blautia wexlerae]
Length=974

 Score =   182 bits (461),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E V+E+ + +  S   L +HKKTGA +M + NDDENKVF I FRTPPK+STG+ HILE
Sbjct  8    AYEVVTEENLTDIHSTGWLLRHKKTGARVMLIENDDENKVFNIAFRTPPKDSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N KDF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDKDFQNLMHVYLDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|WP_020993684.1| MULTISPECIES: hypothetical protein [Ruminococcus]
 emb|CDD77514.1| putative uncharacterized protein [Ruminococcus sp. CAG:9]
 gb|EES75839.2| hypothetical protein RSAG_03026 [Ruminococcus sp. 5_1_39BFAA]
Length=974

 Score =   181 bits (460),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E V+E+ + +  S   L +HKKTGA +M + NDDENKVF I FRTPPK+STG+ HILE
Sbjct  8    AYEVVTEENLTDIHSTGWLLRHKKTGARVMLIENDDENKVFNIAFRTPPKDSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N KDF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDKDFQNLMHVYLDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|WP_021760305.1| putative peptidase M16C [Desulfovibrio gigas]
 gb|AGW13456.1| putative peptidase M16C [Desulfovibrio gigas DSM 1382 = ATCC 
19364]
Length=987

 Score =   181 bits (460),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF    E  + E  +   L++H+KTGA  +S+ N D+NKVF + FRTPPK+STG+ HILE
Sbjct  9    GFVLEREATLQEYHTVVHLWRHQKTGARYLSLCNKDDNKVFAVTFRTPPKDSTGVAHILE  68

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVEL+KGSL TFLNAFTYPD+TCYPVAST+ KDFYNL+DVYLDAV
Sbjct  69   HSVLCGSRKYPVKEPFVELMKGSLQTFLNAFTYPDKTCYPVASTHAKDFYNLMDVYLDAV  128

Query  632  FF  637
            FF
Sbjct  129  FF  130



>ref|WP_022657642.1| peptidase M16 [Desulfovibrio desulfuricans]
Length=970

 Score =   181 bits (460),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 79/123 (64%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +2

Query  266  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHI  445
            K GF  ++EQ + E    A L++H+ TGA+++S++N DENK FG++FRTPP +STG+ HI
Sbjct  3    KHGFTLLTEQHLHEVDGTARLWRHEATGAQLLSINNSDENKCFGVNFRTPPADSTGVAHI  62

Query  446  LEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  625
            LEHSVL GS KYP+K+PFVEL+KGSL TFLNAFT+PD+TCYP+AS N +DFYNL+DVY+D
Sbjct  63   LEHSVLCGSDKYPVKEPFVELMKGSLQTFLNAFTFPDKTCYPIASCNLRDFYNLIDVYID  122

Query  626  AVF  634
            AVF
Sbjct  123  AVF  125



>ref|WP_043643858.1| peptidase M16 [Desulfovibrio putealis]
Length=969

 Score =   181 bits (460),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 83/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  257  VARKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGI  436
            ++ K GF  + E  ++E   +A LY+H++TGAE++S+ + D+NKVFG   RTPP +STG+
Sbjct  1    MSAKHGFSLIHEGPIEEYAIQARLYRHERTGAELLSIISPDDNKVFGAALRTPPTDSTGL  60

Query  437  PHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDV  616
            PHILEHSVL GSR+YP+K+PFVELLK SL TFLNAFTYPD+TCYPVAS N  DFYNLVDV
Sbjct  61   PHILEHSVLCGSRRYPVKEPFVELLKSSLQTFLNAFTYPDKTCYPVASANLADFYNLVDV  120

Query  617  YLDAVFF  637
            YLDAVF+
Sbjct  121  YLDAVFY  127



>ref|XP_002177646.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC50460.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=986

 Score =   181 bits (459),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 83/120 (69%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            ++ V +  VDE  +   LY+HKK+GAE++SV+ DD+NKVFGI FRTPP++STG+PHILEH
Sbjct  1    YDVVEKDVVDEYGAYCTLYRHKKSGAELLSVAVDDDNKVFGITFRTPPEDSTGVPHILEH  60

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKY  K PFV+LL+GSL TFLNAFTYPDRTCY VAS NTKDFYNL++VY DAV+
Sbjct  61   SVLCGSRKYKTKDPFVQLLQGSLQTFLNAFTYPDRTCYVVASQNTKDFYNLINVYADAVY  120



>ref|WP_014129848.1| peptidase M16 [Pelagibacterium halotolerans]
 gb|AEQ50699.1| peptidase M16C associated domain protein [Pelagibacterium halotolerans 
B2]
Length=967

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             FE ++E+ + E  + A  Y+H KTGAE++S+ NDDENKVFGI F TPP++STG+PHILE
Sbjct  6    AFELIAEEKISEVNALARHYRHNKTGAEVLSLINDDENKVFGISFATPPEDSTGLPHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS K+P+KKPFVE+LKGSL+TFLNA T+PD+T YPVAS N  DFYNL  VY+DAV
Sbjct  66   HSVLCGSEKFPVKKPFVEMLKGSLHTFLNAMTFPDKTVYPVASQNLADFYNLTQVYMDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>emb|CCJ33994.1| Protein hypA [Caloramator australicus RC3]
Length=362

