BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7553

Length=1039
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357494.1|  PREDICTED: pre-mRNA-processing factor 6-like       379   6e-119   Solanum tuberosum [potatoes]
ref|XP_004243341.1|  PREDICTED: protein STABILIZED1                     379   1e-118   Solanum lycopersicum
ref|XP_009591253.1|  PREDICTED: protein STABILIZED1                     378   2e-118   Nicotiana tomentosiformis
emb|CDP02726.1|  unnamed protein product                                377   6e-118   Coffea canephora [robusta coffee]
gb|AEY85031.1|  putative pre-mRNA splicing factor                       376   8e-118   Camellia sinensis [black tea]
gb|KJB31690.1|  hypothetical protein B456_005G202800                    377   8e-118   Gossypium raimondii
gb|ADN34237.1|  pre-mRNA splicing factor                                369   1e-117   Cucumis melo subsp. melo
ref|XP_009793994.1|  PREDICTED: LOW QUALITY PROTEIN: protein STAB...    373   8e-117   Nicotiana sylvestris
ref|XP_002267416.1|  PREDICTED: protein STABILIZED1                     374   9e-117   Vitis vinifera
gb|KHN27879.1|  Pre-mRNA-processing factor 6                            369   1e-116   Glycine soja [wild soybean]
ref|XP_012088308.1|  PREDICTED: protein STABILIZED1                     373   2e-116   Jatropha curcas
ref|XP_010245311.1|  PREDICTED: protein STABILIZED1                     372   2e-116   Nelumbo nucifera [Indian lotus]
ref|XP_007043553.1|  Pre-mRNA splicing factor-related                   372   3e-116   
emb|CAN65423.1|  hypothetical protein VITISV_024588                     372   3e-116   Vitis vinifera
ref|XP_006447348.1|  hypothetical protein CICLE_v10018370mg             369   5e-115   Citrus clementina [clementine]
gb|EPS73075.1|  hypothetical protein M569_01676                         369   6e-115   Genlisea aurea
gb|KHN36627.1|  Pre-mRNA-processing factor 6                            368   8e-115   Glycine soja [wild soybean]
ref|XP_009797442.1|  PREDICTED: protein STABILIZED1-like isoform X1     369   8e-115   Nicotiana sylvestris
ref|XP_009797444.1|  PREDICTED: protein STABILIZED1-like isoform X3     369   8e-115   Nicotiana sylvestris
ref|XP_008459779.1|  PREDICTED: pre-mRNA-processing factor 6            368   1e-114   Cucumis melo [Oriental melon]
ref|XP_004140515.1|  PREDICTED: protein STABILIZED1                     368   1e-114   Cucumis sativus [cucumbers]
ref|XP_003540356.1|  PREDICTED: pre-mRNA-processing factor 6-like       368   1e-114   Glycine max [soybeans]
ref|XP_003543338.1|  PREDICTED: pre-mRNA-processing factor 6-like       368   1e-114   Glycine max [soybeans]
ref|XP_002517947.1|  pre-mRNA splicing factor, putative                 368   1e-114   Ricinus communis
ref|XP_007149863.1|  hypothetical protein PHAVU_005G104900g             366   7e-114   Phaseolus vulgaris [French bean]
ref|XP_011458494.1|  PREDICTED: LOW QUALITY PROTEIN: protein STAB...    365   2e-113   Fragaria vesca subsp. vesca
ref|XP_010918430.1|  PREDICTED: protein STABILIZED1                     365   3e-113   Elaeis guineensis
ref|XP_009342654.1|  PREDICTED: protein STABILIZED1-like                360   5e-112   
ref|XP_009357821.1|  PREDICTED: protein STABILIZED1-like                360   9e-112   Pyrus x bretschneideri [bai li]
ref|XP_010099575.1|  Pre-mRNA-processing factor 6                       360   9e-112   Morus notabilis
ref|XP_010035719.1|  PREDICTED: protein STABILIZED1                     360   1e-111   Eucalyptus grandis [rose gum]
ref|NP_001064969.1|  Os10g0498600                                       342   4e-111   
ref|XP_009401680.1|  PREDICTED: protein STABILIZED1                     358   8e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU26151.1|  hypothetical protein MIMGU_mgv1a000662mg                358   1e-110   Erythranthe guttata [common monkey flower]
ref|XP_008809401.1|  PREDICTED: protein STABILIZED1                     357   1e-110   
ref|XP_008342929.1|  PREDICTED: pre-mRNA-processing factor 6-like       356   3e-110   
gb|AEO72346.2|  Prp1 protein                                            355   4e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00717.1|  predicted protein                                      354   5e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008229166.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    354   2e-109   
gb|EMT09961.1|  Pre-mRNA-processing factor 6                            352   3e-109   
ref|XP_007214916.1|  hypothetical protein PRUPE_ppa000712mg             353   3e-109   Prunus persica
gb|EMS45135.1|  Pre-mRNA-processing factor 6                            354   5e-109   Triticum urartu
ref|XP_010685372.1|  PREDICTED: protein STABILIZED1                     352   1e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004514211.1|  PREDICTED: pre-mRNA-processing factor 6-like       352   1e-108   Cicer arietinum [garbanzo]
ref|XP_002319361.2|  hypothetical protein POPTR_0013s13900g             348   6e-108   
ref|XP_011045503.1|  PREDICTED: protein STABILIZED1-like                350   7e-108   Populus euphratica
gb|KEH23176.1|  pre-mRNA splicing factor-like protein                   348   5e-107   Medicago truncatula
emb|CBI28774.3|  unnamed protein product                                338   6e-106   Vitis vinifera
ref|XP_006662478.1|  PREDICTED: pre-mRNA-processing factor 6-like       342   7e-106   Oryza brachyantha
gb|EMT02936.1|  Pre-mRNA-processing factor 6                            342   1e-105   
gb|EEE51217.1|  hypothetical protein OsJ_32045                          343   3e-105   Oryza sativa Japonica Group [Japonica rice]
gb|AAL58273.1|AC068923_15  putative pre-mRNA splicing factor            342   8e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010234868.1|  PREDICTED: protein STABILIZED1                     340   2e-104   Brachypodium distachyon [annual false brome]
ref|XP_010467412.1|  PREDICTED: protein STABILIZED1-like                335   3e-104   
ref|XP_002872777.1|  hypothetical protein ARALYDRAFT_490219             339   6e-104   
gb|EMT28978.1|  Pre-mRNA-processing factor 6                            330   7e-104   
ref|XP_011085353.1|  PREDICTED: LOW QUALITY PROTEIN: protein STAB...    338   1e-103   
ref|XP_004982722.1|  PREDICTED: pre-mRNA-processing factor 6-like...    337   2e-103   Setaria italica
ref|XP_010422461.1|  PREDICTED: protein STABILIZED1-like                338   3e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010455888.1|  PREDICTED: protein STABILIZED1                     338   3e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010522629.1|  PREDICTED: protein STABILIZED1                     337   4e-103   Tarenaya hassleriana [spider flower]
tpg|DAA55350.1|  TPA: hypothetical protein ZEAMMB73_415949              335   7e-103   
ref|XP_008662633.1|  PREDICTED: pre-mRNA-processing factor 6-like       335   1e-102   Zea mays [maize]
ref|XP_006279939.1|  hypothetical protein CARUB_v10025803mg             335   3e-102   
ref|XP_010431097.1|  PREDICTED: protein STABILIZED1-like                335   3e-102   
ref|XP_002442232.1|  hypothetical protein SORBIDRAFT_08g016670          333   4e-102   
ref|XP_006286978.1|  hypothetical protein CARUB_v10000126mg             333   9e-102   
ref|NP_192252.1|  pre-mRNA-processing factor 6-like protein STA1        332   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121844.1|  PREDICTED: protein STABILIZED1                     331   8e-101   Brassica rapa
ref|XP_006396573.1|  hypothetical protein EUTSA_v10028386mg             326   9e-99    Eutrema salsugineum [saltwater cress]
ref|XP_007200323.1|  hypothetical protein PRUPE_ppa000851mg             322   1e-97    Prunus persica
ref|XP_006857690.1|  PREDICTED: protein STABILIZED1                     320   1e-96    Amborella trichopoda
ref|XP_003588705.1|  Pre-mRNA-processing factor                         317   2e-96    
ref|XP_007218131.1|  hypothetical protein PRUPE_ppa007130mg             294   5e-93    
emb|CDX90885.1|  BnaA03g25650D                                          296   3e-92    
ref|XP_009135950.1|  PREDICTED: protein STABILIZED1-like                296   2e-91    
ref|XP_001755087.1|  predicted protein                                  303   4e-91    
ref|XP_001776889.1|  predicted protein                                  301   4e-90    
ref|XP_006442217.1|  hypothetical protein CICLE_v10018758mg             291   1e-86    
ref|XP_002971176.1|  hypothetical protein SELMODRAFT_172051             286   1e-84    Selaginella moellendorffii
gb|EAZ11333.1|  hypothetical protein OsJ_01197                          283   7e-84    Oryza sativa Japonica Group [Japonica rice]
gb|EAY73400.1|  hypothetical protein OsI_01280                          283   9e-84    Oryza sativa Indica Group [Indian rice]
ref|NP_001172269.1|  Os01g0263600                                       259   3e-82    
ref|XP_005651161.1|  hypothetical protein COCSUDRAFT_27128              278   1e-81    Coccomyxa subellipsoidea C-169
ref|XP_002961912.1|  hypothetical protein SELMODRAFT_60593              275   3e-81    
emb|CDY21966.1|  BnaC09g00720D                                          271   4e-79    Brassica napus [oilseed rape]
emb|CDY48561.1|  BnaA09g01570D                                          271   6e-79    Brassica napus [oilseed rape]
ref|XP_009108789.1|  PREDICTED: protein STABILIZED1-like                268   5e-78    Brassica rapa
ref|XP_005850880.1|  hypothetical protein CHLNCDRAFT_34097              268   7e-78    Chlorella variabilis
ref|XP_002987607.1|  hypothetical protein SELMODRAFT_126394             259   1e-74    Selaginella moellendorffii
ref|XP_011399893.1|  Pre-mRNA-processing factor 6                       256   1e-74    Auxenochlorella protothecoides
ref|XP_010466441.1|  PREDICTED: protein STABILIZED1-like                258   4e-74    
ref|XP_002987646.1|  hypothetical protein SELMODRAFT_126445             253   2e-72    
gb|KFP45705.1|  Pre-mRNA-processing factor 6                            243   1e-71    Chlamydotis macqueenii
ref|XP_010126560.1|  PREDICTED: pre-mRNA-processing factor 6            242   2e-71    Chlamydotis macqueenii
gb|KFM80330.1|  Pre-mRNA-processing factor 6                            234   2e-71    Stegodyphus mimosarum
ref|XP_007909448.1|  PREDICTED: pre-mRNA-processing factor 6            249   3e-71    Callorhinchus milii [Australian ghost shark]
gb|EAW75175.1|  chromosome 20 open reading frame 14, isoform CRA_b      240   1e-70    Homo sapiens [man]
emb|CAB70695.1|  hypothetical protein                                   240   2e-70    Homo sapiens [man]
ref|XP_001692638.1|  splicing factor, component of the U4/U6-U5 s...    246   4e-70    Chlamydomonas reinhardtii
gb|AAH05801.1|  Prpf6 protein                                           237   2e-69    Mus musculus [mouse]
ref|XP_009512228.1|  PREDICTED: pre-mRNA-processing factor 6            242   2e-69    Phalacrocorax carbo [common cormorant]
gb|EGW10560.1|  Pre-mRNA-processing factor 6                            237   3e-69    Cricetulus griseus [Chinese hamsters]
ref|XP_008299806.1|  PREDICTED: pre-mRNA-processing factor 6            243   5e-69    Stegastes partitus
ref|XP_010287290.1|  PREDICTED: pre-mRNA-processing factor 6            242   6e-69    Phaethon lepturus
gb|EOA93860.1|  Pre-mRNA-processing factor 6                            236   7e-69    Anas platyrhynchos [duck]
gb|KFQ67669.1|  Pre-mRNA-processing factor 6                            241   7e-69    Phaethon lepturus
ref|XP_002414072.1|  pre-mRNA splicing factor, putative                 242   9e-69    Ixodes scapularis [blacklegged tick]
ref|XP_005030258.1|  PREDICTED: pre-mRNA-processing factor 6-like       237   1e-68    
ref|XP_010749961.1|  PREDICTED: pre-mRNA-processing factor 6            242   1e-68    
ref|XP_009575883.1|  PREDICTED: pre-mRNA-processing factor 6            242   1e-68    Fulmarus glacialis
ref|XP_006639651.1|  PREDICTED: pre-mRNA-processing factor 6-like       242   2e-68    
ref|XP_009072246.1|  PREDICTED: pre-mRNA-processing factor 6            241   2e-68    Acanthisitta chloris
gb|KFW74778.1|  Pre-mRNA-processing factor 6                            241   2e-68    Manacus vitellinus
ref|XP_005801720.1|  PREDICTED: pre-mRNA-processing factor 6-like       242   2e-68    
gb|KFZ67166.1|  Pre-mRNA-processing factor 6                            241   2e-68    Podiceps cristatus
ref|XP_009325174.1|  PREDICTED: pre-mRNA-processing factor 6            241   2e-68    Pygoscelis adeliae
ref|XP_010016636.1|  PREDICTED: pre-mRNA-processing factor 6            241   2e-68    Nestor notabilis
ref|XP_005240002.1|  PREDICTED: pre-mRNA-processing factor 6            241   2e-68    
ref|XP_009491956.1|  PREDICTED: pre-mRNA-processing factor 6            241   2e-68    Pelecanus crispus
ref|XP_008944238.1|  PREDICTED: pre-mRNA-processing factor 6            241   2e-68    Merops nubicus
gb|KFP04021.1|  Pre-mRNA-processing factor 6                            241   2e-68    Calypte anna
gb|KGL81570.1|  Pre-mRNA-processing factor 6                            241   2e-68    Tinamus guttatus
ref|XP_010567787.1|  PREDICTED: pre-mRNA-processing factor 6            241   2e-68    Haliaeetus leucocephalus
ref|XP_011170398.1|  PREDICTED: pre-mRNA-processing factor 6-like       231   2e-68    
ref|XP_002197944.1|  PREDICTED: pre-mRNA-processing factor 6            241   2e-68    Taeniopygia guttata
gb|KFV68328.1|  Pre-mRNA-processing factor 6                            241   2e-68    Picoides pubescens
ref|XP_009900078.1|  PREDICTED: pre-mRNA-processing factor 6            241   2e-68    Picoides pubescens
ref|XP_008316164.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    241   2e-68    
ref|XP_008922828.1|  PREDICTED: pre-mRNA-processing factor 6            241   2e-68    
ref|XP_005491364.1|  PREDICTED: pre-mRNA-processing factor 6            241   3e-68    
ref|XP_005422323.1|  PREDICTED: pre-mRNA-processing factor 6            241   3e-68    
ref|XP_004546042.1|  PREDICTED: pre-mRNA-processing factor 6-like       241   3e-68    
ref|XP_010395389.1|  PREDICTED: pre-mRNA-processing factor 6            241   3e-68    
ref|XP_005524836.1|  PREDICTED: pre-mRNA-processing factor 6            241   3e-68    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_008496174.1|  PREDICTED: pre-mRNA-processing factor 6            241   3e-68    Calypte anna
ref|XP_010219146.1|  PREDICTED: pre-mRNA-processing factor 6            241   3e-68    Tinamus guttatus
ref|XP_006796391.1|  PREDICTED: pre-mRNA-processing factor 6-like       241   3e-68    Neolamprologus brichardi [lyretail cichlid]
gb|ESA12445.1|  hypothetical protein GLOINDRAFT_323384                  234   3e-68    
ref|XP_003787915.1|  PREDICTED: pre-mRNA-processing factor 6            240   3e-68    
ref|XP_009435945.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    240   4e-68    
gb|EAW75177.1|  chromosome 20 open reading frame 14, isoform CRA_d      240   4e-68    Homo sapiens [man]
ref|XP_009633092.1|  PREDICTED: pre-mRNA-processing factor 6            241   4e-68    Egretta garzetta
ref|XP_008412127.1|  PREDICTED: pre-mRNA-processing factor 6            241   4e-68    Poecilia reticulata
gb|EMC83474.1|  Pre-mRNA-processing factor 6                            240   5e-68    
ref|XP_008634309.1|  PREDICTED: pre-mRNA-processing factor 6            241   5e-68    
ref|XP_009864597.1|  PREDICTED: pre-mRNA-processing factor 6            240   5e-68    Apaloderma vittatum
ref|XP_007524498.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    240   5e-68    Erinaceus europaeus [common hedgehog]
ref|XP_007524499.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    240   5e-68    Erinaceus europaeus [common hedgehog]
gb|KFQ99062.1|  Pre-mRNA-processing factor 6                            240   5e-68    Opisthocomus hoazin [hoatzin]
ref|XP_009931643.1|  PREDICTED: pre-mRNA-processing factor 6            240   5e-68    Opisthocomus hoazin [hoatzin]
gb|EAW75178.1|  chromosome 20 open reading frame 14, isoform CRA_e      240   5e-68    Homo sapiens [man]
ref|XP_001113447.2|  PREDICTED: pre-mRNA-processing factor 6            239   6e-68    
ref|XP_004211508.1|  PREDICTED: pre-mRNA-processing factor 6-like       226   6e-68    
ref|XP_009471707.1|  PREDICTED: pre-mRNA-processing factor 6            241   6e-68    Nipponia nippon
ref|XP_005499760.1|  PREDICTED: pre-mRNA-processing factor 6            240   6e-68    
ref|XP_003512405.2|  PREDICTED: pre-mRNA-processing factor 6 isof...    237   7e-68    
ref|XP_006723832.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    239   8e-68    Homo sapiens [man]
ref|XP_008019876.1|  PREDICTED: pre-mRNA-processing factor 6            239   8e-68    Chlorocebus sabaeus
dbj|BAG50938.1|  unnamed protein product                                239   8e-68    Homo sapiens [man]
ref|XP_004062614.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    239   9e-68    
ref|XP_009985480.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    239   9e-68    Tauraco erythrolophus
gb|AAW24649.1|  SJCHGC09396 protein                                     232   9e-68    Schistosoma japonicum
ref|XP_007557713.1|  PREDICTED: pre-mRNA-processing factor 6            239   9e-68    Poecilia formosa
ref|XP_009891871.1|  PREDICTED: pre-mRNA-processing factor 6            240   9e-68    Charadrius vociferus
ref|XP_003280219.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    239   9e-68    Nomascus leucogenys [White-cheeked Gibbon]
gb|AAD01798.1|  putative mitochondrial outer membrane protein imp...    239   9e-68    Homo sapiens [man]
ref|XP_001625285.1|  predicted protein                                  239   9e-68    Nematostella vectensis
ref|XP_005057356.1|  PREDICTED: pre-mRNA-processing factor 6            239   1e-67    Ficedula albicollis
ref|XP_006021718.1|  PREDICTED: pre-mRNA-processing factor 6            239   1e-67    
ref|XP_001152053.3|  PREDICTED: pre-mRNA-processing factor 6 isof...    239   1e-67    
ref|NP_036601.2|  pre-mRNA-processing factor 6                          239   1e-67    Homo sapiens [man]
ref|XP_003280218.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    239   1e-67    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_007062619.1|  PREDICTED: pre-mRNA-processing factor 6            239   1e-67    
dbj|BAG36962.1|  unnamed protein product                                239   1e-67    Homo sapiens [man]
ref|XP_011789820.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    239   1e-67    Colobus angolensis palliatus
ref|XP_006273121.1|  PREDICTED: pre-mRNA-processing factor 6            239   1e-67    Alligator mississippiensis
ref|XP_011721219.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    239   1e-67    
gb|EMP33297.1|  Pre-mRNA-processing factor 6                            239   1e-67    Chelonia mydas [green seaturtle]
ref|XP_005569690.1|  PREDICTED: pre-mRNA-processing factor 6            239   1e-67    Macaca fascicularis [crab eating macaque]
ref|XP_011929527.1|  PREDICTED: pre-mRNA-processing factor 6            239   1e-67    Cercocebus atys
ref|XP_006132536.1|  PREDICTED: pre-mRNA-processing factor 6            239   1e-67    
gb|EKC35667.1|  Pre-mRNA-processing factor 6                            229   2e-67    Crassostrea gigas
ref|XP_009272205.1|  PREDICTED: pre-mRNA-processing factor 6            240   2e-67    Aptenodytes forsteri
ref|XP_005146915.1|  PREDICTED: pre-mRNA-processing factor 6            239   2e-67    Melopsittacus undulatus
ref|XP_007233071.1|  PREDICTED: pre-mRNA-processing factor 6-like       236   2e-67    
ref|XP_005309929.1|  PREDICTED: pre-mRNA-processing factor 6            239   2e-67    Chrysemys picta bellii
ref|XP_005740593.1|  PREDICTED: pre-mRNA-processing factor 6-like       238   2e-67    
ref|XP_003439073.2|  PREDICTED: pre-mRNA-processing factor 6-like       238   3e-67    Oreochromis niloticus
gb|KFV72907.1|  Pre-mRNA-processing factor 6                            238   3e-67    Struthio camelus australis
ref|XP_007437943.1|  PREDICTED: pre-mRNA-processing factor 6-like       233   3e-67    Python bivittatus
ref|XP_009669925.1|  PREDICTED: pre-mRNA-processing factor 6            238   3e-67    Struthio camelus australis
ref|XP_010874125.1|  PREDICTED: pre-mRNA-processing factor 6            238   3e-67    Esox lucius
ref|XP_003757601.1|  PREDICTED: pre-mRNA-processing factor 6            238   4e-67    Sarcophilus harrisii
ref|XP_010176712.1|  PREDICTED: pre-mRNA-processing factor 6            238   4e-67    
gb|KFZ52735.1|  Pre-mRNA-processing factor 6                            238   4e-67    Antrostomus carolinensis
ref|XP_003904514.1|  PREDICTED: pre-mRNA-processing factor 6            238   4e-67    Papio anubis [baboon]
ref|XP_004339973.1|  PRP1 splicing factor, Nterminal/tetratricope...    237   6e-67    Acanthamoeba castellanii str. Neff
ref|XP_011675370.1|  PREDICTED: pre-mRNA-processing factor 6            238   6e-67    Strongylocentrotus purpuratus [purple urchin]
gb|ELV11349.1|  Pre-mRNA-processing factor 6                            237   8e-67    Tupaia chinensis
ref|XP_004586018.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    237   8e-67    Ochotona princeps [southern American pika]
ref|XP_004464990.1|  PREDICTED: pre-mRNA-processing factor 6            237   8e-67    Dasypus novemcinctus
ref|XP_006167182.1|  PREDICTED: pre-mRNA-processing factor 6            237   8e-67    
ref|XP_008841540.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    236   9e-67    
ref|XP_006873391.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    237   9e-67    Chrysochloris asiatica
ref|XP_008841539.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    236   9e-67    
ref|XP_008250773.1|  PREDICTED: pre-mRNA-processing factor 6            237   9e-67    Oryctolagus cuniculus [domestic rabbit]
ref|XP_006873392.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    236   1e-66    Chrysochloris asiatica
ref|XP_004586019.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    236   1e-66    Ochotona princeps [southern American pika]
ref|XP_009168850.1|  hypothetical protein T265_05545                    236   1e-66    Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_004716112.1|  PREDICTED: pre-mRNA-processing factor 6            236   1e-66    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003059661.1|  mRNA splicing protein                              236   1e-66    Micromonas pusilla CCMP1545
emb|CAG11265.1|  unnamed protein product                                236   1e-66    Tetraodon nigroviridis
ref|NP_001125315.1|  pre-mRNA-processing factor 6                       236   1e-66    Pongo abelii [orang utan]
ref|XP_003487820.1|  PREDICTED: pre-mRNA-processing factor 6-like       236   2e-66    Bombus impatiens
ref|XP_006896967.1|  PREDICTED: pre-mRNA-processing factor 6            236   2e-66    Elephantulus edwardii [Cape long-eared elephant shrew]
dbj|BAE26451.1|  unnamed protein product                                236   2e-66    Mus musculus [mouse]
ref|XP_007608741.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    236   2e-66    
ref|XP_008994545.1|  PREDICTED: pre-mRNA-processing factor 6            236   2e-66    
ref|NP_001073234.1|  pre-mRNA-processing factor 6                       236   2e-66    Rattus norvegicus [brown rat]
ref|XP_010135070.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    236   2e-66    Buceros rhinoceros silvestris
ref|XP_005074613.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    236   2e-66    
ref|XP_008841538.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    236   2e-66    Nannospalax galili
ref|XP_006994647.1|  PREDICTED: pre-mRNA-processing factor 6            236   2e-66    Peromyscus maniculatus bairdii
ref|XP_005074612.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    236   2e-66    Mesocricetus auratus [Syrian golden hamster]
emb|CDQ84134.1|  unnamed protein product                                234   2e-66    Oncorhynchus mykiss
ref|NP_598462.1|  pre-mRNA-processing factor 6                          236   2e-66    Mus musculus [mouse]
ref|XP_008057944.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    236   2e-66    Carlito syrichta
gb|ERE70722.1|  pre-mRNA-processing factor 6                            236   2e-66    Cricetulus griseus [Chinese hamsters]
ref|XP_004370209.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    235   3e-66    
ref|XP_003963386.2|  PREDICTED: pre-mRNA-processing factor 6            235   3e-66    Takifugu rubripes [tiger puffer]
ref|XP_004370208.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    235   3e-66    Trichechus manatus latirostris
ref|XP_005362727.1|  PREDICTED: pre-mRNA-processing factor 6            235   4e-66    Microtus ochrogaster [prairie voles]
ref|XP_417426.2|  PREDICTED: pre-mRNA-processing factor 6 isoform X2    235   4e-66    Gallus gallus [bantam]
gb|KFO29364.1|  Pre-mRNA-processing factor 6                            235   4e-66    Fukomys damarensis [Damara mole rat]
ref|XP_004669585.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    234   4e-66    Jaculus jaculus
ref|XP_003399121.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    235   4e-66    Bombus terrestris [large earth bumblebee]
ref|XP_005325464.1|  PREDICTED: pre-mRNA-processing factor 6            235   5e-66    
ref|XP_003462831.1|  PREDICTED: pre-mRNA-processing factor 6            234   5e-66    Cavia porcellus [guinea pig]
ref|XP_011687513.1|  PREDICTED: pre-mRNA-processing factor 6            234   5e-66    Wasmannia auropunctata
ref|XP_010720787.1|  PREDICTED: pre-mRNA-processing factor 6            235   5e-66    
ref|XP_007952836.1|  PREDICTED: pre-mRNA-processing factor 6            234   5e-66    Orycteropus afer afer
ref|XP_004669584.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    234   5e-66    Jaculus jaculus
gb|EXX58698.1|  Prp6p                                                   234   6e-66    Rhizophagus irregularis DAOM 197198w
ref|XP_005044943.1|  PREDICTED: pre-mRNA-processing factor 6-like       235   6e-66    
ref|XP_004841181.1|  PREDICTED: pre-mRNA-processing factor 6            234   6e-66    Heterocephalus glaber [naked mole rat]
ref|XP_011402481.1|  PREDICTED: pre-mRNA-processing factor 6-like       234   6e-66    Amphimedon queenslandica
ref|XP_005410107.1|  PREDICTED: pre-mRNA-processing factor 6            234   6e-66    
ref|XP_004070553.1|  PREDICTED: pre-mRNA-processing factor 6            234   6e-66    Oryzias latipes [Japanese rice fish]
ref|XP_004644241.1|  PREDICTED: pre-mRNA-processing factor 6            234   6e-66    
dbj|GAA37598.2|  pre-mRNA-processing factor 6                           234   7e-66    Clonorchis sinensis [oriental liver fluke]
ref|XP_004908217.1|  PREDICTED: pre-mRNA-processing factor 6            234   7e-66    
ref|XP_011151002.1|  PREDICTED: pre-mRNA-processing factor 6            234   8e-66    Harpegnathos saltator
ref|XP_011632464.1|  PREDICTED: pre-mRNA-processing factor 6            234   8e-66    Pogonomyrmex barbatus
ref|XP_003691902.1|  PREDICTED: pre-mRNA-processing factor 6-like       234   9e-66    Apis florea [dwarf honeybee]
ref|XP_001507659.2|  PREDICTED: pre-mRNA-processing factor 6            234   9e-66    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_006621619.1|  PREDICTED: pre-mRNA-processing factor 6-like       234   1e-65    Apis dorsata [rock honeybee]
ref|XP_623891.2|  PREDICTED: pre-mRNA-processing factor 6-like          234   1e-65    Apis mellifera [bee]
ref|XP_008869866.1|  hypothetical protein H310_06535                    233   2e-65    Aphanomyces invadans
ref|XP_004282421.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    233   2e-65    
ref|XP_010631726.1|  PREDICTED: pre-mRNA-processing factor 6            234   2e-65    Fukomys damarensis [Damara mole rat]
ref|XP_004282420.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    233   2e-65    Orcinus orca [Orca]
ref|XP_004325264.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    233   2e-65    
ref|XP_008575095.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    232   3e-65    Galeopterus variegatus [Malayan flying lemur]
ref|NP_001025642.1|  pre-mRNA processing factor 6                       232   3e-65    Xenopus tropicalis [western clawed frog]
ref|XP_010777270.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    232   3e-65    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003700558.1|  PREDICTED: pre-mRNA-processing factor 6            232   4e-65    Megachile rotundata
gb|KGB36525.1|  Pre-mRNA-processing factor 6                            232   5e-65    Schistosoma haematobium
emb|CEG02177.1|  Tetratricopeptide repeat                               232   5e-65    Ostreococcus tauri
ref|XP_008575094.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    232   5e-65    Galeopterus variegatus [Malayan flying lemur]
ref|XP_011265576.1|  PREDICTED: pre-mRNA-processing factor 6            231   7e-65    Camponotus floridanus
ref|XP_011063836.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    231   7e-65    Acromyrmex echinatior
ref|XP_007462289.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    231   7e-65    Lipotes vexillifer [baiji]
ref|XP_011063837.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    231   7e-65    Acromyrmex echinatior
ref|XP_011331797.1|  PREDICTED: pre-mRNA-processing factor 6            231   8e-65    Ooceraea biroi
ref|XP_007462288.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    231   9e-65    Lipotes vexillifer [baiji]
ref|XP_003421807.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    231   9e-65    Loxodonta africana [African bush elephant]
ref|XP_008108426.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    231   1e-64    Anolis carolinensis [Carolina anole]
ref|XP_003220735.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    231   1e-64    Anolis carolinensis [Carolina anole]
ref|NP_997820.1|  pre-mRNA-processing factor 6                          231   1e-64    
ref|XP_008057945.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    231   1e-64    
gb|AAH66556.1|  C20orf14 homolog (H. sapiens)                           231   1e-64    
ref|XP_011879159.1|  PREDICTED: pre-mRNA-processing factor 6            230   1e-64    
ref|XP_012058766.1|  PREDICTED: pre-mRNA-processing factor 6            230   2e-64    
ref|XP_009842686.1|  hypothetical protein H257_16064                    230   2e-64    
ref|XP_009560968.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    230   2e-64    
ref|XP_002128772.2|  PREDICTED: pre-mRNA-processing factor 6            229   3e-64    
ref|XP_011424711.1|  PREDICTED: uncharacterized protein LOC105326398    230   3e-64    
ref|XP_006820857.1|  PREDICTED: pre-mRNA-processing factor 6-like       218   4e-64    
emb|CDY48206.1|  BnaCnng15970D                                          222   5e-64    
ref|XP_001654491.1|  AAEL010387-PA                                      229   5e-64    
ref|XP_008612817.1|  hypothetical protein SDRG_08701                    229   6e-64    
gb|KDO29186.1|  hypothetical protein SPRG_05428                         229   6e-64    
ref|XP_001951091.1|  PREDICTED: pre-mRNA-processing factor 6            229   7e-64    
ref|XP_009049099.1|  hypothetical protein LOTGIDRAFT_141173             229   7e-64    
gb|KFD51604.1|  hypothetical protein M513_07483                         229   7e-64    
emb|CDW55092.1|  Pre mRNA processing factor 6                           229   7e-64    
gb|AAH79686.1|  MGC80263 protein                                        228   9e-64    
ref|NP_001087374.2|  pre-mRNA processing factor 6                       228   9e-64    
ref|XP_009016422.1|  hypothetical protein HELRODRAFT_77344              228   2e-63    
ref|XP_003083104.1|  putative pre-mRNA splicing factor (ISS)            230   2e-63    
emb|CBJ28499.1|  conserved unknown protein                              226   3e-63    
gb|KHJ41259.1|  tetratricopeptide repeat protein                        229   3e-63    
gb|KDO36235.1|  hypothetical protein CISIN_1g040951mg                   224   3e-63    
ref|XP_002505391.1|  mRNA splicing protein                              226   4e-63    
gb|KFP29002.1|  Pre-mRNA-processing factor 6                            226   4e-63    
ref|XP_004620314.1|  PREDICTED: pre-mRNA-processing factor 6            226   5e-63    
gb|EWM28197.1|  pre-mrna-processing factor 6                            226   6e-63    
ref|XP_009524471.1|  hypothetical protein PHYSODRAFT_557662             225   9e-63    
gb|EFX80606.1|  hypothetical protein DAPPUDRAFT_303888                  224   2e-62    
ref|XP_010193482.1|  PREDICTED: pre-mRNA-processing factor 6            224   2e-62    
ref|XP_002589073.1|  hypothetical protein BRAFLDRAFT_120892             224   3e-62    
ref|XP_006922054.1|  PREDICTED: pre-mRNA-processing factor 6            224   3e-62    
ref|XP_001866982.1|  pre-mRNA-splicing factor prp1                      224   3e-62    
ref|XP_004410159.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    223   3e-62    
ref|XP_008529489.1|  PREDICTED: pre-mRNA-processing factor 6            224   4e-62    
ref|XP_004430229.1|  PREDICTED: pre-mRNA-processing factor 6            224   4e-62    
ref|XP_004410158.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    223   4e-62    
ref|XP_011499897.1|  PREDICTED: pre-mRNA-processing factor 6            223   4e-62    
ref|XP_534481.3|  PREDICTED: pre-mRNA-processing factor 6               223   4e-62    
ref|XP_002902501.1|  pre-mRNA-processing factor, putative               223   6e-62    
ref|XP_008155371.1|  PREDICTED: pre-mRNA-processing factor 6            223   6e-62    
ref|XP_011279101.1|  PREDICTED: pre-mRNA-processing factor 6            223   6e-62    
ref|XP_005885584.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA pro...    223   6e-62    
ref|XP_005604941.1|  PREDICTED: pre-mRNA-processing factor 6            223   7e-62    
emb|CEP09115.1|  hypothetical protein                                   223   7e-62    
ref|XP_007087130.1|  PREDICTED: pre-mRNA-processing factor 6            223   7e-62    
gb|EFB18826.1|  hypothetical protein PANDA_015282                       223   8e-62    
ref|XP_002925730.1|  PREDICTED: pre-mRNA-processing factor 6            223   8e-62    
gb|EPB84496.1|  hypothetical protein HMPREF1544_08732                   223   8e-62    
gb|EHB17771.1|  Pre-mRNA-processing factor 6                            222   8e-62    
ref|XP_005095991.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    223   8e-62    
ref|XP_002428334.1|  pre-mRNA splicing factor, putative                 222   1e-61    
dbj|GAN05126.1|  pre-mRNA-processing factor 6-like                      222   1e-61    
ref|XP_001958184.1|  GF23653                                            222   1e-61    
ref|XP_004760133.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    222   1e-61    
gb|ETN61203.1|  pre-mrna splicing factor                                222   1e-61    
ref|XP_005177230.1|  PREDICTED: pre-mRNA-processing factor 6            222   1e-61    
gb|KDR18974.1|  Pre-mRNA-processing factor 6                            222   1e-61    
ref|XP_011304975.1|  PREDICTED: pre-mRNA-processing factor 6            222   1e-61    
emb|CDH55389.1|  pre-mrna-processing factor 6                           222   2e-61    
emb|CDY48448.1|  BnaA08g11570D                                          221   2e-61    
ref|XP_011199499.1|  PREDICTED: pre-mRNA-processing factor 6            221   2e-61    
ref|XP_006045519.1|  PREDICTED: pre-mRNA-processing factor 6            221   2e-61    
ref|XP_004931733.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    221   2e-61    
ref|XP_004760132.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    221   3e-61    
ref|XP_971592.1|  PREDICTED: pre-mRNA-processing factor 6               221   3e-61    
gb|ETI55238.1|  hypothetical protein F443_02059                         221   3e-61    
ref|XP_002068166.1|  GK10384                                            221   3e-61    
gb|ETO83970.1|  hypothetical protein F444_02071                         221   3e-61    
ref|XP_005908608.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    221   3e-61    
ref|XP_001604212.1|  PREDICTED: pre-mRNA-processing factor 6            221   4e-61    
ref|XP_005688455.1|  PREDICTED: pre-mRNA-processing factor 6            221   4e-61    
ref|XP_004530580.1|  PREDICTED: pre-mRNA-processing factor 6-like       221   4e-61    
ref|XP_008915734.1|  hypothetical protein, variant                      221   4e-61    
gb|ELR47014.1|  Pre-mRNA-processing factor 6                            221   4e-61    
ref|XP_012044212.1|  PREDICTED: pre-mRNA-processing factor 6            221   4e-61    
dbj|BAJ99287.1|  predicted protein                                      221   4e-61    
ref|NP_001039840.1|  pre-mRNA-processing factor 6                       221   4e-61    
ref|XP_001973282.1|  GG16015                                            221   4e-61    
gb|ETP53044.1|  hypothetical protein F442_02010                         221   4e-61    
gb|ETK95058.1|  hypothetical protein L915_01970                         221   4e-61    
ref|XP_006209765.1|  PREDICTED: pre-mRNA-processing factor 6            221   5e-61    
ref|XP_010995299.1|  PREDICTED: pre-mRNA-processing factor 6            220   5e-61    
ref|XP_011186388.1|  PREDICTED: pre-mRNA-processing factor 6            220   5e-61    
ref|XP_007185240.1|  PREDICTED: pre-mRNA-processing factor 6            220   6e-61    
ref|XP_003374769.1|  Pre-mRNA-processing factor 6                       220   6e-61    
ref|XP_008476314.1|  PREDICTED: pre-mRNA-processing factor 6            220   8e-61    
ref|XP_003144592.1|  U5 snRNP-associated protein                        220   8e-61    
ref|XP_006175674.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    220   8e-61    
ref|XP_002095677.1|  GE19580                                            219   9e-61    
ref|XP_002117163.1|  hypothetical protein TRIADDRAFT_51004              219   1e-60    
ref|XP_011547817.1|  PREDICTED: pre-mRNA-processing factor 6            219   1e-60    
emb|CDS07580.1|  hypothetical protein LRAMOSA01529                      219   1e-60    
gb|EIE77540.1|  hypothetical protein RO3G_02244                         219   1e-60    
ref|NP_649073.1|  CG6841                                                219   2e-60    
ref|XP_010952616.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    219   2e-60    
ref|XP_002085426.1|  GD14782                                            219   2e-60    
ref|XP_002042635.1|  GM15004                                            219   2e-60    
ref|XP_010952618.1|  PREDICTED: pre-mRNA-processing factor 6 isof...    219   2e-60    
gb|ELU10841.1|  hypothetical protein CAPTEDRAFT_223651                  219   2e-60    
gb|KIZ07717.1|  putative Pre-mRNA-processing factor 6                   206   2e-60    
ref|XP_001352910.2|  GA19898                                            218   2e-60    
ref|XP_002026575.1|  GL21701                                            218   2e-60    
gb|ABC75573.1|  hypothetical protein                                    204   3e-60    
gb|ELK04445.1|  Pre-mRNA-processing factor 6                            219   4e-60    
emb|CDQ05274.1|  Protein BM-PRP-6, isoform f                            217   4e-60    
emb|CDS28438.1|  pre mRNA processing factor 6                           218   4e-60    
ref|XP_004345122.1|  pre-mRNA splicing factor                           217   5e-60    
emb|CCI11656.1|  unnamed protein product                                207   6e-60    
ref|XP_315659.1|  AGAP005640-PA                                         217   7e-60    
ref|XP_002047585.1|  GJ11852                                            217   9e-60    
ref|XP_001997359.1|  GH23803                                            216   1e-59    
gb|KFB50604.1|  AGAP005640-PA-like protein                              216   1e-59    
dbj|GAA98462.1|  hypothetical protein E5Q_05148                         216   1e-59    
ref|XP_002008426.1|  GI13491                                            216   2e-59    
ref|XP_001891604.1|  U5 snRNP-associated 102 kDa protein                216   2e-59    
ref|XP_002291151.1|  RNA splicing factor                                216   2e-59    
gb|KIW59212.1|  hypothetical protein PV05_03677                         214   4e-59    
ref|XP_001422607.1|  predicted protein                                  214   5e-59    
ref|XP_001215979.1|  conserved hypothetical protein                     214   6e-59    
gb|ERG86119.1|  pre-mrna-processing factor 6                            214   1e-58    
emb|CDJ01474.1|  pre mRNA processing factor 6                           213   2e-58    
gb|KFY86443.1|  hypothetical protein V500_07632                         213   2e-58    
gb|KFX90591.1|  hypothetical protein V490_06379                         212   2e-58    
gb|KFY33094.1|  hypothetical protein V495_08436                         212   2e-58    
ref|XP_003739871.1|  PREDICTED: pre-mRNA-processing factor 6-like       213   2e-58    
gb|EPZ32696.1|  Tetratricopeptide-like helical domain-containing ...    213   2e-58    
gb|EJW87682.1|  pre-mRNA-splicing factor prp1                           210   3e-58    
emb|CEG81837.1|  Putative Pre-mRNA splicing factor prp1                 210   3e-58    
gb|KFY09690.1|  hypothetical protein V492_05381                         213   3e-58    
emb|CEG68489.1|  hypothetical protein RMATCC62417_04740                 213   3e-58    
ref|XP_009161109.1|  hypothetical protein, variant                      212   3e-58    
gb|KFY25220.1|  hypothetical protein V491_01858                         213   3e-58    
emb|CDS18417.1|  pre mRNA processing factor 6                           213   3e-58    
gb|EUB62279.1|  Pre-mRNA-processing factor 6                            212   3e-58    
gb|KFX95665.1|  hypothetical protein O988_05708                         212   4e-58    
gb|KFY56054.1|  hypothetical protein V497_06554                         212   5e-58    
gb|KFY26833.1|  hypothetical protein V493_03848                         212   5e-58    
gb|EJT98800.1|  hypothetical protein DACRYDRAFT_24349                   212   5e-58    
gb|KFY62438.1|  hypothetical protein V496_04599                         212   5e-58    
emb|CCJ28695.1|  unnamed protein product                                212   6e-58    
ref|XP_009161108.1|  hypothetical protein HMPREF1120_08599              212   6e-58    
gb|KFH47477.1|  Pre-mRNA-splicing factor-like protein                   211   6e-58    
gb|KHN88451.1|  Pre-mRNA-processing factor 6                            212   6e-58    
gb|KFZ00816.1|  hypothetical protein V501_10443                         211   9e-58    
gb|KFY33702.1|  hypothetical protein V494_07399                         211   1e-57    
gb|KFY79538.1|  hypothetical protein V499_01470                         211   1e-57    
gb|ELR10680.1|  pre-mRNA-processing factor 6                            211   1e-57    
ref|XP_009997015.1|  PREDICTED: pre-mRNA-processing factor 6            210   2e-57    
gb|EFQ29104.1|  PRP1 splicing factor                                    210   3e-57    
ref|XP_001551631.1|  hypothetical protein BC1G_09798                    210   3e-57    
ref|XP_008077401.1|  TPR-like protein                                   209   3e-57    
ref|XP_006678543.1|  hypothetical protein BATDEDRAFT_29905              209   4e-57    
emb|CCD43254.1|  similar to pre-mRNA-splicing factor prp1               209   4e-57    
emb|CCA14044.1|  hypothetical protein SORBIDRAFT_08g016670              210   5e-57    
emb|CCD81724.1|  putative pre-mRNA splicing factor                      198   5e-57    
ref|XP_001593581.1|  hypothetical protein SS1G_05008                    209   6e-57    
dbj|GAD98637.1|  pre-mRNA-splicing factor prp1                          209   7e-57    
gb|KDN61144.1|  putative PRP1 splicing factor                           209   7e-57    
gb|KIN06332.1|  hypothetical protein OIDMADRAFT_112324                  208   7e-57    
ref|XP_007283846.1|  mRNA splicing factor (prp1 zer1)                   208   8e-57    
gb|EQB58193.1|  PRP1 splicing factor                                    208   1e-56    
ref|XP_002564821.1|  Pc22g08050                                         208   1e-56    
ref|XP_007722982.1|  hypothetical protein A1O1_03892                    208   1e-56    
ref|XP_002541419.1|  conserved hypothetical protein                     207   2e-56    
gb|ESZ91559.1|  putative mRNA splicing factor (Prp1/Zer1)               207   2e-56    
gb|KEZ38670.1|  Pre-mRNA-splicing factor prp1                           207   2e-56    
gb|KFA66994.1|  hypothetical protein S40285_06268                       207   2e-56    
ref|XP_007864021.1|  hypothetical protein GLOTRDRAFT_115025             207   2e-56    
gb|ENN71120.1|  hypothetical protein YQE_12053                          207   2e-56    
ref|XP_007734795.1|  hypothetical protein A1O3_06486                    207   3e-56    
ref|XP_002846911.1|  pre-mRNA splicing factor                           206   3e-56    
ref|XP_002623897.1|  pre-mRNA splicing factor prp1                      207   4e-56    
ref|XP_002144562.1|  mRNA splicing factor (Prp1/Zer1), putative         206   4e-56    
ref|XP_003236211.1|  pre-mRNA splicing factor prp1                      206   4e-56    
emb|CCF45109.1|  PRP1 splicing factor                                   206   5e-56    
gb|EKG21160.1|  RNA-processing protein HAT helix                        200   5e-56    
gb|EYC28110.1|  hypothetical protein Y032_0008g345                      200   5e-56    
ref|XP_002340974.1|  mRNA splicing factor (Prp1/Zer1), putative         206   6e-56    
gb|KEY72006.1|  hypothetical protein S7711_00026                        206   6e-56    
ref|XP_003019275.1|  hypothetical protein TRV_06679                     206   6e-56    
ref|XP_003016780.1|  hypothetical protein ARB_05073                     206   7e-56    
gb|KIP06848.1|  hypothetical protein PHLGIDRAFT_72114                   206   7e-56    
ref|XP_001819214.1|  pre-mRNA-splicing factor prp1                      206   8e-56    
emb|CEI93859.1|  hypothetical protein RMCBS344292_08085                 205   8e-56    
gb|KFA45952.1|  hypothetical protein S40293_07315                       206   8e-56    
ref|XP_003050871.1|  predicted protein                                  206   8e-56    
emb|CEJ03714.1|  hypothetical protein RMCBS344292_17693                 205   9e-56    
ref|XP_002382213.1|  mRNA splicing factor (Prp1/Zer1), putative         206   9e-56    
gb|KKA22398.1|  mRNA splicing factor (Prp1/Zer1)                        206   9e-56    
gb|EEH38074.2|  pre-mRNA-splicing factor prp1                           206   1e-55    
gb|EIT73004.1|  HAT repeat protein                                      205   1e-55    
ref|XP_008554930.1|  PREDICTED: pre-mRNA-processing factor 6            205   1e-55    
ref|XP_010759201.1|  hypothetical protein PADG_03832                    205   1e-55    
gb|EEH18937.1|  hypothetical protein PABG_01256                         205   2e-55    
ref|XP_001400594.1|  pre-mRNA-splicing factor prp1                      205   2e-55    
gb|KJJ31456.1|  hypothetical protein P034_06888888                      205   2e-55    
ref|XP_003066140.1|  pre-mRNA-splicing factor prp1, putative            204   2e-55    
gb|KJK63459.1|  PRP1 splicing factor N-terminal                         205   2e-55    
ref|XP_001247216.1|  pre-mRNA splicing factor                           204   2e-55    
gb|KIV83424.1|  hypothetical protein, variant 1                         203   2e-55    
ref|XP_001260230.1|  mRNA splicing factor (Prp1/Zer1), putative         204   3e-55    
gb|KIW41698.1|  hypothetical protein, variant                           203   3e-55    
gb|EWG40666.1|  hypothetical protein FVEG_02975                         204   3e-55    
ref|XP_006968422.1|  predicted protein                                  204   4e-55    
dbj|GAM34034.1|  U4/U6 x U5 tri-snRNP complex subunit                   206   4e-55    
dbj|GAA84205.1|  mRNA splicing factor (Prp1/Zer1)                       204   5e-55    
gb|EGE03398.1|  pre-mRNA splicing factor                                202   6e-55    
gb|EHK25524.1|  hypothetical protein TRIVIDRAFT_62198                   203   6e-55    
gb|EHK39664.1|  hypothetical protein TRIATDRAFT_47890                   203   7e-55    
gb|EYE93851.1|  hypothetical protein EURHEDRAFT_413847                  203   7e-55    
gb|EPT05134.1|  hypothetical protein FOMPIDRAFT_1155763                 203   7e-55    
ref|XP_007801510.1|  hypothetical protein EPUS_04223                    203   8e-55    
gb|EZF28793.1|  hypothetical protein H101_07519                         203   8e-55    
ref|XP_007597771.1|  PRP1 splicing factor                               203   8e-55    
gb|EGD95302.1|  pre-mRNA splicing factor prp1                           203   8e-55    
ref|XP_001275225.1|  mRNA splicing factor (Prp1/Zer1), putative         203   8e-55    
gb|EWZ90300.1|  hypothetical protein FOWG_07994                         202   9e-55    
ref|XP_007399273.1|  hypothetical protein PHACADRAFT_31805              202   9e-55    



