BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7538

Length=861
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790112.1|  PREDICTED: aldehyde dehydrogenase                  405   5e-136   Nicotiana sylvestris
ref|XP_009593287.1|  PREDICTED: aldehyde dehydrogenase                  401   2e-134   Nicotiana tomentosiformis
ref|XP_004242034.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    390   3e-130   
ref|XP_002520352.1|  Aldehyde dehydrogenase, putative                   379   2e-125   
gb|KDO80590.1|  hypothetical protein CISIN_1g011107mg                   367   9e-124   Citrus sinensis [apfelsine]
gb|KDO80588.1|  hypothetical protein CISIN_1g011107mg                   368   1e-123   Citrus sinensis [apfelsine]
ref|XP_004498346.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    372   4e-123   Cicer arietinum [garbanzo]
gb|KDO80587.1|  hypothetical protein CISIN_1g011107mg                   369   7e-123   Citrus sinensis [apfelsine]
gb|KDO80586.1|  hypothetical protein CISIN_1g011107mg                   369   8e-123   Citrus sinensis [apfelsine]
ref|XP_006363887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    371   9e-123   Solanum tuberosum [potatoes]
gb|AFK46379.1|  unknown                                                 364   1e-122   Medicago truncatula
ref|XP_004498347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    372   2e-122   
gb|KEH40518.1|  NAD-dependent aldehyde dehydrogenase family protein     370   3e-122   Medicago truncatula
gb|KDO80584.1|  hypothetical protein CISIN_1g011107mg                   370   5e-122   Citrus sinensis [apfelsine]
ref|XP_006472804.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    370   6e-122   Citrus sinensis [apfelsine]
ref|XP_006434229.1|  hypothetical protein CICLE_v10000949mg             369   9e-122   Citrus clementina [clementine]
gb|KEH40517.1|  NAD-dependent aldehyde dehydrogenase family protein     369   1e-121   Medicago truncatula
gb|KGN54555.1|  hypothetical protein Csa_4G361890                       366   1e-121   Cucumis sativus [cucumbers]
gb|ACJ85852.1|  unknown                                                 369   2e-121   Medicago truncatula
gb|KJB59283.1|  hypothetical protein B456_009G247000                    361   2e-121   Gossypium raimondii
ref|XP_007161479.1|  hypothetical protein PHAVU_001G072600g             368   3e-121   Phaseolus vulgaris [French bean]
ref|XP_002306641.1|  the aldehyde dehydrogenase cp-ADH from C.pla...    367   5e-121   Populus trichocarpa [western balsam poplar]
ref|XP_010999403.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    367   8e-121   Populus euphratica
ref|XP_004290887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    367   1e-120   Fragaria vesca subsp. vesca
ref|XP_004290886.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    367   1e-120   Fragaria vesca subsp. vesca
ref|XP_004142628.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    366   1e-120   Cucumis sativus [cucumbers]
ref|XP_002302229.2|  the aldehyde dehydrogenase cp-ADH from C.pla...    366   1e-120   
gb|KJB59281.1|  hypothetical protein B456_009G247000                    363   2e-120   Gossypium raimondii
ref|XP_010243505.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    368   4e-120   
ref|XP_010243504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    368   4e-120   Nelumbo nucifera [Indian lotus]
gb|KHG28299.1|  Aldehyde dehydrogenase family 3 member H1               365   6e-120   Gossypium arboreum [tree cotton]
gb|KJB59280.1|  hypothetical protein B456_009G247000                    364   1e-119   Gossypium raimondii
ref|XP_011653785.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    365   1e-119   Cucumis sativus [cucumbers]
gb|AGC65583.1|  fatty aldehyde dehydrogenase                            363   4e-119   Simmondsia chinensis [goatnut]
ref|XP_010268979.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    362   4e-119   Nelumbo nucifera [Indian lotus]
ref|XP_011003449.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    362   5e-119   Populus euphratica
ref|XP_006575169.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    362   1e-118   Glycine max [soybeans]
gb|KHG30796.1|  Aldehyde dehydrogenase family 3 member H1               361   1e-118   Gossypium arboreum [tree cotton]
ref|XP_012078302.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    361   2e-118   Jatropha curcas
ref|XP_010930724.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    361   2e-118   Elaeis guineensis