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  +  + + E  S+A +++H+K+GA ++ + NDD+NKVF I FRTPP +STG+PHI+E
Sbjct  9    GFRLLEIRDIKEINSKAYIFEHEKSGARLLKIHNDDDNKVFSISFRTPPSDSTGVPHIIE  68

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRK+P+K+PFVEL+KGSL TFLNA TYPD+T YPVAS N KDF+NL+DVYLDAV
Sbjct  69   HSVLCGSRKFPVKEPFVELIKGSLQTFLNAMTYPDKTMYPVASKNEKDFFNLMDVYLDAV  128

Query  632  FF  637
            F+
Sbjct  129  FY  130



>ref|WP_019161133.1| peptidase M16 [Ruminococcus sp. JC304]
Length=974

 Score =   181 bits (459),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E + E+ + +  SR  L +HKKTGA +M + NDDENKVF I FRTPPK+STG+ HILE
Sbjct  8    AYEVIMEENLTDIHSRGWLLRHKKTGARVMLIENDDENKVFNIAFRTPPKDSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDQDFQNLMHVYLDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|WP_009302747.1| peptidase M16 [Desulfovibrio sp. 6_1_46AFAA]
 gb|EGW51202.1| hypothetical protein HMPREF1022_01681 [Desulfovibrio sp. 6_1_46AFAA]
Length=970

 Score =   181 bits (458),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 82/123 (67%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  266  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHI  445
            K GF  ++E+ + E    A L++HK TGA+++SV N DENK FG+ FRTPP +STG+ HI
Sbjct  3    KHGFTLLTERDMAEVGGTARLWQHKITGAQLLSVVNADENKCFGVSFRTPPTDSTGVAHI  62

Query  446  LEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  625
            LEHSVL GS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNL+DVY+D
Sbjct  63   LEHSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLRDFYNLIDVYID  122

Query  626  AVF  634
            AVF
Sbjct  123  AVF  125



>ref|WP_008683425.1| peptidase M16 [Desulfovibrio sp. 3_1_syn3]
 gb|EFL87313.1| hypothetical protein HMPREF0326_01089 [Desulfovibrio sp. 3_1_syn3]
Length=970

 Score =   181 bits (458),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 82/123 (67%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  266  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHI  445
            K GF  ++E+ + E    A L++HK TGA+++SV N DENK FG+ FRTPP +STG+ HI
Sbjct  3    KHGFTLLTERDMAEVGGTARLWQHKITGAQLLSVVNADENKCFGVSFRTPPTDSTGVAHI  62

Query  446  LEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  625
            LEHSVL GS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNL+DVY+D
Sbjct  63   LEHSVLCGSDKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLRDFYNLIDVYID  122

Query  626  AVF  634
            AVF
Sbjct  123  AVF  125



>ref|WP_017751909.1| hypothetical protein [Clostridium tyrobutyricum]
Length=973

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ V ++ ++E  S  ++++HKK+GA +  + NDD+NKVF I FRTPP+NS GIPHILE
Sbjct  9    GFKFVEKKNINELNSIGMIFQHKKSGARLFFLKNDDDNKVFAISFRTPPENSEGIPHILE  68

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRK+P+K+PFVEL+KGSLNTFLNAFT+PD+T YPVAS N KDF NL+DVYLDAV
Sbjct  69   HSVLCGSRKFPVKEPFVELIKGSLNTFLNAFTFPDKTMYPVASMNDKDFTNLIDVYLDAV  128

Query  632  FF  637
            F+
Sbjct  129  FY  130



>ref|WP_017895385.1| hypothetical protein [Clostridium tyrobutyricum]
 emb|CDL91770.1| Protein hypA [Clostridium tyrobutyricum DIVETGP]
Length=973

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ V ++ ++E  S  ++++HKK+GA +  + NDD+NKVF I FRTPP+NS GIPHILE
Sbjct  9    GFKFVEKKNINELNSIGMIFQHKKSGARLFFLKNDDDNKVFAISFRTPPENSEGIPHILE  68

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRK+P+K+PFVEL+KGSLNTFLNAFT+PD+T YPVAS N KDF NL+DVYLDAV
Sbjct  69   HSVLCGSRKFPVKEPFVELIKGSLNTFLNAFTFPDKTMYPVASMNDKDFTNLIDVYLDAV  128

Query  632  FF  637
            F+
Sbjct  129  FY  130



>ref|XP_005706792.1| Zn-dependent peptidase [Galdieria sulphuraria]
 gb|EME30272.1| Zn-dependent peptidase [Galdieria sulphuraria]
Length=1090

 Score =   181 bits (458),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 83/121 (69%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            F+ V E+++ +  S    Y H  TGA++MSV N +ENK FG+ FRTPP NS G PHILEH
Sbjct  111  FQLVQEEYIPDIDSIIRKYVHTHTGAQLMSVLNKEENKTFGVVFRTPPSNSRGTPHILEH  170