>ref|XP_006357494.1| PREDICTED: pre-mRNA-processing factor 6-like [Solanum tuberosum]
Length=1019

 Score =   379 bits (974),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGN  +AK  +ESG+K+CP+CIPLWLSLA LEE+MNGLSKARAVLTMARK+NP+NPEL
Sbjct  790   ERLGNSNKAKDAFESGIKNCPNCIPLWLSLASLEEKMNGLSKARAVLTMARKRNPQNPEL  849

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAEARH YK+EADVLMAKALQECP SGIL AASIEMAPRPQR++ S+DA KKC+ 
Sbjct  850   WLAAVRAEARHGYKREADVLMAKALQECPNSGILWAASIEMAPRPQRKTKSSDALKKCDH  909

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW +RKVDKAR+WF+RAVTLAPDIGDFWAL+++FE+Q G+E+ R+DVL+
Sbjct  910   DPHVIAAVAKLFWQERKVDKARNWFNRAVTLAPDIGDFWALYFKFEQQHGAEEQRSDVLK  969

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +CVAAEPKHGEKWQA +K+VENSH+PT+ IL++VVA LKKEEN AE N
Sbjct  970   RCVAAEPKHGEKWQATSKAVENSHEPTESILKKVVATLKKEENLAENN  1017



>ref|XP_004243341.1| PREDICTED: protein STABILIZED1 [Solanum lycopersicum]
Length=1019

 Score =   379 bits (972),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGN  +AK  +ESG+K+CP+CIPLWLSLA LEE+MNGLSKARAVLTMARK+NP+NPEL
Sbjct  790   ERLGNSNKAKDAFESGIKNCPNCIPLWLSLASLEEKMNGLSKARAVLTMARKRNPQNPEL  849

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAEARH YK+EADV+MAKALQECP SGIL AASIEMAPRPQR++ S+DA KKC+ 
Sbjct  850   WLAAVRAEARHGYKREADVMMAKALQECPNSGILWAASIEMAPRPQRKTKSSDALKKCDH  909

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW +RKVDKAR+WF+RAVTLAPDIGDFWAL+++FE+Q G+E+ R+DVL+
Sbjct  910   DPHVIAAVAKLFWQERKVDKARNWFNRAVTLAPDIGDFWALYFKFEQQHGAEEQRSDVLK  969

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +CVAAEPKHGEKWQA +K+VENSH+PT+ IL++VVA LKKEEN AE N
Sbjct  970   RCVAAEPKHGEKWQATSKAVENSHEPTESILKKVVATLKKEENLAENN  1017


 Score = 51.6 bits (122),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 87/208 (42%), Gaps = 16/208 (8%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             L N E A+   +  ++ CP  + LWL+LAKLE   N    A+ VL  AR+K PK P +W+
Sbjct  483   LANEEDARLLLQRAVECCPLHVELWLALAKLETYEN----AKKVLNKAREKLPKEPAIWI  538

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILL--AASIEMAPRPQRRSTSADAYKKCNQ  680
              A R E           ++ +A++     G+ +   A ++ A   +R  +        N 
Sbjct  539   TAARLEEADGNTASVGKIIERAIRALQREGLEIDREAWMKEAEGCERAGSLGTCQAIINN  598

Query  679   DPYV----------LAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFG  530
                V            A A+       ++ A+  ++ A+T+       W    + E+  G
Sbjct  599   TVGVGVEEEDRKRTWVADAEECKKRGSIETAKYIYAHALTVFRTKKSIWLKAAQLEKSHG  658

Query  529   SEDGRNDVLRKCVAAEPKHGEKWQAIAK  446
             + +  + VLRK V   PK    W   AK
Sbjct  659   TRESLDAVLRKAVTYIPKAEVLWLMGAK  686



>ref|XP_009591253.1| PREDICTED: protein STABILIZED1 [Nicotiana tomentosiformis]
Length=1024

 Score =   378 bits (970),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGN ++AK  YESG+K+CP+CIPLWLSLA L+E+MNGLSKARAVLTMARKKNP+N EL
Sbjct  795   ERLGNSDKAKDAYESGIKNCPNCIPLWLSLASLDEKMNGLSKARAVLTMARKKNPQNSEL  854

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAEARH+YK+EADVLMAKALQECP SGIL AASIEMAPRPQR++ S+DA KKC+ 
Sbjct  855   WLAAVRAEARHAYKREADVLMAKALQECPNSGILWAASIEMAPRPQRKTKSSDALKKCDH  914

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+ A+AKLFW +RKVDKAR+WF+RAVTLAPDIGDFWAL+ +FE+Q G+E+ RNDVL+
Sbjct  915   DPHVIVAVAKLFWQERKVDKARNWFNRAVTLAPDIGDFWALYLKFEQQHGTEEQRNDVLK  974

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +C+AAEPKHGEKWQA AK+VENSH+PT+ IL++VVA LKKEEN AE N
Sbjct  975   RCIAAEPKHGEKWQATAKAVENSHEPTESILKKVVATLKKEENLAENN  1022



>emb|CDP02726.1| unnamed protein product [Coffea canephora]
Length=1024

 Score =   377 bits (967),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 209/226 (92%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGNLEQAK TYESGLKHCP+CIPLWLSLA LEE++NGLSKARAVLTMARKKNP+NPEL
Sbjct  795   ERLGNLEQAKETYESGLKHCPNCIPLWLSLANLEEKVNGLSKARAVLTMARKKNPQNPEL  854

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEA++LM+KALQECP SGIL +A+IEMAPRPQ++S S+DAYKKC Q
Sbjct  855   WLAAVRAETRHGNKKEAEILMSKALQECPNSGILWSANIEMAPRPQKKSRSSDAYKKCEQ  914

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             +P+VLAA+AKLFW++RKVDKARS+ +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DV++
Sbjct  915   NPHVLAAVAKLFWHERKVDKARSYLNRAVTLAPDIGDFWALYYKFELQHGNEETQKDVIK  974

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +CVAAEPKHGEKWQAI+K+VENSH+PT+ IL++VV +L KEEN+AE
Sbjct  975   RCVAAEPKHGEKWQAISKAVENSHQPTEAILKKVVVSLGKEENSAE  1020



>gb|AEY85031.1| putative pre-mRNA splicing factor [Camellia sinensis]
Length=1023

 Score =   376 bits (966),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGNLEQAK  YESGLKHCP CIPLWLSLA LEE+MNGLSKARAVLTMARKKNP+NPEL
Sbjct  794   ERLGNLEQAKEAYESGLKHCPSCIPLWLSLANLEEKMNGLSKARAVLTMARKKNPQNPEL  853

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE+RH YKKEAD+LMAKALQEC  SGIL AASIEM PRPQR++ S DA KK +Q
Sbjct  854   WLAAVRAESRHGYKKEADILMAKALQECSNSGILWAASIEMVPRPQRKTKSMDALKKLDQ  913

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW DRKVDKAR+W +RAVTLAPDIGD+WAL+Y+FE Q G+E+ + DVL+
Sbjct  914   DPHVIAAVAKLFWLDRKVDKARNWLNRAVTLAPDIGDYWALYYKFELQHGTEENQKDVLK  973

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +C+AAEPKHGEKWQAI+K+VENSH+PT+ IL++VV AL KEE++AE
Sbjct  974   RCIAAEPKHGEKWQAISKAVENSHQPTEAILKKVVIALGKEESSAE  1019



>gb|KJB31690.1| hypothetical protein B456_005G202800 [Gossypium raimondii]
Length=1033

 Score =   377 bits (967),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGNLE+AK  YESGLKHCP CIPLW+SLA LEE+MNG++KARAVLT+ARKKNP+ PEL
Sbjct  803   ERLGNLEKAKGVYESGLKHCPSCIPLWVSLAILEEKMNGIAKARAVLTLARKKNPQQPEL  862

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAEARH YKKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  863   WLAAIRAEARHGYKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDH  922

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DV++
Sbjct  923   DPHVIAAVAKLFWHDRKVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVMK  982

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +CVAAEPKHGEKWQAI+K+VENSH+PT+ IL++VV  L KEE+AAE N
Sbjct  983   RCVAAEPKHGEKWQAISKAVENSHQPTEAILKKVVVVLGKEESAAENN  1030



>gb|ADN34237.1| pre-mRNA splicing factor [Cucumis melo subsp. melo]
Length=727

 Score =   369 bits (946),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERL +LE+AK  YESGLKHCP CIPLWLSLA LEE+MNGLSKARAVLTMARKKNP+NPEL
Sbjct  498   ERLKHLEKAKEAYESGLKHCPSCIPLWLSLAHLEEKMNGLSKARAVLTMARKKNPQNPEL  557

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL+AVRAE RH +KKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  558   WLSAVRAELRHGHKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDH  617

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW DRKVDKARSW +RAVTLAPD+GDFWAL+Y+FE Q G+++ + DVL+
Sbjct  618   DPHVIAAVAKLFWYDRKVDKARSWLNRAVTLAPDVGDFWALYYKFELQHGADENQKDVLK  677

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +C+AAEPKHGEKWQ I+K+VENSH+PT+ IL++VV AL KE+ A E
Sbjct  678   RCIAAEPKHGEKWQTISKAVENSHQPTESILKKVVVALGKEDGAVE  723


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 88/211 (42%), Gaps = 22/211 (10%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             L N E A+      ++ CP  + LWL+LA+LE       +A+ VL  AR+K PK P +W+
Sbjct  191   LANEEDARLLLHRAVECCPLHVELWLALARLET----YDRAKKVLNSAREKLPKEPAIWI  246

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDP  674
              A + E  +        ++ K ++     G+++     M  +    +  A +   C    
Sbjct  247   TAAKLEEANGNTAMVGKIIEKGIRALQRVGVVIDREAWM--KEAEAAERAGSVATCQAII  304

Query  673   YVLAAIAKLFWNDRK---------------VDKARSWFSRAVTLAPDIGDFWALFYRFEE  539
             +    +  +   DRK               ++ AR+ ++ A+T+       W    + E+
Sbjct  305   HNTIGVG-VEEEDRKRTWVADAEECKKRGSIETARAIYAHALTVFLTKKSIWLKAAQLEK  363

Query  538   QFGSEDGRNDVLRKCVAAEPKHGEKWQAIAK  446
               GS +  + +LRK V   P+    W   AK
Sbjct  364   SHGSRESLDALLRKAVTYRPQAEVLWLMGAK  394



>ref|XP_009793994.1| PREDICTED: LOW QUALITY PROTEIN: protein STABILIZED1-like [Nicotiana 
sylvestris]
Length=974

 Score =   373 bits (957),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGN ++AK  YESG+K+CP+CIPLWLSLA LEE+MNGLSKARAVLTMARKKNP++PE 
Sbjct  745   ERLGNSDKAKDAYESGIKNCPNCIPLWLSLASLEEKMNGLSKARAVLTMARKKNPQSPEP  804

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAV+AEARH YK+EADVLMAKALQECP SGIL AASIEMAPRPQR++ S+DA KKC+ 
Sbjct  805   WLAAVQAEARHGYKREADVLMAKALQECPNSGILWAASIEMAPRPQRKTKSSDALKKCDH  864

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+ A+AKLFW +RKV+KAR+WF+RAVTLAPDIGDFWAL+++FE+Q G+E+ RNDVL+
Sbjct  865   DPHVIVAVAKLFWQERKVEKARNWFNRAVTLAPDIGDFWALYFKFEQQHGTEEQRNDVLK  924

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +CVAAEPKHGEKWQA  K+VENSH+PT+ IL++VVA+LK+EEN AE N
Sbjct  925   RCVAAEPKHGEKWQATEKAVENSHEPTESILKKVVASLKEEENLAENN  972



>ref|XP_002267416.1| PREDICTED: protein STABILIZED1 [Vitis vinifera]
Length=1023

 Score =   374 bits (959),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER GN E+AK  Y+SGLKHCP CIPLWLSL+ LEE+MNGLSKARAVLTMARKKNP+NPEL
Sbjct  794   ERFGNFEKAKEAYDSGLKHCPSCIPLWLSLSHLEEKMNGLSKARAVLTMARKKNPQNPEL  853

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE+RH  KKEAD+LMAKALQECPTSGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  854   WLAAVRAESRHGNKKEADILMAKALQECPTSGILWAASIEMVPRPQRKTKSLDALKKCDH  913

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q GSE+ + DVLR
Sbjct  914   DPHVIAAVAKLFWHDRKVDKARTWLNRAVTLAPDIGDFWALYYKFEVQHGSEENQKDVLR  973

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +CVAAEPKHGEKWQ I+K+VENSH PT+ IL++ V AL KEE+ AE
Sbjct  974   RCVAAEPKHGEKWQVISKAVENSHLPTEAILKKAVVALGKEESVAE  1019



>gb|KHN27879.1| Pre-mRNA-processing factor 6 [Glycine soja]
Length=835

 Score =   369 bits (947),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             L ++  AK  YESGL++CP+C+PLWLSLA LEE MNGLSKARAVLTMARKKNP+NPELWL
Sbjct  608   LDHMNAAKKVYESGLRNCPNCVPLWLSLANLEEEMNGLSKARAVLTMARKKNPQNPELWL  667

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDP  674
             AAVRAE +H YKKEAD+LMAKALQECP SGIL AASIEM PRPQR++ SADA KKC+ DP
Sbjct  668   AAVRAELKHGYKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSADAIKKCDHDP  727

Query  673   YVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKC  494
             +V+AA+AKLFW DRKVDKAR+W SRAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL++C
Sbjct  728   HVIAAVAKLFWLDRKVDKARTWLSRAVTLAPDIGDFWALLYKFELQHGTEENQKDVLKRC  787

Query  493   VAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +AAEPKHGEKWQAI+K+VENSH+PT+ IL++VV AL KEENAAE N
Sbjct  788   IAAEPKHGEKWQAISKAVENSHQPTESILKKVVVALGKEENAAENN  833



>ref|XP_012088308.1| PREDICTED: protein STABILIZED1 [Jatropha curcas]
 gb|KDP24152.1| hypothetical protein JCGZ_25809 [Jatropha curcas]
Length=1025

 Score =   373 bits (957),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLG  E+AK  YESGLKHCP CIPLWLSLA LEE+MNGLSKARAVLTMARKKNP+NPEL
Sbjct  791   ERLGQFEKAKEVYESGLKHCPSCIPLWLSLANLEEKMNGLSKARAVLTMARKKNPQNPEL  850

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE+RH  KKEAD+LMAKALQECP SGIL AASIEM PRPQR+S S DA KKC+ 
Sbjct  851   WLAAVRAESRHGNKKEADILMAKALQECPNSGILWAASIEMVPRPQRKSKSMDALKKCDH  910

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTLAPD GDFWAL+Y+FE Q G+E+ + DVL+
Sbjct  911   DPHVIAAVAKLFWHDRKVDKARTWLNRAVTLAPDTGDFWALYYKFELQHGTEENQKDVLK  970

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +CVAAEPKHGEKWQAI+K+V+N+H+ T+ IL++VV AL KEENAAE N
Sbjct  971   RCVAAEPKHGEKWQAISKAVDNAHQQTEAILKKVVLALGKEENAAENN  1018



>ref|XP_010245311.1| PREDICTED: protein STABILIZED1 [Nelumbo nucifera]
Length=1020

 Score =   372 bits (956),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RLG LEQAK  YESGLKHCP CIPLWLSLA LEE+M+GLSKARA+LTMARK+NP++PEL
Sbjct  792   DRLGRLEQAKEAYESGLKHCPGCIPLWLSLANLEEKMSGLSKARAILTMARKRNPQSPEL  851

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE+RH  KKEAD+LMAKALQECPTSGIL AASIEM PRPQR++ S DA K+C+ 
Sbjct  852   WLAAVRAESRHGNKKEADILMAKALQECPTSGILWAASIEMVPRPQRKTKSMDALKRCDH  911

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DPYV+AA+AKLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL+
Sbjct  912   DPYVIAAVAKLFWHDRKVDKARNWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVLK  971

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +C+AAEPKHGE+WQAI+K+VENSH+P + IL++ V AL KEENAAE
Sbjct  972   RCIAAEPKHGERWQAISKAVENSHQPIEAILKKAVVALGKEENAAE  1017


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/211 (24%), Positives = 89/211 (42%), Gaps = 22/211 (10%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             L N E A+   +  ++ CP  + LWL+LA+LE   N    A+ VL  AR+K PK P +W+
Sbjct  485   LANEEDARLLLQRAVECCPLHVELWLALARLETYEN----AKKVLNKAREKLPKEPAIWI  540

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDP  674
              A + E  +        ++ + ++     G+++   + M  +    S  A +   C    
Sbjct  541   TAAKLEEANGNTAMVGKIIERGIRSLQREGVVIDREVWM--KEAEASERAGSVATCQAII  598

Query  673   YVLAAIAKLFWNDRK---------------VDKARSWFSRAVTLAPDIGDFWALFYRFEE  539
                  I  +   DRK               ++ AR+ ++ A+T+       W    + E+
Sbjct  599   RNTIGIG-VEEEDRKRTWVADAEECKKRGSIETARAIYAHALTVFLTKKSIWLKAAQLEK  657

Query  538   QFGSEDGRNDVLRKCVAAEPKHGEKWQAIAK  446
               G+ +  + +LRK V   P+    W   AK
Sbjct  658   SHGTRESLDALLRKAVTYRPQAEVLWLMGAK  688



>ref|XP_007043553.1| Pre-mRNA splicing factor-related [Theobroma cacao]
 gb|EOX99384.1| Pre-mRNA splicing factor-related [Theobroma cacao]
Length=1033

 Score =   372 bits (956),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E LGNLE+AK  YESGLKHCP CIPLW+SLA LEE+MNG++KARAVLT+ARKKNP+ PEL
Sbjct  803   EGLGNLEKAKEVYESGLKHCPSCIPLWVSLAILEEKMNGIAKARAVLTLARKKNPQQPEL  862

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE+RH YK+EAD+LMAKALQECP SGIL A SIEM PRPQR++ S DA KKC+ 
Sbjct  863   WLAAIRAESRHGYKREADILMAKALQECPNSGILWAVSIEMVPRPQRKTKSMDALKKCDH  922

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q GSE+ + DV++
Sbjct  923   DPHVIAAVAKLFWHDRKVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGSEENQKDVMK  982

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +CVAAEPKHGEKWQAI+K+VENSH+PT+ IL++VV AL KEE+AAE N
Sbjct  983   RCVAAEPKHGEKWQAISKAVENSHQPTEAILKKVVVALGKEESAAENN  1030



>emb|CAN65423.1| hypothetical protein VITISV_024588 [Vitis vinifera]
Length=1023

 Score =   372 bits (955),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER GN E+AK  Y+SGLKHCP CIPLWLSL+ LEE+MNGLSK RAVLTMARKKNP+NPEL
Sbjct  794   ERFGNFEKAKEAYDSGLKHCPSCIPLWLSLSHLEEKMNGLSKXRAVLTMARKKNPQNPEL  853

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE+RH  KKEAD+LMAKALQECPTSGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  854   WLAAVRAESRHGNKKEADILMAKALQECPTSGILWAASIEMVPRPQRKTKSLDALKKCDH  913

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q GSE+ + DVLR
Sbjct  914   DPHVIAAVAKLFWHDRKVDKARTWLNRAVTLAPDIGDFWALYYKFEVQHGSEENQKDVLR  973

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +CVAAEPKHGEKWQ I+K+VENSH PT+ IL++ V AL KEE+ AE
Sbjct  974   RCVAAEPKHGEKWQVISKAVENSHLPTEAILKKAVVALGKEESVAE  1019



>ref|XP_006447348.1| hypothetical protein CICLE_v10018370mg [Citrus clementina]
 ref|XP_006491644.1| PREDICTED: pre-mRNA-processing factor 6-like [Citrus sinensis]
 gb|ESR60588.1| hypothetical protein CICLE_v10018370mg [Citrus clementina]
Length=1027

 Score =   369 bits (947),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLG LEQAK  YESGLKHCP+CIPLWLSL+ LE  MNGLSKARAVLTMARKKNP+N EL
Sbjct  798   ERLGRLEQAKEAYESGLKHCPNCIPLWLSLSNLEGMMNGLSKARAVLTMARKKNPQNAEL  857

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE +H  KKEAD LMAKALQ C  SGIL AASIEM PRPQRRS SADAYK C+ 
Sbjct  858   WLAAIRAELKHGNKKEADSLMAKALQVCRKSGILWAASIEMVPRPQRRSKSADAYKNCDH  917

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q GSED + DVL+
Sbjct  918   DPHVIAAVAKLFWHDRKVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGSEDNQKDVLK  977

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +CVAAEPKHGEKWQA++K+VENSH+PT+ IL++VV AL KEE AAE N
Sbjct  978   RCVAAEPKHGEKWQAVSKAVENSHQPTEAILKKVVLALGKEETAAESN  1025



>gb|EPS73075.1| hypothetical protein M569_01676 [Genlisea aurea]
Length=1022

 Score =   369 bits (947),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGNLE+AK  YE GLKHCPDCIPLWLSL+ LEE++NG+SKARAVLTMARK+NP+NPEL
Sbjct  795   ERLGNLERAKDAYELGLKHCPDCIPLWLSLSHLEEKVNGISKARAVLTMARKRNPQNPEL  854

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL+AVRAE RH ++KEADVLMAKALQECPTSGIL AAS+EMAPRPQ R+ S DAYK+C  
Sbjct  855   WLSAVRAECRHGFRKEADVLMAKALQECPTSGILWAASVEMAPRPQHRTKSRDAYKRCGD  914

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VLAA+ K+FW++RKVDKARSWF+RAVTLAPDIGDFWA++Y+FE Q G+E+ + DVL 
Sbjct  915   DPHVLAAVGKIFWHERKVDKARSWFNRAVTLAPDIGDFWAVYYKFELQHGNEETQRDVLS  974

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +CVAAEPKHGEKWQA++K+VENSH+P + IL++VV AL KEE AA+
Sbjct  975   RCVAAEPKHGEKWQAVSKAVENSHQPPEFILKKVVLALGKEEIAAD  1020



>gb|KHN36627.1| Pre-mRNA-processing factor 6 [Glycine soja]
Length=1008

 Score =   368 bits (945),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RL  +  AK  YE+GL++CP+C+PLWLSLA LEE MNGLSK RAVLTMARKKNP+NPEL
Sbjct  779   KRLDCMNAAKKVYEAGLRNCPNCVPLWLSLANLEEEMNGLSKERAVLTMARKKNPQNPEL  838

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE +H YKKEAD+LMAKALQECP SGIL AASIEM PRPQR++ SADA KKC+ 
Sbjct  839   WLAAVRAELKHGYKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSADAIKKCDH  898

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W SRAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL+
Sbjct  899   DPHVIAAVAKLFWHDRKVDKARTWLSRAVTLAPDIGDFWALLYKFELQHGTEENQKDVLK  958

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEINE  353
             +C+AAEPKHGEKWQAI+K+VENSH+PT+ IL++VV AL KEENAAE N+
Sbjct  959   RCIAAEPKHGEKWQAISKAVENSHQPTESILKKVVVALGKEENAAENNK  1007



>ref|XP_009797442.1| PREDICTED: protein STABILIZED1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009797443.1| PREDICTED: protein STABILIZED1-like isoform X2 [Nicotiana sylvestris]
Length=1024

 Score =   369 bits (946),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGN ++AK  YESG+K+CP+CIPLWLSLA LEE+MNGLSKARAVLTMARKKNP++PEL
Sbjct  795   ERLGNSDKAKDAYESGIKNCPNCIPLWLSLASLEEKMNGLSKARAVLTMARKKNPQSPEL  854

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAEARH YK+EADVLMAKALQECP SGIL AASIEMAPRPQR++ S+DA KKC+ 
Sbjct  855   WLAAVRAEARHGYKREADVLMAKALQECPNSGILWAASIEMAPRPQRKTKSSDALKKCDH  914

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+ A+AKLFW +RKVDKAR+WF+RAVTLAPDIGDFWAL+ +FE+Q G+E+ RNDVL+
Sbjct  915   DPHVIVAVAKLFWQERKVDKARNWFNRAVTLAPDIGDFWALYLKFEQQHGTEEQRNDVLK  974

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKK  380
             +CVAAEPKHG KWQA AK+VENSH+PT+ IL++VVA LKK
Sbjct  975   RCVAAEPKHGGKWQATAKAVENSHEPTESILKKVVATLKK  1014



>ref|XP_009797444.1| PREDICTED: protein STABILIZED1-like isoform X3 [Nicotiana sylvestris]
Length=1024

 Score =   369 bits (946),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 201/220 (91%), Gaps = 0/220 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGN ++AK  YESG+K+CP+CIPLWLSLA LEE+MNGLSKARAVLTMARKKNP++PEL
Sbjct  795   ERLGNSDKAKDAYESGIKNCPNCIPLWLSLASLEEKMNGLSKARAVLTMARKKNPQSPEL  854

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAEARH YK+EADVLMAKALQECP SGIL AASIEMAPRPQR++ S+DA KKC+ 
Sbjct  855   WLAAVRAEARHGYKREADVLMAKALQECPNSGILWAASIEMAPRPQRKTKSSDALKKCDH  914

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+ A+AKLFW +RKVDKAR+WF+RAVTLAPDIGDFWAL+ +FE+Q G+E+ RNDVL+
Sbjct  915   DPHVIVAVAKLFWQERKVDKARNWFNRAVTLAPDIGDFWALYLKFEQQHGTEEQRNDVLK  974

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKK  380
             +CVAAEPKHG KWQA AK+VENSH+PT+ IL++VVA LKK
Sbjct  975   RCVAAEPKHGGKWQATAKAVENSHEPTESILKKVVATLKK  1014



>ref|XP_008459779.1| PREDICTED: pre-mRNA-processing factor 6 [Cucumis melo]
Length=1023

 Score =   368 bits (945),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERL +LE+AK  YESGLKHCP CIPLWLSLA LEE+MNGLSKARAVLTMARKKNP+NPEL
Sbjct  794   ERLKHLEKAKEAYESGLKHCPSCIPLWLSLAHLEEKMNGLSKARAVLTMARKKNPQNPEL  853

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL+AVRAE RH +KKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  854   WLSAVRAELRHGHKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDH  913

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW DRKVDKARSW +RAVTLAPD+GDFWAL+Y+FE Q G+++ + DVL+
Sbjct  914   DPHVIAAVAKLFWYDRKVDKARSWLNRAVTLAPDVGDFWALYYKFELQHGADENQKDVLK  973

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +C+AAEPKHGEKWQ I+K+VENSH+PT+ IL++VV AL KE+ A E
Sbjct  974   RCIAAEPKHGEKWQTISKAVENSHQPTESILKKVVVALGKEDGAVE  1019


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 88/211 (42%), Gaps = 22/211 (10%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             L N E A+      ++ CP  + LWL+LA+LE       +A+ VL  AR+K PK P +W+
Sbjct  487   LANEEDARLLLHRAVECCPLHVELWLALARLET----YDRAKKVLNSAREKLPKEPAIWI  542