gb|KHN21716.1|  Aldehyde dehydrogenase family 3 member H1               358   2e-118   Glycine soja [wild soybean]
ref|XP_006596209.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    358   2e-118   Glycine max [soybeans]
ref|XP_003526638.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    360   3e-118   
ref|XP_007019116.1|  Aldehyde dehydrogenase 3H1 isoform 1               360   4e-118   
ref|XP_009420563.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    360   4e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003544699.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    359   6e-118   Glycine max [soybeans]
ref|XP_003544698.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    359   9e-118   Glycine max [soybeans]
gb|EYU23873.1|  hypothetical protein MIMGU_mgv1a005640mg                356   9e-118   Erythranthe guttata [common monkey flower]
ref|XP_007019117.1|  Aldehyde dehydrogenase 3H1 isoform 2               360   1e-117   
gb|KHN47009.1|  Aldehyde dehydrogenase family 3 member H1               358   1e-117   Glycine soja [wild soybean]
ref|XP_010095408.1|  Aldehyde dehydrogenase family 3 member H1          359   1e-117   
ref|XP_003523436.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    358   1e-117   
ref|XP_008781593.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    358   3e-117   Phoenix dactylifera
gb|KHN20611.1|  Aldehyde dehydrogenase family 3 member H1               362   3e-117   Glycine soja [wild soybean]
gb|EYU23872.1|  hypothetical protein MIMGU_mgv1a005640mg                357   4e-117   Erythranthe guttata [common monkey flower]
ref|XP_008219617.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    352   5e-116   
ref|XP_007137428.1|  hypothetical protein PHAVU_009G126400g             354   6e-116   Phaseolus vulgaris [French bean]
ref|XP_007222253.1|  hypothetical protein PRUPE_ppa004751mg             354   8e-116   Prunus persica
ref|XP_008444179.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    354   9e-116   Cucumis melo [Oriental melon]
ref|XP_008444183.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    353   1e-115   Cucumis melo [Oriental melon]
ref|XP_009383529.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    353   2e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008444182.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    353   2e-115   Cucumis melo [Oriental melon]
ref|XP_008219616.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    353   2e-115   Prunus mume [ume]
ref|XP_011027504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    353   3e-115   Populus euphratica
ref|XP_010530214.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    352   3e-115   Tarenaya hassleriana [spider flower]
gb|KHG30273.1|  Aldehyde dehydrogenase family 3 member H1               352   4e-115   Gossypium arboreum [tree cotton]
ref|XP_009414877.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    352   5e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003602042.1|  Aldehyde dehydrogenase family 3 member H1          352   7e-115   
ref|XP_011653786.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    351   7e-115   Cucumis sativus [cucumbers]
gb|AES72293.2|  NAD-dependent aldehyde dehydrogenase family protein     352   8e-115   Medicago truncatula
ref|NP_001077676.1|  aldehyde dehydrogenase 3H1                         348   1e-114   Arabidopsis thaliana [mouse-ear cress]
gb|KJB29203.1|  hypothetical protein B456_005G089100                    349   2e-114   Gossypium raimondii
gb|KJB29202.1|  hypothetical protein B456_005G089100                    350   2e-114   Gossypium raimondii
ref|XP_011074837.1|  PREDICTED: aldehyde dehydrogenase                  350   3e-114   Sesamum indicum [beniseed]
ref|XP_010674968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    350   3e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008338656.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    350   5e-114   
ref|XP_010063405.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    349   5e-114   Eucalyptus grandis [rose gum]
ref|XP_009379028.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    349   7e-114   Pyrus x bretschneideri [bai li]
ref|XP_009379029.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    349   8e-114   Pyrus x bretschneideri [bai li]
gb|AAM61211.1|  aldehyde dehydrogenase, putative                        348   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175081.1|  aldehyde dehydrogenase 3H1                            348   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008365201.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    348   2e-113   Malus domestica [apple tree]