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSRKYP+K+PFVEL+K SLNTFLNAFT+PD+TCYPVAS N KDFYNLVDVYLDAVF
Sbjct  171  SVLCGSRKYPVKEPFVELMKSSLNTFLNAFTFPDKTCYPVASCNLKDFYNLVDVYLDAVF  230

Query  635  F  637
            +
Sbjct  231  Y  231



>ref|WP_020887440.1| Peptidase M16C associated domain protein [Desulfovibrio alkalitolerans]
 gb|EPR32391.1| Peptidase M16C associated domain protein [Desulfovibrio alkalitolerans 
DSM 16529]
Length=964

 Score =   180 bits (456),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 82/121 (68%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  + E+ + E +++A++Y+H  TGA ++SV+  DENKVFGI FRTPP++STG+ HILE
Sbjct  4    GFTLLREEDIPEIQAKALIYRHDATGARLLSVAAPDENKVFGIAFRTPPRDSTGVAHILE  63

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS KYP+K+PFVELLKGSL TFLNAFTYPD+TCYPVASTN +D  NL+DVYLDAV
Sbjct  64   HSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTYPDKTCYPVASTNGQDLTNLIDVYLDAV  123

Query  632  F  634
            F
Sbjct  124  F  124



>ref|WP_027369289.1| peptidase M16 [Desulfovermiculus halophilus]
Length=970

 Score =   179 bits (455),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 81/125 (65%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  263  RKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPH  442
            + +GFE V +  + E +  A LY++ + GAE+++V NDDENKV GI FRTPPK+STG+ H
Sbjct  2    KDIGFELVWQARIPEIQGLARLYRYSRNGAEVLAVENDDENKVAGIAFRTPPKDSTGVAH  61

Query  443  ILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYL  622
            ILEHSVL GSRKYP+K+PFVELLKGS+ TFLNA T+PD+TCYPVAS N++D  NL+DVYL
Sbjct  62   ILEHSVLCGSRKYPVKEPFVELLKGSVQTFLNAMTFPDKTCYPVASQNSQDLQNLLDVYL  121

Query  623  DAVFF  637
            DA FF
Sbjct  122  DAAFF  126



>emb|CCY32009.1| putative uncharacterized protein [Ruminococcus sp. CAG:60]
Length=974

 Score =   179 bits (455),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E V+++ + +  S   + +HKKTGA ++ + NDDENKVF I FRTPP NSTG+PHILE
Sbjct  8    AYEIVTQENLTDIHSTGYMLRHKKTGARLILIENDDENKVFSIAFRTPPANSTGVPHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDQDFQNLMHVYLDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>gb|AKA71691.1| Peptidase M16C associated domain protein [Clostridium scatologenes]
Length=975

 Score =   179 bits (454),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ V ++ ++E  S  +L++H+K+GA +  + N+D+NKVF I FRTPPK+STG+PHILE
Sbjct  11   GFKLVEKKDINEINSTGILFEHEKSGARLFYLKNEDDNKVFSISFRTPPKDSTGVPHILE  70

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRK+PLK+PFVEL+KGS+NTFLNAFT+PD+T YPVAS N KDF NL++VYLDAV
Sbjct  71   HSVLCGSRKFPLKEPFVELIKGSMNTFLNAFTFPDKTMYPVASRNNKDFLNLMNVYLDAV  130

Query  632  FF  637
            F+
Sbjct  131  FY  132



>ref|WP_032078808.1| peptidase M16 [Clostridium drakei]
Length=975

 Score =   179 bits (454),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ V ++ ++E  S  +L++H+K+GA +  + N+D+NKVF I FRTPPK+STG+PHILE
Sbjct  11   GFKLVEKKDINEINSTGILFEHEKSGARLFYLKNEDDNKVFSISFRTPPKDSTGVPHILE  70

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRK+PLK+PFVEL+KGS+NTFLNAFT+PD+T YPVAS N KDF NL++VYLDAV
Sbjct  71   HSVLCGSRKFPLKEPFVELIKGSMNTFLNAFTFPDKTMYPVASRNNKDFLNLMNVYLDAV  130

Query  632  FF  637
            F+
Sbjct  131  FY  132



>ref|WP_044943560.1| peptidase M16 [Blautia schinkii]
Length=974

 Score =   179 bits (454),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 82/125 (66%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  263  RKLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPH  442
            R   +E + ++ + +  S   L +HKKTGA +M + NDDENKVF I FRTPP NSTG+PH
Sbjct  5    RLSAYEIIKQENLADIHSAGWLLRHKKTGARVMLIENDDENKVFNIAFRTPPMNSTGVPH  64

Query  443  ILEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYL  622
            ILEHSVL GS+++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYL
Sbjct  65   ILEHSVLCGSKEFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNEQDFQNLMHVYL  124

Query  623  DAVFF  637
            DAVFF
Sbjct  125  DAVFF  129



>ref|WP_028588391.1| peptidase M16 [Desulfocurvus vexinensis]
Length=964

 Score =   179 bits (453),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF  + EQ + E    A LY H +TGA+++SV+  DENKVFG+  RTPP +STG+ HILE
Sbjct  6    GFSLLREQEIAEAGCTARLYCHDRTGAQLVSVACPDENKVFGVTLRTPPADSTGVAHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSR+YP+K+PFVELLKGSL+TFLNAFTYPD+TCYPVASTN  DF NLVDVYLDAV
Sbjct  66   HSVLCGSRRYPVKEPFVELLKGSLHTFLNAFTYPDKTCYPVASTNLADFRNLVDVYLDAV  125

Query  632  F  634
            F
Sbjct  126  F  126



>ref|WP_018702572.1| hypothetical protein [Anaeromusa acidaminophila]
Length=970

 Score =   179 bits (453),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  266  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHI  445
            K GF  ++ Q V E  S+A  Y+H+++GA ++ + NDD+NKVF I F+TPP + TG+PHI
Sbjct  4    KSGFRLIATQTVAELASKAYTYEHEQSGARLVYLENDDDNKVFSITFKTPPADHTGVPHI  63

Query  446  LEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  625
            LEHSVL GSRK+PLK+PFVEL+KGSLNTFLNA T+PD+T YPVAS N KDF NL+DVYLD
Sbjct  64   LEHSVLCGSRKFPLKEPFVELIKGSLNTFLNAMTFPDKTMYPVASQNDKDFRNLMDVYLD  123

Query  626  AVFF  637
            AVFF
Sbjct  124  AVFF  127



>ref|WP_027938345.1| peptidase M16 [Anaeroarcus burkinensis]
Length=970

 Score =   179 bits (453),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  266  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHI  445
            K GF  ++ Q V E  S+A  Y+H+++GA ++ + NDD+NKVF I F+TPP + TG+PHI
Sbjct  4    KSGFRLIATQTVAELASKAYTYEHEQSGARLVYLENDDDNKVFSITFKTPPADHTGVPHI  63

Query  446  LEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  625
            LEHSVL GSRK+PLK+PFVEL+KGSLNTFLNA T+PD+T YPVAS N KDF NL+DVYLD
Sbjct  64   LEHSVLCGSRKFPLKEPFVELIKGSLNTFLNAMTFPDKTMYPVASQNDKDFRNLMDVYLD  123

Query  626  AVFF  637
            AVFF
Sbjct  124  AVFF  127



>ref|WP_007061507.1| peptidase M16 [Clostridium carboxidivorans]
 gb|EET86900.1| Peptidase M16C associated domain protein [Clostridium carboxidivorans 
P7]
 gb|EFG90000.1| peptidase M16C associated [Clostridium carboxidivorans P7]
Length=975

 Score =   179 bits (453),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ V ++ ++E  S  +L++H+K+GA +  + N+D+NKVF I FRTPPK+STG+PHILE
Sbjct  11   GFKLVEKKDINEINSTGILFEHEKSGARLFYLKNEDDNKVFSISFRTPPKDSTGVPHILE  70

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRK+PLK+PFVEL+KGS+NTFLNAFT+PD+T YPVAS N KDF NL++VYLDAV
Sbjct  71   HSVLCGSRKFPLKEPFVELIKGSMNTFLNAFTFPDKTMYPVASRNNKDFLNLMNVYLDAV  130

Query  632  FF  637
            F+
Sbjct  131  FY  132



>ref|WP_031481722.1| peptidase M16 [Desulfovibrio frigidus]
Length=961

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF ++S + + E     V+Y+H+KTG  ++SV N DENK FGI FRTPP +STG+PHILE
Sbjct  6    GFNEISRETLTELNGEVVIYEHEKTGGRVLSVINGDENKTFGISFRTPPADSTGLPHILE  65

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSRKYP+K+PFVELLK SL TFLNA TYPD+T YPVAS N +DF NLV VYLDAV
Sbjct  66   HSVLCGSRKYPVKEPFVELLKCSLQTFLNAMTYPDKTVYPVASPNEQDFRNLVGVYLDAV  125

Query  632  FF  637
            FF
Sbjct  126  FF  127



>ref|WP_011526733.1| peptidase M16 [Lawsonia intracellularis]
 emb|CAJ54704.1| predicted Zn-dependent peptidases, insulinase-like [Lawsonia 
intracellularis PHE/MN1-00]
 gb|AGC50071.1| M16 family peptidase [Lawsonia intracellularis N343]
Length=963

 Score =   179 bits (453),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 79/118 (67%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +2

Query  284  VSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVL  463
            + E  + E    A  ++H  T AEI+S+SN+DENK FG+ FRTPP +STG+ HILEHSVL
Sbjct  8    IREVKIPEVSGIAKYWRHNGTNAEILSISNNDENKCFGVTFRTPPHDSTGVAHILEHSVL  67

Query  464  SGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
             GS+KYP+K+PFVELLKGSL TFLNAFT+PD+TCYP+AS N +DFYNL+DVYLDAVFF
Sbjct  68   CGSKKYPIKEPFVELLKGSLQTFLNAFTFPDKTCYPIASANLQDFYNLIDVYLDAVFF  125