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDP  674
              A + E  +        ++ K ++     G+++     M  +    +  A +   C    
Sbjct  543   TAAKLEEANGNTAMVGKIIEKGIRALQRVGVVIDREAWM--KEAEAAERAGSVATCQAII  600

Query  673   YVLAAIAKLFWNDRK---------------VDKARSWFSRAVTLAPDIGDFWALFYRFEE  539
             +    +  +   DRK               ++ AR+ ++ A+T+       W    + E+
Sbjct  601   HNTIGVG-VEEEDRKRTWVADAEECKKRGSIETARAIYAHALTVFLTKKSIWLKAAQLEK  659

Query  538   QFGSEDGRNDVLRKCVAAEPKHGEKWQAIAK  446
               GS +  + +LRK V   P+    W   AK
Sbjct  660   SHGSRESLDALLRKAVTYRPQAEVLWLMGAK  690



>ref|XP_004140515.1| PREDICTED: protein STABILIZED1 [Cucumis sativus]
 gb|KGN46502.1| hypothetical protein Csa_6G104100 [Cucumis sativus]
Length=1023

 Score =   368 bits (944),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERL +LE+AK  YESGLKHCP CIPLWLSLA LEE+MNGLSKARAVLTMARKKNP+NPEL
Sbjct  794   ERLKHLEKAKEAYESGLKHCPSCIPLWLSLAHLEEKMNGLSKARAVLTMARKKNPQNPEL  853

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL+AVRAE RH +KKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  854   WLSAVRAELRHGHKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDAIKKCDH  913

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW DRKVDKAR+W +RAVTLAPD+GDFWAL+Y+FE Q G ++ + DVL+
Sbjct  914   DPHVIAAVAKLFWYDRKVDKARNWLNRAVTLAPDVGDFWALYYKFELQHGGDENQKDVLK  973

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +C+AAEPKHGEKWQ I+K+VENSH+PT+ IL++VV AL KEE A E
Sbjct  974   RCIAAEPKHGEKWQTISKAVENSHQPTESILKKVVVALGKEEGAVE  1019


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 88/211 (42%), Gaps = 22/211 (10%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             L N E A+      ++ CP  + LWL+LA+LE       +A+ VL  AR+K PK P +W+
Sbjct  487   LANEEDARLLLHRAVECCPLHVELWLALARLET----YDRAKKVLNSAREKLPKEPAIWI  542

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDP  674
              A + E  +        ++ K ++     G+++     M  +    +  A +   C    
Sbjct  543   TAAKLEEANGNTAMVGKIIEKGIRALQRVGVVIDREAWM--KEAEAAERAGSVATCQAII  600

Query  673   YVLAAIAKLFWNDRK---------------VDKARSWFSRAVTLAPDIGDFWALFYRFEE  539
             +    +  +   DRK               ++ AR+ ++ A+T+       W    + E+
Sbjct  601   HNTIGVG-VEEEDRKRTWVADAEECKKRGSIETARAIYAHALTVFLTKKSIWLKAAQLEK  659

Query  538   QFGSEDGRNDVLRKCVAAEPKHGEKWQAIAK  446
               GS +  + +LRK V   P+    W   AK
Sbjct  660   SHGSRESLDALLRKAVTYRPQAEVLWLMGAK  690



>ref|XP_003540356.1| PREDICTED: pre-mRNA-processing factor 6-like [Glycine max]
Length=1041

 Score =   368 bits (945),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 201/227 (89%), Gaps = 0/227 (0%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             L ++  AK  YESGL++CP+C+PLWLSLA LEE MNGLSKARAVLTMARKKNP+NPELWL
Sbjct  814   LDHMNAAKKVYESGLRNCPNCVPLWLSLANLEEEMNGLSKARAVLTMARKKNPQNPELWL  873

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDP  674
             AAVRAE +H YKKEAD+LMAKALQECP SGIL AASIEM PRPQR++ SADA KKC+ DP
Sbjct  874   AAVRAELKHGYKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSADAIKKCDHDP  933

Query  673   YVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKC  494
             +V+AA+AKLFW DRKVDKAR+W SRAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL++C
Sbjct  934   HVIAAVAKLFWLDRKVDKARTWLSRAVTLAPDIGDFWALLYKFELQHGTEENQKDVLKRC  993

Query  493   VAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEINE  353
             +AAEPKHGEKWQAI+K+VENSH+PT+ IL++VV AL KEENAAE N+
Sbjct  994   IAAEPKHGEKWQAISKAVENSHQPTESILKKVVVALGKEENAAENNK  1040



>ref|XP_003543338.1| PREDICTED: pre-mRNA-processing factor 6-like [Glycine max]
Length=1034

 Score =   368 bits (945),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RL  +  AK  YE+GL++CP+C+PLWLSLA LEE MNGLSK RAVLTMARKKNP+NPEL
Sbjct  805   KRLDRMNAAKKVYEAGLRNCPNCVPLWLSLANLEEEMNGLSKERAVLTMARKKNPQNPEL  864

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE +H YKKEAD+LMAKALQECP SGIL AASIEM PRPQR++ SADA KKC+ 
Sbjct  865   WLAAVRAELKHGYKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSADAIKKCDH  924

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W SRAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL+
Sbjct  925   DPHVIAAVAKLFWHDRKVDKARTWLSRAVTLAPDIGDFWALLYKFELQHGTEENQKDVLK  984

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEINE  353
             +C+AAEPKHGEKWQAI+K+VENSH+PT+ IL++VV AL KEENAAE N+
Sbjct  985   RCIAAEPKHGEKWQAISKAVENSHQPTESILKKVVVALGKEENAAENNK  1033



>ref|XP_002517947.1| pre-mRNA splicing factor, putative [Ricinus communis]
 gb|EEF44465.1| pre-mRNA splicing factor, putative [Ricinus communis]
Length=1031

 Score =   368 bits (945),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER+ +L++AK  YESGLKHCP CIPLWLSLA LEE+MNGLSKARAVLTMARKKNP+NPEL
Sbjct  802   ERIFHLDKAKEVYESGLKHCPSCIPLWLSLANLEEKMNGLSKARAVLTMARKKNPQNPEL  861

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE+RH  KKE+D+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  862   WLAAVRAESRHGNKKESDILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDH  921

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL+
Sbjct  922   DPHVIAAVAKLFWHDRKVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGTEENQRDVLK  981

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +C+AAEPKHGEKWQAI+K+VEN+H+ T+ IL++VV  L KEENAAE N
Sbjct  982   RCIAAEPKHGEKWQAISKAVENAHQQTEAILKKVVIVLGKEENAAENN  1029



>ref|XP_007149863.1| hypothetical protein PHAVU_005G104900g [Phaseolus vulgaris]
 gb|ESW21857.1| hypothetical protein PHAVU_005G104900g [Phaseolus vulgaris]
Length=1041

 Score =   366 bits (940),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RL ++ +AK  YESGLK CP+ +PLWLSLA LEE MNGLSKARAVLTMARKKNP+NPEL
Sbjct  812   KRLDHMREAKKVYESGLKSCPNSVPLWLSLANLEEEMNGLSKARAVLTMARKKNPQNPEL  871

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE +H YKKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  872   WLAAVRAELKHGYKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSVDAIKKCDH  931

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL+
Sbjct  932   DPHVIAAVAKLFWHDRKVDKARTWLNRAVTLAPDIGDFWALCYKFELQHGTEENQKDVLK  991

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEINE  353
             +C+AAEPKHGEKWQAI+K+VENSH+PT+ IL++VV AL KEENAAE N+
Sbjct  992   RCIAAEPKHGEKWQAISKAVENSHQPTESILKKVVVALGKEENAAENNK  1040



>ref|XP_011458494.1| PREDICTED: LOW QUALITY PROTEIN: protein STABILIZED1-like [Fragaria 
vesca subsp. vesca]
Length=1024

 Score =   365 bits (936),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERL +L++AK TY+SGLKHC + IPLWLSLA LEE+MNGLSKARAVLTMARKKNP+NPEL
Sbjct  795   ERLNHLDKAKETYDSGLKHCSNSIPLWLSLANLEEKMNGLSKARAVLTMARKKNPQNPEL  854

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  855   WLAAVRAELRHGNKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDH  914

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+++ + DVL+
Sbjct  915   DPHVIAAVAKLFWLDRKVDKARTWLNRAVTLAPDIGDFWALYYKFELQNGTDENQKDVLK  974

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +C+AAEPKHGEKWQ I+K+VENSH+PT+ IL++VV AL KEE+AAE N
Sbjct  975   RCIAAEPKHGEKWQPISKAVENSHQPTEAILKKVVVALGKEESAAENN  1022



>ref|XP_010918430.1| PREDICTED: protein STABILIZED1 [Elaeis guineensis]
 ref|XP_010918431.1| PREDICTED: protein STABILIZED1 [Elaeis guineensis]
Length=1036

 Score =   365 bits (936),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 198/222 (89%), Gaps = 0/222 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLG  EQAK  YE+GLKHCP+CIPLWLSLA LEERMNGLSKARAVLTMARKKNP++PEL
Sbjct  805   ERLGQGEQAKEAYENGLKHCPNCIPLWLSLANLEERMNGLSKARAVLTMARKKNPQSPEL  864

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE+RH  KKEAD LMAKALQECPTSGIL AASIEM PRPQR+S SADA K+C+ 
Sbjct  865   WLAAIRAESRHGNKKEADTLMAKALQECPTSGILWAASIEMVPRPQRKSKSADALKRCDH  924

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW DRKVDKAR+WF+RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL+
Sbjct  925   DPHVIAAVAKLFWYDRKVDKARNWFNRAVTLAPDIGDFWALYYKFELQHGTEEQQKDVLK  984

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEE  374
             +C++AEPKHGE+WQAI+K+VENSH P + +L++ V AL KEE
Sbjct  985   RCISAEPKHGERWQAISKAVENSHLPIEALLKKAVVALGKEE  1026



>ref|XP_009342654.1| PREDICTED: protein STABILIZED1-like [Pyrus x bretschneideri]
Length=998

 Score =   360 bits (925),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 201/228 (88%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLG+LE+AK  Y+SG KHC   IPLWLSLA LEE+M+GLSKARA+LTMARKKNP++PEL
Sbjct  769   ERLGHLEKAKEAYDSGQKHCSSSIPLWLSLANLEEKMSGLSKARAILTMARKKNPQDPEL  828

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  829   WLAAVRAELRHGNKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDH  888

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA++KLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL+
Sbjct  889   DPHVIAAVSKLFWHDRKVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVLK  948

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +C+AAEPKHGEKWQ I+K+VENSH+PT+ +L++VV AL KEE+AAE N
Sbjct  949   RCIAAEPKHGEKWQPISKAVENSHQPTEAVLKKVVVALGKEESAAENN  996



>ref|XP_009357821.1| PREDICTED: protein STABILIZED1-like [Pyrus x bretschneideri]
Length=1026

 Score =   360 bits (925),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLG+LE+AK  Y+SGLK+C   IPLWLSLA LEE+M GLSKARA+LTMARKKNP+NPEL
Sbjct  797   ERLGHLEKAKEAYDSGLKYCSSSIPLWLSLANLEEKMTGLSKARAILTMARKKNPQNPEL  856

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  857   WLAAVRAELRHGNKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDH  916

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA++KLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+++ + DVL+
Sbjct  917   DPHVIAAVSKLFWHDRKVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGTDENQKDVLK  976

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEINE  353
             +C++AEPKHGEKWQ I+K+VENSH+PT+ IL++VV AL KEE+AAE N+
Sbjct  977   RCISAEPKHGEKWQPISKAVENSHQPTEAILKKVVVALGKEESAAENNK  1025



>ref|XP_010099575.1| Pre-mRNA-processing factor 6 [Morus notabilis]
 gb|EXB79641.1| Pre-mRNA-processing factor 6 [Morus notabilis]
Length=1024

 Score =   360 bits (925),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 167/229 (73%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLG LE+AK  Y SGLK CP+CIPLW+SL+ LEE MNGLSKARAVLTMARKKNP+NPEL
Sbjct  795   ERLGRLEKAKEAYYSGLKQCPNCIPLWISLSTLEEEMNGLSKARAVLTMARKKNPQNPEL  854

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE +H  KKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  855   WLAAVRAELKHGNKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDAVKKCDH  914

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTL PDIGDFWAL Y+FE Q G+E+ + DVL+
Sbjct  915   DPHVIAAVAKLFWHDRKVDKARTWLNRAVTLGPDIGDFWALCYKFELQHGNEETQKDVLK  974

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEINE  353
             KC+AAEPKHGEKWQA++K+VENSH+P + +L++VV A  KEE+AAE N+
Sbjct  975   KCIAAEPKHGEKWQAVSKAVENSHQPIEAVLKKVVVAFGKEESAAENNK  1023



>ref|XP_010035719.1| PREDICTED: protein STABILIZED1 [Eucalyptus grandis]
 gb|KCW47157.1| hypothetical protein EUGRSUZ_K00962 [Eucalyptus grandis]
Length=1030

 Score =   360 bits (925),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 195/222 (88%), Gaps = 0/222 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLG+LEQAK  YESGLKHC  CIPLW+SLAKLEE  NGLSKARAVLT+ARKKNP   EL
Sbjct  803   ERLGHLEQAKEVYESGLKHCSSCIPLWISLAKLEEMTNGLSKARAVLTLARKKNPAKDEL  862

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE+RH  KKEAD+LMAKALQECPTSGIL AASIEMAPRPQR++ +ADA+KKCN 
Sbjct  863   WLAAIRAESRHGNKKEADILMAKALQECPTSGILWAASIEMAPRPQRKTKTADAFKKCNN  922

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V  A+AKLFW+DRKVDKAR+W +RAVTL PD+GDFWAL+Y+FE Q G+ED + DVL 
Sbjct  923   DPHVFVALAKLFWHDRKVDKARTWLNRAVTLKPDVGDFWALYYKFELQHGTEDTQKDVLM  982

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEE  374
             +CVAAEPK+GEKWQ I+K+VENSH+PT+ IL++VV AL KEE
Sbjct  983   RCVAAEPKYGEKWQVISKAVENSHQPTEAILKKVVVALGKEE  1024


 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 89/211 (42%), Gaps = 22/211 (10%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             L N E A+      ++ CP  + LWL+LA+LE   N    A+ VL  AR++  K P +W+
Sbjct  496   LSNEENARILLHRAVESCPLHVELWLALARLETYDN----AKKVLNRARERLSKEPAIWI  551

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDP  674
              A + E  +        ++ + ++     G+++   + M  +    +  A +   C    
Sbjct  552   TAAKLEEANGNTSMVGKIIERGIRALQREGVVIDRELWM--KEAEAAERAGSVTTCQAII  609

Query  673   YVLAAIAKLFWNDRK---------------VDKARSWFSRAVTLAPDIGDFWALFYRFEE  539
             +    I  +   DRK               ++ AR+ ++ A+T+       W    + E+
Sbjct  610   HNTIGIG-VEEEDRKRTWVADAEECKKRGSIETARAIYAHALTVFLTKKSIWLKAAQLEK  668

Query  538   QFGSEDGRNDVLRKCVAAEPKHGEKWQAIAK  446
               G+++  + +LRK V   P+    W   AK
Sbjct  669   SHGTKESLDALLRKAVTYRPQAEVLWLMGAK  699



>ref|NP_001064969.1| Os10g0498600 [Oryza sativa Japonica Group]
 dbj|BAF26883.1| Os10g0498600, partial [Oryza sativa Japonica Group]
Length=428

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RLG+  +AK  YE+ LKHCP CIPLWLSLA LEE++NGLSK+RAVLTMARKKNP  PEL
Sbjct  200   DRLGHGSKAKEVYENALKHCPSCIPLWLSLANLEEKINGLSKSRAVLTMARKKNPATPEL  259

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEAD L+AKALQECPTSGIL AA+IEM PRPQR++ S+DA K+C+ 
Sbjct  260   WLAAVRAELRHGNKKEADALLAKALQECPTSGILWAAAIEMVPRPQRKAKSSDAIKRCDH  319

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  320   DPHVIAAVAKLFWHDRKVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQKDVLQ  379

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +CVAAEPKHGE+WQAI K+VENSH   + +L++ V AL +EEN
Sbjct  380   RCVAAEPKHGERWQAITKAVENSHLSIEALLKKAVLALGQEEN  422



>ref|XP_009401680.1| PREDICTED: protein STABILIZED1 [Musa acuminata subsp. malaccensis]
Length=1035

 Score =   358 bits (919),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RLG+ EQAK  YE+GLKHCP C+ LWLSLA LEERM+GLSKARAVLTMARKKNP+NPEL
Sbjct  804   DRLGHGEQAKEAYENGLKHCPHCVHLWLSLANLEERMSGLSKARAVLTMARKKNPQNPEL  863

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+R+E+RH  KKEAD LMAKA+QECPTSGIL A SIEM PRPQR++ SADA K+C+ 
Sbjct  864   WLAAIRSESRHGNKKEADSLMAKAVQECPTSGILWAESIEMVPRPQRKTKSADALKRCDH  923

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DPYV++A+AKLFW DRKVDKAR+WF+RAV LAPD+GDFWAL+Y+FE Q G+E+ + DVL+
Sbjct  924   DPYVISAVAKLFWQDRKVDKARNWFNRAVILAPDVGDFWALYYKFELQHGTEETQKDVLK  983

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +C+AAEPKHGEKWQAI+K+VENSH PT+ +L++ V AL KEEN   I+
Sbjct  984   RCMAAEPKHGEKWQAISKAVENSHLPTEALLKKAVVALGKEENPTVID  1031



>gb|EYU26151.1| hypothetical protein MIMGU_mgv1a000662mg [Erythranthe guttata]
 gb|EYU26152.1| hypothetical protein MIMGU_mgv1a000662mg [Erythranthe guttata]
Length=1027

 Score =   358 bits (918),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERL NL++AK TYE GLKHC +CI LWLSLA LEE++NGLSKARA+LTMARKKNP+NP L
Sbjct  798   ERLSNLDKAKETYELGLKHCQNCIQLWLSLAHLEEKVNGLSKARAILTMARKKNPQNPHL  857

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAV AEARH  KKE+D+LMAKALQECPTSGIL AASIEM  RPQ+++ S DAYKKC  
Sbjct  858   WLAAVWAEARHGNKKESDILMAKALQECPTSGILWAASIEMVSRPQQKTKSRDAYKKCGD  917

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VLAA+ ++FW+DRKVDKARSWF+RAVTL+PDIGDFWAL+Y+FE Q G+E+ + DVL 
Sbjct  918   DPHVLAAVGRIFWHDRKVDKARSWFNRAVTLSPDIGDFWALYYKFELQHGTEETQRDVLN  977

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +CV AEPKHGEKWQAI+K+VENSH+PT+ IL++VV A+ KEE+AAE
Sbjct  978   RCVTAEPKHGEKWQAISKAVENSHQPTEFILKKVVVAIGKEEHAAE  1023



>ref|XP_008809401.1| PREDICTED: protein STABILIZED1 [Phoenix dactylifera]
Length=1035

 Score =   357 bits (917),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER G  E+AK  YE+GLKHCP+CI LWLSLA LEERMNGLSKARAVLTMARKKNP++PEL
Sbjct  804   ERFGRGERAKEDYENGLKHCPNCISLWLSLANLEERMNGLSKARAVLTMARKKNPQSPEL  863

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE+RH  KKEAD LMAKALQECPTSGIL AASIEM PRPQR+S SADA K+C+ 
Sbjct  864   WLAAIRAESRHGNKKEADSLMAKALQECPTSGILWAASIEMVPRPQRKSKSADALKRCDH  923

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+WF+RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL+
Sbjct  924   DPHVIAAVAKLFWHDRKVDKARNWFNRAVTLAPDIGDFWALYYKFELQHGTEEQQKDVLK  983

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +C++AEPKHGE+WQAI+K+VENSH P + +L++ V  L KEE++   +
Sbjct  984   RCISAEPKHGERWQAISKAVENSHLPIEAVLKKAVVVLGKEESSTTTD  1031



>ref|XP_008342929.1| PREDICTED: pre-mRNA-processing factor 6-like [Malus domestica]
Length=1026

 Score =   356 bits (914),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERL +LE+AK  Y+SG KHC   IPLWLSLA LEE+M+GLSKARA+LTMARKKNP+NPEL
Sbjct  797   ERLXHLEKAKEAYDSGQKHCSSSIPLWLSLANLEEKMSGLSKARAILTMARKKNPQNPEL  856

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  857   WLAAVRAELRHGNKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDH  916

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA++KLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL+
Sbjct  917   DPHVIAAVSKLFWHDRKVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVLK  976

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +C+AA+P HGEKWQ I+K+VENSH+PT+ IL++VV AL KEE+AAE N
Sbjct  977   RCIAADPXHGEKWQPISKAVENSHQPTEAILKKVVVALGKEESAAENN  1024



>gb|AEO72346.2| Prp1 protein [Hordeum vulgare subsp. vulgare]
Length=955

 Score =   355 bits (910),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +R+G++ +AK  YE+GLKHCP CIPLWLSLA LEER+NGLSK+RA LTMARKKNP  PEL
Sbjct  727   DRIGHVPKAKEVYENGLKHCPGCIPLWLSLASLEERINGLSKSRAFLTMARKKNPATPEL  786

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  KKEAD L+AKALQECPTSGIL AA+IEM PRPQR+S S+DA K+C+ 
Sbjct  787   WLAAIRAELRHGNKKEADSLLAKALQECPTSGILWAAAIEMVPRPQRKSKSSDAIKRCDH  846

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  847   DPHVIAAVAKLFWHDRKVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQKDVLK  906

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +C+AAEPKHGE+WQAI+K+VENSH P D ILR+VV AL  EEN
Sbjct  907   RCIAAEPKHGERWQAISKAVENSHLPVDAILRKVVLALGAEEN  949



>dbj|BAK00717.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=955

 Score =   354 bits (909),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +R+G++ +AK  YE+GLKHCP CIPLWLSLA LEER+NGLSK+RA LTMARKKNP  PEL
Sbjct  727   DRIGHVPKAKEVYENGLKHCPGCIPLWLSLASLEERINGLSKSRAFLTMARKKNPATPEL  786

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  KKEAD L+AKALQECPTSGIL AA+IEM PRPQR+S S+DA K+C+ 
Sbjct  787   WLAAIRAELRHGNKKEADSLLAKALQECPTSGILWAAAIEMVPRPQRKSKSSDAIKRCDH  846

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  847   DPHVIAAVAKLFWHDRKVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQKDVLK  906

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +C+AAEPKHGE+WQAI+K+VENSH P D ILR+VV AL  EEN
Sbjct  907   RCIAAEPKHGERWQAISKAVENSHLPVDAILRKVVLALGAEEN  949



>ref|XP_008229166.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6 
[Prunus mume]
Length=1026

 Score =   354 bits (909),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 197/228 (86%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLG+LE+AK  Y+SGLKHC + IPLWLS A LEE+M GLSKARAVLTM RKKNP+NPEL
Sbjct  797   ERLGHLEKAKEAYDSGLKHCSNSIPLWLSRANLEEKMVGLSKARAVLTMGRKKNPQNPEL  856

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  857   WLAAVRAELRHGNKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDH  916

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL+
Sbjct  917   DPHVIAAVAKLFWHDRKVDKARNWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVLK  976

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +C AAEPKHGEKWQ I+K+VENSH+  + IL++VV AL KEE+AAE N
Sbjct  977   RCEAAEPKHGEKWQPISKAVENSHQSIEAILKKVVVALGKEESAAENN  1024



>gb|EMT09961.1| Pre-mRNA-processing factor 6 [Aegilops tauschii]
Length=946

 Score =   352 bits (903),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 194/223 (87%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +R+G++ +AK  YE+GLKHCP CI LWLSLA LEER+NGLSK+RA LTMARKKNP  PEL
Sbjct  718   DRIGHVGKAKEVYENGLKHCPGCIHLWLSLASLEERINGLSKSRAFLTMARKKNPATPEL  777

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  KKEAD L+AKALQECPTSGIL AA+IEM PRPQR+S S+DA K+C+ 
Sbjct  778   WLAAIRAELRHGNKKEADSLLAKALQECPTSGILWAAAIEMVPRPQRKSKSSDAIKRCDH  837

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  838   DPHVIAAVAKLFWHDRKVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQRDVLK  897

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +C+AAEPKHGE+WQAI+K+VENSH+P D ILR+VV AL  EEN
Sbjct  898   RCIAAEPKHGERWQAISKAVENSHQPVDAILRKVVLALGAEEN  940



>ref|XP_007214916.1| hypothetical protein PRUPE_ppa000712mg [Prunus persica]
 gb|EMJ16115.1| hypothetical protein PRUPE_ppa000712mg [Prunus persica]
Length=1026

 Score =   353 bits (907),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 197/228 (86%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLG+LE+AK  Y+SGLKHC + IPLWLS A LEE+M GLSKARAVLTM RKKNP+NPEL
Sbjct  797   ERLGHLEKAKEAYDSGLKHCSNSIPLWLSRANLEEKMVGLSKARAVLTMGRKKNPQNPEL  856

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ 
Sbjct  857   WLAAVRAELRHGNKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDH  916

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL+
Sbjct  917   DPHVIAAVAKLFWHDRKVDKARNWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVLK  976

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +C AAEPKHGEKWQ I+K+VENSH+  + IL++VV AL KEE+AAE N
Sbjct  977   RCEAAEPKHGEKWQPISKAVENSHQSFEAILKKVVVALGKEESAAENN  1024



>gb|EMS45135.1| Pre-mRNA-processing factor 6 [Triticum urartu]
Length=1063

 Score =   354 bits (908),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 195/223 (87%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +R+G++ +AK  YE+GLKHCP CIPLWLSLA LEER+NGLSK+RA LTM+RKKNP  PEL
Sbjct  835   DRIGHVGKAKEVYENGLKHCPGCIPLWLSLASLEERINGLSKSRAFLTMSRKKNPATPEL  894

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  KKEAD L+AKALQECPTSGIL AA+IEM PRPQR+S S+DA K+C+ 
Sbjct  895   WLAAIRAELRHGNKKEADSLLAKALQECPTSGILWAAAIEMVPRPQRKSKSSDAIKRCDH  954

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  955   DPHVIAAVAKLFWHDRKVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQRDVLK  1014

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +C+AAEPKHGE+WQAI+K+VENSH+P D ILR+VV AL  EEN
Sbjct  1015  RCIAAEPKHGERWQAISKAVENSHQPVDAILRKVVLALGAEEN  1057



>ref|XP_010685372.1| PREDICTED: protein STABILIZED1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010685373.1| PREDICTED: protein STABILIZED1 [Beta vulgaris subsp. vulgaris]
Length=1024

 Score =   352 bits (903),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 194/228 (85%), Gaps = 0/228 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER G   +AK  YESGLK+CP CI LWLSLA LEE   GLSKARAVLTMARK+NP+NPEL
Sbjct  794   ERFGEQAKAKEAYESGLKNCPHCITLWLSLANLEETRTGLSKARAVLTMARKRNPRNPEL  853

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH +KKEAD L+AKALQECP SGIL AA IE  PRPQR++ S+DA  KC+Q
Sbjct  854   WLAAVRAELRHGHKKEADNLLAKALQECPNSGILWAAQIENVPRPQRKAKSSDALTKCDQ  913

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ED + DVLR
Sbjct  914   DPHVIAAVAKLFWHDRKVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGTEDLQKDVLR  973

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
             +CVAAEPKHGEKWQ IAK+VEN+H+PT+ IL++VV AL KEENAA  N
Sbjct  974   RCVAAEPKHGEKWQPIAKAVENAHQPTEAILKKVVIALGKEENAAGNN  1021



>ref|XP_004514211.1| PREDICTED: pre-mRNA-processing factor 6-like [Cicer arietinum]
Length=1043

 Score =   352 bits (904),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = -1

Query  1036  RLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELW  857
             R  ++ +AK  YESGLK C + +PLWLSLA LEE M+GLSKARAVLTM RKKNP+NPELW
Sbjct  815   RHTHMMEAKKVYESGLKSCANSVPLWLSLANLEEEMSGLSKARAVLTMGRKKNPQNPELW  874

Query  856   LAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQD  677
             LAAVRAE +H YKKEAD+LMAKALQECP SGIL AASIEM PRPQR++ S DA KKC+ D
Sbjct  875   LAAVRAELKHGYKKEADILMAKALQECPNSGILWAASIEMVPRPQRKTKSMDALKKCDHD  934

Query  676   PYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRK  497
             P+V+AA+AKLFW DRKVDKAR+W +RAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL++
Sbjct  935   PHVIAAVAKLFWLDRKVDKARTWLNRAVTLAPDIGDFWALCYKFELQHGTEENQKDVLKR  994

Query  496   CVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             CVAAEPKHGEKWQA++K+VENSH+PT+ IL++VV AL KEENAAE
Sbjct  995   CVAAEPKHGEKWQAVSKAVENSHQPTESILKKVVIALGKEENAAE  1039



>ref|XP_002319361.2| hypothetical protein POPTR_0013s13900g [Populus trichocarpa]
 gb|EEE95284.2| hypothetical protein POPTR_0013s13900g [Populus trichocarpa]
Length=945

 Score =   348 bits (894),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 197/230 (86%), Gaps = 1/230 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGNL++AK  YE+GLK CP  +PLWLSLA LEE+ NGLSKARAVLTMARKKNPKNPEL
Sbjct  715   ERLGNLDKAKEIYEAGLKSCPSHVPLWLSLANLEEKTNGLSKARAVLTMARKKNPKNPEL  774

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCN-  683
             WLAA+RAE+RH   KEAD LMAKALQECPTSGIL AASIEMAPR Q +S SADA KKC+ 
Sbjct  775   WLAAIRAESRHGNNKEADNLMAKALQECPTSGILWAASIEMAPRAQHKSKSADAIKKCSP  834

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
              DP+V  A+AKLFW +RKVDKARSW +RAVTLAPDIGDFWA +Y+FE Q G+E+ + DVL
Sbjct  835   HDPHVTTAVAKLFWRERKVDKARSWLNRAVTLAPDIGDFWAYYYKFELQHGNEEDQKDVL  894

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEINE  353
             ++C+AAEPKHGEKWQ I+K+VENSH+PT+ IL++VV  L KEE+A+E N+
Sbjct  895   KRCIAAEPKHGEKWQTISKAVENSHQPTEAILKKVVVVLGKEESASENND  944



>ref|XP_011045503.1| PREDICTED: protein STABILIZED1-like [Populus euphratica]
 ref|XP_011045504.1| PREDICTED: protein STABILIZED1-like [Populus euphratica]
 ref|XP_011045506.1| PREDICTED: protein STABILIZED1-like [Populus euphratica]
 ref|XP_011015402.1| PREDICTED: protein STABILIZED1-like isoform X1 [Populus euphratica]
 ref|XP_011015403.1| PREDICTED: protein STABILIZED1-like isoform X2 [Populus euphratica]
Length=1024

 Score =   350 bits (898),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 197/230 (86%), Gaps = 1/230 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGNLE+AK  Y++GLK CP  +PLWLSLA LEE+ NGLSKARAVLTMARKKNPKNPEL
Sbjct  794   ERLGNLEKAKEIYDAGLKSCPSHVPLWLSLANLEEKTNGLSKARAVLTMARKKNPKNPEL  853

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCN-  683
             WLAA+RAE+RH   KEAD LMAKALQECPTSGIL AASIEMAPR Q +S SADA KKC+ 
Sbjct  854   WLAAIRAESRHGNNKEADNLMAKALQECPTSGILWAASIEMAPRAQHKSKSADAIKKCSP  913

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
              DP+V  A+AKLFW +RKVDKARSW +RAVTLAPDIGDFWA +Y+FE Q G+E+ + DVL
Sbjct  914   HDPHVTTAVAKLFWRERKVDKARSWLNRAVTLAPDIGDFWAYYYKFELQHGTEEDQKDVL  973

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEINE  353
             ++C+AAEPKHGEKWQ I+K+VENSH+PT+ IL++VV  L KEE+A+E N+
Sbjct  974   KRCIAAEPKHGEKWQTISKAVENSHQPTEAILKKVVVVLGKEESASENND  1023


 Score = 51.6 bits (122),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/210 (23%), Positives = 89/210 (42%), Gaps = 20/210 (10%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             L N E A++     ++ CP  + LWL+ A+LE   N    AR VL  AR+K PK P +W+
Sbjct  487   LCNEEDARTLLGRAVECCPLHVELWLAFARLETYEN----ARKVLNRAREKLPKEPAIWI  542

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILL--------------AASIEMAPRPQRR  716
              A + E  +        L+ + ++     G+++              A S+       + 
Sbjct  543   TAAKLEEANGNTPMVGKLIERGIRALQREGVVIDREEWMKEAEAAERAGSVATCQAIIKN  602

Query  715   STSADAYKKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQ  536
             +      ++  +  +V  A A+       ++ AR+ ++ A+T+       W    + E+ 
Sbjct  603   TIGIGVEEEDRKRTWV--ADAEECKKRGSIETARAIYAHALTVFLTKKSIWLKAAQLEKS  660

Query  535   FGSEDGRNDVLRKCVAAEPKHGEKWQAIAK  446
              G+ +  + +LRK V   P+    W   AK
Sbjct  661   HGTRESLDALLRKAVTYRPQAEVLWLMGAK  690



>gb|KEH23176.1| pre-mRNA splicing factor-like protein [Medicago truncatula]
Length=1054

 Score =   348 bits (893),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -1

Query  1018  QAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVRA  839
             +AK  Y+SGLK CP+ +PLWLSLA LEE M+GLSKARA LTMARK+NP+NPELWLAAVRA
Sbjct  832   EAKKVYDSGLKSCPNSVPLWLSLANLEEEMSGLSKARAALTMARKRNPQNPELWLAAVRA  891

Query  838   EARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLAA  659
             E +H YKKEAD+LMAKALQECP SGIL AASIEMAPRPQR+S S DA KKC  DP+V+AA
Sbjct  892   ELKHGYKKEADILMAKALQECPNSGILWAASIEMAPRPQRKSKSMDALKKCEHDPHVIAA  951

Query  658   IAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEP  479
             +AKLFW DRKVDKAR+W ++AVTLAPD+GDFWAL Y+FE Q G+E+ + DVL++CVAAEP
Sbjct  952   VAKLFWIDRKVDKARNWLNKAVTLAPDVGDFWALLYKFELQHGTEENQKDVLKRCVAAEP  1011

Query  478   KHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             KHGEKWQ ++K+VENSH+PT+ IL++VV AL KEE AAE
Sbjct  1012  KHGEKWQPVSKAVENSHQPTESILKKVVIALGKEEKAAE  1050



>emb|CBI28774.3| unnamed protein product [Vitis vinifera]
Length=747

 Score =   338 bits (868),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -1

Query  973  CIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVRAEARHSYKKEADVLMA  794
            CIPLWLSL+ LEE+MNGLSKARAVLTMARKKNP+NPELWLAAVRAE+RH  KKEAD+LMA
Sbjct  472  CIPLWLSLSHLEEKMNGLSKARAVLTMARKKNPQNPELWLAAVRAESRHGNKKEADILMA  531

Query  793  KALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLAAIAKLFWNDRKVDKAR  614
            KALQECPTSGIL AASIEM PRPQR++ S DA KKC+ DP+V+AA+AKLFW+DRKVDKAR
Sbjct  532  KALQECPTSGILWAASIEMVPRPQRKTKSLDALKKCDHDPHVIAAVAKLFWHDRKVDKAR  591

Query  613  SWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAIAKSVEN  434
            +W +RAVTLAPDIGDFWAL+Y+FE Q GSE+ + DVLR+CVAAEPKHGEKWQ I+K+VEN
Sbjct  592  TWLNRAVTLAPDIGDFWALYYKFEVQHGSEENQKDVLRRCVAAEPKHGEKWQVISKAVEN  651

Query  433  SHKPTDEILRQVVAALKKEENAAE  362
            SH PT+ IL++ V AL KEE+ AE
Sbjct  652  SHLPTEAILKKAVVALGKEESVAE  675



>ref|XP_006662478.1| PREDICTED: pre-mRNA-processing factor 6-like, partial [Oryza 
brachyantha]
Length=896

 Score =   342 bits (877),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RLG+  +AK  YE+ LKHCP CIPLWLSLA LEE++NGLSK+RAVLTMARKKNP  PEL
Sbjct  668   DRLGHGAKAKEVYENALKHCPSCIPLWLSLANLEEKINGLSKSRAVLTMARKKNPATPEL  727

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEAD L+AKALQECPTSGIL AA+IEM PRPQR++ S+DA K+C+ 
Sbjct  728   WLAAVRAELRHGNKKEADALLAKALQECPTSGILWAAAIEMVPRPQRKAKSSDAIKRCDH  787

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSW +RAVTL+PDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  788   DPHVIAAVAKLFWHDRKVDKARSWLNRAVTLSPDIGDFWALYYKFELQHGNADTQKDVLQ  847

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +CVAAEPKHGE+WQAI K+VENSH   + +L++ V AL +EEN
Sbjct  848   RCVAAEPKHGERWQAITKAVENSHLSVEALLKKAVVALGQEEN  890


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 49/208 (24%), Positives = 92/208 (44%), Gaps = 16/208 (8%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             L N E A+      ++ CP  + LWL+LA+LE       +A+ VL  AR+K PK P +W+
Sbjct  361   LANEEDARLLLHRAVECCPLHVELWLALARLE----TYDQAKKVLNKAREKLPKEPAIWI  416

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILL--AASIEMAPRPQRRST--SADAYKKC  686
              A + E  +   +  + ++ ++++     G+ +   A ++ A   +R  +  +  A  K 
Sbjct  417   TAAKLEEANGNTQSVNKVIERSIRTLQREGLDIDREAWLKEAEAAERAGSVLTCQAIVKN  476

Query  685   NQDPYVLAAIAKLFW--------NDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFG  530
                  V     K  W            ++ AR+ ++ A+++       W    + E+  G
Sbjct  477   TIGIGVDDEDRKRTWVADAEECKKRGSIETARAIYAHALSVFVSKKSIWLKAAQLEKSHG  536

Query  529   SEDGRNDVLRKCVAAEPKHGEKWQAIAK  446
             ++D   ++LRK V   P+    W   AK
Sbjct  537   TKDSLYNLLRKAVTYNPRAEVLWLMSAK  564