ref|XP_008378442.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    348   2e-113   
gb|ERN08786.1|  hypothetical protein AMTR_s00017p00253390               345   2e-113   Amborella trichopoda
gb|EYU31773.1|  hypothetical protein MIMGU_mgv1a018415mg                344   3e-113   Erythranthe guttata [common monkey flower]
ref|XP_011069490.1|  PREDICTED: aldehyde dehydrogenase-like             345   1e-112   Sesamum indicum [beniseed]
gb|EYU22982.1|  hypothetical protein MIMGU_mgv1a005625mg                345   1e-112   Erythranthe guttata [common monkey flower]
ref|XP_006304446.1|  hypothetical protein CARUB_v10011079mg             345   3e-112   Capsella rubella
ref|XP_002888606.1|  ALDH3H1                                            345   4e-112   
ref|XP_011624378.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    346   4e-112   Amborella trichopoda
emb|CBI21614.3|  unnamed protein product                                343   5e-111   Vitis vinifera
ref|XP_002273730.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    343   5e-111   Vitis vinifera
gb|KJB64495.1|  hypothetical protein B456_010G051500                    340   5e-111   Gossypium raimondii
ref|XP_010664200.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    341   7e-111   Vitis vinifera
ref|NP_001065921.1|  Os11g0186200                                       341   8e-111   
gb|AAX96338.1|  aldehyde dehydrogenase, putative                        341   9e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010500136.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    341   1e-110   Camelina sativa [gold-of-pleasure]
gb|KJB64493.1|  hypothetical protein B456_010G051500                    341   1e-110   Gossypium raimondii
emb|CAE51203.1|  putative aldehyde dehydrogenase                        340   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461437.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    340   2e-110   Camelina sativa [gold-of-pleasure]
ref|XP_004502482.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    340   3e-110   Cicer arietinum [garbanzo]
ref|XP_004502483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    340   3e-110   
ref|XP_003577758.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    339   4e-110   Brachypodium distachyon [annual false brome]
ref|XP_010479042.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    339   4e-110   Camelina sativa [gold-of-pleasure]
ref|XP_006662790.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    336   5e-110   
ref|XP_007213817.1|  hypothetical protein PRUPE_ppa005609mg             338   7e-110   
emb|CDY36336.1|  BnaC08g05150D                                          338   7e-110   Brassica napus [oilseed rape]
ref|XP_008227590.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    341   7e-110   Prunus mume [ume]
emb|CBI19000.3|  unnamed protein product                                341   8e-110   Vitis vinifera
ref|XP_007159875.1|  hypothetical protein PHAVU_002G275200g             341   1e-109   Phaseolus vulgaris [French bean]
ref|XP_009107480.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    338   2e-109   Brassica rapa
emb|CDY36018.1|  BnaA08g04430D                                          338   2e-109   Brassica napus [oilseed rape]
ref|XP_006662789.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    337   4e-109   Oryza brachyantha
ref|XP_009404859.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    337   5e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009145048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    335   1e-108   Brassica rapa
ref|XP_010025727.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    337   2e-108   Eucalyptus grandis [rose gum]
gb|KCW70625.1|  hypothetical protein EUGRSUZ_F03800                     335   2e-108   Eucalyptus grandis [rose gum]
ref|XP_010025726.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    337   3e-108   Eucalyptus grandis [rose gum]
gb|KDO52216.1|  hypothetical protein CISIN_1g009109mg                   335   4e-108   Citrus sinensis [apfelsine]
gb|KCW70623.1|  hypothetical protein EUGRSUZ_F03800                     335   5e-108   Eucalyptus grandis [rose gum]
ref|XP_008387507.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    336   6e-108   
gb|KFK24209.1|  hypothetical protein AALP_AAs42301U000200               333   7e-108   Arabis alpina [alpine rockcress]
ref|XP_008367720.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    335   1e-107   