>ref|WP_021651012.1| peptidase M16 inactive domain protein [Blautia sp. KLE 1732]
 gb|ERI97649.1| peptidase M16 inactive domain protein [Blautia sp. KLE 1732]
Length=973

 Score =   178 bits (452),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E + E+ + +  S+  L +HKKTGA +M + N DENKVF I FRTPPKNSTG+ HILE
Sbjct  8    AYEVLKEEELQDIHSKGWLLRHKKTGARVMLIENSDENKVFNIAFRTPPKNSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDRDFQNLMHVYLDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|WP_022655669.1| peptidase M16 [Desulfovibrio sp. Dsv1]
Length=971

 Score =   178 bits (452),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  266  KLGFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHI  445
            K GF  ++E+ + E    A L++H+ TGA+++SV+N DENK FG+ FRTPP +STG+ HI
Sbjct  3    KHGFILLTERDMAEVGGTARLWRHRVTGAQLLSVTNADENKCFGVSFRTPPTDSTGVAHI  62

Query  446  LEHSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLD  625
            LEHSVL GS KYP+K+PFVELLKGSL TFLNAFT+PD+TCYPVAS N +DFYNLV VY+D
Sbjct  63   LEHSVLCGSEKYPVKEPFVELLKGSLQTFLNAFTFPDKTCYPVASANLRDFYNLVSVYID  122

Query  626  AVF  634
            AVF
Sbjct  123  AVF  125



>ref|WP_021720806.1| peptidase M16 inactive domain protein [Phascolarctobacterium 
succinatutens]
 emb|CDD10024.1| peptidase M16 inactive domain protein [Phascolarctobacterium 
succinatutens CAG:287]
Length=973

 Score =   178 bits (452),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF+ +  QFVDE  S+A + +H K+GA ++ ++NDD+NKVF I FRTPP + TG+ HILE
Sbjct  11   GFKVLQAQFVDEISSQAYIMEHIKSGARLLCLANDDDNKVFSISFRTPPADDTGVAHILE  70

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HS L GSRKYPLK+PFV+L+KGSLNTFLNA T+PD+T YPVAS N KDF+NL+DVYLDAV
Sbjct  71   HSSLCGSRKYPLKEPFVDLVKGSLNTFLNAMTFPDKTMYPVASRNDKDFHNLMDVYLDAV  130

Query  632  FF  637
            F+
Sbjct  131  FY  132



>emb|CBL19941.1| Predicted Zn-dependent peptidases, insulinase-like [Ruminococcus 
sp. SR1/5]
Length=973

 Score =   178 bits (452),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E + E+ + +  S+  L +HKKTGA +M + N DENKVF I FRTPPKNSTG+ HILE
Sbjct  8    AYEVLKEEELQDIHSKGWLLRHKKTGARVMLIENSDENKVFNIAFRTPPKNSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYP+AS N +DF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPIASCNDRDFQNLMHVYLDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|XP_002977652.1| hypothetical protein SELMODRAFT_152047 [Selaginella moellendorffii]
 gb|EFJ20990.1| hypothetical protein SELMODRAFT_152047 [Selaginella moellendorffii]
Length=959

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +2

Query  359  MSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVLSGSRKYPLKKPFVELLKGSLNTFLN  538
            MSV N+DENKVFGI FRTPPK+S GIPHILEHSVL GSRKYPLK+PFVELLKGSL+TFLN
Sbjct  1    MSVVNEDENKVFGIVFRTPPKDSKGIPHILEHSVLCGSRKYPLKEPFVELLKGSLHTFLN  60

Query  539  AFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            AFTYPDRTCYPVASTN KDFYNLVDVYLDAVF
Sbjct  61   AFTYPDRTCYPVASTNLKDFYNLVDVYLDAVF  92



>ref|WP_028988397.1| peptidase M16 [Thermicanus aegyptius]
Length=975

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF    + +V+E KS  +L++HKK+GA ++ + NDDENKVF I FRTPP +S G+PHILE
Sbjct  11   GFLLQKKAYVEEIKSEGLLFEHKKSGARLLVLLNDDENKVFSITFRTPPASSNGLPHILE  70

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL+GSRKYP+K+PFVEL KGSLNTFLNA TY D+T YPVAS N KDF NL+DVYLDAV
Sbjct  71   HSVLNGSRKYPVKEPFVELAKGSLNTFLNAMTYSDKTMYPVASMNDKDFRNLMDVYLDAV  130

Query  632  FF  637
            F+
Sbjct  131  FY  132



>ref|WP_027871447.1| peptidase M16 [[Eubacterium] cellulosolvens]
Length=977

 Score =   177 bits (450),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 77/121 (64%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            +E +S++F+++  +R +L +H+K+GA +  ++NDD NKVF I FRTPPKNSTG+ HI+EH
Sbjct  10   YEVISDEFIEDVHARGMLLRHRKSGARVALLANDDNNKVFNIAFRTPPKNSTGVAHIIEH  69

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            +VL GSRK+PLK PFVEL+KGSLNTFLNA TYPD+T +PVAS N +DF NL+DVYLDAVF
Sbjct  70   TVLCGSRKFPLKDPFVELVKGSLNTFLNAMTYPDKTMFPVASCNDQDFQNLMDVYLDAVF  129