>gb|EMT02936.1| Pre-mRNA-processing factor 6 [Aegilops tauschii]
Length=918

 Score =   342 bits (877),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 193/230 (84%), Gaps = 1/230 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +R+G   +AK  YE+GLKHCP CIPLWLSLA LEER+NGLSK+RA LTMARKKNP  PEL
Sbjct  690   DRIGRGAKAKEVYENGLKHCPGCIPLWLSLANLEERINGLSKSRAFLTMARKKNPATPEL  749

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE  H  KKEA  L+AKAL+ECPTSG+L AA+IEM PRPQR+S S+DA K+C+ 
Sbjct  750   WLAAIRAELGHGNKKEAGSLLAKALRECPTSGVLWAAAIEMVPRPQRKSKSSDAIKRCDH  809

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSW +RAV+LAPDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  810   DPHVIAAVAKLFWHDRKVDKARSWLNRAVSLAPDIGDFWALYYKFELQHGNADTQRDVLK  869

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEINEP  350
             +C+AAEPKHGE+WQA +K+VENSH+P D ILR+VV AL  EEN   + EP
Sbjct  870   RCIAAEPKHGERWQATSKAVENSHQPIDAILRRVVLALGVEEN-PNVTEP  918



>gb|EEE51217.1| hypothetical protein OsJ_32045 [Oryza sativa Japonica Group]
Length=1004

 Score =   343 bits (879),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RLG+  +AK  YE+ LKHCP CIPLWLSLA LEE++NGLSK+RAVLTMARKKNP  PEL
Sbjct  776   DRLGHGSKAKEVYENALKHCPSCIPLWLSLANLEEKINGLSKSRAVLTMARKKNPATPEL  835

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEAD L+AKALQECPTSGIL AA+IEM PRPQR++ S+DA K+C+ 
Sbjct  836   WLAAVRAELRHGNKKEADALLAKALQECPTSGILWAAAIEMVPRPQRKAKSSDAIKRCDH  895

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  896   DPHVIAAVAKLFWHDRKVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQKDVLQ  955

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +CVAAEPKHGE+WQAI K+VENSH   + +L++ V AL +EEN
Sbjct  956   RCVAAEPKHGERWQAITKAVENSHLSIEALLKKAVLALGQEEN  998



>gb|AAL58273.1|AC068923_15 putative pre-mRNA splicing factor [Oryza sativa Japonica Group]
 gb|AAP54456.1| U5 snRNP-associated 102 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAY79087.1| hypothetical protein OsI_34194 [Oryza sativa Indica Group]
Length=1039

 Score =   342 bits (878),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RLG+  +AK  YE+ LKHCP CIPLWLSLA LEE++NGLSK+RAVLTMARKKNP  PEL
Sbjct  811   DRLGHGSKAKEVYENALKHCPSCIPLWLSLANLEEKINGLSKSRAVLTMARKKNPATPEL  870

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE RH  KKEAD L+AKALQECPTSGIL AA+IEM PRPQR++ S+DA K+C+ 
Sbjct  871   WLAAVRAELRHGNKKEADALLAKALQECPTSGILWAAAIEMVPRPQRKAKSSDAIKRCDH  930

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  931   DPHVIAAVAKLFWHDRKVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQKDVLQ  990

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +CVAAEPKHGE+WQAI K+VENSH   + +L++ V AL +EEN
Sbjct  991   RCVAAEPKHGERWQAITKAVENSHLSIEALLKKAVLALGQEEN  1033



>ref|XP_010234868.1| PREDICTED: protein STABILIZED1 [Brachypodium distachyon]
Length=960

 Score =   340 bits (871),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 188/222 (85%), Gaps = 0/222 (0%)
 Frame = -1

Query  1036  RLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELW  857
             R+G+  +AK  YE+GLKHCP  IPLWLSLA LEE +NGLSK+RA LTMARKKNP  PELW
Sbjct  733   RIGHGARAKEVYENGLKHCPSSIPLWLSLASLEEVINGLSKSRAFLTMARKKNPGRPELW  792

Query  856   LAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQD  677
             LAA+RAE RH  KKEAD L+AKALQECPTSGIL AA+IEM PRPQR+S S+DA K+C+ D
Sbjct  793   LAAIRAELRHGNKKEADALLAKALQECPTSGILWAAAIEMVPRPQRKSKSSDALKRCDHD  852

Query  676   PYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRK  497
             P+V+AA+AKLFW+DRKVDKAR+W  +AVTLAPDIGDFWA  Y+FE Q G+ D + +VL+K
Sbjct  853   PHVIAAVAKLFWHDRKVDKARTWLDKAVTLAPDIGDFWAFLYKFELQHGNADTQKEVLKK  912

Query  496   CVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             C+AAEPKHGE+WQ+++K+VENSH+P D ILR+VV AL  EEN
Sbjct  913   CIAAEPKHGERWQSVSKAVENSHQPVDAILRKVVLALGAEEN  954



>ref|XP_010467412.1| PREDICTED: protein STABILIZED1-like [Camelina sativa]
Length=798

 Score =   335 bits (860),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 190/225 (84%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  +LEQA+  Y+SGLKHCP C PLWLSLA LEE++NGL++ARA+LTMARK+NP   EL
Sbjct  574   ERFKHLEQARKAYDSGLKHCPHCTPLWLSLANLEEKVNGLNRARAILTMARKRNPGGDEL  633

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  K+EA+ LM+KALQECP SGIL AA IEMAPRP+R++ S DA KKC  
Sbjct  634   WLAAIRAELRHENKREAEHLMSKALQECPNSGILWAADIEMAPRPRRKTKSVDALKKCAH  693

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V AA+AKLFW D+KV+KARSWF RAVTLAP+IGDFWAL+Y+FE Q GSE+ + +V+ 
Sbjct  694   DPHVTAAVAKLFWQDKKVEKARSWFKRAVTLAPNIGDFWALYYKFEHQHGSEENQKEVIA  753

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA EPKHGEKWQAI+K+VEN+H+P + IL++VV+A+ KEE AA
Sbjct  754   KCVACEPKHGEKWQAISKAVENAHQPIETILKRVVSAMSKEEKAA  798



>ref|XP_002872777.1| hypothetical protein ARALYDRAFT_490219 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49036.1| hypothetical protein ARALYDRAFT_490219 [Arabidopsis lyrata subsp. 
lyrata]
Length=1004

 Score =   339 bits (869),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 193/225 (86%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  +LEQA+  Y++GLKHCP CIPLWLSLA LEE++NGL+KARA+LT ARKKNP   EL
Sbjct  780   ERFKHLEQARKAYDTGLKHCPHCIPLWLSLADLEEKVNGLNKARAILTTARKKNPGGAEL  839

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  K+EA+ LM+KALQECP+SGIL AA IEMAPRP+R++ S DA KKC++
Sbjct  840   WLAAIRAELRHDNKREAEHLMSKALQECPSSGILWAADIEMAPRPRRKTKSMDAMKKCDR  899

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V  A+AKLFW D+KV+KARSWF RAVTL PDIGDFWAL+Y+FE Q GS++ R +V+ 
Sbjct  900   DPHVTVAVAKLFWQDKKVEKARSWFERAVTLGPDIGDFWALYYKFELQHGSDENRKEVVA  959

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA+EPKHGEKWQAI+K+VEN+H+P + IL++VV+AL KEENAA
Sbjct  960   KCVASEPKHGEKWQAISKAVENAHQPIEVILKRVVSALSKEENAA  1004



>gb|EMT28978.1| Pre-mRNA-processing factor 6 [Aegilops tauschii]
Length=646

 Score =   330 bits (847),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 185/218 (85%), Gaps = 0/218 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +R+G   +AK  YE+ LKHCP CIPLWLSLA LEER+NGLSK+RA LT+ARKKNP  PEL
Sbjct  336   DRMGRGAKAKEVYENALKHCPGCIPLWLSLASLEERINGLSKSRAFLTLARKKNPATPEL  395

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH   KEAD L+AKALQECPTSGIL AA+IEM PR QR+S S+DA K+C+ 
Sbjct  396   WLAAIRAELRHGNNKEADSLLAKALQECPTSGILWAAAIEMVPRAQRKSKSSDAIKRCDH  455

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW+DRKVDKARSWF+RA +LAPDIGDF AL+Y+ E Q G+ D + DVL+
Sbjct  456   DPHVIAAVAKLFWHDRKVDKARSWFNRAASLAPDIGDFRALYYKSELQHGNADTQRDVLK  515

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             +C+AAEPKHGE+WQA +K+VENSH+PTD ILR+VV AL
Sbjct  516   RCIAAEPKHGERWQATSKAVENSHQPTDAILRRVVLAL  553



>ref|XP_011085353.1| PREDICTED: LOW QUALITY PROTEIN: protein STABILIZED1 [Sesamum 
indicum]
Length=1007

 Score =   338 bits (868),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 191/226 (85%), Gaps = 17/226 (8%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGNLEQAK  YESGLKHCP+CIPLWLSLA+LEE+++GLSKARAVLTMARKKNP+NPEL
Sbjct  795   ERLGNLEQAKEAYESGLKHCPNCIPLWLSLAQLEEKVSGLSKARAVLTMARKKNPQNPEL  854

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVRAE+RH YKKEAD+LMAK +                 PRPQ+++ S DAYK+C  
Sbjct  855   WLAAVRAESRHGYKKEADILMAKDV-----------------PRPQQKTKSRDAYKRCGD  897

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP VLAA+ K+FW+DRKVDKARSWF+RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL 
Sbjct  898   DPQVLAAVGKIFWHDRKVDKARSWFNRAVTLAPDIGDFWALYYKFELQHGTEETQKDVLN  957

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             +CVAAEPKHGEKWQAI+K+VENSH+PT+ IL++VV A+ KEE+AAE
Sbjct  958   RCVAAEPKHGEKWQAISKAVENSHQPTEFILKKVVVAIGKEEHAAE  1003



>ref|XP_004982722.1| PREDICTED: pre-mRNA-processing factor 6-like isoform X1 [Setaria 
italica]
 ref|XP_004982723.1| PREDICTED: pre-mRNA-processing factor 6-like isoform X2 [Setaria 
italica]
Length=955

 Score =   337 bits (863),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RLG+  +AK  YE+GLK+CP CIPLWLSLA LEE+++GLSK+RA+LTMARKKNP  PEL
Sbjct  727   DRLGHGAKAKEVYENGLKNCPSCIPLWLSLASLEEKISGLSKSRAILTMARKKNPAQPEL  786

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH+ KKEAD L+AKALQECPTSGIL AA+IEMAPRPQR+  S DA K+C+ 
Sbjct  787   WLAAIRAELRHANKKEADALLAKALQECPTSGILWAAAIEMAPRPQRKGKSTDAIKRCDH  846

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+A ++KLFW DRKVDKAR WF+RAVTLAPDIGDFWAL+Y+FE Q G+ + + DVL+
Sbjct  847   DPHVIATVSKLFWLDRKVDKARIWFNRAVTLAPDIGDFWALYYKFELQHGNAETQKDVLK  906

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +CVAAEPKHGEKWQAI+K+VENSH+P + +L++ V AL  +E 
Sbjct  907   RCVAAEPKHGEKWQAISKAVENSHQPVEALLKKAVVALDADET  949



>ref|XP_010422461.1| PREDICTED: protein STABILIZED1-like [Camelina sativa]
Length=1021

 Score =   338 bits (866),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  +LEQA+  Y+SGLKHCP CIPLWLSLA LEE++NGL++ARA+LTMARK+NP   EL
Sbjct  797   ERFKHLEQARKAYDSGLKHCPHCIPLWLSLANLEEKVNGLNRARAILTMARKRNPGGAEL  856

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  K+EA+ LM+KALQECP SGIL AA IEMAPRP+R++ S DA KKC+ 
Sbjct  857   WLAAIRAELRHENKREAEHLMSKALQECPKSGILWAADIEMAPRPRRKTKSVDAMKKCDH  916

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V AA+AKLFW D+KV+KARSWF RAVT+AP+IGDFWAL+Y+FE Q GSE+ + +V+ 
Sbjct  917   DPHVTAAVAKLFWQDKKVEKARSWFKRAVTIAPNIGDFWALYYKFEHQHGSEENQKEVIA  976

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA EPKHGEKWQAI+K+VEN+H+P + IL++VV+A+ KEE AA
Sbjct  977   KCVACEPKHGEKWQAISKAVENAHQPIETILKRVVSAMSKEEKAA  1021



>ref|XP_010455888.1| PREDICTED: protein STABILIZED1 [Camelina sativa]
Length=1021

 Score =   338 bits (866),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  +LEQA+  Y+SGLKHCP CIPLWLSLA LEE++NGL++ARA+LTMARK+NP   EL
Sbjct  797   ERFKHLEQARKAYDSGLKHCPHCIPLWLSLANLEEKVNGLNRARAILTMARKRNPGGAEL  856

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  K+EA+ LM+KALQECP SGIL AA IEMAPRP+R++ S DA KKC+ 
Sbjct  857   WLAAIRAELRHENKREAEHLMSKALQECPKSGILWAADIEMAPRPRRKTKSVDAMKKCDH  916

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V AA+AKLFW D+KV+KARSWF RAVT+AP+IGDFWAL+Y+FE Q GSE+ + +V+ 
Sbjct  917   DPHVTAAVAKLFWQDKKVEKARSWFKRAVTIAPNIGDFWALYYKFEHQHGSEENQKEVIA  976

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA EPKHGEKWQAI+K+VEN+H+P + IL++VV+A+ KEE AA
Sbjct  977   KCVACEPKHGEKWQAISKAVENAHQPIETILKRVVSAMSKEEKAA  1021



>ref|XP_010522629.1| PREDICTED: protein STABILIZED1 [Tarenaya hassleriana]
Length=1021

 Score =   337 bits (864),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/226 (70%), Positives = 189/226 (84%), Gaps = 0/226 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLG+LEQAK  YESGLK CP+CIPLWLSLAKLEE++NGL+KARA LTMARKKNP+  EL
Sbjct  796   ERLGHLEQAKKAYESGLKSCPNCIPLWLSLAKLEEKVNGLNKARATLTMARKKNPQTAEL  855

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+R E RH  KKEA+ LM+KALQECP SGIL AA IEMAPRP+R+  S DA KKC+ 
Sbjct  856   WLAAIRVELRHGNKKEAEHLMSKALQECPNSGILWAADIEMAPRPRRKMKSIDAMKKCDH  915

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKLFW D KVDKARSW  RAVTLAPD+GDFWAL+Y+FE Q GS++ + +VL 
Sbjct  916   DPHVIAAVAKLFWQDMKVDKARSWLKRAVTLAPDVGDFWALYYKFELQHGSDENQKEVLA  975

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
              C  AEPK+GEKWQ IAK+VEN+H+  + IL++VV AL +EENAAE
Sbjct  976   NCAVAEPKYGEKWQPIAKAVENAHQTVEVILKKVVVALGREENAAE  1021



>tpg|DAA55350.1| TPA: hypothetical protein ZEAMMB73_415949 [Zea mays]
Length=962

 Score =   335 bits (860),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RL N  +AK  +E+GLKHCP CIPLWLSLA LEE+++GLSK+RAVLTMARKKNP  PEL
Sbjct  734   DRLDNGAKAKEVFENGLKHCPSCIPLWLSLANLEEKISGLSKSRAVLTMARKKNPATPEL  793

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE R+  KKEAD L+AKALQECPTSGIL AA+IEMAPRPQR+  S DA K+ + 
Sbjct  794   WLAAIRAELRNGNKKEADALLAKALQECPTSGILWAAAIEMAPRPQRKGKSTDAIKRSDH  853

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+A +AKLFW DRKVDKARSW +RAVTLAPD+GDFWAL+Y+FE Q G+ D + DVL+
Sbjct  854   DPHVIATVAKLFWLDRKVDKARSWLNRAVTLAPDVGDFWALYYKFELQHGNVDTQKDVLK  913

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENA  368
             +CVAAEPKHGEKWQAI+KSVENSH P + +L++ V  L  EENA
Sbjct  914   RCVAAEPKHGEKWQAISKSVENSHLPVEALLKKAVVVLDVEENA  957



>ref|XP_008662633.1| PREDICTED: pre-mRNA-processing factor 6-like [Zea mays]
 gb|AFW56581.1| hypothetical protein ZEAMMB73_917811 [Zea mays]
Length=956

 Score =   335 bits (859),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 187/224 (83%), Gaps = 0/224 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RLGN  +AK  +E+GLK CP CIPLWLSLA LEE+++GLSK+RAVLTMARKKNP  PEL
Sbjct  728   DRLGNGAKAKEVFENGLKQCPSCIPLWLSLATLEEKISGLSKSRAVLTMARKKNPATPEL  787

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE R+  KKEAD L+AKALQECPTSGIL AA+IEMAPRPQR+  S DA K+ + 
Sbjct  788   WLAAIRAELRNGNKKEADALLAKALQECPTSGILWAAAIEMAPRPQRKGKSTDAIKRSDH  847

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+A +AKLFW DRKVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  848   DPHVIATVAKLFWLDRKVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNVDTQKDVLK  907

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENA  368
             +CVAAEPKHGEKWQAI K+VENSH P + +L++ V  L  EENA
Sbjct  908   RCVAAEPKHGEKWQAITKAVENSHLPVEALLKKAVVVLDVEENA  951



>ref|XP_006279939.1| hypothetical protein CARUB_v10025803mg [Capsella rubella]
 gb|EOA12837.1| hypothetical protein CARUB_v10025803mg [Capsella rubella]
Length=1021

 Score =   335 bits (859),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 190/225 (84%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  +LEQA+  Y SGLKHCP C+PLWLSLA LEE++NGL+KARA+LT ARK+NP   EL
Sbjct  797   ERFKHLEQARKAYGSGLKHCPHCVPLWLSLANLEEQVNGLNKARAILTTARKRNPGAAEL  856

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  KKEA+ LM+KALQECP SGIL AA IEMAPRP+R++ S DA KKC+ 
Sbjct  857   WLAAIRAELRHDNKKEAEHLMSKALQECPNSGILWAADIEMAPRPRRKTKSMDAMKKCDN  916

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V AA+AKLFW D+KV+KARSWF RAVTL+PDIGDFWAL+Y+FE Q GSE+ + +V+ 
Sbjct  917   DPHVTAAVAKLFWQDKKVEKARSWFKRAVTLSPDIGDFWALYYKFEHQHGSEENQKEVIA  976

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA+EPKHGEKWQAI+KSVEN+H+P + IL++V+ A+ KEE AA
Sbjct  977   KCVASEPKHGEKWQAISKSVENAHQPIETILKRVMLAMNKEEKAA  1021



>ref|XP_010431097.1| PREDICTED: protein STABILIZED1-like [Camelina sativa]
Length=1021

 Score =   335 bits (859),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 190/225 (84%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  +LEQA+  Y+SGLKHCP C PLWLSLA LEE++NGL++ARA+LTMARK+NP   EL
Sbjct  797   ERFKHLEQARKAYDSGLKHCPHCTPLWLSLANLEEKVNGLNRARAILTMARKRNPGGDEL  856

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  K+EA+ LM+KALQECP SGIL AA IEMAPRP+R++ S DA KKC  
Sbjct  857   WLAAIRAELRHENKREAEHLMSKALQECPNSGILWAADIEMAPRPRRKTKSVDALKKCAH  916

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V AA+AKLFW D+KV+KARSWF RAVTLAP+IGDFWAL+Y+FE Q GSE+ + +V+ 
Sbjct  917   DPHVTAAVAKLFWQDKKVEKARSWFKRAVTLAPNIGDFWALYYKFEHQHGSEENQKEVIA  976

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA EPKHGEKWQAI+K+VEN+H+P + IL++VV+A+ KEE AA
Sbjct  977   KCVACEPKHGEKWQAISKAVENAHQPIETILKRVVSAMSKEEKAA  1021



>ref|XP_002442232.1| hypothetical protein SORBIDRAFT_08g016670 [Sorghum bicolor]
 gb|EES16070.1| hypothetical protein SORBIDRAFT_08g016670 [Sorghum bicolor]
Length=963

 Score =   333 bits (855),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RLGN  +AK  +E+GLKHCP CIPLWLSLA LEE+++GLSK+RAVLTMARKKNP  PEL
Sbjct  735   DRLGNGAKAKEVFENGLKHCPSCIPLWLSLAGLEEKVSGLSKSRAVLTMARKKNPATPEL  794

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE+R+  KKEAD L+AKALQECPTSGIL A +IEMAPRPQR+  S DA K+ + 
Sbjct  795   WLAAIRAESRNGNKKEADALLAKALQECPTSGILWAEAIEMAPRPQRKGKSTDAIKRSDH  854

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+A +AKLFW DRKVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL+
Sbjct  855   DPHVIATVAKLFWLDRKVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGTVDTQKDVLK  914

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +CVAAEPKHGEKWQ ++K+VENSH P + +L++ V  L  EEN
Sbjct  915   RCVAAEPKHGEKWQEVSKAVENSHLPVEALLKKAVVGLHVEEN  957



>ref|XP_006286978.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
 ref|XP_006286979.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
 ref|XP_006286980.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
 gb|EOA19876.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
 gb|EOA19877.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
 gb|EOA19878.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
Length=1018

 Score =   333 bits (855),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  +LEQA+  Y SGLKHCP CIPLWLSLA LEE++NGL+KARA+LT ARKKNP   EL
Sbjct  794   ERFKHLEQARKAYGSGLKHCPHCIPLWLSLANLEEKVNGLNKARAILTTARKKNPGGAEL  853

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  KKEA+ LM+KALQECP SGIL AA IEMAPRP+R++ S DA KKC+ 
Sbjct  854   WLAAIRAELRHDNKKEAERLMSKALQECPDSGILWAADIEMAPRPRRKTKSVDAMKKCDN  913

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V AA+AKL W D+KV+KARSWF RAVTLAP+IGDFWAL+Y+FE Q GSE+ + +V+ 
Sbjct  914   DPHVTAAVAKLSWQDKKVEKARSWFKRAVTLAPNIGDFWALYYKFEHQHGSEENQKEVIA  973

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA+EPKHGEKWQAI+KSVEN+H+P + IL++V+ A+ KEE AA
Sbjct  974   KCVASEPKHGEKWQAISKSVENAHQPIETILKRVMLAMNKEEKAA  1018



>ref|NP_192252.1| pre-mRNA-processing factor 6-like protein STA1 [Arabidopsis thaliana]
 sp|Q9ZT71.1|STA1_ARATH RecName: Full=Protein STABILIZED1; AltName: Full=Pre-mRNA processing 
factor 6-like protein; AltName: Full=Protein EMBRYO 
DEFECTIVE 2770 [Arabidopsis thaliana]
 gb|AAD11585.1| putative pre-mRNA splicing factor [Arabidopsis thaliana]
 emb|CAB77828.1| putative pre-mRNA splicing factor [Arabidopsis thaliana]
 gb|AAL24077.1| putative pre-mRNA splicing factor [Arabidopsis thaliana]
 gb|AAN13111.1| putative pre-mRNA splicing factor [Arabidopsis thaliana]
 gb|AEE82320.1| pre-mRNA-processing factor 6-like protein [Arabidopsis thaliana]
Length=1029

 Score =   332 bits (851),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 190/225 (84%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  +LEQA+  Y++GLKHCP CIPLWLSLA LEE++NGL+KARA+LT ARKKNP   EL
Sbjct  805   ERFKHLEQARKAYDTGLKHCPHCIPLWLSLADLEEKVNGLNKARAILTTARKKNPGGAEL  864

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  K+EA+ LM+KALQ+CP SGIL AA IEMAPRP+R++ S DA KKC++
Sbjct  865   WLAAIRAELRHDNKREAEHLMSKALQDCPKSGILWAADIEMAPRPRRKTKSIDAMKKCDR  924

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V  A+AKLFW D+KV+KAR+WF RAVT+ PDIGDFWALFY+FE Q GS++ R +V+ 
Sbjct  925   DPHVTIAVAKLFWQDKKVEKARAWFERAVTVGPDIGDFWALFYKFELQHGSDEDRKEVVA  984

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA EPKHGEKWQAI+K+VEN+H+P + IL++VV AL KEEN+A
Sbjct  985   KCVACEPKHGEKWQAISKAVENAHQPIEVILKRVVNALSKEENSA  1029



>ref|XP_009121844.1| PREDICTED: protein STABILIZED1 [Brassica rapa]
 ref|XP_009121855.1| PREDICTED: protein STABILIZED1 [Brassica rapa]
Length=1015

 Score =   331 bits (848),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  +LEQA+  YESGLKHCPDC+PLWL+LA LEER+ GL+KARA+LT ARKKNP   EL
Sbjct  790   ERFNHLEQARKAYESGLKHCPDCVPLWLALANLEERVTGLNKARAILTTARKKNPHVDEL  849

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+R E RH  K+EA+ LM+KALQECPTSGIL AA +EMAPRP+R++ S DA KKC++
Sbjct  850   WLAAIRVELRHDNKREAEHLMSKALQECPTSGILWAADVEMAPRPRRKTKSMDAMKKCDR  909

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V AA+AKLFW D+KV+KA +W  RAVTLAPDIGDFWAL+Y+FE Q G+E+ + +VL 
Sbjct  910   DPHVTAAVAKLFWQDKKVEKAGAWLKRAVTLAPDIGDFWALYYKFELQHGTEESQKEVLA  969

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA EPKHGEKWQAI+K+VEN+H+P + IL++VV AL KE+ AA
Sbjct  970   KCVACEPKHGEKWQAISKAVENAHQPIEVILKKVVIALSKEQKAA  1014



>ref|XP_006396573.1| hypothetical protein EUTSA_v10028386mg [Eutrema salsugineum]
 gb|ESQ38026.1| hypothetical protein EUTSA_v10028386mg [Eutrema salsugineum]
Length=1021

 Score =   326 bits (835),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERL +LEQAK  Y SG +HCPDCIPLWLSLA LEE+++G +KAR  LT ARKKNP N EL
Sbjct  797   ERLNHLEQAKKAYSSGTEHCPDCIPLWLSLANLEEKVDGANKARGTLTRARKKNPANAEL  856

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVR E RH  KKEA+ +M+KALQECP SGIL AA IEMAPRP+R++ S DA KKC+ 
Sbjct  857   WLAAVRTELRHGNKKEAEHMMSKALQECPHSGILWAADIEMAPRPRRKTKSMDAMKKCDH  916

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V AA+AKLFW D+KV+KARSW  RAVTLAPDIGD WAL+Y+FE Q GSE+ + +V+ 
Sbjct  917   DPHVTAAVAKLFWQDKKVEKARSWLKRAVTLAPDIGDIWALYYKFELQHGSEENQKEVVA  976

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA EPKHGEKWQAIAK+VEN+H+P + IL +V  A+ KEE AA
Sbjct  977   KCVACEPKHGEKWQAIAKAVENAHQPVEVILIRVAVAMSKEEKAA  1021



>ref|XP_007200323.1| hypothetical protein PRUPE_ppa000851mg [Prunus persica]
 gb|EMJ01522.1| hypothetical protein PRUPE_ppa000851mg [Prunus persica]
Length=982

 Score =   322 bits (825),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERL +LE+AK  Y SGLKHCP+ + LWLSLA LEE+M GLSKARAVLT+ARKKNP+NPEL
Sbjct  760   ERLDHLEKAKKAYHSGLKHCPNSLQLWLSLANLEEKMIGLSKARAVLTIARKKNPQNPEL  819

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLA+VRAE RH  KKE+D+LMAKALQECP SGIL AA++EM  RPQR++ S DA +KC  
Sbjct  820   WLASVRAELRHGKKKESDILMAKALQECPNSGILWAAALEMVARPQRKAKSKDALEKCRH  879

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+AKL W+DRK+DKAR+W + AV  APDIGDFWAL+Y+FE Q G+E+ + DVL 
Sbjct  880   DPHVVAAVAKLLWHDRKLDKARNWLNMAVMFAPDIGDFWALYYKFELQHGTEENQKDVLN  939

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAA  389
             +C+AA PKHGEKWQ I+K+VENSH+P + IL++VVAA
Sbjct  940   RCIAAGPKHGEKWQPISKAVENSHQPIEAILKKVVAA  976



>ref|XP_006857690.1| PREDICTED: protein STABILIZED1 [Amborella trichopoda]
 gb|ERN19157.1| hypothetical protein AMTR_s00061p00165040 [Amborella trichopoda]
Length=1032

 Score =   320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPD--CIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNP  866
             ER+GNLE+AK  YESGLKHCP+   +PLWLS+A +EERMNGLSKARAVLT ARK+ P+N 
Sbjct  800   ERIGNLEKAKQVYESGLKHCPNPTSVPLWLSVANVEERMNGLSKARAVLTTARKRIPQNQ  859

Query  865   ELWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKC  686
              LWLAA+RAEARH  KKEADVL+AKALQECPTSGIL AASIE+APRPQR+S S++A  + 
Sbjct  860   HLWLAAIRAEARHGKKKEADVLLAKALQECPTSGILWAASIELAPRPQRKSRSSEAVTRL  919

Query  685   NQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDV  506
              QDPYV A +A LFW  R +DKAR+WF+RAVT  PDIGD WAL+Y+FE Q G+ED + DV
Sbjct  920   TQDPYVTAEVAILFWQKRSIDKARTWFNRAVTHDPDIGDSWALYYKFELQHGTEDSQKDV  979

Query  505   LRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             L +CV+AEP+HG +W  ++K++ENSH+P + IL++VV AL K+E 
Sbjct  980   LDRCVSAEPRHGPRWTQVSKAIENSHQPIEAILKKVVVALGKDEG  1024



>ref|XP_003588705.1| Pre-mRNA-processing factor [Medicago truncatula]
 gb|AES58956.1| pre-mRNA splicing factor-like protein [Medicago truncatula]
Length=895

 Score =   317 bits (812),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -1

Query  1036  RLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELW  857
             R  ++  AK  YESG K+CP+ +PLWLSLA LEE MNGLSK R + TMARKKNP+NPELW
Sbjct  676   RHSHMMTAKKVYESGQKNCPNSVPLWLSLANLEEEMNGLSKVRVIFTMARKKNPQNPELW  735

Query  856   LAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQD  677
             LAA+RAE +H YKKEAD LMAKALQECP SGIL AASIEMAP PQR++ S DA KKCN D
Sbjct  736   LAAIRAELKHGYKKEADTLMAKALQECPNSGILWAASIEMAPHPQRKTKSKDALKKCNSD  795

Query  676   PYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRK  497
             P+V+A  AKL W+ RKV+KAR+  + AVTLAPDIGDFW L Y+FE Q G+E+ + DVL++
Sbjct  796   PHVIAGTAKLLWHHRKVEKARTLLNTAVTLAPDIGDFWVLCYKFELQHGTEENQKDVLKR  855

Query  496   CVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVV  395
             CVAAEPKHGEKWQA++K++EN+H+PT+ IL++VV
Sbjct  856   CVAAEPKHGEKWQAVSKALENAHQPTESILKKVV  889



>ref|XP_007218131.1| hypothetical protein PRUPE_ppa007130mg [Prunus persica]
 gb|EMJ19330.1| hypothetical protein PRUPE_ppa007130mg [Prunus persica]
Length=381

 Score =   294 bits (753),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 178/229 (78%), Gaps = 3/229 (1%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERL  LE+AK  Y+ GLKHCP+ IPLWLSL  LEE +NG++ ARAVLT+AR KNP NP+L
Sbjct  143   ERLDRLEKAKEAYDLGLKHCPNSIPLWLSLVNLEENLNGVTSARAVLTLARNKNPHNPQL  202

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIE-MAPRP--QRRSTSADAYKK  689
             WLAA R E RH   KEAD+LM +AL ECP SGIL AA IE M P P  Q  +   DA +K
Sbjct  203   WLAATRTELRHGNNKEADILMVRALHECPNSGILWAAYIESMVPLPPSQWMAKIMDALRK  262

Query  688   CNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRND  509
             C+ DP+V+AA+AKLFW+  +V +AR+W  RAVT+APDIGDFWAL+++FE Q G+++ + D
Sbjct  263   CDYDPHVIAAVAKLFWHHSEVKRARTWLDRAVTIAPDIGDFWALYFKFELQHGTDENQKD  322

Query  508   VLRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAE  362
             VLR+C+A++PK+GEKWQ I+K++ NSH+PT+ IL QVVA L KEE++ +
Sbjct  323   VLRRCIASQPKYGEKWQPISKALHNSHQPTEAILHQVVAVLGKEESSQQ  371



>emb|CDX90885.1| BnaA03g25650D [Brassica napus]
Length=508

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 171/225 (76%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  NLE A+  YESGLKHCP+CIPLW+S A LEER+N L+KAR +L  ARKKNP   +L
Sbjct  284   ERFNNLEHARKAYESGLKHCPNCIPLWISYANLEERVNDLNKARNILITARKKNPYVADL  343

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVR E RH  + EA+ LM+KALQECP SGIL AA I MA RP R++ S DA KKC +
Sbjct  344   WLAAVRVELRHDNRGEAENLMSKALQECPKSGILFAADIGMATRPHRKTKSMDAMKKCFR  403

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V AA+AKLFW D K +KAR+W  RAVTL  DIGD WAL+Y+FE Q G+E  +N +L 
Sbjct  404   DPHVTAAVAKLFWQDNKGEKARAWLKRAVTLNQDIGDHWALYYKFELQHGTEVRQNAILA  463

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA EPK GEKWQAI+K+VEN+H+P + IL +V+ AL KEE A 
Sbjct  464   KCVACEPKRGEKWQAISKAVENAHQPIEAILNKVLIALSKEEKAT  508



>ref|XP_009135950.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
Length=574

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 171/225 (76%), Gaps = 0/225 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  NLE A+  YESGLKHCP+CIPLWLS A LEER+N L+KAR +L  ARKKNP   +L
Sbjct  350   ERFNNLEHARKAYESGLKHCPNCIPLWLSYANLEERVNELNKAREILITARKKNPHVADL  409

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVR E  H  + EA+ LM+KALQECP SGILLA  I MA RP R++ S DA KKC +
Sbjct  410   WLAAVRVELTHDNRGEAENLMSKALQECPKSGILLAEDIGMATRPHRKTKSMDAMKKCFR  469

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V AA+AKLFW D+KV+KAR+W  RAVTL  DIGD WAL+Y+FE Q G+E  +  +L 
Sbjct  470   DPHVTAAVAKLFWQDKKVEKARAWLKRAVTLNQDIGDHWALYYKFELQHGTEVRQKQILA  529

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             KCVA EPK GEKWQAI+K+VEN+H+P + IL +V+ AL KEE A 
Sbjct  530   KCVACEPKRGEKWQAISKAVENAHQPIEAILNKVLIALSKEEKAT  574



>ref|XP_001755087.1| predicted protein [Physcomitrella patens]
 gb|EDQ80031.1| predicted protein [Physcomitrella patens]
Length=938

 Score =   303 bits (777),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 175/223 (78%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +R+G  E A+ TYE  L++CP  IPLWLS A LEER+ GL+KARAVLT AR KN  NPEL
Sbjct  715   DRIGQPEAARDTYERALRNCPHSIPLWLSAAALEERLGGLTKARAVLTKARLKNTHNPEL  774

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+R EA    KKEA+ LMAKALQ+CP+SG L A +I+MAPRPQR+S S DA K+C+Q
Sbjct  775   WLAAIRVEAHAGNKKEAESLMAKALQDCPSSGRLWAEAIDMAPRPQRKSKSVDALKRCDQ  834

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DPYV+AA+AKLFW DRKVDKARSW +RAVTLAPDIGDFWA  Y+FE Q   ED + DV++
Sbjct  835   DPYVIAAVAKLFWQDRKVDKARSWLNRAVTLAPDIGDFWAQLYKFELQHSGEDLQQDVIQ  894

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +C AAEP+HGEKW   +K+VEN+H  T EIL+++V A K EE 
Sbjct  895   RCTAAEPRHGEKWTKFSKAVENAHFSTKEILKKIVLAAKDEET  937



>ref|XP_001776889.1| predicted protein [Physcomitrella patens]
 gb|EDQ58292.1| predicted protein [Physcomitrella patens]
Length=946

 Score =   301 bits (771),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 176/223 (79%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             +RLG  E A+ TYE  L++CP  IPLWLS A LEE++ GLSKARAVLT AR KN  NPEL
Sbjct  723   DRLGQPEAARETYERALRNCPHSIPLWLSAAALEEKLGGLSKARAVLTKARLKNTHNPEL  782

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+R EA    KK+A+ LMAKALQ+CP+SG L A +I+MAPRPQR+S S DA K+C+Q
Sbjct  783   WLAAIRVEAHAGNKKDAESLMAKALQDCPSSGRLWAEAIDMAPRPQRKSKSVDALKRCDQ  842

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DPYV+AA+AKLFW DRKVDKARSW +RAVTLAPDIGDFWA  Y+FE Q   ED + DV++
Sbjct  843   DPYVIAAVAKLFWQDRKVDKARSWLNRAVTLAPDIGDFWAQLYKFELQHSGEDVQQDVIQ  902

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +C AAEP+HGEKW  ++K+VEN+H  T+ IL+++V A K EE 
Sbjct  903   RCSAAEPRHGEKWTKVSKAVENAHFSTEAILKKLVLAAKDEET  945



>ref|XP_006442217.1| hypothetical protein CICLE_v10018758mg [Citrus clementina]
 gb|ESR55457.1| hypothetical protein CICLE_v10018758mg [Citrus clementina]
Length=915

 Score =   291 bits (746),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 176/221 (80%), Gaps = 3/221 (1%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEER---MNGLSKARAVLTMARKKNPKN  869
             ERLG+L++AK  Y+SG   CP+CIPLW SLA LEE+   +NGLSKARAVL++AR KNP N
Sbjct  682   ERLGHLKEAKEAYQSGCNQCPNCIPLWYSLANLEEKRNGLNGLSKARAVLSVARLKNPLN  741

Query  868   PELWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKK  689
             PE+ LA +RAE++H  KKEAD  +AKALQ+CP SGIL A  I+M P   R+S   DA  K
Sbjct  742   PEICLATIRAESKHGNKKEADSFIAKALQKCPNSGILWAELIKMVPHHDRKSKGKDALVK  801

Query  688   CNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRND  509
              ++DP+V AA+AKLFW+DRKVDKAR+WF++AV+L PD GDFWAL+Y+FE Q GS + + +
Sbjct  802   SDRDPHVFAAVAKLFWHDRKVDKARNWFNKAVSLDPDTGDFWALYYKFELQQGSVENQKE  861