gb|KDO52215.1|  hypothetical protein CISIN_1g009109mg                   335   1e-107   Citrus sinensis [apfelsine]
ref|XP_003532071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    335   1e-107   
ref|XP_009355863.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    335   2e-107   Pyrus x bretschneideri [bai li]
gb|EAZ19830.1|  hypothetical protein OsJ_35414                          332   2e-107   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82454.1|  hypothetical protein OsI_37671                          332   2e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_004502485.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    332   2e-107   Cicer arietinum [garbanzo]
ref|XP_006432086.1|  hypothetical protein CICLE_v10000776mg             334   2e-107   Citrus clementina [clementine]
gb|ABA96616.1|  aldehyde dehydrogenase family protein, expressed        332   2e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006393739.1|  hypothetical protein EUTSA_v10011438mg             332   3e-107   Eutrema salsugineum [saltwater cress]
gb|ABR16899.1|  unknown                                                 332   1e-106   Picea sitchensis
ref|XP_010444975.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    322   2e-106   
ref|XP_010437649.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    324   2e-106   Camelina sativa [gold-of-pleasure]
ref|NP_001168661.1|  hypothetical protein                               329   2e-106   Zea mays [maize]
ref|XP_006663868.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    329   3e-106   
ref|XP_011031097.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    331   4e-106   Populus euphratica
ref|XP_010674356.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    331   6e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    330   7e-106   Beta vulgaris subsp. vulgaris [field beet]
sp|Q8VXQ2.1|ALDH_CRAPL  RecName: Full=Aldehyde dehydrogenase; Alt...    328   8e-106   Craterostigma plantagineum
ref|XP_010539000.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    328   9e-106   Tarenaya hassleriana [spider flower]
gb|AET04825.2|  NAD-dependent aldehyde dehydrogenase family protein     329   2e-105   Medicago truncatula
dbj|BAK01937.1|  predicted protein                                      327   2e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAC84903.1|  aldehyde dehydrogenase                                 328   6e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002307060.1|  hypothetical protein POPTR_0005s07090g             326   6e-105   Populus trichocarpa [western balsam poplar]
ref|XP_004503900.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    327   7e-105   Cicer arietinum [garbanzo]
emb|CAB36701.1|  putative aldehyde dehydrogenase                        327   7e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002449124.1|  hypothetical protein SORBIDRAFT_05g005470          325   8e-105   
ref|XP_011468213.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    327   1e-104   Fragaria vesca subsp. vesca
ref|NP_567962.1|  aldehyde dehydrogenase 3I1                            327   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010664198.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    326   1e-104   Vitis vinifera
ref|XP_004503899.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    327   1e-104   Cicer arietinum [garbanzo]
ref|XP_010437650.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    325   6e-104   Camelina sativa [gold-of-pleasure]
ref|XP_002869163.1|  ALDH3I1                                            325   7e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_010447116.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    325   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010432443.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    325   1e-103   Camelina sativa [gold-of-pleasure]
gb|AFW65463.1|  hypothetical protein ZEAMMB73_893012                    321   3e-103   
gb|ACG29168.1|  aldehyde dehydrogenase, dimeric NADP-preferring         322   3e-103   Zea mays [maize]
ref|XP_009350139.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    320   4e-103   
gb|ACF85700.1|  unknown                                                 321   4e-103   Zea mays [maize]
ref|XP_007048537.1|  Aldehyde dehydrogenase 3I1 isoform 3               321   5e-103   
gb|KHG17901.1|  Aldehyde dehydrogenase family 3 member I1, chloro...    317   8e-103   Gossypium arboreum [tree cotton]