Query  635  F  637
            +
Sbjct  130  Y  130



>ref|WP_004603088.1| peptidase M16 [[Eubacterium] cellulosolvens]
 gb|EIM56951.1| putative Zn-dependent peptidase, insulinase [ [[Eubacterium] 
cellulosolvens 6]
Length=977

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            ++ +S++F+++  +R VL +H+K+GA +  ++NDD NKVF I FRTPPKNSTG+ HI+EH
Sbjct  10   YDVISDEFIEDVHARGVLLRHRKSGARVALLANDDNNKVFNIAFRTPPKNSTGVAHIIEH  69

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            +VL GSRK+PLK PFVEL+KGSLNTFLNA TYPD+T +PVAS N +DF NL+DVYLDAVF
Sbjct  70   TVLCGSRKFPLKDPFVELVKGSLNTFLNAMTYPDKTMFPVASCNDQDFQNLMDVYLDAVF  129

Query  635  F  637
            +
Sbjct  130  Y  130



>ref|WP_006568065.1| peptidase M16 [Anaerostipes caccae]
 gb|EDR96737.1| peptidase M16 inactive domain protein [Anaerostipes caccae DSM 
14662]
Length=966

 Score =   177 bits (448),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 79/121 (65%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            +E V E+ + E      +Y+HKKTGA ++ VSN+D+NKVF I F+TPPK+ TG+PHI+EH
Sbjct  5    YELVKEEQIKELNGTGYVYRHKKTGARVVVVSNEDDNKVFQIGFKTPPKDDTGVPHIMEH  64

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF+NL+ VYLDAVF
Sbjct  65   SVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFFNLMHVYLDAVF  124

Query  635  F  637
            +
Sbjct  125  Y  125



>ref|WP_009290271.1| peptidase M16 [Anaerostipes sp. 3_2_56FAA]
 gb|EFV22064.1| peptidase [Anaerostipes sp. 3_2_56FAA]
Length=966

 Score =   176 bits (447),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 79/121 (65%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            +E V E+ + E      +Y+HKKTGA ++ VSN+D+NKVF I F+TPPK+ TG+PHI+EH
Sbjct  5    YELVKEEQIKELNGTGYVYRHKKTGARVVVVSNEDDNKVFQIGFKTPPKDDTGVPHIMEH  64

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF+NL+ VYLDAVF
Sbjct  65   SVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFFNLMHVYLDAVF  124

Query  635  F  637
            +
Sbjct  125  Y  125



>ref|WP_022261301.1| peptidase [Anaerostipes sp. CAG:276]
 emb|CDC34340.1| peptidase [Anaerostipes sp. CAG:276]
Length=965

 Score =   176 bits (447),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 79/121 (65%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            +E V E+ + E      +Y+HKKTGA ++ VSN+D+NKVF I F+TPPK+ TG+PHI+EH
Sbjct  4    YELVKEEQIKELNGTGYVYRHKKTGARVVVVSNEDDNKVFQIGFKTPPKDDTGVPHIMEH  63

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF+NL+ VYLDAVF
Sbjct  64   SVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFFNLMHVYLDAVF  123

Query  635  F  637
            +
Sbjct  124  Y  124



>ref|WP_022215422.1| peptidase M16 inactive domain protein [Blautia sp. CAG:237]
 emb|CDB77493.1| peptidase M16 inactive domain protein [Blautia sp. CAG:237]
Length=974

 Score =   176 bits (447),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 80/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E + ++ + + +S   L +H KTGA +M + NDDENKVF I FRTPPKNSTG+ HILE
Sbjct  8    AYEVIQKKKLTDIRSTGYLLRHIKTGARVMLIENDDENKVFNIAFRTPPKNSTGVAHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSR++PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAV
Sbjct  68   HSVLCGSREFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDQDFQNLMHVYLDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>emb|CBK80754.1| Predicted Zn-dependent peptidases, insulinase-like [Coprococcus 
catus GD/7]
Length=979

 Score =   176 bits (447),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E VS +++DE KS+A L +H+KTGA I  ++NDDENK F I FRTPPK+STG+ HI+E
Sbjct  11   AYEIVSLEYIDEIKSQAALLRHRKTGARIAVLANDDENKTFNIGFRTPPKDSTGVAHIME  70

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS K+P K PFVEL KGSLNTFLNA TYPD+T YP+AS N  DF NL+ VYLDAV
Sbjct  71   HSVLCGSEKFPAKDPFVELAKGSLNTFLNAMTYPDKTVYPIASCNDADFQNLMHVYLDAV  130

Query  632  F  634
            F
Sbjct  131  F  131



>emb|CBL23820.1| Predicted Zn-dependent peptidases, insulinase-like [Ruminococcus 
obeum A2-162]
Length=974

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +2

Query  284  VSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVL  463
            V ++ +++ +S   L++H KTGA +M++ NDDENKVF I FRTPPKNSTG+ HILEHSVL
Sbjct  12   VKKEKLNDIRSTGYLFRHIKTGARVMAIENDDENKVFNIAFRTPPKNSTGVAHILEHSVL  71