Query  508   VLRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             VL +C+AAEPKHGEKWQAI+K+VENSH PT+ IL +VV AL
Sbjct  862   VLNRCIAAEPKHGEKWQAISKAVENSHCPTEAILMKVVNAL  902



>ref|XP_002971176.1| hypothetical protein SELMODRAFT_172051 [Selaginella moellendorffii]
 gb|EFJ27774.1| hypothetical protein SELMODRAFT_172051 [Selaginella moellendorffii]
Length=966

 Score =   286 bits (733),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 171/223 (77%), Gaps = 0/223 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER+GN E A+S YE  L+ CP   PLWLS A+LEE++ G+S+ARA+LT AR KN +NPEL
Sbjct  736   ERVGNFEAARSVYERALEKCPASTPLWLSAAQLEEKVGGISRARAMLTTARLKNRENPEL  795

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE R    KEAD LMAKALQEC  SG+L AA++EM PR QR++ S DA K   Q
Sbjct  796   WLAAIRAETRAGNWKEADALMAKALQECRQSGLLWAANVEMVPRAQRKTKSFDAIKNSEQ  855

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DPYV+AA+ K FW DRKV+KAR+W +RAVT APD+GDFWAL Y+FE+Q GSE    +V+ 
Sbjct  856   DPYVIAAVGKFFWQDRKVEKARNWMNRAVTFAPDVGDFWALLYKFEQQHGSEAQLQEVVE  915

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +C AAEPKHGE+W  ++K+VEN+H+ T+ IL++VVA   K+E 
Sbjct  916   RCKAAEPKHGERWIRVSKAVENAHQTTEFILKKVVAGFGKDEG  958


 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 59/230 (26%), Positives = 97/230 (42%), Gaps = 18/230 (8%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E  G +  A+S  + G + CP    +WL       R+     A+ V+ MA K  P + +L
Sbjct  336   EVAGKIAAARSFIQKGCEECPKNEDVWLEAC----RLASGDAAKKVIAMAVKSIPTSVKL  391

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             W+AA R E  ++ K     ++ K L+  P S  L  A +E+A   + R   A A + C  
Sbjct  392   WMAAARLEVENAAKSR---VLRKGLEFIPDSVRLWKAVVELANEDEARILLARATECCRL  448

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                +  A+A+L       DKAR   +RA    P     W    + EE  G+      ++ 
Sbjct  449   HVELWLALARL----ETYDKARVVLNRAREALPTEPTIWIAAAKLEEAQGNVSRVEGIID  504

Query  499   KCVAAEPKHG-----EKWQAIAKSVE--NSHKPTDEILRQVVAALKKEEN  371
             + + +  + G     E W   A++ E   S      I+R  +    +EE+
Sbjct  505   RAIRSLQRVGVVIDREFWMKEAEAAERAGSAATCVAIVRSTIGIGVEEED  554



>gb|EAZ11333.1| hypothetical protein OsJ_01197 [Oryza sativa Japonica Group]
Length=867

 Score =   283 bits (724),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  931  MNGLSKARAVLTMARKKNPKNPELWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLA  752
            +NGL K+RAVLTMARKKNP  PELWLAAVRAE RH  KKEAD L+AKALQECPTSGIL A
Sbjct  675  INGLRKSRAVLTMARKKNPATPELWLAAVRAELRHRNKKEADALLAKALQECPTSGILWA  734

Query  751  ASIEMAPRPQRRSTSADAYKKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIG  572
            A+IEM PRPQR++ S+DA K+C+ DP+V+AA+AKLFW+DRK DKARSW +RAVTLAPDIG
Sbjct  735  AAIEMVPRPQRKAKSSDAIKRCDHDPHVIAAVAKLFWHDRKFDKARSWLNRAVTLAPDIG  794

Query  571  DFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVA  392
            DFWAL+Y+FE Q G+ D   DV+++CVA+EPKHGE+WQAIAK+VENSH   + +L++ V 
Sbjct  795  DFWALYYKFELQHGNADTHKDVVQRCVASEPKHGERWQAIAKAVENSHLSIEALLKKAVV  854

Query  391  ALKKEEN  371
            AL ++EN
Sbjct  855  ALGQDEN  861



>gb|EAY73400.1| hypothetical protein OsI_01280 [Oryza sativa Indica Group]
Length=892

 Score =   283 bits (724),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  931  MNGLSKARAVLTMARKKNPKNPELWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLA  752
            +NGL K+RAVLTMARKKNP  PELWLAAVRAE RH  KKEAD L+AKALQECPTSGIL A
Sbjct  700  INGLRKSRAVLTMARKKNPATPELWLAAVRAELRHRNKKEADALLAKALQECPTSGILWA  759

Query  751  ASIEMAPRPQRRSTSADAYKKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIG  572
            A+IEM PRPQR++ S+DA K+C+ DP+V+AA+AKLFW+DRK DKARSW +RAVTLAPDIG
Sbjct  760  AAIEMVPRPQRKAKSSDAIKRCDHDPHVIAAVAKLFWHDRKFDKARSWLNRAVTLAPDIG  819

Query  571  DFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVA  392
            DFWAL+Y+FE Q G+ D   DV+++CVA+EPKHGE+WQAIAK+VENSH   + +L++ V 
Sbjct  820  DFWALYYKFELQHGNADTHKDVVQRCVASEPKHGERWQAIAKAVENSHLSIEALLKKAVV  879

Query  391  ALKKEEN  371
            AL ++EN
Sbjct  880  ALGQDEN  886



>ref|NP_001172269.1| Os01g0263600 [Oryza sativa Japonica Group]
 dbj|BAH90999.1| Os01g0263600, partial [Oryza sativa Japonica Group]
Length=181

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -1

Query  889  RKKNPKNPELWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRST  710
            RKKNP  PELWLAAVRAE RH  KKEAD L+AKALQECPTSGIL AA+IEM PRPQR++ 
Sbjct  3    RKKNPATPELWLAAVRAELRHRNKKEADALLAKALQECPTSGILWAAAIEMVPRPQRKAK  62

Query  709  SADAYKKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFG  530
            S+DA K+C+ DP+V+AA+AKLFW+DRK DKARSW +RAVTLAPDIGDFWAL+Y+FE Q G
Sbjct  63   SSDAIKRCDHDPHVIAAVAKLFWHDRKFDKARSWLNRAVTLAPDIGDFWALYYKFELQHG  122

Query  529  SEDGRNDVLRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAAEIN  356
            + D   DV+++CVA+EPKHGE+WQAIAK+VENSH   + +L++ V AL ++EN   ++
Sbjct  123  NADTHKDVVQRCVASEPKHGERWQAIAKAVENSHLSIEALLKKAVVALGQDENPNAVD  180



>ref|XP_005651161.1| hypothetical protein COCSUDRAFT_27128 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26617.1| hypothetical protein COCSUDRAFT_27128 [Coccomyxa subellipsoidea 
C-169]
Length=947

 Score =   278 bits (712),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 170/221 (77%), Gaps = 0/221 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER G +E A+++Y  GLK C D +PLW S+A+LEE    ++KARA+L  AR KNPKN EL
Sbjct  724   ERQGRVEAARASYLDGLKRCMDSVPLWRSIARLEEAAGSVAKARALLEQARLKNPKNEEL  783

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVR E R    K A+ LMAKALQ+CP SG L A ++ MAPRPQRRS S DA K+CN 
Sbjct  784   WLAAVRTEQRAGNVKAAEALMAKALQDCPASGPLNAEAVAMAPRPQRRSRSLDALKRCND  843

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+++AA+A+LFWNDRKV+KARSWF+RA+ L PDIGDFWAL Y+FE QFG+ + +  V+ 
Sbjct  844   DPHIIAAVAQLFWNDRKVEKARSWFNRALLLKPDIGDFWALLYKFECQFGTPELQAAVVE  903

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKE  377
             +C  A+P+HGE+WQ ++K+ EN+HKPTD IL++VV  L KE
Sbjct  904   RCKKADPRHGERWQRMSKNPENAHKPTDFILKKVVLDLDKE  944


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 96/220 (44%), Gaps = 16/220 (7%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E  G L +A+     G + CP    +WL  A+ + + N    A+A+L      NP + +L
Sbjct  320   ELAGKLAEARKLIMKGCELCPTSEDVWLEAARFQTQDN----AKALLARGVAANPTSVKL  375

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             W+ A R E   + K     ++ +AL+  PTS  L  A++E+A +   R   + A + C Q
Sbjct  376   WMQAARLETDDAAKSR---VLRRALERIPTSVRLWKAAVELANQDDARVLLSRAVECCPQ  432

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL-  503
                +  A+A+L       + AR   ++A    P     W    + EE  G+      ++ 
Sbjct  433   HVELWLALARL----ESYENARKVLNKARQAIPTDASIWITAAKLEEAQGNTHMVEKIID  488

Query  502   RKCVAAEPKH----GEKWQAIAKSVENSHKPTDEILRQVV  395
             R  ++ E  +     E W   A++ E ++ P     R +V
Sbjct  489   RGIISLEANNVVIKREDWLKEAEAAEQANPPNVVTCRAIV  528



>ref|XP_002961912.1| hypothetical protein SELMODRAFT_60593, partial [Selaginella moellendorffii]
 gb|EFJ37172.1| hypothetical protein SELMODRAFT_60593, partial [Selaginella moellendorffii]
Length=802

 Score =   275 bits (703),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 165/214 (77%), Gaps = 0/214 (0%)
 Frame = -1

Query  1015  AKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVRAE  836
             A+S YE  L+ CP   PLWLS A+LEE++ G+S+ARA+LT AR KN +NPELWLAA+RAE
Sbjct  589   ARSVYERALEKCPASTPLWLSAAQLEEKVGGISRARAMLTTARLKNRENPELWLAAIRAE  648

Query  835   ARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLAAI  656
              R    KEAD LMAKALQEC  SG+L AA++EM PR QR++ S DA K   QDPYV+AA+
Sbjct  649   TRAGNWKEADALMAKALQECRQSGLLWAANVEMVPRAQRKTKSFDAIKNSEQDPYVIAAV  708

Query  655   AKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPK  476
              K FW DRKV+KAR+W +RAVT APD+GDFWAL Y+FE+Q GSE    +V+ +C AAEPK
Sbjct  709   GKFFWQDRKVEKARNWMNRAVTFAPDVGDFWALLYKFEQQHGSEAQLQEVVERCKAAEPK  768

Query  475   HGEKWQAIAKSVENSHKPTDEILRQVVAALKKEE  374
             HGE+W  ++K+VEN+H+ T+ IL++VVA   K+E
Sbjct  769   HGERWIRVSKAVENAHQTTEFILKKVVAGFGKDE  802


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 75/171 (44%), Gaps = 11/171 (6%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E  G +  A+S  + G + CP    +WL       R+     A+ V+ MA K  P + +L
Sbjct  330   EVAGKIAAARSFIQKGCEECPKNEDVWLEAC----RLASGDAAKKVIAMAVKSIPTSVKL  385

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             W+AA R E  ++ K     ++ K L+  P S  L  A +E+A   + R   A A + C  
Sbjct  386   WMAAARLEVENAAKSR---VLRKGLEFIPDSVRLWKAVVELANEDEARILLARATECCRL  442

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGS  527
                +  A+A+L       DKAR   +RA    P     W    + EE  G+
Sbjct  443   HVELWLALARL----ETYDKARVVLNRAREALPTEPTIWIAAAKLEEAQGN  489



>emb|CDY21966.1| BnaC09g00720D [Brassica napus]
Length=931

 Score =   271 bits (693),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 166/223 (74%), Gaps = 17/223 (8%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             LG++E  +     GLK                  + GL+KARA+LT ARKKNP   ELWL
Sbjct  725   LGDVEAERRLINEGLKQ-----------------VTGLNKARAILTTARKKNPHVDELWL  767

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDP  674
             AA+R E RH  K+EA+ LM+KALQECPTSGIL AA +EMAPRP+R++ S DA KKC++DP
Sbjct  768   AAIRVELRHDNKREAEHLMSKALQECPTSGILWAADVEMAPRPRRKTKSMDAMKKCDRDP  827

Query  673   YVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKC  494
             +V AA+AKLFW D+KV+KA +W  RAVTLAPDIGDFWAL+Y+FE Q G+E+ + +VL KC
Sbjct  828   HVTAAVAKLFWQDKKVEKAGAWLKRAVTLAPDIGDFWALYYKFELQHGTEESQKEVLAKC  887

Query  493   VAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             VA EPKHGEKWQ I+K+VEN+H+P D IL++VV AL KE+ AA
Sbjct  888   VACEPKHGEKWQTISKAVENAHQPIDVILKKVVIALSKEQKAA  930



>emb|CDY48561.1| BnaA09g01570D [Brassica napus]
Length=956

 Score =   271 bits (692),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 167/223 (75%), Gaps = 17/223 (8%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             LG++E  +     GLK                  + GL+KARA+LT ARKKNP   ELWL
Sbjct  750   LGDVEAERRLINEGLKQ-----------------VTGLNKARAILTTARKKNPHVDELWL  792

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDP  674
             AA+R E RH  K+EA+ LM+KALQECPTSGIL AA +EMAPRP+R++ S DA KKC++DP
Sbjct  793   AAIRVELRHDNKREAEHLMSKALQECPTSGILWAADVEMAPRPRRKTKSMDAMKKCDRDP  852

Query  673   YVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKC  494
             +V AA+AKLFW D+KV+KA +W  RAVTLAPDIGDFWAL+Y+FE Q G+E+ + +VL KC
Sbjct  853   HVTAAVAKLFWQDKKVEKAGAWLKRAVTLAPDIGDFWALYYKFELQHGTEESQKEVLAKC  912

Query  493   VAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEENAA  365
             VA EPKHGEKWQAI+K+VEN+H+P + IL++VV AL KE+ AA
Sbjct  913   VACEPKHGEKWQAISKAVENAHQPIEVILKKVVIALSKEQKAA  955



>ref|XP_009108789.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
 ref|XP_009108790.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
 ref|XP_009108791.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
 ref|XP_009108792.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
 ref|XP_009108793.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
Length=962

 Score =   268 bits (686),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 170/224 (76%), Gaps = 3/224 (1%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKL-EERMNGLSKARAVLTMARKKNPKNPE  863
             ERL +L QAK  Y SGL HCP CIPL LSLA L E+++NGL+KAR +LT ARK+ PK  E
Sbjct  734   ERLNHLVQAKRVYSSGLNHCPQCIPLCLSLADLVEKKLNGLNKARVILTNARKRCPKEDE  793

Query  862   LWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPR-PQRRSTSADAYKK-  689
             LWLAA+R E RH  KKEA+ LM+KALQE P SGILLAA IEMAP+ P  +    DA KK 
Sbjct  794   LWLAAIRIELRHGNKKEAERLMSKALQELPKSGILLAADIEMAPQCPLPKMKIKDALKKN  853

Query  688   CNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRND  509
             C ++ YV A++AK+FW +RKVDKAR +F R V L PD GDFWAL+Y+FE Q GSE+ + +
Sbjct  854   CVKEGYVTASVAKIFWRERKVDKARKYFERTVKLNPDNGDFWALYYKFEVQHGSEERQKE  913

Query  508   VLRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKE  377
             VL +CV +EPKHGEKWQA++K++ENSH+  + IL++V  AL +E
Sbjct  914   VLNRCVVSEPKHGEKWQAVSKALENSHQSVEVILKKVAIALNRE  957



>ref|XP_005850880.1| hypothetical protein CHLNCDRAFT_34097 [Chlorella variabilis]
 gb|EFN58778.1| hypothetical protein CHLNCDRAFT_34097 [Chlorella variabilis]
Length=932

 Score =   268 bits (684),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 167/221 (76%), Gaps = 0/221 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ERLGN + A+  Y +G+K C DCIPLW+S A+LEER   ++KARA+L  AR KNPKN +L
Sbjct  711   ERLGNADAARLAYAAGIKRCLDCIPLWVSAARLEERAGNVAKARALLEQARLKNPKNAQL  770

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAAVR E R   +K  + LMAKALQ+CP SG L A +I MAPRPQR+S S DA KKCN 
Sbjct  771   WLAAVRTELRAQNQKAGEALMAKALQDCPDSGPLWAETINMAPRPQRKSRSVDALKKCND  830

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+V+AA+A LFW DRKVDKARSWF+RAVTL PD+GDFWA + +FE QFGS + +  V++
Sbjct  831   DPHVVAAVAALFWLDRKVDKARSWFNRAVTLNPDVGDFWASYLKFETQFGSPEQQEGVVK  890

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKE  377
             + +AAEP HGE+WQ +AK    +H+ ++ +L++VV  L KE
Sbjct  891   RFLAAEPHHGERWQRVAKDAACAHQKSEVVLKRVVLDLDKE  931



>ref|XP_002987607.1| hypothetical protein SELMODRAFT_126394 [Selaginella moellendorffii]
 gb|EFJ11443.1| hypothetical protein SELMODRAFT_126394 [Selaginella moellendorffii]
Length=938

 Score =   259 bits (661),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 164/225 (73%), Gaps = 2/225 (1%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHC--PDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNP  866
             ER GNL  A+S YE  L+ C      P+WL+ A+LEE+  G++KARA+LT AR K  ++P
Sbjct  706   ERTGNLAAARSVYERALERCDPATSTPVWLAAAELEEKGGGIAKARALLTTARLKKKEDP  765

Query  865   ELWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKC  686
             ELWLAA+RAEAR    KEA+ LMAKALQEC  SGIL AAS EMAPR QR++ S DA K  
Sbjct  766   ELWLAAIRAEARAGKWKEAEALMAKALQECRRSGILWAASAEMAPRAQRKARSFDAVKNS  825

Query  685   NQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDV  506
              QDP+V+A + K FW DRKVDKARSW  RAV  APDIGDFWA+ YRFE++ GS +   +V
Sbjct  826   EQDPFVVAVVGKFFWQDRKVDKARSWIKRAVAAAPDIGDFWAVLYRFEQEHGSAEAIEEV  885

Query  505   LRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             + +C AAEPKHGE+W  ++K+VEN+H+  + +L +V A  +++++
Sbjct  886   VERCKAAEPKHGERWIRVSKAVENAHQGVEFVLGKVAAGFRRDDS  930



>ref|XP_011399893.1| Pre-mRNA-processing factor 6 [Auxenochlorella protothecoides]
 gb|KFM26937.1| Pre-mRNA-processing factor 6 [Auxenochlorella protothecoides]
Length=761

 Score =   256 bits (655),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 159/221 (72%), Gaps = 0/221 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER G +E+A++ Y +G+K C DC+PLW++ A LEER   L++ARA+L  AR KNP  P L
Sbjct  538   ERQGEVERARAAYHAGIKRCLDCVPLWIAAAALEEREGALARARALLEQARLKNPGQPAL  597

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA R EAR    K A+ ++A+ALQ CP SG + A SI  APRP RRS S DA K+CN 
Sbjct  598   WLAAARTEARAGNAKAAEAVLARALQACPDSGAVWAESIRAAPRPARRSRSVDALKRCND  657

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP V+AA+A+LFW +RKV+KARSWF RAVTL PD+GD WAL+ RFE   G+ +    VL 
Sbjct  658   DPAVVAAVAQLFWGERKVEKARSWFDRAVTLDPDVGDHWALYLRFEAAHGTPEAAAAVLE  717

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKE  377
             + VAAEP+HGE+WQA+AK   N+H+P   +L+++   ++K+
Sbjct  718   RAVAAEPRHGERWQALAKDPVNAHQPLGTLLKKLAQTIEKD  758



>ref|XP_010466441.1| PREDICTED: protein STABILIZED1-like [Camelina sativa]
Length=969

 Score =   258 bits (658),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             ER  +LEQA+  Y+SGLKHCP C PLWLSLA LEE++NGL++ARA+LTMARK+NP   EL
Sbjct  797   ERFKHLEQARKAYDSGLKHCPHCTPLWLSLANLEEKVNGLNRARAILTMARKRNPGGDEL  856

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WLAA+RAE RH  K+EA+ LM+KALQECP SGIL AA IEMAPRP+R++ S DA KKC  
Sbjct  857   WLAAIRAELRHENKREAEHLMSKALQECPNSGILWAADIEMAPRPRRKTKSVDALKKCAH  916

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFE  542
             DP+V AA+AKLFW D+KV+KARSWF RAVTLAP+IGDFWAL+Y+FE
Sbjct  917   DPHVTAAVAKLFWQDKKVEKARSWFKRAVTLAPNIGDFWALYYKFE  962



>ref|XP_002987646.1| hypothetical protein SELMODRAFT_126445 [Selaginella moellendorffii]
 gb|EFJ11221.1| hypothetical protein SELMODRAFT_126445 [Selaginella moellendorffii]
Length=938

 Score =   253 bits (645),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 160/225 (71%), Gaps = 2/225 (1%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHC--PDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNP  866
             ER GNL  A+S YE  L+ C      P+WL+ A+LEE+   ++KARA+LT AR K  ++P
Sbjct  706   ERTGNLAAARSVYERALERCDPATSTPVWLAAAELEEKGGRIAKARALLTTARLKKKEDP  765

Query  865   ELWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKC  686
             ELWLAA+RAEAR    KEA+ LMAKALQEC  SGIL AAS EMAPR QR++ S DA K  
Sbjct  766   ELWLAAIRAEARAGKWKEAEALMAKALQECRRSGILWAASAEMAPRAQRKARSFDAVKNS  825

Query  685   NQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDV  506
              QDP+V+A + K FW DRKVDKARSW  RAV  APDIGDFWA+ YRFE+  GS +   +V
Sbjct  826   EQDPFVVAVVGKFFWQDRKVDKARSWIKRAVAAAPDIGDFWAVLYRFEQGHGSTEAIEEV  885

Query  505   LRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             + +C AAEPKHGE+W  ++K+VEN+H+  + +L +V A   +++ 
Sbjct  886   VERCKAAEPKHGEQWIRVSKAVENAHQGVEFVLGKVAAGFGRDDG  930



>gb|KFP45705.1| Pre-mRNA-processing factor 6, partial [Chlamydotis macqueenii]
Length=509

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  293   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  352

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  353   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  412

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  413   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  472

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  473   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  506


 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  156   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  215

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  216   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  275

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  276   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  335

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  336   KSRLKNPKNPDLW  348



>ref|XP_010126560.1| PREDICTED: pre-mRNA-processing factor 6, partial [Chlamydotis 
macqueenii]
Length=506

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  290   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  349

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  350   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  409

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  410   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  469

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  470   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  503


 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  153   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  212

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  213   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  272

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  273   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  332

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  333   KSRLKNPKNPDLW  345



>gb|KFM80330.1| Pre-mRNA-processing factor 6, partial [Stegodyphus mimosarum]
Length=263

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 151/218 (69%), Gaps = 0/218 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G + +A+  Y  G+K CP+ IPLWL L++LEER   L KAR+VL  AR KNPKNP+L
Sbjct  42    EQEGRVNEARDVYNQGIKRCPNSIPLWLLLSQLEERTGALIKARSVLEKARLKNPKNPQL  101

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
              L ++R E R   K  A  LMAKA+QECP SGIL A +I +  RPQR++ S DA K+C  
Sbjct  102   LLESIRVELRGGLKDIALNLMAKAMQECPNSGILWAEAIFLEARPQRKTKSVDALKRCEH  161

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A++KLFW +RK  KAR WF++ V + PD+GD WA +Y+FE   G+E+ + DV +
Sbjct  162   DPHVLLAVSKLFWTERKTIKARDWFNKTVKIDPDLGDAWAYYYKFELIHGTEEQQEDVKK  221

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             +CV AEP+HGE W  ++K++ N  K T++IL    A+L
Sbjct  222   RCVHAEPRHGENWCKVSKNINNWRKKTEQILIMTAASL  259



>ref|XP_007909448.1| PREDICTED: pre-mRNA-processing factor 6 [Callorhinchus milii]
Length=959

 Score =   249 bits (637),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 155/219 (71%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E++GN ++A+  Y  GLK CP   PLWL L++LEE+   L++ARA+L  AR KNP+NPEL
Sbjct  738   EQVGNTDKAREAYNYGLKKCPHSSPLWLLLSRLEEKAGNLTRARAILEKARLKNPQNPEL  797

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  798   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  857

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V + PD+GD WALFY+FE Q G+ED + DV +
Sbjct  858   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDPDLGDAWALFYKFELQHGTEDQQEDVKK  917

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W  ++K ++N  +   EIL  V A +K
Sbjct  918   RCENAEPRHGELWCEVSKDIKNWQRKIGEILMLVAAQIK  956


 Score = 73.6 bits (179),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 89/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  606   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  665

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +   P+ R    +A K    
Sbjct  666   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGDIPRARELCEEALKHYED  725

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       DKAR  ++  +   P     W L  R EE+ G+      +L 
Sbjct  726   FPKLWMMKGQIEEQVGNTDKAREAYNYGLKKCPHSSPLWLLLSRLEEKAGNLTRARAILE  785

Query  499   KCVAAEPKHGEKW  461
             K     P++ E W
Sbjct  786   KARLKNPQNPELW  798



>gb|EAW75175.1| chromosome 20 open reading frame 14, isoform CRA_b [Homo sapiens]
Length=520

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  304   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  363

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  364   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  423

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  424   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  483

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  484   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  517


 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  167   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  226

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  227   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  286

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  287   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  346

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  347   KSRLKNPKNPGLW  359



>emb|CAB70695.1| hypothetical protein [Homo sapiens]
Length=540

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  324   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  383

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  384   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  443

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  444   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  503

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  504   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  537


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  187   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  246

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  247   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  306

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  307   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  366

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  367   KSRLKNPKNPGLW  379



>ref|XP_001692638.1| splicing factor, component of the U4/U6-U5 snRNP complex [Chlamydomonas 
reinhardtii]
 gb|EDP03657.1| splicing factor, component of the U4/U6-U5 snRNP complex [Chlamydomonas 
reinhardtii]
Length=947

 Score =   246 bits (629),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 149/197 (76%), Gaps = 0/197 (0%)
 Frame = -1

Query  982  CPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVRAEARHSYKKEADV  803
            CPD IPLW S A+LEE    +++ARA+L  AR KNPK+ ELWLAA+R E R   +K AD 
Sbjct  743  CPDSIPLWRSAARLEEEAGNVARARALLEQARLKNPKSAELWLAAIRTEQRAGNEKAADT  802

Query  802  LMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLAAIAKLFWNDRKVD  623
             +AKALQ+CPTSG L A +I MAPRP R++ + DA K+C+ DP+V+AA+A+LFW DRKV+
Sbjct  803  ALAKALQDCPTSGPLWAEAISMAPRPARKTKATDALKRCDNDPHVVAAVAQLFWADRKVE  862

Query  622  KARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAIAKS  443
            KARSWF+RAVTL PDIGD WA FY+FE QFG+ + + DV  +C AAEP HGE+W  ++K 
Sbjct  863  KARSWFNRAVTLNPDIGDHWAQFYKFECQFGTPEQQADVSSRCAAAEPHHGERWCRVSKD  922

Query  442  VENSHKPTDEILRQVVA  392
              N+H+P + +LR+ VA
Sbjct  923  TRNAHQPPEVLLRRTVA  939


 Score = 60.8 bits (146),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 104/227 (46%), Gaps = 29/227 (13%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E  G L +A+     G + CP+   +WL  A+L+   N    A+A+L     + P++ +L
Sbjct  316   EVAGKLPEARKLVMQGCELCPNSEDIWLEAARLQTPDN----AKALLARGVAQLPESTKL  371

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             W+AA + EA  + K     ++ KAL+  PTS  L  A++E+A     R   + A + C Q
Sbjct  372   WMAAAKLEADDTAKAR---VLRKALERIPTSVRLWKAAVELAAEDDARILLSRAVECCPQ  428

Query  679   DPYVLAAIAKL--FWNDRKV-DKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRND  509
                +  A+A+L  + N RKV + AR    +AV   P I   W    + EE  G++    D
Sbjct  429   AVELWLALARLETYENARKVLNNAR----KAVPTEPAI---WVTAAKLEEAHGAD---QD  478

Query  508   VLRKCVAAEPK---------HGEKWQAIAKSVENSHKPTDEILRQVV  395
              + K V    K         H + W   A++ E S  P     R +V
Sbjct  479   TVDKIVGKALKSLSANGVVIHRDAWIKEAENCERSSPPQLVTARAIV  525



>gb|AAH05801.1| Prpf6 protein, partial [Mus musculus]
Length=493

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  277   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  336

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  337   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  396

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  397   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  456

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  457   EPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  490


 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  140   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  199

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  200   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAAQELCEEALRHYED  259

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  260   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  319

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  320   KSRLKNPKNPGLW  332



>ref|XP_009512228.1| PREDICTED: pre-mRNA-processing factor 6, partial [Phalacrocorax 
carbo]
 gb|KFW81402.1| Pre-mRNA-processing factor 6, partial [Phalacrocorax carbo]
Length=736

 Score =   242 bits (617),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  520   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  579

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  580   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  639

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  640   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  699

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  700   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  733


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  383   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  442

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  443   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  502

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  503   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  562

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  563   KSRLKNPKNPDLW  575



>gb|EGW10560.1| Pre-mRNA-processing factor 6 [Cricetulus griseus]
Length=535

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  319   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  378

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  379   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  438

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  439   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  498

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  499   EPRHGELWCAVSKDITNWQRKIGEILVLVAAHIK  532



>ref|XP_008299806.1| PREDICTED: pre-mRNA-processing factor 6 [Stegastes partitus]
Length=969

 Score =   243 bits (621),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 155/219 (71%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N+++A+  Y  GLK CP  + LWL L+ LEER+  L++ARA+L  AR KNP++PEL
Sbjct  748   EQCENMDKAREAYNQGLKKCPHSVALWLLLSHLEERVGQLTRARAILEKARLKNPQSPEL  807

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  808   WLESVRLEFRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  867

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V + PD+GD WALFY+FE Q G+E+ + +V +
Sbjct  868   DPHVLLAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWALFYKFELQHGTEEQQEEVRK  927

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  K T EIL QV + +K
Sbjct  928   RCENAEPRHGELWCAESKHVLNWQKKTGEILAQVASKIK  966


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 87/198 (44%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  616   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAEDVPAARSILALAFQANPNSEEIWLA  675

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  676   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  730

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++      +DKAR  +++ +   P     W L    EE+ G     
Sbjct  731   KHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVALWLLLSHLEERVGQLTRA  790

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  E W
Sbjct  791   RAILEKARLKNPQSPELW  808



>ref|XP_010287290.1| PREDICTED: pre-mRNA-processing factor 6, partial [Phaethon lepturus]
Length=821

 Score =   242 bits (617),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  605   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  664

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  665   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEVRPQRKTKSVDALKKCEHDPHVL  724

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  725   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  784

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  785   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  818


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  468   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  527

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  528   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  587

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  588   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  647

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  648   KSRLKNPKNPDLW  660



>gb|EOA93860.1| Pre-mRNA-processing factor 6, partial [Anas platyrhynchos]
Length=546

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KN KNP+LWL +V
Sbjct  330   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNAKNPDLWLESV  389

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  390   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  449

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  450   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  509

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  K   EIL  V A LK
Sbjct  510   EPRHGELWCDVSKDIANWQKKIGEILVLVAAKLK  543


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  193   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  252

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  253   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  312

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  313   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  372

Query  499   KCVAAEPKHGEKW  461
             K      K+ + W
Sbjct  373   KSRLKNAKNPDLW  385



>gb|KFQ67669.1| Pre-mRNA-processing factor 6, partial [Phaethon lepturus]
Length=822

 Score =   241 bits (616),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  606   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  665

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  666   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEVRPQRKTKSVDALKKCEHDPHVL  725

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  726   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  785

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  786   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  819


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  469   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  528

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  529   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  588

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  589   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  648

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  649   KSRLKNPKNPDLW  661



>ref|XP_002414072.1| pre-mRNA splicing factor, putative [Ixodes scapularis]
 gb|EEC17380.1| pre-mRNA splicing factor, putative [Ixodes scapularis]
Length=939

 Score =   242 bits (618),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 152/215 (71%), Gaps = 0/215 (0%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  ++A++TY  GLK CP  +PLWL L++LEE    L+KAR+VL  AR +NP +PELWL 
Sbjct  721   GQTDEARATYNQGLKKCPTSVPLWLLLSRLEESGGALTKARSVLEKARLRNPCHPELWLE  780

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPY  671
             AVR EAR  +K+ A  LMAKA+Q+CP SGIL + +I M PRPQR++ S DA K+C  DPY
Sbjct  781   AVRVEARAGFKEIALTLMAKAMQDCPGSGILWSEAIFMEPRPQRKTKSVDALKRCEHDPY  840

Query  670   VLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCV  491
             VL A++KLFW +RK +K R W +R V + PD+GD WA FY+FE   GSE+ + +V R+C+
Sbjct  841   VLLAVSKLFWTERKTNKVREWLNRTVKIEPDLGDAWAYFYKFELLHGSEEQQEEVKRRCI  900

Query  490   AAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
              AEP+HG  W  ++K + N  K T++IL  V A+L
Sbjct  901   LAEPRHGPNWCKVSKDIVNWRKKTEDILVLVAASL  935


 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 93/191 (49%), Gaps = 7/191 (4%)
 Frame = -1

Query  1012  KSTYESGLK----HCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +ST E+ L+    HCP    LWL  AK +     +  AR++L++A + NP + E+WLAAV
Sbjct  588   RSTLEALLQRAVAHCPKAEVLWLMGAKSKWMAGDIPAARSILSLAFQANPNSEEIWLAAV  647

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQRRSTS--ADAYKKCNQDP  674
             + E+ ++  + A  L+AKA    PT+ +++ +  +E A    R ++    +  K     P
Sbjct  648   KLESENNEFERARRLLAKARSSAPTARVMMKSVRLEWALGDLRMASELLEEGLKLYADFP  707

Query  673   YVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKC  494
              +     ++  +  + D+AR+ +++ +   P     W L  R EE  G+      VL K 
Sbjct  708   KLWMMKGQILQSQGQTDEARATYNQGLKKCPTSVPLWLLLSRLEESGGALTKARSVLEKA  767

Query  493   VAAEPKHGEKW  461
                 P H E W
Sbjct  768   RLRNPCHPELW  778



>ref|XP_005030258.1| PREDICTED: pre-mRNA-processing factor 6-like, partial [Anas platyrhynchos]
Length=575

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KN KNP+LWL +V
Sbjct  359   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNAKNPDLWLESV  418

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  419   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  478

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  479   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  538

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  K   EIL  V A LK
Sbjct  539   EPRHGELWCDVSKDIANWQKKIGEILVLVAAKLK  572


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  222   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  281

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  282   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  341

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  342   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  401

Query  499   KCVAAEPKHGEKW  461
             K      K+ + W
Sbjct  402   KSRLKNAKNPDLW  414



>ref|XP_010749961.1| PREDICTED: pre-mRNA-processing factor 6 [Larimichthys crocea]
Length=937

 Score =   242 bits (618),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 156/219 (71%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N+++A+  Y  GLK CP  + LWL L++LEER+  L++ARA+L  AR KNP++PEL
Sbjct  716   EQCENMDKAREAYNQGLKKCPHSVALWLLLSRLEERVGQLTRARAILEKARLKNPQSPEL  775

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  ++ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  776   WLESVRLEFRAGLKNISNTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  835

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V + PD+GD WALFY+FE Q G+E+ + +V +
Sbjct  836   DPHVLLAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWALFYKFELQHGTEEQQEEVRK  895

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  K T EIL +V + +K
Sbjct  896   RCENAEPRHGELWCAESKHVLNWQKKTGEILAEVASKIK  934


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  584   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAEDVPAARSILALAFQANPNSEEIWLA  643

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  644   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  698

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++      +DKAR  +++ +   P     W L  R EE+ G     
Sbjct  699   KHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVALWLLLSRLEERVGQLTRA  758

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  E W
Sbjct  759   RAILEKARLKNPQSPELW  776



>ref|XP_009575883.1| PREDICTED: pre-mRNA-processing factor 6, partial [Fulmarus glacialis]
 ref|XP_009925924.1| PREDICTED: pre-mRNA-processing factor 6, partial [Haliaeetus 
albicilla]
 gb|KFQ11038.1| Pre-mRNA-processing factor 6, partial [Haliaeetus albicilla]
 gb|KFW04752.1| Pre-mRNA-processing factor 6, partial [Fulmarus glacialis]
Length=917

 Score =   242 bits (617),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILMLVAAKLK  914


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>ref|XP_006639651.1| PREDICTED: pre-mRNA-processing factor 6-like [Lepisosteus oculatus]
Length=980

 Score =   242 bits (617),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +++A+  Y  GLK CP  IPLWL L++LEE+   L++ARA+L  +R KNP+NPELWL +V
Sbjct  764   MDKAREAYNQGLKKCPHSIPLWLLLSRLEEKAGQLTRARAILEKSRLKNPQNPELWLESV  823

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  ++ LMAKALQECP SGIL A +I +  RPQR++ S DA KKC  DP+VL
Sbjct  824   RLEYRAGLKNISNTLMAKALQECPNSGILWAEAIFLESRPQRKTKSVDALKKCEHDPHVL  883

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V + PD+GD WALFY+FE Q G+E+ + +V R+C  A
Sbjct  884   LAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWALFYKFEIQHGTEEQQEEVKRRCENA  943

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A +K + N  K   EIL  V A +K
Sbjct  944   EPRHGELWCAESKHIHNWQKKIGEILVLVAAKIK  977


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  627   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  686

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  687   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAAQELCVEALKHYED  746

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++    + +DKAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  747   FPKLWMMKGQIEEQSQCMDKAREAYNQGLKKCPHSIPLWLLLSRLEEKAGQLTRARAILE  806

Query  499   KCVAAEPKHGEKW  461
             K     P++ E W
Sbjct  807   KSRLKNPQNPELW  819



>ref|XP_009072246.1| PREDICTED: pre-mRNA-processing factor 6, partial [Acanthisitta 
chloris]
 ref|XP_009694487.1| PREDICTED: pre-mRNA-processing factor 6, partial [Cariama cristata]
 ref|XP_009817816.1| PREDICTED: pre-mRNA-processing factor 6, partial [Gavia stellata]
 ref|XP_009970754.1| PREDICTED: pre-mRNA-processing factor 6, partial [Tyto alba]
 ref|XP_010180096.1| PREDICTED: pre-mRNA-processing factor 6, partial [Mesitornis 
unicolor]
 ref|XP_010309910.1| PREDICTED: pre-mRNA-processing factor 6, partial [Balearica regulorum 
gibbericeps]
 gb|KFO06539.1| Pre-mRNA-processing factor 6, partial [Balearica regulorum gibbericeps]
 gb|KFO53263.1| Pre-mRNA-processing factor 6, partial [Corvus brachyrhynchos]
 gb|KFP12585.1| Pre-mRNA-processing factor 6, partial [Egretta garzetta]
 gb|KFP63060.1| Pre-mRNA-processing factor 6, partial [Cariama cristata]
 gb|KFP79723.1| Pre-mRNA-processing factor 6, partial [Acanthisitta chloris]
 gb|KFQ33109.1| Pre-mRNA-processing factor 6, partial [Mesitornis unicolor]
 gb|KFQ58560.1| Pre-mRNA-processing factor 6, partial [Pelecanus crispus]
 gb|KFR06769.1| Pre-mRNA-processing factor 6, partial [Nipponia nippon]
 gb|KFV58136.1| Pre-mRNA-processing factor 6, partial [Tyto alba]
 gb|KFV60020.1| Pre-mRNA-processing factor 6, partial [Gavia stellata]
 gb|KGM00032.1| Pre-mRNA-processing factor 6, partial [Charadrius vociferus]
Length=917

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  914


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>gb|KFW74778.1| Pre-mRNA-processing factor 6, partial [Manacus vitellinus]
Length=917

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  914


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>ref|XP_005801720.1| PREDICTED: pre-mRNA-processing factor 6-like [Xiphophorus maculatus]
Length=969

 Score =   242 bits (617),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 155/219 (71%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N+++A+  Y  GLK CP  +PLWL L+ LEER+  L++ARA+L  AR KNP++P+L
Sbjct  748   EQCENMDKAREAYNQGLKKCPHSVPLWLLLSHLEERVGQLTRARAILEKARLKNPQSPDL  807

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  808   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  867

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V + PD+GD WALFY+FE Q G+E+ + +V +
Sbjct  868   DPHVLLAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWALFYKFELQHGTEEQQEEVRK  927

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  + T EIL  V + +K
Sbjct  928   RCENAEPRHGELWCAESKHVLNWQRKTGEILALVASKIK  966


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 88/198 (44%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +   N +  AR++L +A + NP + E+WLA
Sbjct  616   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLANDVPAARSILALAFQANPNSEEIWLA  675

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  676   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  730

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++      +DKAR  +++ +   P     W L    EE+ G     
Sbjct  731   KHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVPLWLLLSHLEERVGQLTRA  790

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  + W
Sbjct  791   RAILEKARLKNPQSPDLW  808



>gb|KFZ67166.1| Pre-mRNA-processing factor 6, partial [Podiceps cristatus]
Length=917

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  914


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>ref|XP_009325174.1| PREDICTED: pre-mRNA-processing factor 6, partial [Pygoscelis 
adeliae]
 gb|KFM03894.1| Pre-mRNA-processing factor 6, partial [Aptenodytes forsteri]
 gb|KFW69111.1| Pre-mRNA-processing factor 6, partial [Pygoscelis adeliae]
Length=917

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 150/213 (70%), Gaps = 0/213 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +VR
Sbjct  702   EKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESVR  761

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL 
Sbjct  762   LEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVLL  821

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  AE
Sbjct  822   AVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAE  881

Query  481   PKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             P+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  882   PRHGELWCDVSKDIENWQKKIGEILMLVAAKLK  914


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       +KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELAEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>ref|XP_010016636.1| PREDICTED: pre-mRNA-processing factor 6, partial [Nestor notabilis]
 gb|KFQ43116.1| Pre-mRNA-processing factor 6, partial [Nestor notabilis]
Length=917

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +++A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VDKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  I+K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDISKDIENWQKKIGEILMLVAAKLK  914


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      VDKAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVDKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>ref|XP_005240002.1| PREDICTED: pre-mRNA-processing factor 6 [Falco peregrinus]
 ref|XP_005445064.1| PREDICTED: pre-mRNA-processing factor 6 [Falco cherrug]
Length=928

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  712   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  771

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  772   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  831

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  832   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  891

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  892   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  925


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  575   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  634

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  635   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  694

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  695   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  754

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  755   KSRLKNPKNPDLW  767



>ref|XP_009491956.1| PREDICTED: pre-mRNA-processing factor 6, partial [Pelecanus crispus]
Length=925

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  709   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  768

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  769   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  828

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  829   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  888

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  889   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  922


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  572   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  631

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  632   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  691

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  692   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  751

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  752   KSRLKNPKNPDLW  764



>ref|XP_008944238.1| PREDICTED: pre-mRNA-processing factor 6, partial [Merops nubicus]
 gb|KFQ17005.1| Pre-mRNA-processing factor 6, partial [Merops nubicus]
Length=917

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VERAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  914


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V++AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVERAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>gb|KFP04021.1| Pre-mRNA-processing factor 6, partial [Calypte anna]
Length=924

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  708   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  767

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  768   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  827

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  828   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  887

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  888   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  921


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  571   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  630

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  631   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  690

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  691   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  750

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  751   KSRLKNPKNPDLW  763



>gb|KGL81570.1| Pre-mRNA-processing factor 6, partial [Tinamus guttatus]
Length=917

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 153/219 (70%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E++   E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+L
Sbjct  696   EQIELTEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDL  755

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  
Sbjct  756   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEH  815

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V +
Sbjct  816   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKK  875

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  876   RCENAEPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  914


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       +KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQIELTEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>ref|XP_010567787.1| PREDICTED: pre-mRNA-processing factor 6 [Haliaeetus leucocephalus]
 ref|XP_011576786.1| PREDICTED: pre-mRNA-processing factor 6 [Aquila chrysaetos canadensis]
Length=941

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  725   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  905   EPRHGELWCDVSKDIENWQKKIGEILMLVAAKLK  938


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  768   KSRLKNPKNPDLW  780



>ref|XP_011170398.1| PREDICTED: pre-mRNA-processing factor 6-like, partial [Solenopsis 
invicta]
 gb|EFZ11098.1| hypothetical protein SINV_13115, partial [Solenopsis invicta]
Length=393

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 152/219 (69%), Gaps = 1/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G L++A  TY   +K CP  IPLW  LA+LE + N ++KAR+VL  AR KNPKN EL
Sbjct  171   EQQGYLDKAIDTYNQAIKKCPHSIPLWRLLARLEHKKNQVTKARSVLEKARLKNPKNAEL  230

Query  859   WLAAVRAEARHSYKKE-ADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCN  683
             WL A+R E ++   ++ A+ LMAKALQECPTSG+L A +I M PRPQR++ S DA KKC 
Sbjct  231   WLEAIRNELKNGGARDMANTLMAKALQECPTSGLLWAEAIFMEPRPQRKTKSIDATKKCE  290

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
              DP+VL A++KLFW + K+ K R WF+R V + PD+GD WA FY+FE   G+E+ ++DV 
Sbjct  291   HDPHVLLAVSKLFWCEHKISKCRDWFNRTVKIDPDLGDAWAYFYKFELLNGTEEQQDDVK  350

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             ++C+AAEP HGE W  ++K++ N     D+IL  V   L
Sbjct  351   KRCIAAEPHHGENWCKVSKNIANWCLSIDQILILVAKEL  389


 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 94/204 (46%), Gaps = 4/204 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR +L++A + NP + E+WLA
Sbjct  39    GTRESLETLLQRAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLA  98

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQRRSTS--ADAYKKCNQ  680
             AV+ E+ +S  + A  L+AKA    PT  +++ +A +E A      +     +A +  + 
Sbjct  99    AVKLESENSEYERARRLLAKARASAPTPRVMMKSAKLEWALNNLDAALHLLKEALEAFDD  158

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      +DKA   +++A+   P     W L  R E +         VL 
Sbjct  159   FPKLWLMKGQIEEQQGYLDKAIDTYNQAIKKCPHSIPLWRLLARLEHKKNQVTKARSVLE  218

Query  499   KCVAAEPKHGEKW-QAIAKSVENS  431
             K     PK+ E W +AI   ++N 
Sbjct  219   KARLKNPKNAELWLEAIRNELKNG  242



>ref|XP_002197944.1| PREDICTED: pre-mRNA-processing factor 6 [Taeniopygia guttata]
Length=938

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  722   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  781

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  782   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  841

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  842   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  901

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  902   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  935


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  585   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  644

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  645   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  704

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  705   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  764

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  765   KSRLKNPKNPDLW  777



>gb|KFV68328.1| Pre-mRNA-processing factor 6, partial [Picoides pubescens]
Length=923

 Score =   241 bits (615),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  707   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  766

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  767   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  826

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  827   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  886

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  887   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  920


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  570   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  629

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  630   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  689

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  690   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  749

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  750   KSRLKNPKNPDLW  762



>ref|XP_009900078.1| PREDICTED: pre-mRNA-processing factor 6 [Picoides pubescens]
Length=936

 Score =   241 bits (615),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  720   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  779

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  780   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  839

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  840   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  899

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  900   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  933


 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  583   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  642

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  643   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  702

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  703   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  762

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  763   KSRLKNPKNPDLW  775



>ref|XP_008316164.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6 
[Cynoglossus semilaevis]
Length=952

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 154/215 (72%), Gaps = 0/215 (0%)
 Frame = -1

Query  1027  NLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAA  848
             N+++A+  Y  GLK CP  +PLWL L++LEE++  L++ARA+L  AR KNP++PELW  +
Sbjct  735   NMDKAREAYNQGLKKCPHSVPLWLLLSRLEEKVGQLTRARAILEKARLKNPQSPELWSES  794

Query  847   VRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYV  668
             VR E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  DP+V
Sbjct  795   VRLEFRAGLKNIANTLMAKALQECPNSGILWAQAVFLEARPQRKTKSVDALKKCEHDPHV  854

Query  667   LAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVA  488
             L A+AKLFW++RK+ KAR WF R V + PD+GD WA+FY+FE Q G+E+ + +VL++C  
Sbjct  855   LLAVAKLFWSERKITKAREWFLRTVKIDPDLGDSWAMFYKFELQHGTEEQQAEVLKRCDN  914

Query  487   AEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             AEP+HGE W A +K + N  K T EIL  V + +K
Sbjct  915   AEPRHGELWCAESKHILNWQKKTGEILELVASKIK  949


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK + +   +  AR++L +A + NP + E+WLA
Sbjct  599   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWQAEDVPAARSILALAFQANPNSEEIWLA  658

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  659   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIDDAQDLCTEALKHYED  718

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      +DKAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  719   FPKLWMMRGQIEVQCENMDKAREAYNQGLKKCPHSVPLWLLLSRLEEKVGQLTRARAILE  778

Query  499   KCVAAEPKHGEKW  461
             K     P+  E W
Sbjct  779   KARLKNPQSPELW  791



>ref|XP_008922828.1| PREDICTED: pre-mRNA-processing factor 6 [Manacus vitellinus]
Length=938

 Score =   241 bits (615),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  722   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  781

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  782   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  841

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  842   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  901

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  902   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  935


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  585   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  644

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  645   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  704

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  705   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  764

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  765   KSRLKNPKNPDLW  777



>ref|XP_005491364.1| PREDICTED: pre-mRNA-processing factor 6 [Zonotrichia albicollis]
Length=938

 Score =   241 bits (615),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  722   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  781

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  782   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  841

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  842   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  901

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  902   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  935


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  585   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  644

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  645   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  704

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  705   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  764

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  765   KSRLKNPKNPDLW  777



>ref|XP_005422323.1| PREDICTED: pre-mRNA-processing factor 6, partial [Geospiza fortis]
Length=933

 Score =   241 bits (615),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  717   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  776

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  777   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  836

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  837   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  896

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  897   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  930


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  580   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  639

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  640   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  699

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  700   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  759

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  760   KSRLKNPKNPDLW  772



>ref|XP_004546042.1| PREDICTED: pre-mRNA-processing factor 6-like [Maylandia zebra]
 ref|XP_005931895.1| PREDICTED: pre-mRNA-processing factor 6-like [Haplochromis burtoni]
Length=969

 Score =   241 bits (616),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 153/219 (70%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N+++A+  Y  GLK CP  +PLWL L+ LEER+  L++ARA+L  AR KNP+  EL
Sbjct  748   EQCENMDKAREAYNQGLKKCPHSVPLWLLLSHLEERVGQLTRARAILEKARLKNPQTAEL  807

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  808   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  867

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ K+R WF R V + PD+GD WA FY+FE Q G+E+ + +V +
Sbjct  868   DPHVLLAVAKLFWSERKITKSREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVRK  927

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  K T EIL QV + +K
Sbjct  928   RCENAEPRHGELWCAESKHVLNWQKKTGEILAQVASKIK  966


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 87/198 (44%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  616   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAEDVPAARSILALAFQANPNSEEIWLA  675

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  676   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  730

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++      +DKAR  +++ +   P     W L    EE+ G     
Sbjct  731   KHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVPLWLLLSHLEERVGQLTRA  790

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  E W
Sbjct  791   RAILEKARLKNPQTAELW  808



>ref|XP_010395389.1| PREDICTED: pre-mRNA-processing factor 6 [Corvus cornix cornix]
Length=975

 Score =   241 bits (616),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  759   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  818

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  819   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  878

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  879   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  938

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  939   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  972


 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  622   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  681

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  682   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  741

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  742   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  801

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  802   KSRLKNPKNPDLW  814



>ref|XP_005524836.1| PREDICTED: pre-mRNA-processing factor 6 [Pseudopodoces humilis]
 ref|XP_009091340.1| PREDICTED: pre-mRNA-processing factor 6 [Serinus canaria]
Length=941

 Score =   241 bits (615),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  725   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  905   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  938


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  768   KSRLKNPKNPDLW  780



>ref|XP_008496174.1| PREDICTED: pre-mRNA-processing factor 6 [Calypte anna]
Length=965

 Score =   241 bits (615),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  749   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  808

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  809   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  868

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  869   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  928

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  929   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  962


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  612   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  671

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  672   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  731

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  732   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  791

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  792   KSRLKNPKNPDLW  804



>ref|XP_010219146.1| PREDICTED: pre-mRNA-processing factor 6 [Tinamus guttatus]
Length=928

 Score =   241 bits (615),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 153/219 (70%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E++   E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+L
Sbjct  707   EQIELTEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDL  766

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  
Sbjct  767   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEH  826

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V +
Sbjct  827   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKK  886

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  887   RCENAEPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  925


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  575   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  634

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  635   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  694

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       +KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  695   FPKLWMMKGQIEEQIELTEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  754

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  755   KSRLKNPKNPDLW  767



>ref|XP_006796391.1| PREDICTED: pre-mRNA-processing factor 6-like [Neolamprologus 
brichardi]
Length=969

 Score =   241 bits (615),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 153/219 (70%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N+++A+  Y  GLK CP  +PLWL L+ LEER+  L++ARA+L  AR KNP+  EL
Sbjct  748   EQCENMDKAREAYNQGLKKCPHSVPLWLLLSHLEERVGQLTRARAILEKARLKNPQTAEL  807

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  808   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  867

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ K+R WF R V + PD+GD WA FY+FE Q G+E+ + +V +
Sbjct  868   DPHVLLAVAKLFWSERKITKSREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVRK  927

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  K T EIL QV + +K
Sbjct  928   RCENAEPRHGELWCAESKHVLNWQKKTGEILAQVASKIK  966


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 87/198 (44%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  616   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAEDVPAARSILALAFQANPNSEEIWLA  675

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  676   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  730

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++      +DKAR  +++ +   P     W L    EE+ G     
Sbjct  731   KHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVPLWLLLSHLEERVGQLTRA  790

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  E W
Sbjct  791   RAILEKARLKNPQTAELW  808



>gb|ESA12445.1| hypothetical protein GLOINDRAFT_323384 [Rhizophagus irregularis 
DAOM 181602]
Length=527

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 146/215 (68%), Gaps = 0/215 (0%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G+L  A++TY   LK+CP  +PLW+  ++LEE+   L KARA L   R  NPK PELW  
Sbjct  312   GDLPAARATYARALKNCPKSVPLWILASRLEEKACFLIKARATLERGRLLNPKTPELWCE  371

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPY  671
             AVR E R +    A  L+AKALQECP SG+L + +I M PRPQR++ S DA KKC+ DP 
Sbjct  372   AVRVELRGNNINMAKALLAKALQECPNSGLLWSEAIFMEPRPQRKTKSVDALKKCDNDPI  431

Query  670   VLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCV  491
             ++  IA+LFW +RKVDK R+WF +AV + PD GD WA FY+FE Q G+E  + DV+ +CV
Sbjct  432   IIMTIARLFWAERKVDKGRTWFEKAVKVDPDRGDSWAWFYKFECQHGTEQQQQDVITRCV  491

Query  490   AAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
              AEP HGE+WQ +AK ++N  K  +EIL+ V   L
Sbjct  492   TAEPHHGEQWQIVAKDMKNVGKSIEEILKLVSNVL  526


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 11/172 (6%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  +  +   +  ++ CP    LWL  AK +     ++ AR +LT A K NP + ++WLA
Sbjct  177   GTRDSLEELLQRAVRFCPQAEVLWLMGAKEKWLAGDVNGARFILTEAFKANPNSEQIWLA  236

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPY  671
             AV+ EA +   + A +L+ KA  +  T  + + + +    R  ++ T A A      D Y
Sbjct  237   AVKLEAENGEYERARMLLHKARGKADTEKVWMKSIV--LERQLKKITEALAMLDEALDKY  294

Query  670   VLAAIAKLFW-----NDRKVD--KARSWFSRAVTLAPDIGDFWALFYRFEEQ  536
                   KL+       D K D   AR+ ++RA+   P     W L  R EE+
Sbjct  295   --PTFDKLWMIKGQIEDEKGDLPAARATYARALKNCPKSVPLWILASRLEEK  344


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 84/190 (44%), Gaps = 16/190 (8%)
 Frame = -1

Query  979  PDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVRAEARHSYKKEADVL  800
            P  + LWL+LA+LE   N    A+ VL  AR + P + E+W+AA R E +   +K  D +
Sbjct  20   PLSVDLWLALARLESYEN----AKKVLNKARGQIPTSHEIWIAAARLEEQQGNEKMTDRI  75

Query  799  MAKALQECPTSGILLAAS--IEMAPRPQRRST--SADAYKKCNQDPYVLAAIAKLFWNDR  632
            +AKA+      G +L     ++ A + +R  +  +  A  +      +     K  W + 
Sbjct  76   IAKAVTVLSEKGSVLGRDQWLQEAEKCEREGSVGTCQAIVRNTIGMGIEEQDKKTIWLED  135

Query  631  --------KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPK  476
                     ++ AR+ F++A+   P     W      E+  G+ D   ++L++ V   P+
Sbjct  136  AESCILHGSIETARAIFAQALKTYPGKKSIWRKAAFLEKSHGTRDSLEELLQRAVRFCPQ  195

Query  475  HGEKWQAIAK  446
                W   AK
Sbjct  196  AEVLWLMGAK  205



>ref|XP_003787915.1| PREDICTED: pre-mRNA-processing factor 6 [Otolemur garnettii]
Length=857

 Score =   240 bits (613),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 152/219 (69%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R +NPKNPEL
Sbjct  636   EQEGQMEKAREAYSQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLRNPKNPEL  695

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  
Sbjct  696   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEH  755

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V +
Sbjct  756   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRK  815

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A++K + N  +   EIL  V   +K
Sbjct  816   RCENAEPRHGELWCAVSKDITNWQRKIGEILVLVAGHIK  854


 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 90/193 (47%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  504   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  563

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  564   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGSIAAAQELCEEALRPYED  623

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   + +++KAR  +S+ +   P     W L  R EE+ G       +L 
Sbjct  624   FPKLWMMKGQIEEQEGQMEKAREAYSQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  683

Query  499   KCVAAEPKHGEKW  461
             K     PK+ E W
Sbjct  684   KSRLRNPKNPELW  696



>ref|XP_009435945.1| PREDICTED: pre-mRNA-processing factor 6 isoform X1 [Pan troglodytes]
Length=830

 Score =   240 bits (612),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  614   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  673

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  674   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  733

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  734   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  793

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  794   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  827


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  477   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  536

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  537   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  596

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  597   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  656

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  657   KSRLKNPKNPGLW  669



>gb|EAW75177.1| chromosome 20 open reading frame 14, isoform CRA_d [Homo sapiens]
Length=845

 Score =   240 bits (612),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  629   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  688

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  689   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  748

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  749   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  808

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  809   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  842


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  492   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  551

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  552   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  611

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  612   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  671

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  672   KSRLKNPKNPGLW  684



>ref|XP_009633092.1| PREDICTED: pre-mRNA-processing factor 6 [Egretta garzetta]
Length=1036

 Score =   241 bits (615),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  820   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  879

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  880   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  939

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  940   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  999

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  1000  EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  1033


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  683   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  742

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  743   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  802

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  803   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  862

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  863   KSRLKNPKNPDLW  875



>ref|XP_008412127.1| PREDICTED: pre-mRNA-processing factor 6 [Poecilia reticulata]
Length=969

 Score =   241 bits (614),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 156/219 (71%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N+++A+  Y  GLK CP  +PLWL L++LEER+  L++ARA+L  AR KNP++P+L
Sbjct  748   EQCENMDKAREAYNQGLKKCPHSVPLWLLLSRLEERVGQLTRARAILEKARLKNPQSPDL  807

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  ++ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  808   WLESVRLEYRAGLKNISNTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  867

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ K+R WF R V + PD+GD WALFY+FE Q G+E+ + +V +
Sbjct  868   DPHVLLAVAKLFWSERKITKSREWFLRTVKIEPDLGDAWALFYKFELQHGTEEQQEEVRK  927

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  + T EIL  V + +K
Sbjct  928   RCENAEPRHGELWCAESKHVLNWQRKTGEILALVASKIK  966


 Score = 70.5 bits (171),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 89/198 (45%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +   N +  AR++L +A + NP + E+WLA
Sbjct  616   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLANDVPAARSILALAFQANPNSEEIWLA  675

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  676   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  730

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++      +DKAR  +++ +   P     W L  R EE+ G     
Sbjct  731   KHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVPLWLLLSRLEERVGQLTRA  790

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  + W
Sbjct  791   RAILEKARLKNPQSPDLW  808



>gb|EMC83474.1| Pre-mRNA-processing factor 6, partial [Columba livia]
Length=917

 Score =   240 bits (613),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K ++N  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIQNWQKKIGEILVLVAAKLK  914


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>ref|XP_008634309.1| PREDICTED: pre-mRNA-processing factor 6 [Corvus brachyrhynchos]
Length=1036

 Score =   241 bits (614),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  820   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  879

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  880   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  939

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  940   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  999

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  1000  EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  1033


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  683   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  742

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  743   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  802

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  803   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  862

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  863   KSRLKNPKNPDLW  875



>ref|XP_009864597.1| PREDICTED: pre-mRNA-processing factor 6, partial [Apaloderma 
vittatum]
 gb|KFP85856.1| Pre-mRNA-processing factor 6, partial [Apaloderma vittatum]
Length=917

 Score =   240 bits (613),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +++A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VDKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  914


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      VDKAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVDKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>ref|XP_007524498.1| PREDICTED: pre-mRNA-processing factor 6 isoform X1 [Erinaceus 
europaeus]
Length=941

 Score =   240 bits (613),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 153/219 (70%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP L
Sbjct  720   EQEGLMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGL  779

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SG+L + +I +  RPQR++ S DA KKC  
Sbjct  780   WLESVRLEYRAGLKNIANTLMAKALQECPNSGVLWSEAIFLEARPQRKTKSVDALKKCEH  839

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V R
Sbjct  840   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRR  899

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A++K + N  +   EIL  V A++K
Sbjct  900   RCENAEPRHGELWCAVSKDIANWQRKIGEILVLVAASIK  938


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   +  ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQVEEQEGLMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_007524499.1| PREDICTED: pre-mRNA-processing factor 6 isoform X2 [Erinaceus 
europaeus]
Length=901

 Score =   240 bits (612),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 153/219 (70%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP L
Sbjct  680   EQEGLMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGL  739

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SG+L + +I +  RPQR++ S DA KKC  
Sbjct  740   WLESVRLEYRAGLKNIANTLMAKALQECPNSGVLWSEAIFLEARPQRKTKSVDALKKCEH  799

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V R
Sbjct  800   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRR  859

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A++K + N  +   EIL  V A++K
Sbjct  860   RCENAEPRHGELWCAVSKDIANWQRKIGEILVLVAASIK  898



>gb|KFQ99062.1| Pre-mRNA-processing factor 6, partial [Opisthocomus hoazin]
Length=917

 Score =   240 bits (613),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +++A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VDRAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  914


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      VD+AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVDRAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>ref|XP_009931643.1| PREDICTED: pre-mRNA-processing factor 6 [Opisthocomus hoazin]
Length=921

 Score =   240 bits (613),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +++A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  705   VDRAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  764

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  765   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  824

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  825   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  884

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  885   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  918


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  568   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  627

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  628   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  687

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      VD+AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  688   FPKLWMMKGQIEEQKELVDRAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  747

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  748   KSRLKNPKNPDLW  760



>gb|EAW75178.1| chromosome 20 open reading frame 14, isoform CRA_e, partial [Homo 
sapiens]
 gb|EAW75179.1| chromosome 20 open reading frame 14, isoform CRA_f [Homo sapiens]
Length=882

 Score =   240 bits (612),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  666   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  725

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  726   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  785

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  786   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  845

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  846   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  879


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  529   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  588

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  589   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  648

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  649   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  708

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  709   KSRLKNPKNPGLW  721



>ref|XP_001113447.2| PREDICTED: pre-mRNA-processing factor 6 [Macaca mulatta]
Length=824

 Score =   239 bits (610),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  608   MENAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  667

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  668   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  727

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  728   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  787

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  788   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  821


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 85/193 (44%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  471   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  530

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  531   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  590

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++ AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  591   FPKLWMMKGQIEEQKEMMENAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  650

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  651   KSRLKNPKNPGLW  663



>ref|XP_004211508.1| PREDICTED: pre-mRNA-processing factor 6-like, partial [Hydra 
vulgaris]
Length=281

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 146/219 (67%), Gaps = 0/219 (0%)
 Frame = -1

Query  1027  NLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAA  848
             +L +A+  Y +G K  P    LW+ LA+LEE+   ++KAR+VL  AR +NP+   LWL +
Sbjct  62    DLYEAQQAYRNGTKKSPTSFQLWILLARLEEKQGNITKARSVLEQARHRNPRVDLLWLES  121

Query  847   VRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYV  668
             VR E R   K  A  LMAKALQ+CP+SG L A +I M  RPQR++ S DA K+C  DP+V
Sbjct  122   VRIETRGGNKDFAKSLMAKALQDCPSSGQLWAEAIFMETRPQRKTKSVDALKRCEHDPHV  181

Query  667   LAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVA  488
             L A++KLFW++RK++KAR WF+R V + PD GD WA FY+FE   G+E  +  ++ +CV 
Sbjct  182   LLAVSKLFWSERKLNKAREWFNRTVKIDPDFGDAWAYFYKFELAHGTEANQKSIMERCVK  241

Query  487   AEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
             +EP+HGE W  IAKS +N  K TDEIL  V   LK  EN
Sbjct  242   SEPRHGEMWNQIAKSTKNWRKKTDEILPIVARTLKPVEN  280



>ref|XP_009471707.1| PREDICTED: pre-mRNA-processing factor 6 [Nipponia nippon]
Length=1029

 Score =   241 bits (614),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  813   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  872

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  873   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  932

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  933   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  992

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  993   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  1026


 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  676   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  735

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  736   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  795

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  796   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  855

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  856   KSRLKNPKNPDLW  868



>ref|XP_005499760.1| PREDICTED: pre-mRNA-processing factor 6 [Columba livia]
Length=942

 Score =   240 bits (613),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  726   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  785

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  786   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  845

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  846   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  905

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K ++N  K   EIL  V A LK
Sbjct  906   EPRHGELWCDVSKDIQNWQKKIGEILVLVAAKLK  939


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  589   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  648

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  649   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  708

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  709   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  768

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  769   KSRLKNPKNPDLW  781



>ref|XP_003512405.2| PREDICTED: pre-mRNA-processing factor 6 isoform X2, partial [Cricetulus 
griseus]
Length=686

 Score =   237 bits (604),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  470   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  529

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  530   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  589

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  590   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  649

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  650   EPRHGELWCAVSKDITNWQRKIGEILVLVAAHIK  683


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  333   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  392

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  393   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNITAAQELCEEALRHYED  452

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  453   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  512

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  513   KSRLKNPKNPGLW  525



>ref|XP_006723832.1| PREDICTED: pre-mRNA-processing factor 6 isoform X1 [Homo sapiens]
Length=868

 Score =   239 bits (610),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  652   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  711

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  712   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  771

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  772   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  831

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  832   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  865


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  515   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  574

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  575   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  634

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  635   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  694

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  695   KSRLKNPKNPGLW  707



>ref|XP_008019876.1| PREDICTED: pre-mRNA-processing factor 6 [Chlorocebus sabaeus]
Length=913

 Score =   239 bits (611),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  697   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  756

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  757   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  816

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  817   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  876

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  877   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  910


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  560   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  619

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  620   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  679

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  680   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  739

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  740   KSRLKNPKNPGLW  752



>dbj|BAG50938.1| unnamed protein product [Homo sapiens]
Length=901

 Score =   239 bits (611),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  685   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  744

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  745   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  804

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  805   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  864

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  865   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  898



>ref|XP_004062614.1| PREDICTED: pre-mRNA-processing factor 6 isoform 2 [Gorilla gorilla 
gorilla]
 gb|EAW75176.1| chromosome 20 open reading frame 14, isoform CRA_c [Homo sapiens]
Length=901

 Score =   239 bits (611),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  685   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  744

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  745   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  804

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  805   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  864

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  865   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  898



>ref|XP_009985480.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6, 
partial [Tauraco erythrolophus]
Length=917

 Score =   239 bits (611),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 150/213 (70%), Gaps = 0/213 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VERAREAYNLGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             EP+HGE W  ++K +EN  K   EIL  V A L
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILTLVAAKL  913


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIVAAQELCEEALRHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V++AR  ++  +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIQEQQELVERAREAYNLGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>gb|AAW24649.1| SJCHGC09396 protein [Schistosoma japonicum]
Length=472

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 142/206 (69%), Gaps = 0/206 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A++TY  GL H P    LWL LA+ EER   L+KAR++L  AR +NPK PELWL A++
Sbjct  257   ERARNTYRDGLNHNPHYTALWLQLARFEERHGNLTKARSILEKARSQNPKTPELWLEAIK  316

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R   K  AD L++KALQECPTSG L A +I M PR QR+S S DA KKC  DP VL 
Sbjct  317   LEVRAQLKPVADSLLSKALQECPTSGCLWAEAIFMTPRAQRKSKSVDALKKCEHDPLVLL  376

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A++K+FW +R V KAR+WF+R V L PD+GD WA FY+FE Q G+ED + +V R+C+ AE
Sbjct  377   AVSKMFWCERLVMKARNWFTRTVKLEPDLGDAWAYFYKFELQHGTEDQQKEVYRRCITAE  436

Query  481   PKHGEKWQAIAKSVENSHKPTDEILR  404
             P HGE W  I+K  +N    T ++L+
Sbjct  437   PHHGEVWCQISKDPKNWRLKTKDLLK  462


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 91/224 (41%), Gaps = 16/224 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  +      + HCP    LWL  AK       +  AR++L  A + NP + E+WLA
Sbjct  107   GTRETLEELLRQAVSHCPQAEVLWLMAAKTRWLAGDVPAARSILARAFEANPNSEEIWLA  166

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAASI------EMAPRPQRRSTSADAYKK  689
             AV+ E+ +     A  L+ KA     T+ + + A+       E+    Q    +   Y +
Sbjct  167   AVKLESENKEYARARRLLDKACASASTARVWMKAARLEWCLGELDKALQMLEKATSMYHQ  226

Query  688   CNQDPYVLAAI---------AKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQ  536
               +   +L+ I          KL   +   ++AR+ +   +   P     W    RFEE+
Sbjct  227   APKLWLMLSQIYEQMSVGEGLKLNEVESLKERARNTYRDGLNHNPHYTALWLQLARFEER  286

Query  535   FGSEDGRNDVLRKCVAAEPKHGEKW-QAIAKSVENSHKPTDEIL  407
              G+      +L K  +  PK  E W +AI   V    KP  + L
Sbjct  287   HGNLTKARSILEKARSQNPKTPELWLEAIKLEVRAQLKPVADSL  330



>ref|XP_007557713.1| PREDICTED: pre-mRNA-processing factor 6 [Poecilia formosa]
Length=969

 Score =   239 bits (611),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 155/219 (71%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N+++A+  Y  GLK CP   PLWL L++LEER+  L++ARA+L  AR KNP++P+L
Sbjct  748   EQCENMDKAREAYNQGLKKCPHSAPLWLLLSRLEERVGQLTRARAILEKARLKNPQSPDL  807

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  808   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  867

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ K+R WF R V + PD+GD WALFY+FE Q G+E+ + +V +
Sbjct  868   DPHVLLAVAKLFWSERKITKSREWFLRTVKIEPDLGDAWALFYKFELQHGTEEQQEEVRK  927

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  + T EIL  V + +K
Sbjct  928   RCENAEPRHGELWCAESKHVLNWQRKTGEILALVASKIK  966


 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 89/198 (45%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +   N +  AR++L +A + NP + E+WLA
Sbjct  616   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLANDVPAARSILALAFQANPNSEEIWLA  675

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  676   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  730

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++      +DKAR  +++ +   P     W L  R EE+ G     
Sbjct  731   KHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSAPLWLLLSRLEERVGQLTRA  790

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  + W
Sbjct  791   RAILEKARLKNPQSPDLW  808



>ref|XP_009891871.1| PREDICTED: pre-mRNA-processing factor 6 [Charadrius vociferus]
Length=1070

 Score =   240 bits (613),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  854   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  913

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  914   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  973

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  974   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  1033

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  1034  EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  1067


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  717   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  776

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  777   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  836

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  837   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  896

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  897   KSRLKNPKNPDLW  909



>ref|XP_003280219.1| PREDICTED: pre-mRNA-processing factor 6 isoform 2 [Nomascus leucogenys]
Length=901

 Score =   239 bits (610),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  685   MERAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  744

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  745   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  804

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  805   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  864

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  865   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  898



>gb|AAD01798.1| putative mitochondrial outer membrane protein import receptor 
[Homo sapiens]
Length=941

 Score =   239 bits (611),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  845   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  905   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  938


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  648   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_001625285.1| predicted protein [Nematostella vectensis]
 gb|EDO33185.1| predicted protein [Nematostella vectensis]
Length=935

 Score =   239 bits (611),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 151/219 (69%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  NL +A+  Y++G+K CP  IPLWL L++LEE+    +KAR+VL   R++NPK+PEL
Sbjct  712   EQEKNLPEAREAYKTGVKKCPTSIPLWLLLSRLEEKTGQATKARSVLEQGRQRNPKSPEL  771

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL AVR E R   K  A  LMAKA+QECPT+G+L + +I M PRPQR++ S DA K+C  
Sbjct  772   WLEAVRIETRGGRKDFARTLMAKAMQECPTAGVLWSEAIFMEPRPQRKTRSVDALKRCEH  831

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             D +VL A+AKLFW++RKV KAR WF+RAV L PD GD WA FYRFE Q G+E  +  V  
Sbjct  832   DAHVLLAVAKLFWSERKVSKARDWFNRAVKLDPDFGDAWAYFYRFELQHGTEAQQESVSH  891

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             KCV  EP HGE W A++K++ N    T ++L     +LK
Sbjct  892   KCVQVEPHHGEVWCAVSKAIPNWRLKTKDVLPLAARSLK  930


 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  +S  +S +KHCP    LWL  AK +   N +  AR++L +A + NP + E+WLA
Sbjct  580   GTRESLESLLQSAVKHCPKAEVLWLMGAKSKWMANDIPSARSILALAFQANPNSEEIWLA  639

Query  850   AVRAEARHSYKKEADVLMAKA-LQECPTSGILLAASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+ +A +  C    ++ +  +E  +   P+      +A +K   
Sbjct  640   AVKLESENNEDQRARKLLQRARMNACTARVMMKSIKLEWVLGNIPEANKLLDEAVQKYPD  699

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                +     +L   ++ + +AR  +   V   P     W L  R EE+ G       VL 
Sbjct  700   FAKLWMMKGQLQEQEKNLPEAREAYKTGVKKCPTSIPLWLLLSRLEEKTGQATKARSVLE  759

Query  499   KCVAAEPKHGEKW  461
             +     PK  E W
Sbjct  760   QGRQRNPKSPELW  772


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 64/230 (28%), Positives = 105/230 (46%), Gaps = 19/230 (8%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             +G++++A+   +S +   P   P W++ A+LEE    +  AR  +    +   KN ++WL
Sbjct  280   IGDIKKARLLLKSVITTNPQHAPGWIAAARLEEVTGRMQAARNTIMKGTEVCEKNEDIWL  339

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILL--AASIEMAPRPQRRSTSADAYKKCNQ  680
              AVR +   + K     ++A+A+++ P S  L   AA++E     ++R      Y+K  +
Sbjct  340   EAVRLQPPDAMK----AVVAQAVRQLPQSVRLWIKAAAVETEIVAKKR-----VYRKALE  390

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                    I K      + + AR   SRAV   P   + W    R E     E+ R  VL 
Sbjct  391   HIPNSVRIWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETY---ENARK-VLN  446

Query  499   KCVAAEPKHGEKWQAIAKSVE-NSHKP-TDEILRQVVAALKKEENAAEIN  356
             K     P     W   AK  E N++ P  ++I+ + VA+LK   N  EIN
Sbjct  447   KARENIPTDRLIWITAAKLEEANNNMPMVEKIIERAVASLKS--NGVEIN  494



>ref|XP_005057356.1| PREDICTED: pre-mRNA-processing factor 6 [Ficedula albicollis]
Length=941

 Score =   239 bits (611),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  +  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  725   VEKAREAFNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  905   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  938


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  F++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKELVEKAREAFNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  768   KSRLKNPKNPDLW  780



>ref|XP_006021718.1| PREDICTED: pre-mRNA-processing factor 6 [Alligator sinensis]
Length=941

 Score =   239 bits (611),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 150/213 (70%), Gaps = 0/213 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +VR
Sbjct  726   EKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESVR  785