Query  464  SGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
             GS+ +PLK PFVEL+KGSLNTFLNA TYPD+TCYPVAS N +DF NL+ VYLDAVF+
Sbjct  72   CGSKDFPLKDPFVELVKGSLNTFLNAMTYPDKTCYPVASCNDQDFQNLMHVYLDAVFY  129



>ref|WP_035355373.1| peptidase M16 [Acetobacterium dehalogenans]
Length=973

 Score =   176 bits (447),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF    E+FVDE    A  + H+KTGA ++ +S DD+NKVF I FRTP  +STG+PHILE
Sbjct  10   GFILNKEEFVDEIDGFARTFVHEKTGARLLYISADDDNKVFSISFRTPSTDSTGVPHILE  69

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS+KYP+K+PFVEL KGSLNTFLNA TYPD+T YP+ASTN KDF NL+DVYLDAV
Sbjct  70   HSVLCGSKKYPVKEPFVELAKGSLNTFLNAMTYPDKTMYPIASTNAKDFMNLMDVYLDAV  129

Query  632  FF  637
            F+
Sbjct  130  FY  131



>ref|WP_005584172.1| Protein HypA [Clostridium ultunense]
 emb|CCQ94331.1| Protein HypA [Clostridium ultunense Esp]
Length=975

 Score =   176 bits (446),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF    + +V+E KS  +L++HKK+GA ++ + NDDENKVF I FRTPP +S G+PHILE
Sbjct  11   GFLLQKKAYVEEIKSEGLLFEHKKSGARLLVLLNDDENKVFSITFRTPPASSNGLPHILE  70

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL+GSRKYP+K+PFVEL KGSLNTFLNA T+ D+T YPVAS N KDF NL+DVYLDAV
Sbjct  71   HSVLNGSRKYPVKEPFVELAKGSLNTFLNAMTFSDKTMYPVASMNDKDFRNLMDVYLDAV  130

Query  632  FF  637
            F+
Sbjct  131  FY  132



>ref|WP_016440111.1| hypothetical protein [Coprococcus sp. HPP0048]
 gb|EPD65839.1| hypothetical protein HMPREF1216_00251 [Coprococcus sp. HPP0048]
Length=974

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E V +Q V + +S   L++HKKTGA ++ + NDDENKVF I FRTPP++STG+PHILE
Sbjct  8    AYELVRKQDVSDLQSVGYLFRHKKTGARVLLLENDDENKVFTIGFRTPPEDSTGLPHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS+K+P K PFVEL+KGSLNTFLNA TYPD+T YP+AS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSKKFPAKDPFVELVKGSLNTFLNAMTYPDKTLYPIASCNDKDFQNLMHVYMDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|WP_016439298.1| hypothetical protein [Coprococcus sp. HPP0074]
 gb|EPD58559.1| hypothetical protein HMPREF1215_01578 [Coprococcus sp. HPP0074]
Length=974

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E V +Q V + +S   L++HKKTGA ++ + NDDENKVF I FRTPP++STG+PHILE
Sbjct  8    AYELVRKQDVSDLQSVGYLFRHKKTGARVLLLENDDENKVFTIGFRTPPEDSTGLPHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS+K+P K PFVEL+KGSLNTFLNA TYPD+T YP+AS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSKKFPAKDPFVELVKGSLNTFLNAMTYPDKTLYPIASCNDKDFQNLMHVYMDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|WP_009262834.1| peptidase M16 [Lachnospiraceae bacterium 9_1_43BFAA]
 gb|EGG86451.1| hypothetical protein HMPREF0987_01409 [Lachnospiraceae bacterium 
9_1_43BFAA]
Length=974

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E V +Q V + +S   L++HKKTGA ++ + NDDENKVF I FRTPP++STG+PHILE
Sbjct  8    AYELVRKQDVSDLQSVGYLFRHKKTGARVLLLENDDENKVFTIGFRTPPEDSTGLPHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS+K+P K PFVEL+KGSLNTFLNA TYPD+T YP+AS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSKKFPAKDPFVELVKGSLNTFLNAMTYPDKTLYPIASCNDKDFQNLMHVYMDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|WP_009002339.1| peptidase M16 [Clostridium sp. D5]
 gb|EGB94707.1| peptidase, M16 family [Clostridium sp. D5]
Length=975

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 78/122 (64%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E V E+ + + KS+  L +HKK+GA ++ + NDDENKVF I FRTPP +STG+PHI+E
Sbjct  8    AYEPVLEEDLSDLKSKGCLLRHKKSGARVLLMENDDENKVFSIGFRTPPSDSTGVPHIME  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GSR +P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSRDFPVKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFQNLMHVYMDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|WP_008976346.1| peptidase M16 [Lachnospiraceae bacterium 6_1_37FAA]
 gb|EGC74703.1| hypothetical protein HMPREF0490_01583 [Lachnospiraceae bacterium 
6_1_37FAA]
Length=974