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL 
Sbjct  786   LEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVLL  845

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  AE
Sbjct  846   AVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKKRCENAE  905

Query  481   PKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             P+HGE W  ++K +EN  K   EIL  V A +K
Sbjct  906   PRHGELWCEMSKDIENWQKKIGEILVLVAAKIK  938


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       +KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQVEEQKELTEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  768   KSRLKNPKNPDLW  780



>ref|XP_001152053.3| PREDICTED: pre-mRNA-processing factor 6 isoform X2 [Pan troglodytes]
Length=941

 Score =   239 bits (611),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  845   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  905   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  938


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  648   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|NP_036601.2| pre-mRNA-processing factor 6 [Homo sapiens]
 ref|XP_003809979.1| PREDICTED: pre-mRNA-processing factor 6 [Pan paniscus]
 ref|XP_004062613.1| PREDICTED: pre-mRNA-processing factor 6 isoform 1 [Gorilla gorilla 
gorilla]
 sp|O94906.1|PRP6_HUMAN RecName: Full=Pre-mRNA-processing factor 6; AltName: Full=Androgen 
receptor N-terminal domain-transactivating protein 1; 
Short=ANT-1; AltName: Full=PRP6 homolog; AltName: Full=U5 snRNP-associated 
102 kDa protein; Short=U5-102 kDa protein [Homo 
sapiens]
 gb|AAF66128.1|AF221842_1 U5 snRNP-associated 102 kDa protein [Homo sapiens]
 dbj|BAA37140.1| unnamed protein product [Homo sapiens]
 gb|AAH01666.1| PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) [Homo 
sapiens]
 gb|EAW75174.1| chromosome 20 open reading frame 14, isoform CRA_a [Homo sapiens]
 dbj|BAI46012.1| PRP6 pre-mRNA processing factor 6 homolog [synthetic construct]
 gb|AIC51036.1| PRPF6, partial [synthetic construct]
Length=941

 Score =   239 bits (611),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  845   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  905   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  938


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  648   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_003280218.1| PREDICTED: pre-mRNA-processing factor 6 isoform 1 [Nomascus leucogenys]
Length=941

 Score =   239 bits (611),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MERAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  845   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  905   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  938


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  648   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      +++AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKEMMERAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_007062619.1| PREDICTED: pre-mRNA-processing factor 6 [Chelonia mydas]
Length=946

 Score =   239 bits (611),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  730   IEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  789

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  790   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  849

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  850   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKKRCENA  909

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A +K
Sbjct  910   EPRHGELWCEVSKDIENWQKKIGEILVVVAAKIK  943


 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  593   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  652

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  653   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  712

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   D  ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  713   FPKLWMMKGQIEEQDELIEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  772

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  773   KSRLKNPKNPDLW  785



>dbj|BAG36962.1| unnamed protein product [Homo sapiens]
Length=941

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  845   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  905   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  938


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  648   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_011789820.1| PREDICTED: pre-mRNA-processing factor 6 isoform X2 [Colobus angolensis 
palliatus]
Length=901

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  685   MENAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  744

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  745   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  804

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  805   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  864

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  865   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  898



>ref|XP_006273121.1| PREDICTED: pre-mRNA-processing factor 6 [Alligator mississippiensis]
Length=941

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 150/213 (70%), Gaps = 0/213 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +VR
Sbjct  726   ERAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESVR  785

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL 
Sbjct  786   LEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVLL  845

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  AE
Sbjct  846   AVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKKRCENAE  905

Query  481   PKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             P+HGE W  ++K +EN  K   EIL  V A +K
Sbjct  906   PRHGELWCEMSKDIENWQKKIGEILVLVAAKIK  938


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       ++AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQVEEQKELTERAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  768   KSRLKNPKNPDLW  780



>ref|XP_011721219.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6 
[Macaca nemestrina]
Length=961

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  745   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  804

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  805   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  864

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  865   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  924

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  925   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  958


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 85/190 (45%), Gaps = 3/190 (2%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLAAV+
Sbjct  611   ESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVK  670

Query  841   AEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQDPY  671
              E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +     P 
Sbjct  671   LESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPK  730

Query  670   VLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCV  491
             +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L K  
Sbjct  731   LWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSR  790

Query  490   AAEPKHGEKW  461
                PK+   W
Sbjct  791   LKNPKNPGLW  800



>gb|EMP33297.1| Pre-mRNA-processing factor 6, partial [Chelonia mydas]
Length=916

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  700   IEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  759

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  760   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  819

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  820   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKKRCENA  879

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A +K
Sbjct  880   EPRHGELWCEVSKDIENWQKKIGEILVVVAAKIK  913


 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  563   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  622

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  623   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  682

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   D  ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  683   FPKLWMMKGQIEEQDELIEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  742

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  743   KSRLKNPKNPDLW  755



>ref|XP_005569690.1| PREDICTED: pre-mRNA-processing factor 6 [Macaca fascicularis]
 ref|XP_011789819.1| PREDICTED: pre-mRNA-processing factor 6 isoform X1 [Colobus angolensis 
palliatus]
 gb|EHH19499.1| U5 snRNP-associated 102 kDa protein [Macaca mulatta]
Length=941

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MENAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  845   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  905   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  938


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 85/193 (44%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  648   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++ AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKEMMENAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_011929527.1| PREDICTED: pre-mRNA-processing factor 6 [Cercocebus atys]
Length=941

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  845   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   +K
Sbjct  905   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIK  938


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  648   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_006132536.1| PREDICTED: pre-mRNA-processing factor 6, partial [Pelodiscus 
sinensis]
Length=919

 Score =   239 bits (609),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  703   IEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  762

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  763   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  822

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  823   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKKRCENA  882

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A +K
Sbjct  883   EPRHGELWCEVSKDIENWQKKIGEILVLVAAKIK  916


 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  566   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  625

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  626   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  685

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   D  ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  686   FPKLWMMKGQIEEQDELIEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  745

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  746   KSRLKNPKNPDLW  758



>gb|EKC35667.1| Pre-mRNA-processing factor 6 [Crassostrea gigas]
Length=411

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 147/219 (67%), Gaps = 1/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N E A+  Y  GLK CP  IPLWL +++LEE+   L KAR++L  AR KNP+  EL
Sbjct  189   EQNNNKELAREAYNQGLKKCPRAIPLWLLMSRLEEKSGQLIKARSILEKARLKNPQCAEL  248

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL AVR E R   K  A  LMA+ALQECP SGIL A SI M PRPQR++ S DA +KC  
Sbjct  249   WLEAVRVENRGGLKNIAQTLMARALQECPNSGILWAESIAMEPRPQRKTKSVDALRKCEH  308

Query  679   DPYVLAAIAK-LFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
             DP+VL A +K +FW +RKV KAR WF+R V + PD+GD WA FY+FE+  G ED + D+ 
Sbjct  309   DPHVLLAASKYIFWAERKVAKAREWFNRTVKIEPDLGDAWAYFYKFEQAHGDEDSQADIK  368

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             ++C+ A+PKHGE W  ++K ++N    T++IL  V   L
Sbjct  369   KRCINADPKHGEFWCQVSKDIKNWRLRTEQILPLVADCL  407


 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 106/224 (47%), Gaps = 10/224 (4%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  +S  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  91    GTRESLESLLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  150

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAY----KKCN  683
             AV+ E+ ++  + A  L+ KA    PT+ + +    ++  +   +  + +AY    KKC 
Sbjct  151   AVKLESENNEFERARRLLQKARASAPTARLWMMKG-QIEEQNNNKELAREAYNQGLKKCP  209

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
             +   +   +++L     ++ KARS   +A    P   + W    R E + G ++    ++
Sbjct  210   RAIPLWLLMSRLEEKSGQLIKARSILEKARLKNPQCAELWLEAVRVENRGGLKNIAQTLM  269

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALKKEEN  371
              + +   P  G  W   A+S+    +P  +   + V AL+K E+
Sbjct  270   ARALQECPNSGILW---AESIAMEPRPQRKT--KSVDALRKCEH  308



>ref|XP_009272205.1| PREDICTED: pre-mRNA-processing factor 6 [Aptenodytes forsteri]
Length=1192

 Score =   240 bits (613),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 150/213 (70%), Gaps = 0/213 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +VR
Sbjct  977   EKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESVR  1036

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL 
Sbjct  1037  LEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVLL  1096

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  AE
Sbjct  1097  AVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAE  1156

Query  481   PKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             P+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  1157  PRHGELWCDVSKDIENWQKKIGEILMLVAAKLK  1189


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  839   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  898

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  899   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  958

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       +KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  959   FPKLWMMKGQIEEQKELAEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  1018

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  1019  KSRLKNPKNPDLW  1031



>ref|XP_005146915.1| PREDICTED: pre-mRNA-processing factor 6 [Melopsittacus undulatus]
Length=1022

 Score =   239 bits (610),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 151/214 (71%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +++A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  806   VDKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  865

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  866   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  925

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  926   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  985

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  986   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  1019


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  669   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  728

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  729   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  788

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      VDKAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  789   FPKLWMMKGQIEEQKELVDKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  848

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  849   KSRLKNPKNPDLW  861



>ref|XP_007233071.1| PREDICTED: pre-mRNA-processing factor 6-like [Astyanax mexicanus]
Length=730

 Score =   236 bits (603),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 152/219 (69%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N++ A+  Y  GLK CP  +PLWL L++LEER+  L++ARA+L  +R KNP+ PEL
Sbjct  509   EQSENMDLAREAYNQGLKKCPHSMPLWLLLSRLEERVGQLTRARAILEKSRLKNPQAPEL  568

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  ++ LMAKALQECP SG+L A ++ +  RPQR++ S DA KKC  
Sbjct  569   WLESVRLEYRAGLKNISNTLMAKALQECPNSGVLWAEAVFLEARPQRKTKSVDALKKCEH  628

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V + PD+GD WA FY+FE Q G+E+ + +V +
Sbjct  629   DPHVLLAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVKK  688

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K + N  K   EIL  V A LK
Sbjct  689   RCENAEPRHGELWCAESKHILNWQKKIGEILVLVAAKLK  727


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 88/199 (44%), Gaps = 17/199 (9%)
 Frame = -1

Query  1021  EQAKSTYESGLK----HCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             +Q K + E+ L+    HCP    LWL  AK +     +  AR++L +A + NP + E+WL
Sbjct  376   QQQKESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWL  435

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADA  698
             AAV+ E+ ++  + A  L+AKA     T+ + + +        +I+ A     +    +A
Sbjct  436   AAVKLESENNEYERARRLLAKARSSAATARVFMKSIKLEWVLGNIDAA-----QELCTEA  490

Query  697   YKKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDG  518
              +     P +     ++      +D AR  +++ +   P     W L  R EE+ G    
Sbjct  491   LRLYENFPKLWMMKGQIEEQSENMDLAREAYNQGLKKCPHSMPLWLLLSRLEERVGQLTR  550

Query  517   RNDVLRKCVAAEPKHGEKW  461
                +L K     P+  E W
Sbjct  551   ARAILEKSRLKNPQAPELW  569



>ref|XP_005309929.1| PREDICTED: pre-mRNA-processing factor 6 [Chrysemys picta bellii]
Length=977

 Score =   239 bits (609),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  761   IEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  820

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  821   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  880

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  881   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKKRCENA  940

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A +K
Sbjct  941   EPRHGELWCEVSKDIENWQKKIGEILVVVAAKIK  974


 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  624   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  683

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  684   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  743

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   D  ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  744   FPKLWMMKGQIEEQDELIEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  803

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  804   KSRLKNPKNPDLW  816



>ref|XP_005740593.1| PREDICTED: pre-mRNA-processing factor 6-like [Pundamilia nyererei]
Length=892

 Score =   238 bits (607),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 152/219 (69%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N+++A+  Y  GLK CP  +PLWL L+ LEER+  L++ARA+L  AR KNP+  EL
Sbjct  671   EQCENMDKAREAYNQGLKKCPHSVPLWLLLSHLEERVGQLTRARAILEKARLKNPQTAEL  730

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SG L A ++ +  RPQR++ S DA KKC  
Sbjct  731   WLESVRLEYRAGLKNIANTLMAKALQECPNSGNLWAEAVFLEARPQRKTKSVDALKKCEH  790

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ K+R WF R V + PD+GD WA FY+FE Q G+E+ + +V +
Sbjct  791   DPHVLLAVAKLFWSERKITKSREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVRK  850

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  K T EIL QV + +K
Sbjct  851   RCENAEPRHGELWCAESKHVLNWQKKTGEILAQVASKIK  889


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 87/198 (44%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  539   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAEDVPAARSILALAFQANPNSEEIWLA  598

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  599   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  653

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++      +DKAR  +++ +   P     W L    EE+ G     
Sbjct  654   KHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVPLWLLLSHLEERVGQLTRA  713

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  E W
Sbjct  714   RAILEKARLKNPQTAELW  731



>ref|XP_003439073.2| PREDICTED: pre-mRNA-processing factor 6-like [Oreochromis niloticus]
Length=969

 Score =   238 bits (608),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 152/219 (69%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N+++A+  Y  GLK CP  +PLWL L+ LEER+  L++ARA+L  AR KNP+  EL
Sbjct  748   EQCENMDKAREAYNQGLKKCPHSVPLWLLLSHLEERVGQLTRARAILEKARLKNPQTAEL  807

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  808   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  867

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             D +VL A+AKLFW++RK+ KAR WF R V + PD+GD WA FY+FE Q G+E+ + +V +
Sbjct  868   DAHVLLAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVRK  927

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  K T EIL QV + +K
Sbjct  928   RCENAEPRHGELWCAESKHVLNWQKKTGEILAQVASKIK  966


 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 87/198 (44%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  616   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAEDVPAARSILALAFQANPNSEEIWLA  675

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  676   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  730

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++      +DKAR  +++ +   P     W L    EE+ G     
Sbjct  731   KHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVPLWLLLSHLEERVGQLTRA  790

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  E W
Sbjct  791   RAILEKARLKNPQTAELW  808



>gb|KFV72907.1| Pre-mRNA-processing factor 6, partial [Struthio camelus australis]
Length=917

 Score =   238 bits (607),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKN +LWL +V
Sbjct  701   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNADLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  914


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNADLW  756



>ref|XP_007437943.1| PREDICTED: pre-mRNA-processing factor 6-like [Python bivittatus]
Length=567

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 147/212 (69%), Gaps = 0/212 (0%)
 Frame = -1

Query  1018  QAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVRA  839
             +A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKN +LWL +VR 
Sbjct  353   KARDAYNQGLKKCPGSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNQDLWLESVRL  412

Query  838   EARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLAA  659
             E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL A
Sbjct  413   EYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVLLA  472

Query  658   IAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEP  479
             +AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  AEP
Sbjct  473   VAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEP  532

Query  478   KHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +HGE W  ++K + N  +   EIL  V A +K
Sbjct  533   RHGELWCEVSKDISNWQRKIGEILILVAAKIK  564


 Score = 63.9 bits (154),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 89/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  214   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  273

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  274   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  333

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   +  ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  334   FPKLWMMKGQIEEQEELIEKARDAYNQGLKKCPGSIPLWLLLSRLEEKVGQLTRARAILE  393

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  394   KSRLKNPKNQDLW  406



>ref|XP_009669925.1| PREDICTED: pre-mRNA-processing factor 6 [Struthio camelus australis]
Length=923

 Score =   238 bits (607),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKN +LWL +V
Sbjct  707   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNADLWLESV  766

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  767   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  826

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  827   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKKRCENA  886

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  887   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  920


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  570   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  629

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  630   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  689

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  690   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  749

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  750   KSRLKNPKNADLW  762



>ref|XP_010874125.1| PREDICTED: pre-mRNA-processing factor 6 [Esox lucius]
Length=1003

 Score =   238 bits (608),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 151/213 (71%), Gaps = 0/213 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A+  Y  GLK CP  IPLWL L++LEER+  L++ARA+L  +R KN ++PELWL +VR
Sbjct  788   EKAREAYNQGLKKCPHSIPLWLLLSRLEERVGQLTRARAILEKSRLKNAQSPELWLESVR  847

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  DP+VL 
Sbjct  848   LEYRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEHDPHVLL  907

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A+AKLFW++RK+ KAR WF R V + PD+GD WALFY+FE Q G+E+ + +V ++C  AE
Sbjct  908   AVAKLFWSERKITKAREWFLRTVKIEPDLGDAWALFYKFETQHGTEEQQEEVRKRCENAE  967

Query  481   PKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             P+HGE W A +K V +  K   EIL QV + +K
Sbjct  968   PRHGELWCAESKHVLHWQKKIGEILTQVASKIK  1000


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 85/198 (43%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  650   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAEDVPAARSILALAFQANPNSEEIWLA  709

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A          +A 
Sbjct  710   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----HDLCTEAL  764

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++       +KAR  +++ +   P     W L  R EE+ G     
Sbjct  765   KHYEDFPKLWMMRGQIEEQSEHNEKAREAYNQGLKKCPHSIPLWLLLSRLEERVGQLTRA  824

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K      +  E W
Sbjct  825   RAILEKSRLKNAQSPELW  842



>ref|XP_003757601.1| PREDICTED: pre-mRNA-processing factor 6 [Sarcophilus harrisii]
Length=941

 Score =   238 bits (607),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 149/213 (70%), Gaps = 0/213 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +VR
Sbjct  726   EKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESVR  785

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL 
Sbjct  786   LEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVLL  845

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  AE
Sbjct  846   AVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKKRCENAE  905

Query  481   PKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             P+HGE W  ++K +EN  K   EIL  V A +K
Sbjct  906   PRHGELWCEVSKDIENWQKKIGEILVLVAAKIK  938


 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQDLCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   +   +KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQEELTEKAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  768   KSRLKNPKNPDLW  780



>ref|XP_010176712.1| PREDICTED: pre-mRNA-processing factor 6, partial [Caprimulgus 
carolinensis]
Length=917

 Score =   238 bits (606),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK C   IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  701   VEKAREAYNQGLKKCRHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  914


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +         W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCRHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNPDLW  756



>gb|KFZ52735.1| Pre-mRNA-processing factor 6, partial [Caprimulgus carolinensis]
Length=919

 Score =   238 bits (606),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK C   IPLWL L++LEE++  L++ARA+L  +R KNPKNP+LWL +V
Sbjct  703   VEKAREAYNQGLKKCRHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPDLWLESV  762

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  763   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  822

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  823   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  882

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  883   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  916


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  566   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  625

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  626   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  685

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +         W L  R EE+ G       +L 
Sbjct  686   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCRHSIPLWLLLSRLEEKVGQLTRARAILE  745

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  746   KSRLKNPKNPDLW  758



>ref|XP_003904514.1| PREDICTED: pre-mRNA-processing factor 6 [Papio anubis]
Length=941

 Score =   238 bits (606),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MENAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  845   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   +ILR V   ++
Sbjct  905   EPRHGELWCAVSKDIANWQKKIGDILRLVAGRIR  938


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 85/193 (44%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  648   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++ AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKEMMENAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_004339973.1| PRP1 splicing factor, Nterminal/tetratricopeptide repeat domain 
containing protein [Acanthamoeba castellanii str. Neff]
 gb|ELR17957.1| PRP1 splicing factor, Nterminal/tetratricopeptide repeat domain 
containing protein [Acanthamoeba castellanii str. Neff]
Length=946

 Score =   237 bits (605),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 152/214 (71%), Gaps = 1/214 (0%)
 Frame = -1

Query  1027  NLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAA  848
             N E A++ Y+ GL +CP C+PLWL  A LEER + + KAR++L  AR KNPKN ELWLAA
Sbjct  731   NPEAARAIYQRGLINCPQCVPLWLCTAALEERQSAM-KARSLLEKARLKNPKNQELWLAA  789

Query  847   VRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYV  668
             +  E R    K A  L+AKA+Q+CPT G+L A ++ M PRP+++S S DA K+C+ DP+V
Sbjct  790   IEVELRAGNAKIAQTLLAKAIQDCPTGGLLWAQAVWMEPRPKQKSKSVDALKRCDNDPHV  849

Query  667   LAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVA  488
             + A+A +FW DRKVDKARSW +RAV L PD+GD WA FY+FE+Q G+E    +++ +CV 
Sbjct  850   IVAVATVFWQDRKVDKARSWLNRAVVLNPDLGDTWAYFYKFEKQQGTEQSLAELVARCVR  909

Query  487   AEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
              +P+HG  W  + K+ EN+   TDE+L+ V A+L
Sbjct  910   TDPRHGRYWTRVRKAPENARLKTDEVLKLVAASL  943


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 100/230 (43%), Gaps = 18/230 (8%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E  G L QA+     G + CP    +WL  A+L+   N    A+A+L  A +  P   ++
Sbjct  328   EVAGRLAQARKVAAKGCQACPKNPDIWLEAARLQSPQN----AKAILAKAVRHIPHAVKV  383

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             W+ A   EA  + KK    ++ KAL+  PTS  L  A++E+      R   + A +    
Sbjct  384   WIQAANLEADATAKKR---VLRKALEFVPTSVKLWKAAVELEEPDDARILLSRAVECVPH  440

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                +  A+AKL       + AR   ++A    P     W    + EE  G+E+G   ++ 
Sbjct  441   SVSMWLALAKL----ETYENARRVLNKARETIPTDARIWITAAKLEEANGNEEGVKLIIN  496

Query  499   KCVAAEPKHG-----EKWQAIAKSVENSH--KPTDEILRQVVAALKKEEN  371
             + V +   +G     E+W   A+  E S        I+R+ +    +EE+
Sbjct  497   RSVKSLSANGVIIDREQWLKEAEEAERSGFVSTCQAIVRETIGIGVEEED  546


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 91/201 (45%), Gaps = 17/201 (8%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  +   +T +  + +CP    LWL  AK +     +  +R +LT A + NP + ++WLA
Sbjct  596   GTKDSLDATLKKAVAYCPQAEILWLMAAKEKWLAGDVDASRTILTEAFRANPDSEQIWLA  655

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAASI---EMAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ +  +  A  L+AKA +   T  + + ++    E+    + R+   +A KK  Q
Sbjct  656   AVKLESENHEQDRARQLLAKARERAGTDRVWMKSAALERELGNDAEARAILDEAIKKFPQ  715

Query  679   DPYVLAAIAKLFWNDRKVDK------ARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDG  518
              P       KL+    +VD+      AR+ + R +   P     W      EE+  +   
Sbjct  716   FP-------KLWMMRGQVDEKSNPEAARAIYQRGLINCPQCVPLWLCTAALEERQSAMKA  768

Query  517   RNDVLRKCVAAEPKHGEKWQA  455
             R+ +L K     PK+ E W A
Sbjct  769   RS-LLEKARLKNPKNQELWLA  788



>ref|XP_011675370.1| PREDICTED: pre-mRNA-processing factor 6 [Strongylocentrotus purpuratus]
Length=1045

 Score =   238 bits (606),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 148/211 (70%), Gaps = 0/211 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E LGN E+++ TY  G+K CP  IPLWL  A+LEE++  L+KARA++  AR  N +  +L
Sbjct  825   EELGNKEESRKTYTQGMKKCPRSIPLWLLAARLEEKVGNLTKARAIMEKARLTNQQCADL  884

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL AVR E R   K  A   MA+A+QECPTSGIL A SI M  RPQR++ S DA K+C  
Sbjct  885   WLEAVRIENRAGNKAIALSTMARAMQECPTSGILWAESIFMEARPQRKTKSVDALKRCEH  944

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A++KLFW++RK+ KAR WF+R V + PD+GD WA FYRFE  +G+E+ +  V  
Sbjct  945   DPHVLLAVSKLFWSERKLTKAREWFTRTVKIEPDLGDAWAYFYRFELLYGNEEQQKTVRD  1004

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEIL  407
             +C+ AEP HGE W A++K +EN  K TDEIL
Sbjct  1005  RCILAEPHHGETWCAVSKGIENWRKKTDEIL  1035



>gb|ELV11349.1| Pre-mRNA-processing factor 6 [Tupaia chinensis]
Length=939

 Score =   237 bits (604),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 151/220 (69%), Gaps = 1/220 (0%)
 Frame = -1

Query  1039  ERLGNL-EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPE  863
             E  G+L E A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP 
Sbjct  717   EEQGDLTENAREAYSQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPG  776

Query  862   LWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCN  683
             LWL +VR E R   K  A+ LMAKALQECP SG+L + +I +  RPQR++ S DA KKC 
Sbjct  777   LWLESVRLEYRAGLKNIANTLMAKALQECPNSGVLWSEAIFLEARPQRKTKSVDALKKCE  836

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
              DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FYRFE Q G+E+ + +V 
Sbjct  837   HDPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYRFELQHGTEEQQEEVR  896

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             ++C  AEP+HGE W A++K + N  +   EIL  V A +K
Sbjct  897   KRCENAEPRHGELWCAVSKDIANWQRKVGEILVLVAARIK  936


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 85/193 (44%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  586   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  645

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  646   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGSIAAAQELCEEALRHYEY  705

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       + AR  +S+ +   P     W L  R EE+ G       +L 
Sbjct  706   FPKLWMMKGQIEEQGDLTENAREAYSQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  765

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  766   KSRLKNPKNPGLW  778



>ref|XP_004586018.1| PREDICTED: pre-mRNA-processing factor 6 isoform X1 [Ochotona 
princeps]
Length=941

 Score =   237 bits (604),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 150/219 (68%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G  E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP L
Sbjct  720   EQQGLTEKARDAYTQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGL  779

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SG+L + +I +  RPQR++ S DA KKC  
Sbjct  780   WLESVRLEYRAGLKNIANTLMAKALQECPNSGVLWSEAIFLEARPQRKTKSVDALKKCEH  839

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V +
Sbjct  840   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKK  899

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A++K + N  +   EIL  V   LK
Sbjct  900   RCENAEPRHGELWCAVSKDITNWQRKIGEILVLVAGRLK  938


 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +  S +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGDTAAAQELSEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                +     ++       +KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FAKLWMMTGQMLEQQGLTEKARDAYTQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_004464990.1| PREDICTED: pre-mRNA-processing factor 6 [Dasypus novemcinctus]
Length=941

 Score =   237 bits (604),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 152/219 (69%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP L
Sbjct  720   EQEGLVEKARDAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGL  779

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A  LMAKALQECP+SG+L + +I +  RPQR++ S DA KKC  
Sbjct  780   WLESVRLEYRAGLKNIASTLMAKALQECPSSGVLWSEAIFLEARPQRKTKSVDALKKCEH  839

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V +
Sbjct  840   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRK  899

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A++K + N  K   E+L  V A +K
Sbjct  900   RCENAEPRHGELWCAVSKDIANWQKKIGEVLVLVAARIK  938


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 89/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +   A+A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCAEALKPYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   +  V+KAR  +S+ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQVEEQEGLVEKARDAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_006167182.1| PREDICTED: pre-mRNA-processing factor 6 [Tupaia chinensis]
Length=980

 Score =   237 bits (604),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 151/220 (69%), Gaps = 1/220 (0%)
 Frame = -1

Query  1039  ERLGNL-EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPE  863
             E  G+L E A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP 
Sbjct  758   EEQGDLTENAREAYSQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPG  817

Query  862   LWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCN  683
             LWL +VR E R   K  A+ LMAKALQECP SG+L + +I +  RPQR++ S DA KKC 
Sbjct  818   LWLESVRLEYRAGLKNIANTLMAKALQECPNSGVLWSEAIFLEARPQRKTKSVDALKKCE  877

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
              DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FYRFE Q G+E+ + +V 
Sbjct  878   HDPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYRFELQHGTEEQQEEVR  937

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             ++C  AEP+HGE W A++K + N  +   EIL  V A +K
Sbjct  938   KRCENAEPRHGELWCAVSKDIANWQRKVGEILVLVAARIK  977


 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 85/193 (44%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  627   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  686

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  687   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGSIAAAQELCEEALRHYEY  746

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       + AR  +S+ +   P     W L  R EE+ G       +L 
Sbjct  747   FPKLWMMKGQIEEQGDLTENAREAYSQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  806

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  807   KSRLKNPKNPGLW  819



>ref|XP_008841540.1| PREDICTED: pre-mRNA-processing factor 6 isoform X3 [Nannospalax 
galili]
Length=830

 Score =   236 bits (602),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  614   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  673

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  674   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  733

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  734   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  793

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  794   EPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  827


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  477   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  536

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  537   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  596

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  597   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  656

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  657   KSRLKNPKNPGLW  669



>ref|XP_006873391.1| PREDICTED: pre-mRNA-processing factor 6 isoform X1 [Chrysochloris 
asiatica]
Length=941

 Score =   237 bits (604),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 148/213 (69%), Gaps = 0/213 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +VR
Sbjct  726   EKAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGLWLESVR  785

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL 
Sbjct  786   LEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVLL  845

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + DV ++C  AE
Sbjct  846   AVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEDVRKRCENAE  905

Query  481   PKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             P+HGE W A++K + N  K   E+L  V A +K
Sbjct  906   PRHGELWCAVSKDIANWQKKIGEMLVLVAARIK  938


 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLETLLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   +   +KAR  +S+ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQEELTEKAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_008841539.1| PREDICTED: pre-mRNA-processing factor 6 isoform X2 [Nannospalax 
galili]
Length=882

 Score =   236 bits (603),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  666   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  725

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  726   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  785

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  786   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  845

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  846   EPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  879


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  529   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  588

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  589   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  648

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  649   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  708

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  709   KSRLKNPKNPGLW  721



>ref|XP_008250773.1| PREDICTED: pre-mRNA-processing factor 6 [Oryctolagus cuniculus]
Length=941

 Score =   237 bits (604),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 151/219 (69%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G  E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP L
Sbjct  720   EQQGLTEKARDAYTQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGL  779

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SG+L + +I +  RPQR++ S DA KKC  
Sbjct  780   WLESVRLEYRAGLKNIANTLMAKALQECPNSGVLWSEAIFLEARPQRKTKSVDALKKCEH  839

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V +
Sbjct  840   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKK  899

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A++K + N  +   EIL  V A +K
Sbjct  900   RCENAEPRHGELWCAVSKDIANWQRKIGEILVLVAARIK  938


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +  S +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGDTAAAQELSEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                +     ++       +KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FAKLWMMTGQMQEQQGLTEKARDAYTQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_006873392.1| PREDICTED: pre-mRNA-processing factor 6 isoform X2 [Chrysochloris 
asiatica]
Length=901

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 148/213 (69%), Gaps = 0/213 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +VR
Sbjct  686   EKAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGLWLESVR  745

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL 
Sbjct  746   LEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVLL  805

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + DV ++C  AE
Sbjct  806   AVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEDVRKRCENAE  865

Query  481   PKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             P+HGE W A++K + N  K   E+L  V A +K
Sbjct  866   PRHGELWCAVSKDIANWQKKIGEMLVLVAARIK  898



>ref|XP_004586019.1| PREDICTED: pre-mRNA-processing factor 6 isoform X2 [Ochotona 
princeps]
Length=901

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 150/219 (68%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G  E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP L
Sbjct  680   EQQGLTEKARDAYTQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGL  739

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SG+L + +I +  RPQR++ S DA KKC  
Sbjct  740   WLESVRLEYRAGLKNIANTLMAKALQECPNSGVLWSEAIFLEARPQRKTKSVDALKKCEH  799

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V +
Sbjct  800   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVKK  859

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A++K + N  +   EIL  V   LK
Sbjct  860   RCENAEPRHGELWCAVSKDITNWQRKIGEILVLVAGRLK  898



>ref|XP_009168850.1| hypothetical protein T265_05545 [Opisthorchis viverrini]
 gb|KER27364.1| hypothetical protein T265_05545 [Opisthorchis viverrini]
Length=937

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 148/212 (70%), Gaps = 0/212 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A+  Y SGL+H PD   LWL +A+ EER   ++KAR++L  AR +NPK  ELWL A+R
Sbjct  722   ERAREAYRSGLQHTPDHTVLWLQMAEFEERNGSITKARSILERARTQNPKIAELWLGAIR  781

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R + K  AD L++KALQECP +G L A +I M PR QR+S S DA KKC  DP VL 
Sbjct  782   LELRANLKPVADSLLSKALQECPNAGCLWAEAIFMTPRAQRKSKSVDALKKCEHDPLVLL  841

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A++K+FWN+R V KAR+WF+R V L PD+GD WA FY+FE Q G+ED + +VLR+CV+AE
Sbjct  842   AVSKMFWNERLVSKARNWFTRTVKLEPDLGDAWAYFYKFELQHGTEDQQKEVLRRCVSAE  901

Query  481   PKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             P HGE W  IAK+  N    T E+L +V  A+
Sbjct  902   PHHGEAWCRIAKAPCNWRLKTKEVLARVAEAV  933


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 82/205 (40%), Gaps = 15/205 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  +  +      + HCP    LWL  AK       +  AR++L  A + NP + E+WLA
Sbjct  572   GTRDTLEELLRQAVAHCPQAEVLWLMAAKTRWLAGDVPSARSILARAFEANPNSEEIWLA  631

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAAS------IEMAPRPQRRSTSADAYKK  689
             AV+ E+ ++    A  L+AKA     T+ + + ++       E+    Q    +   Y+ 
Sbjct  632   AVKLESENNEYARARRLLAKARDSASTARVWMKSARLEWCLGELKEALQMLERATKIYQH  691

Query  688   CNQDPYVLAAIAKLFWNDRKV---------DKARSWFSRAVTLAPDIGDFWALFYRFEEQ  536
               +   +L  + +   N   +         ++AR  +   +   PD    W     FEE+
Sbjct  692   APKLWLMLGQLLEELSNREHMSPDEASEYKERAREAYRSGLQHTPDHTVLWLQMAEFEER  751

Query  535   FGSEDGRNDVLRKCVAAEPKHGEKW  461
              GS      +L +     PK  E W
Sbjct  752   NGSITKARSILERARTQNPKIAELW  776



>ref|XP_004716112.1| PREDICTED: pre-mRNA-processing factor 6 [Echinops telfairi]
Length=941

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 151/219 (69%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G  E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP L
Sbjct  720   EQQGLPERAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGL  779

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  
Sbjct  780   WLESVRLEYRAGLKNIANTLMAKALQECPHSGILWSEAVFLEARPQRKTKSVDALKKCEH  839

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V +
Sbjct  840   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVSK  899

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A++K V N  K   E+L  V A +K
Sbjct  900   RCENAEPRHGELWCAVSKDVANWQKKIGEVLVLVAAGIK  938


 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGSLVAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       ++AR  +S+ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQVEEQQGLPERAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_003059661.1| mRNA splicing protein [Micromonas pusilla CCMP1545]
 gb|EEH55613.1| mRNA splicing protein [Micromonas pusilla CCMP1545]
Length=939

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 150/223 (67%), Gaps = 10/223 (4%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLE---ERMNGLSKARAVLTMARKKNPKN  869
             E+ G+++ A++ Y  G + CPD IPLW + A LE   +  N  +KARAVL  AR +NP N
Sbjct  708   EKEGDVDAARNAYAKGTRRCPDAIPLWCAAAALEASPDGGNAPAKARAVLEQARLRNPAN  767

Query  868   PELWLAAVRAE-------ARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRST  710
               LWL A R E             + AD LMAKALQECP SG+L A ++ MAPRPQR+S 
Sbjct  768   ETLWLTAARQERGGKPVGVDPESDRAADALMAKALQECPASGMLWAEAVRMAPRPQRKSK  827

Query  709   SADAYKKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFG  530
             S DA K+C+ DP V+A+IA LFW DRK+DKAR WF+RAVTL PD+GD WA +++FE + G
Sbjct  828   SVDALKRCDNDPAVIASIANLFWLDRKMDKARGWFNRAVTLNPDVGDHWAAYFKFETRHG  887

Query  529   SEDGRNDVLRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQ  401
              ED  N V+++C  A PKHGE W  +AK VEN H+P D +LR+
Sbjct  888   DEDAVNAVVKRCAEAAPKHGEAWCRVAKRVENWHEPVDALLRK  930


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 95/220 (43%), Gaps = 16/220 (7%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E  G L+ A+S  + G   CP    +W+  A    R+N    A+AVL       P++ ++
Sbjct  305   ELAGKLQAARSFIQRGCDACPKSEDVWIEAA----RLNTPENAKAVLARGVASLPQSVKI  360

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             W+AA + E     K+    ++ +AL+  P S  L  A ++++     R   A A + C Q
Sbjct  361   WIAAAQLETEDERKRR---VLRRALENIPNSVRLWKAVVDLSKEEDARMLLARAVECCPQ  417

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                +  A+A+L       +++R   ++A    P     W    + EE  G+      +L 
Sbjct  418   HVDLWLALARL----ESYEQSRKVLNKARETLPTEPAIWITAAKLEEANGNAKSVGKILE  473

Query  499   KCVAAEPKHG-----EKWQAIAKSVENSHKPTDEILRQVV  395
             + V +   HG     E W   A++ E    P  E  +Q+V
Sbjct  474   RAVKSLGSHGVSIDREHWLKEAEACEKQDPPATETCKQIV  513



>emb|CAG11265.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=913

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 149/215 (69%), Gaps = 0/215 (0%)
 Frame = -1

Query  1027  NLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAA  848
             N ++A+  Y  GLK CP  + LWL ++ LEER+  L++ARA+L  AR KNP++PELWL +
Sbjct  696   NTDKAREAYSQGLKKCPHSVALWLLMSHLEERVGQLTRARAILEKARLKNPQSPELWLES  755

Query  847   VRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYV  668
             VR E R   K  A  LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  DP+V
Sbjct  756   VRLEFRAGLKNIASTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEHDPHV  815

Query  667   LAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVA  488
             L A+AKLFW++RK+ KAR WF R V + PD+GD WA FY+FE Q G+E+ + +V ++C  
Sbjct  816   LLAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVRKRCEN  875

Query  487   AEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             AEP+HGE W A +K V N  K T EIL +V   +K
Sbjct  876   AEPRHGELWCAESKHVLNWQKKTGEILAEVAKKIK  910


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 86/198 (43%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  560   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAEDVPAARSILALAFQANPNSEEIWLA  619

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  620   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  674

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++       DKAR  +S+ +   P     W L    EE+ G     
Sbjct  675   KHYEDFPKLWMMRGQIEDQCENTDKAREAYSQGLKKCPHSVALWLLMSHLEERVGQLTRA  734

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  E W
Sbjct  735   RAILEKARLKNPQSPELW  752



>ref|NP_001125315.1| pre-mRNA-processing factor 6 [Pongo abelii]
 sp|Q5RCC2.1|PRP6_PONAB RecName: Full=Pre-mRNA-processing factor 6; AltName: Full=PRP6 
homolog; AltName: Full=U5 snRNP-associated 102 kDa protein; 
Short=U5-102 kDa protein [Pongo abelii]
 emb|CAH90585.1| hypothetical protein [Pongo abelii]
Length=941

 Score =   236 bits (602),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ RA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRTRAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQRR+ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW+ RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  845   LAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEERQEEVRKRCESA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A+++ + N  K   +ILR V   +K
Sbjct  905   EPRHGELWCAVSEDIANWQKKIGDILRLVAGRIK  938


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLTGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQR--RSTSADAYKKCNQ  680
             AV+ E+ +   + A  L+AKA    PT+ + + +  +E      R  +    +A +    
Sbjct  648   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRTRAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_003487820.1| PREDICTED: pre-mRNA-processing factor 6-like [Bombus impatiens]
Length=931

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 152/219 (69%), Gaps = 1/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ GNL++A  TY   +K CP  IPLW  LA+LE R   ++KAR+VL  AR KNPKNPEL
Sbjct  709   EQQGNLDKALETYNQAIKKCPTSIPLWRLLAQLEHRKGQVTKARSVLEKARLKNPKNPEL  768

Query  859   WLAAVRAEARHSYKKE-ADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCN  683
             WL A+R E +    ++ A+ LMAKALQECPTSG+L A +I M PRPQR++ S DA KKC 
Sbjct  769   WLEAIRNELKTGGVRDMANTLMAKALQECPTSGLLWAEAIFMEPRPQRKTKSVDALKKCE  828

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
              DP+VL A++KLFW + K+ K R WF+R V + PD+GD WA FY+FE   G+E+ + DV 
Sbjct  829   HDPHVLLAVSKLFWCEHKISKCRDWFNRTVKIDPDLGDAWAYFYKFELLNGTEEQQEDVK  888

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             ++C+AAEP HGE W  ++K++ N    TD+IL  V   L
Sbjct  889   KRCIAAEPHHGENWCKVSKNIANWCLNTDQILVLVAKDL  927


 Score = 67.0 bits (162),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  +S  +  + HCP    LWL  AK +     +  AR +L++A + NP + E+WLA
Sbjct  577   GTRESLESLLQRAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLA  636

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQRRSTSADAYKKCNQD-  677
             AV+ E+ +S  + A  L+AKA    PT  +++ +A +E A      +           D 
Sbjct  637   AVKLESENSEYERARRLLAKARASAPTPRVMMKSAKLEWALNNLDAALLLLKEALEAFDD  696

Query  676   -PYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      +DKA   +++A+   P     W L  + E + G       VL 
Sbjct  697   FPKLWLMKGQIEEQQGNLDKALETYNQAIKKCPTSIPLWRLLAQLEHRKGQVTKARSVLE  756

Query  499   KCVAAEPKHGEKW  461
             K     PK+ E W
Sbjct  757   KARLKNPKNPELW  769


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 103/231 (45%), Gaps = 21/231 (9%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             + ++++A+   +S  +  P+  P W++ A+LEE    +  AR ++    + NP + +LWL
Sbjct  277   INDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQAARNLIMKGCEVNPTSEDLWL  336

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILL--AASIEMAPRPQRRSTSADAYKKCNQ  680
              A R +   +    A  ++A++++  PTS  +   AA +E   + +RR      Y+K  +
Sbjct  337   EAARLQPPDT----AKAVIAQSVRHIPTSVRIWIKAADLETETKAKRR-----VYRKALE  387

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                    + K      + + AR   SRAV   P   D W    R E    + D    VL 
Sbjct  388   HIPNSVRLWKAAVELEEPEDARILLSRAVECCPTSVDLWLALARLE----TYDNARKVLN  443

Query  499   KCVAAEPKHGEKWQAIAKSVE---NSHKPTDEILRQVVAALKKEENAAEIN  356
             K     P   + W   AK  E   N H   ++I+ + +++L    N  EIN
Sbjct  444   KARENIPTDRQIWTTAAKLEEANGNKHM-VEKIIDRAISSLSA--NGVEIN  491



>ref|XP_006896967.1| PREDICTED: pre-mRNA-processing factor 6 [Elephantulus edwardii]
Length=941

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   IEKAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPHSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDTWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   E+L  V A +K
Sbjct  905   EPRHGELWCAVSKDIANWQKKVGEVLVLVAARIK  938


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   +  ++KAR  +S+ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQVEEQEELIEKAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>dbj|BAE26451.1| unnamed protein product [Mus musculus]
Length=941

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  905   EPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  938


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAAQELCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_007608741.1| PREDICTED: pre-mRNA-processing factor 6 isoform X3 [Cricetulus 
griseus]
Length=941

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  905   EPRHGELWCAVSKDITNWQRKIGEILVLVAAHIK  938


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNITAAQELCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_008994545.1| PREDICTED: pre-mRNA-processing factor 6 [Callithrix jacchus]
Length=868

 Score =   236 bits (601),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP    LWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  652   MEKAREAYNQGLKKCPHSTALWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  711

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  712   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  771

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C +A
Sbjct  772   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESA  831

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   E+LR V   +K
Sbjct  832   EPRHGELWCAVSKDIANWQKKIGEVLRLVAGRIK  865


 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 49/198 (25%), Positives = 87/198 (44%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  515   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  574

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ +   + A  L+AKA    PT+ + + +        +I+ A     +    +A 
Sbjct  575   AVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIKAA-----QDLCEEAL  629

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             +     P +     ++      ++KAR  +++ +   P     W L  R EE+ G     
Sbjct  630   RHYEDFPKLWMMKGQIEEQKELMEKAREAYNQGLKKCPHSTALWLLLSRLEEKIGQLTRA  689

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     PK+   W
Sbjct  690   RAILEKSRLKNPKNPGLW  707



>ref|NP_001073234.1| pre-mRNA-processing factor 6 [Rattus norvegicus]
 sp|A1A5S1.1|PRP6_RAT RecName: Full=Pre-mRNA-processing factor 6; AltName: Full=PRP6 
homolog; AltName: Full=U5 snRNP-associated 102 kDa protein; 
Short=U5-102 kDa protein [Rattus norvegicus]
 gb|AAI28780.1| PRP6 pre-mRNA splicing factor 6 homolog (S. cerevisiae) [Rattus 
norvegicus]
 gb|EDL88695.1| similar to RIKEN cDNA 1190003A07 (predicted) [Rattus norvegicus]
Length=941

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MERAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  905   EPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  938


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNITAAQELCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      +++AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELMERAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_010135070.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6, 
partial [Buceros rhinoceros silvestris]
Length=917

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKN +LWL +V
Sbjct  701   VERAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNADLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQ CP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQXCPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K +EN  K   EIL  V A LK
Sbjct  881   EPRHGELWCDVSKDIENWQKKIGEILVLVAAKLK  914


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V++AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQKELVERAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  744   KSRLKNPKNADLW  756



>ref|XP_005074613.1| PREDICTED: pre-mRNA-processing factor 6 isoform X2 [Mesocricetus 
auratus]
Length=901

 Score =   236 bits (601),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  685   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  744

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  745   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  804

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  805   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  864

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  865   EPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  898



>ref|XP_008841538.1| PREDICTED: pre-mRNA-processing factor 6 isoform X1 [Nannospalax 
galili]
Length=941

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  905   EPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  938


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_006994647.1| PREDICTED: pre-mRNA-processing factor 6 [Peromyscus maniculatus 
bairdii]
Length=941

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  905   EPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  938


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNITAAQELCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_005074612.1| PREDICTED: pre-mRNA-processing factor 6 isoform X1 [Mesocricetus 
auratus]
Length=941

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  905   EPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  938


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNITAAQELCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>emb|CDQ84134.1| unnamed protein product [Oncorhynchus mykiss]
Length=756

 Score =   234 bits (597),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 150/213 (70%), Gaps = 0/213 (0%)
 Frame = -1

Query  1021  EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVR  842
             E+A+  Y  GLK CP  + LWL L++LEER+  L++AR++L  +R KNP++P+LWL +VR
Sbjct  541   EKAREAYNQGLKKCPHSMSLWLLLSRLEERVGQLTRARSILEKSRLKNPQSPDLWLESVR  600

Query  841   AEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVLA  662
              E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  DP+VL 
Sbjct  601   LEFRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEHDPHVLL  660

Query  661   AIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAE  482
             A+AKLFW++RK+ KAR WF R V + PD+GD WALFY+FE Q G+E+ + +V ++C  AE
Sbjct  661   AVAKLFWSERKITKAREWFLRTVKIEPDLGDAWALFYKFEMQHGTEEQQEEVRKRCENAE  720

Query  481   PKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             P+HGE W A +K V    K   EIL QV + +K
Sbjct  721   PRHGELWCAESKHVLYWQKKIGEILTQVASKIK  753


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 86/198 (43%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  403   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAEDVPAARSILALAFQANPNSEEIWLA  462

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A          +A 
Sbjct  463   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----HELCTEAL  517

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++       +KAR  +++ +   P     W L  R EE+ G     
Sbjct  518   KHYEDFPKLWMMRGQIEEQSEHNEKAREAYNQGLKKCPHSMSLWLLLSRLEERVGQLTRA  577

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  + W
Sbjct  578   RSILEKSRLKNPQSPDLW  595



>ref|NP_598462.1| pre-mRNA-processing factor 6 [Mus musculus]
 sp|Q91YR7.1|PRP6_MOUSE RecName: Full=Pre-mRNA-processing factor 6; AltName: Full=PRP6 
homolog; AltName: Full=U5 snRNP-associated 102 kDa protein; 
Short=U5-102 kDa protein [Mus musculus]
 gb|AAH14869.1| PRP6 pre-mRNA splicing factor 6 homolog (yeast) [Mus musculus]
 dbj|BAC38390.1| unnamed protein product [Mus musculus]
 gb|AAH23691.2| PRP6 pre-mRNA splicing factor 6 homolog (yeast) [Mus musculus]
 gb|EDL07438.1| PRP6 pre-mRNA splicing factor 6 homolog (yeast) [Mus musculus]
Length=941

 Score =   236 bits (601),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  905   EPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  938


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAAQELCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_008057944.1| PREDICTED: pre-mRNA-processing factor 6 isoform X1 [Tarsius syrichta]
Length=941

 Score =   236 bits (601),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKARDAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V   +K
Sbjct  905   EPRHGELWCAVSKDIANWQRKIGEILMLVAGRIK  938


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNITAAQELCEEALRHYEG  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   +  ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQEELMEKARDAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>gb|ERE70722.1| pre-mRNA-processing factor 6 [Cricetulus griseus]
Length=1009

 Score =   236 bits (602),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  793   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  852

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  853   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  912

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  913   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  972

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  +   EIL  V A +K
Sbjct  973   EPRHGELWCAVSKDITNWQRKIGEILVLVAAHIK  1006


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  656   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  715

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  716   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNITAAQELCEEALRHYED  775

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  776   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  835

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  836   KSRLKNPKNPGLW  848



>ref|XP_004370209.1| PREDICTED: pre-mRNA-processing factor 6 isoform 2 [Trichechus 
manatus latirostris]
Length=901

 Score =   235 bits (599),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  685   VEKAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGLWLESV  744

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  745   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  804

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  805   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  864

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   E+L  V A +K
Sbjct  865   EPRHGELWCAVSKDIANWQKKIGEVLVLVAARIK  898



>ref|XP_003963386.2| PREDICTED: pre-mRNA-processing factor 6 [Takifugu rubripes]
Length=969

 Score =   235 bits (600),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 150/219 (68%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N ++A+  Y  GLK CP  + LWL ++ LEER+  L++ARA+L  AR KNP++PEL
Sbjct  748   EQCENTDKAREAYSQGLKKCPHSVALWLLMSHLEERVGQLTRARAILEKARLKNPQSPEL  807

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A  LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  808   WLESVRLEFRAGLKNIASTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  867

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V + PD+GD WA FY+FE Q G+E+ + +V +
Sbjct  868   DPHVLLAVAKLFWSERKITKAREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVRK  927

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  K T EIL +    +K
Sbjct  928   RCENAEPRHGELWCAESKHVLNWQKKTGEILAEAAKKIK  966


 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 86/198 (43%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  616   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAEDVPAARSILALAFQANPNSEEIWLA  675

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  676   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QELCTEAL  730

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++       DKAR  +S+ +   P     W L    EE+ G     
Sbjct  731   KHYEDFPKLWMMRGQIEEQCENTDKAREAYSQGLKKCPHSVALWLLMSHLEERVGQLTRA  790

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  E W
Sbjct  791   RAILEKARLKNPQSPELW  808



>ref|XP_004370208.1| PREDICTED: pre-mRNA-processing factor 6 isoform 1 [Trichechus 
manatus latirostris]
Length=941

 Score =   235 bits (600),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   VEKAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W A++K + N  K   E+L  V A +K
Sbjct  905   EPRHGELWCAVSKDIANWQKKIGEVLVLVAARIK  938


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNLAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   +  V+KAR  +S+ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQEELVEKAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_005362727.1| PREDICTED: pre-mRNA-processing factor 6 [Microtus ochrogaster]
Length=941

 Score =   235 bits (599),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 151/220 (69%), Gaps = 1/220 (0%)
 Frame = -1

Query  1039  ERLGNL-EQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPE  863
             E  G L E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP 
Sbjct  719   EEQGELTEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPG  778

Query  862   LWLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCN  683
             LWL +VR E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC 
Sbjct  779   LWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCE  838

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
              DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V 
Sbjct  839   HDPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVR  898

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             ++C  AEP+HGE W A++K + N  +   EIL  V A +K
Sbjct  899   KRCENAEPRHGELWCAVSKDITNWQRKIGEILVLVAARIK  938


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNITAAQELCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++       +KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELTEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_417426.2| PREDICTED: pre-mRNA-processing factor 6 isoform X2 [Gallus gallus]
Length=941

 Score =   235 bits (599),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKN +LWL +V
Sbjct  725   VERAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNADLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  K   EIL  V A LK
Sbjct  905   EPRHGELWCDVSKDIVNWQKKIGEILVLVAAKLK  938


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A +    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALRHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V++AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQKELVERAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  768   KSRLKNPKNADLW  780



>gb|KFO29364.1| Pre-mRNA-processing factor 6, partial [Fukomys damarensis]
Length=917

 Score =   235 bits (599),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  701   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  760

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  761   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  820

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  821   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  880

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  +   EIL  V A +K
Sbjct  881   EPRHGELWCTVSKDITNWQRKIGEILVLVAARIK  914


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  564   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  623

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  624   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  683

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  684   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  743

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  744   KSRLKNPKNPGLW  756



>ref|XP_004669585.1| PREDICTED: pre-mRNA-processing factor 6 isoform X2 [Jaculus jaculus]
Length=901

 Score =   234 bits (598),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  685   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  744

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  745   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  804

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  805   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  864

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  +   EIL  V A +K
Sbjct  865   EPRHGELWCTVSKDIANWQRKIGEILVLVAACIK  898



>ref|XP_003399121.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6-like 
[Bombus terrestris]
Length=931

 Score =   235 bits (599),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 151/219 (69%), Gaps = 1/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ GNL++A  TY   +K CP  IPLW  LA+LE R   ++KAR+VL  AR KNPKNPEL
Sbjct  709   EQQGNLDKALETYNQAIKKCPTSIPLWRLLAQLEHRKGQVTKARSVLEKARLKNPKNPEL  768

Query  859   WLAAVRAEARHSYKKE-ADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCN  683
             WL A+R E +    ++ A+ LMAKALQECPTSG+L A +I M PRPQR++ S DA KKC 
Sbjct  769   WLEAIRNELKTGGVRDMANTLMAKALQECPTSGLLWAEAIFMEPRPQRKTKSVDALKKCE  828

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
              DP+VL A++KLFW + K+ K R WF+R V + PD+GD WA FY+FE   G+E+ + DV 
Sbjct  829   HDPHVLLAVSKLFWCEHKISKCRDWFNRTVKIDPDLGDAWAYFYKFELLNGTEEQQEDVK  888

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             ++C+ AEP HGE W  ++K++ N    TD+IL  V   L
Sbjct  889   KRCIVAEPHHGENWCKVSKNIANWCLNTDQILVLVAKDL  927


 Score = 67.0 bits (162),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  +S  +  + HCP    LWL  AK +     +  AR +L++A + NP + E+WLA
Sbjct  577   GTRESLESLLQRAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLA  636

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQRRSTSADAYKKCNQD-  677
             AV+ E+ +S  + A  L+AKA    PT  +++ +A +E A      +           D 
Sbjct  637   AVKLESENSEYERARRLLAKARASAPTPRVMMKSAKLEWALNNLDAALLLLKEALEAFDD  696

Query  676   -PYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      +DKA   +++A+   P     W L  + E + G       VL 
Sbjct  697   FPKLWLMKGQIEEQQGNLDKALETYNQAIKKCPTSIPLWRLLAQLEHRKGQVTKARSVLE  756

Query  499   KCVAAEPKHGEKW  461
             K     PK+ E W
Sbjct  757   KARLKNPKNPELW  769


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 103/231 (45%), Gaps = 21/231 (9%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             + ++++A+   +S  +  P+  P W++ A+LEE    +  AR ++    + NP + +LWL
Sbjct  277   INDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQAARNLIMKGCEVNPTSEDLWL  336

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILL--AASIEMAPRPQRRSTSADAYKKCNQ  680
              A R +   +    A  ++A++++  PTS  +   AA +E   + +RR      Y+K  +
Sbjct  337   EAARLQPPDT----AKAVIAQSVRHIPTSVRIWIKAADLETETKAKRR-----VYRKALE  387

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                    + K      + + AR   SRAV   P   D W    R E    + D    VL 
Sbjct  388   HIPNSVRLWKAAVELEEPEDARILLSRAVECCPTSVDLWLALARLE----TYDNARKVLN  443

Query  499   KCVAAEPKHGEKWQAIAKSVE---NSHKPTDEILRQVVAALKKEENAAEIN  356
             K     P   + W   AK  E   N H   ++I+ + +++L    N  EIN
Sbjct  444   KARENIPTDRQIWTTAAKLEEANGNKHM-VEKIIDRAISSLSA--NGVEIN  491



>ref|XP_005325464.1| PREDICTED: pre-mRNA-processing factor 6 [Ictidomys tridecemlineatus]
Length=953

 Score =   235 bits (599),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  737   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  796

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP+SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  797   RLEYRAGLKNIANTLMAKALQECPSSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  856

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  857   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  916

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  +   EIL  V A +K
Sbjct  917   EPRHGELWCTVSKDIANWQRKIGEILVLVAARIK  950


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  600   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  659

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  660   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  719

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  720   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  779

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  780   KSRLKNPKNPGLW  792



>ref|XP_003462831.1| PREDICTED: pre-mRNA-processing factor 6 [Cavia porcellus]
Length=941

 Score =   234 bits (598),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  +   EIL  V A +K
Sbjct  905   EPRHGELWCTVSKDITNWQRKIGEILVLVAARIK  938


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_011687513.1| PREDICTED: pre-mRNA-processing factor 6 [Wasmannia auropunctata]
Length=931

 Score =   234 bits (598),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 154/219 (70%), Gaps = 1/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G L++A +TY   +K CP+ IPLW  LA+LE + N ++KAR+VL  AR KNPKN EL
Sbjct  709   EQQGYLDKAINTYNQAIKKCPNSIPLWRLLARLEHKKNQVTKARSVLEKARLKNPKNAEL  768

Query  859   WLAAVRAEARHSYKKE-ADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCN  683
             WL A+R E ++   ++ A+ LMAKALQECPTSG+L A +I M PRPQR++ S DA KKC 
Sbjct  769   WLEAIRNELKNGGARDMANTLMAKALQECPTSGLLWAEAIFMEPRPQRKTKSIDATKKCE  828

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
              DP+VL A++KLFW + K+ K R WF+R V + PD+GD WA FY+FE   G+E+ + DV 
Sbjct  829   HDPHVLLAVSKLFWCEHKISKCRDWFNRTVKIDPDLGDAWAYFYKFELLNGTEEQQEDVK  888

Query  502   RKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             ++C+AAEP HGE W  I+K++ N    TD+IL  V   L
Sbjct  889   KRCIAAEPHHGENWCKISKNIANWCLSTDQILVLVAKEL  927


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 96/204 (47%), Gaps = 4/204 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR +L++A + NP + E+WLA
Sbjct  577   GTRESLEALLQRAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLA  636

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQRRSTS--ADAYKKCNQ  680
             AV+ E+ +S  + A  L+AKA    PT  +++ +A +E A      +     +A +  + 
Sbjct  637   AVKLESENSEYERARRLLAKARASAPTPRVMMKSAKLEWALNNLDAALHLLKEALEAFDD  696

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      +DKA + +++A+   P+    W L  R E +         VL 
Sbjct  697   FPKLWLMKGQIEEQQGYLDKAINTYNQAIKKCPNSIPLWRLLARLEHKKNQVTKARSVLE  756

Query  499   KCVAAEPKHGEKW-QAIAKSVENS  431
             K     PK+ E W +AI   ++N 
Sbjct  757   KARLKNPKNAELWLEAIRNELKNG  780


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 103/231 (45%), Gaps = 21/231 (9%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             + ++++A+   +S  +  P+  P W++ A+LEE    +  AR ++    + NP + +LWL
Sbjct  277   INDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQAARNLIMKGCEVNPMSEDLWL  336

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILL--AASIEMAPRPQRRSTSADAYKKCNQ  680
              A R +   +    A  ++A++++  PTS  +   AA +E   + +RR      Y+K  +
Sbjct  337   EAARLQPPDT----AKAVIAQSVRHIPTSVRIWIKAADLETEVKAKRR-----VYRKALE  387

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                    + K      + + AR   SRAV   P   D W    R E    + D    VL 
Sbjct  388   HIPNSVRLWKAAVELEEPEDARILLSRAVECCPTSVDLWLALARLE----TYDNARKVLN  443

Query  499   KCVAAEPKHGEKWQAIAKSVE---NSHKPTDEILRQVVAALKKEENAAEIN  356
             K     P   + W   AK  E   N H   ++I+ + +++L    N  EIN
Sbjct  444   KARENIPTDRQIWTTAAKLEEANGNKHM-VEKIIERAISSLSA--NGVEIN  491



>ref|XP_010720787.1| PREDICTED: pre-mRNA-processing factor 6 [Meleagris gallopavo]
Length=988

 Score =   235 bits (599),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L  +R KNPKN +LWL +V
Sbjct  772   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNADLWLESV  831

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  DP+VL
Sbjct  832   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEHDPHVL  891

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  892   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  951

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  K   EIL  V A LK
Sbjct  952   EPRHGELWCDVSKDIVNWQKKIGEILVLVAAKLK  985


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 88/193 (46%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  635   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  694

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  695   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  754

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  755   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  814

Query  499   KCVAAEPKHGEKW  461
             K     PK+ + W
Sbjct  815   KSRLKNPKNADLW  827



>ref|XP_007952836.1| PREDICTED: pre-mRNA-processing factor 6 [Orycteropus afer afer]
Length=941

 Score =   234 bits (598),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 150/219 (68%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+    E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP L
Sbjct  720   EQDNGTEKAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGL  779

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL + +I +  RPQR++ S DA KKC  
Sbjct  780   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRKTKSVDALKKCEH  839

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V +
Sbjct  840   DPHVLLAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRK  899

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A++K + N  K   E+L  V A ++
Sbjct  900   RCEHAEPRHGELWCAVSKDIANWQKKIGEVLVLVAARIR  938


 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGTISAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++   D   +KAR  +S+ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQDNGTEKAREAYSQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_004669584.1| PREDICTED: pre-mRNA-processing factor 6 isoform X1 [Jaculus jaculus]
Length=941

 Score =   234 bits (598),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  +   EIL  V A +K
Sbjct  905   EPRHGELWCTVSKDIANWQRKIGEILVLVAACIK  938


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>gb|EXX58698.1| Prp6p [Rhizophagus irregularis DAOM 197198w]
Length=893

 Score =   234 bits (597),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 146/215 (68%), Gaps = 0/215 (0%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G+L  A++TY   LK+CP  +PLW+  ++LEE+   L KARA L   R  NPK PELW  
Sbjct  678   GDLPAARATYARALKNCPKSVPLWILASRLEEKACFLIKARATLERGRLLNPKTPELWCE  737

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPY  671
             AVR E R +    A  L+AKALQECP SG+L + +I M PRPQR++ S DA KKC+ DP 
Sbjct  738   AVRVELRGNNINMAKALLAKALQECPNSGLLWSEAIFMEPRPQRKTKSVDALKKCDNDPI  797

Query  670   VLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCV  491
             ++  IA+LFW +RKVDK R+WF +AV + PD GD WA FY+FE Q G+E  + DV+ +CV
Sbjct  798   IIMTIARLFWAERKVDKGRTWFEKAVKVDPDRGDSWAWFYKFECQHGTEQQQQDVITRCV  857

Query  490   AAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
              AEP HGE+WQ +AK ++N  K  +EIL+ V   L
Sbjct  858   TAEPHHGEQWQIVAKDMKNVGKSIEEILKLVSNVL  892


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 57/223 (26%), Positives = 93/223 (42%), Gaps = 22/223 (10%)
 Frame = -1

Query  1033  LGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWL  854
             +G++++A+    S +   P   P W++ A+LEE    L++AR ++    ++ PKN ++WL
Sbjct  242   IGDIKKARLLLNSVISTNPKHAPGWIAAARLEEVAGKLAQARTIIAKGCEECPKNEDVWL  301

Query  853   AAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDP  674
              A    AR +       ++A A++  P S  +   S+++        T   A KK  +  
Sbjct  302   EA----ARLNNADNGRTILANAVRHLPQSVKIWLQSVKL-------ETDIKAQKKVLRRA  350

Query  673   YVLAAIAKLFWN-----DRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRND  509
                   +   W      +     AR   +RA  L P   D W    R E    S +    
Sbjct  351   LEYVPNSVKLWKAAVNMEENPSDARILLARATELVPLSVDLWLALARLE----SYENAKK  406

Query  508   VLRKCVAAEPKHGEKWQAIAKSVE--NSHKPTDEILRQVVAAL  386
             VL K     P   E W A A+  E   + K TD I+ + V  L
Sbjct  407   VLNKARGQIPTSHEIWIAAARLEEQQGNEKMTDRIIAKAVTVL  449


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 85/191 (45%), Gaps = 12/191 (6%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E  G L QA++    G + CP    +WL  A+L    NG    R +L  A +  P++ ++
Sbjct  274   EVAGKLAQARTIIAKGCEECPKNEDVWLEAARLNNADNG----RTILANAVRHLPQSVKI  329

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQR-RSTSADAYKKCN  683
             WL +V+ E     +K+   ++ +AL+  P S  L  A++ M   P   R   A A +   
Sbjct  330   WLQSVKLETDIKAQKK---VLRRALEYVPNSVKLWKAAVNMEENPSDARILLARATELVP  386

Query  682   QDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVL  503
                 +  A+A+L       + A+   ++A    P   + W    R EEQ G+E   + ++
Sbjct  387   LSVDLWLALARL----ESYENAKKVLNKARGQIPTSHEIWIAAARLEEQQGNEKMTDRII  442

Query  502   RKCVAAEPKHG  470
              K V    + G
Sbjct  443   AKAVTVLSEKG  453


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 79/172 (46%), Gaps = 11/172 (6%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  +  +   +  ++ CP    LWL  AK +     ++ AR +LT A K NP + ++WLA
Sbjct  543   GTRDSLEELLQRAVRFCPQAEVLWLMGAKEKWLAGDVNGARFILTEAFKANPNSEQIWLA  602

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPY  671
             AV+ EA +   + A +L+ KA  +  T  + + + +    R  ++ T A A      D Y
Sbjct  603   AVKLEAENGEYERARMLLHKARGKADTEKVWMKSIV--LERQLKKITEALAMLDEALDKY  660

Query  670   VLAAIAKLFW-----NDRKVD--KARSWFSRAVTLAPDIGDFWALFYRFEEQ  536
                   KL+       D K D   AR+ ++RA+   P     W L  R EE+
Sbjct  661   --PTFDKLWMIKGQIEDEKGDLPAARATYARALKNCPKSVPLWILASRLEEK  710


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 84/191 (44%), Gaps = 16/191 (8%)
 Frame = -1

Query  982  CPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAVRAEARHSYKKEADV  803
             P  + LWL+LA+LE   N    A+ VL  AR + P + E+W+AA R E +   +K  D 
Sbjct  385  VPLSVDLWLALARLESYEN----AKKVLNKARGQIPTSHEIWIAAARLEEQQGNEKMTDR  440

Query  802  LMAKALQECPTSGILLAAS--IEMAPRPQRRST--SADAYKKCNQDPYVLAAIAKLFWND  635
            ++AKA+      G +L     ++ A + +R  +  +  A  +      +     K  W +
Sbjct  441  IIAKAVTVLSEKGSVLGRDQWLQEAEKCEREGSVGTCQAIVRNTIGMGIEEQDKKTIWLE  500

Query  634  R--------KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEP  479
                      ++ AR+ F++A+   P     W      E+  G+ D   ++L++ V   P
Sbjct  501  DAESCILHGSIETARAIFAQALKTYPGKKSIWRKAAFLEKSHGTRDSLEELLQRAVRFCP  560

Query  478  KHGEKWQAIAK  446
            +    W   AK
Sbjct  561  QAEVLWLMGAK  571



>ref|XP_005044943.1| PREDICTED: pre-mRNA-processing factor 6-like, partial [Ficedula 
albicollis]
Length=996

 Score =   235 bits (599),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP  IPLWL L++LEE++  L++ARA+L   R KNP+ P+LWL +V
Sbjct  780   VEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILEKTRLKNPRTPDLWLESV  839

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A  LMAKALQECP SGIL + +I +  RPQR++ S DA ++C  DP+VL
Sbjct  840   RLEYRAGLKNIASTLMAKALQECPNSGILWSEAILLEARPQRKTKSVDALRRCEHDPHVL  899

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R + +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  900   LAVAKLFWSERKITKAREWFHRTLKVGSDLGDAWAFFYKFELQHGTEEQQEEVRKRCGNA  959

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K  EN  K T EIL  V A LK
Sbjct  960   EPRHGELWCDVSKDTENWRKKTGEILVLVAAKLK  993


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 85/193 (44%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  +  CP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  643   GTRESLEALLQRAVAFCPKAEVLWLMGAKSKWLAGDVPAARSILGLALQANPNSEEIWLA  702

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  +    L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  703   AVKLESENNEFERVRRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  762

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      V+KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  763   FPKLWMMKGQIEEQKELVEKAREAYNQGLKKCPHSIPLWLLLSRLEEKVGQLTRARAILE  822

Query  499   KCVAAEPKHGEKW  461
             K     P+  + W
Sbjct  823   KTRLKNPRTPDLW  835



>ref|XP_004841181.1| PREDICTED: pre-mRNA-processing factor 6 [Heterocephalus glaber]
Length=941

 Score =   234 bits (598),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 147/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  725   MENAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  784

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  785   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  844

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  845   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  904

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  +   EIL  V A +K
Sbjct  905   EPRHGELWCTVSKDITNWQRKIGEILVLVAAHIK  938


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 86/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  588   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  647

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  648   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  707

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++ AR  +++ +   P     W L  R EE+ G       +L 
Sbjct  708   FPKLWMMKGQIEEQGELMENAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  767

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  768   KSRLKNPKNPGLW  780



>ref|XP_011402481.1| PREDICTED: pre-mRNA-processing factor 6-like [Amphimedon queenslandica]
Length=939

 Score =   234 bits (598),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 155/218 (71%), Gaps = 0/218 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+ G +++A+ +Y   LK CP  +PLW+  ++LEE+    +KAR+VL  AR KNP++P+L
Sbjct  718   EQEGKIDEARMSYIDALKKCPGSLPLWILYSRLEEKSGQPTKARSVLEKARLKNPRSPDL  777

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL A+R E R   K  A  LMAKALQECP+SG L A SI MA RPQR++ S DA KKC  
Sbjct  778   WLEAIRLEMRGDRKPIAQNLMAKALQECPSSGKLWAESIFMATRPQRKTKSVDALKKCEH  837

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW +RK+ K R WF RA+ + PD GD WA +Y+FE   G+++ +++VL+
Sbjct  838   DPHVLLAVAKLFWTERKISKCREWFIRAIKIDPDQGDTWAHYYKFELAHGTQEQQDEVLK  897

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAAL  386
             +CV AEP+HGE W +++K ++N  K T++IL  V AA+
Sbjct  898   RCVQAEPRHGETWCSVSKDIKNWQKHTNDILPLVTAAI  935


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 102/212 (48%), Gaps = 4/212 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G+ E  ++  +  +++CP    LWL  AK +     +  AR++L++A + NP + E+WLA
Sbjct  586   GSGESLEALLQKAVQNCPKAEVLWLMAAKSKWLAGDVPSARSILSLAFQANPNSEEVWLA  645

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIEMAPRPQRRS--TSADAYKKCNQ  680
             AV+ E+ ++  + A +L+ KA     T+ +++ +  +E       ++   + DA +K   
Sbjct  646   AVKLESENNEFERARILLEKAWASAGTARVMMKSVKLEWVLNNMEKAFKLTRDALEKHPD  705

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
                +   + ++   + K+D+AR  +  A+   P     W L+ R EE+ G       VL 
Sbjct  706   FAKLWMMLGQMNEQEGKIDEARMSYIDALKKCPGSLPLWILYSRLEEKSGQPTKARSVLE  765

Query  499   KCVAAEPKHGEKW-QAIAKSVENSHKPTDEIL  407
             K     P+  + W +AI   +    KP  + L
Sbjct  766   KARLKNPRSPDLWLEAIRLEMRGDRKPIAQNL  797



>ref|XP_005410107.1| PREDICTED: pre-mRNA-processing factor 6 [Chinchilla lanigera]
Length=965

 Score =   234 bits (598),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  749   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  808

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  809   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  868

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  869   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  928

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  +   EIL  V A +K
Sbjct  929   EPRHGELWCTVSKDITNWQRKIGEILVLVAARIK  962


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 3/193 (2%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  612   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  671

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILL-AASIE--MAPRPQRRSTSADAYKKCNQ  680
             AV+ E+ ++  + A  L+AKA    PT+ + + +  +E  +      +    +A K    
Sbjct  672   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIAAAQELCEEALKHYED  731

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
              P +     ++      ++KAR  +++ +   P     W L  R EE+ G       +L 
Sbjct  732   FPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILE  791

Query  499   KCVAAEPKHGEKW  461
             K     PK+   W
Sbjct  792   KSRLKNPKNPGLW  804



>ref|XP_004070553.1| PREDICTED: pre-mRNA-processing factor 6 [Oryzias latipes]
Length=969

 Score =   234 bits (598),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 153/219 (70%), Gaps = 0/219 (0%)
 Frame = -1

Query  1039  ERLGNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPEL  860
             E+  N+++A+  Y  GLK CP  + LW  L++LEER+  L++ARA+L  +R KNP+  +L
Sbjct  748   EQCENMDKAREAYNQGLKKCPHSVALWFLLSRLEERVGQLTRARAILEKSRLKNPQCADL  807

Query  859   WLAAVRAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQ  680
             WL +VR E R   K  A+ LMAKALQECP SGIL A ++ +  RPQR++ S DA KKC  
Sbjct  808   WLESVRLEYRAGLKNIANTLMAKALQECPNSGILWAEAVFLEARPQRKTKSVDALKKCEH  867

Query  679   DPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLR  500
             DP+VL A+AKLFW++RK+ K+R WF R V + PD+GD WALFY+FE Q G+++ + +V +
Sbjct  868   DPHVLLAVAKLFWSERKITKSREWFLRTVKIEPDLGDAWALFYKFELQHGTQEQQEEVRK  927

Query  499   KCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             +C  AEP+HGE W A +K V N  K T EIL QV + +K
Sbjct  928   RCENAEPRHGELWCAESKHVLNWQKKTGEILEQVASKIK  966


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/198 (26%), Positives = 88/198 (44%), Gaps = 13/198 (7%)
 Frame = -1

Query  1030  GNLEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLA  851
             G  E  ++  +  + HCP    LWL  AK +     +  AR++L +A + NP + E+WLA
Sbjct  616   GTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLA  675

Query  850   AVRAEARHSYKKEADVLMAKALQECPTSGILLAA--------SIEMAPRPQRRSTSADAY  695
             AV+ E+ ++  + A  L+AKA    PT+ + + +        +IE A     +    +A 
Sbjct  676   AVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNIEAA-----QDLCTEAL  730

Query  694   KKCNQDPYVLAAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGR  515
             K     P +     ++      +DKAR  +++ +   P     W L  R EE+ G     
Sbjct  731   KHYEDFPKLWMMRGQIEEQCENMDKAREAYNQGLKKCPHSVALWFLLSRLEERVGQLTRA  790

Query  514   NDVLRKCVAAEPKHGEKW  461
               +L K     P+  + W
Sbjct  791   RAILEKSRLKNPQCADLW  808



>ref|XP_004644241.1| PREDICTED: pre-mRNA-processing factor 6 [Octodon degus]
Length=871

 Score =   234 bits (597),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = -1

Query  1024  LEQAKSTYESGLKHCPDCIPLWLSLAKLEERMNGLSKARAVLTMARKKNPKNPELWLAAV  845
             +E+A+  Y  GLK CP   PLWL L++LEE++  L++ARA+L  +R KNPKNP LWL +V
Sbjct  655   MEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESV  714

Query  844   RAEARHSYKKEADVLMAKALQECPTSGILLAASIEMAPRPQRRSTSADAYKKCNQDPYVL  665
             R E R   K  A+ LMAKALQECP SGIL + ++ +  RPQR++ S DA KKC  DP+VL
Sbjct  715   RLEYRAGLKNIANTLMAKALQECPNSGILWSEAVFLEARPQRKTKSVDALKKCEHDPHVL  774

Query  664   AAIAKLFWNDRKVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAA  485
              A+AKLFW++RK+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  A
Sbjct  775   LAVAKLFWSERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENA  834

Query  484   EPKHGEKWQAIAKSVENSHKPTDEILRQVVAALK  383
             EP+HGE W  ++K + N  +   EIL  V A +K
Sbjct  835   EPRHGELWCTVSKDIANWQRKIGEILVLVAARIK  868



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2665783826636