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 79/122 (65%), Positives = 99/122 (81%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             +E V +Q V + +S   L++HKKTGA ++ + NDDENKVF I FRTPP++STG+PHILE
Sbjct  8    AYELVRKQDVSDLQSVGYLFRHKKTGARVLLLENDDENKVFTIGFRTPPEDSTGLPHILE  67

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS+K+P K PFVEL+KGSLNTFLNA TYPD+T YP+AS N KDF NL+ VY+DAV
Sbjct  68   HSVLCGSKKFPAKDPFVELVKGSLNTFLNAMTYPDKTLYPIASCNDKDFQNLMHVYMDAV  127

Query  632  FF  637
            F+
Sbjct  128  FY  129



>ref|WP_022374165.1| putative Zn-dependent peptidase insulinase-like [Firmicutes bacterium 
CAG:270]
 emb|CDD69858.1| predicted Zn-dependent peptidases insulinase-like [Firmicutes 
bacterium CAG:270]
Length=966

 Score =   175 bits (444),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  284  VSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEHSVL  463
            + ++ ++E      L KH KTGA ++ VSN+D+NKVF I FRTPPK+ TG+PHILEHSVL
Sbjct  8    IKQESIEELNGTGYLLKHNKTGARVVVVSNEDDNKVFQIGFRTPPKDDTGVPHILEHSVL  67

Query  464  SGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFF  637
             GSR++P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF+NLV VYLDAVF+
Sbjct  68   CGSREFPMKDPFVELVKGSLNTFLNAMTYPDKTVYPVASQNDKDFFNLVHVYLDAVFY  125



>gb|AFA48231.1| peptidase [Acetobacterium woodii DSM 1030]
Length=970

 Score =   175 bits (444),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF    E+FVDE    A  + H+KTGA+ + +S +D+NKVF I FRTP  +STG+PHILE
Sbjct  7    GFILKKEEFVDEIDGYARTFVHQKTGAQCLYISAEDDNKVFSISFRTPSTDSTGVPHILE  66

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS+KYP+K+PFVEL KGSLNTFLNA TYPD+T YP+ASTN KDF NL+DVYLDAV
Sbjct  67   HSVLCGSKKYPVKEPFVELAKGSLNTFLNAMTYPDKTMYPIASTNAKDFMNLMDVYLDAV  126

Query  632  FF  637
            F+
Sbjct  127  FY  128



>ref|WP_042736266.1| peptidase M16 [Lachnospiraceae bacterium TWA4]
 gb|KIR03095.1| Zn-dependent peptidase, insulinase family [Lachnospiraceae bacterium 
TWA4]
Length=975

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +2

Query  275  FEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILEH  454
            +E++ ++++ E  S A + KHKK+GA I  +SNDDENKVF I FRTPPK+STG+ HILEH
Sbjct  4    YEQIKQEYISELNSEAFILKHKKSGARIFFLSNDDENKVFTIGFRTPPKDSTGVAHILEH  63

Query  455  SVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVF  634
            SVL GS+K+PLK PFVEL+KGSLNTFLNA TY D+T YPVAS N KDF NL DVYLDAV 
Sbjct  64   SVLCGSKKFPLKDPFVELVKGSLNTFLNAMTYSDKTVYPVASCNDKDFRNLTDVYLDAVL  123



>ref|WP_041670908.1| peptidase M16 [Acetobacterium woodii]
Length=973

 Score =   175 bits (444),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
            GF    E+FVDE    A  + H+KTGA+ + +S +D+NKVF I FRTP  +STG+PHILE
Sbjct  10   GFILKKEEFVDEIDGYARTFVHQKTGAQCLYISAEDDNKVFSISFRTPSTDSTGVPHILE  69

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS+KYP+K+PFVEL KGSLNTFLNA TYPD+T YP+ASTN KDF NL+DVYLDAV
Sbjct  70   HSVLCGSKKYPVKEPFVELAKGSLNTFLNAMTYPDKTMYPIASTNAKDFMNLMDVYLDAV  129

Query  632  FF  637
            F+
Sbjct  130  FY  131



>ref|WP_021642841.1| peptidase M16 inactive domain protein [[Clostridium] symbiosum]
 gb|ERI77326.1| peptidase M16 inactive domain protein [ [[Clostridium] symbiosum 
ATCC 14940]
Length=974

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +2

Query  272  GFEKVSEQFVDECKSRAVLYKHKKTGAEIMSVSNDDENKVFGIDFRTPPKNSTGIPHILE  451
             ++ +SE++V E  S  ++ +HKKTGA I  +SN+DENKVF I FRTPP +STG+PHILE
Sbjct  10   AYQVISEKYVKELNSEGIILEHKKTGARIFLLSNEDENKVFTIGFRTPPSDSTGVPHILE  69

Query  452  HSVLSGSRKYPLKKPFVELLKGSLNTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAV  631
            HSVL GS K+P+K PFVEL+KGSLNTFLNA TYPD+T YPVAS N KDF NL++VY+DAV
Sbjct  70   HSVLCGSEKFPVKDPFVELVKGSLNTFLNAMTYPDKTVYPVASCNDKDFQNLMNVYMDAV  129

Query  632  F  634
             
Sbjct  130  L  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 970004890272