gb|ABK24239.1|  unknown                                                 320   1e-102   Picea sitchensis
ref|XP_003630349.1|  Aldehyde dehydrogenase family 3 member H1          322   1e-102   
ref|XP_006283479.1|  hypothetical protein CARUB_v10004527mg             322   2e-102   Capsella rubella
ref|XP_011002476.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    327   2e-102   Populus euphratica
ref|NP_001148092.1|  aldehyde dehydrogenase, dimeric NADP-preferring    319   2e-102   
gb|EMS62407.1|  Aldehyde dehydrogenase family 3 member H1               318   2e-102   Triticum urartu
gb|KJB75337.1|  hypothetical protein B456_012G037500                    318   2e-102   Gossypium raimondii
ref|XP_007048536.1|  Aldehyde dehydrogenase 3I1 isoform 2               320   4e-102   
ref|XP_007048535.1|  Aldehyde dehydrogenase 3I1 isoform 1               321   4e-102   
gb|EMT24757.1|  Aldehyde dehydrogenase family 3 member H1               313   4e-102   
gb|KJB75341.1|  hypothetical protein B456_012G037500                    318   6e-102   Gossypium raimondii
emb|CDX69039.1|  BnaC01g04140D                                          320   7e-102   
ref|XP_002893982.1|  ALDH3H1                                            318   9e-102   
gb|KFK30059.1|  hypothetical protein AALP_AA7G211500                    319   2e-101   Arabis alpina [alpine rockcress]
ref|XP_006412252.1|  hypothetical protein EUTSA_v10024844mg             318   2e-101   Eutrema salsugineum [saltwater cress]
emb|CAN73659.1|  hypothetical protein VITISV_044129                     318   4e-101   Vitis vinifera
gb|EMS67813.1|  Aldehyde dehydrogenase family 3 member H1               311   4e-101   Triticum urartu
gb|KJB75338.1|  hypothetical protein B456_012G037500                    318   6e-101   Gossypium raimondii
gb|KJB75340.1|  hypothetical protein B456_012G037500                    317   7e-101   Gossypium raimondii
ref|XP_009115014.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    317   9e-101   
ref|NP_001288985.1|  aldehyde dehydrogenase family 3 member I1, c...    317   1e-100   Brassica rapa
ref|XP_009115077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    317   1e-100   
ref|XP_002441918.1|  hypothetical protein SORBIDRAFT_08g004840          315   2e-100   Sorghum bicolor [broomcorn]
emb|CDX75414.1|  BnaA01g02880D                                          317   2e-100   
gb|AID60136.1|  aldehyde dehydrogenase 3                                317   2e-100   Brassica napus [oilseed rape]
gb|EMT33845.1|  Aldehyde dehydrogenase family 3 member H1               314   6e-100   
gb|EPS67421.1|  aldehyde dehydrogenase                                  305   7e-100   Genlisea aurea
gb|AFW56225.1|  hypothetical protein ZEAMMB73_146423                    306   7e-98    
ref|XP_010238657.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    306   4e-97    Brachypodium distachyon [annual false brome]
gb|ACL53721.1|  unknown                                                 306   5e-97    Zea mays [maize]
ref|NP_001152171.1|  aldehyde dehydrogenase, dimeric NADP-preferring    306   6e-97    Zea mays [maize]
gb|KJB75339.1|  hypothetical protein B456_012G037500                    306   1e-96    Gossypium raimondii
ref|XP_004977224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    295   4e-93    Setaria italica
ref|XP_010547359.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    289   5e-91    Tarenaya hassleriana [spider flower]
ref|XP_001780129.1|  variable substrate                                 290   1e-90    
ref|XP_010093107.1|  Aldehyde dehydrogenase family 3 member I1          291   2e-90    
ref|XP_010547357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    289   5e-90    Tarenaya hassleriana [spider flower]
ref|XP_002978104.1|  hypothetical protein SELMODRAFT_271300             284   1e-88    
ref|XP_002966639.1|  hypothetical protein SELMODRAFT_227647             284   1e-88    
ref|XP_001764841.1|  variable substrate                                 282   6e-88    
ref|XP_002978037.1|  hypothetical protein SELMODRAFT_268146             280   6e-87    
ref|XP_002966702.1|  hypothetical protein SELMODRAFT_168397             279   8e-87    
ref|XP_004977223.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    277   1e-85    
ref|XP_001757163.1|  variable substrate                                 270   2e-83    
gb|EPS67391.1|  aldehyde dehydrogenase                                  268   4e-83    Genlisea aurea
gb|KDO80591.1|  hypothetical protein CISIN_1g011107mg                   262   8e-81    Citrus sinensis [apfelsine]
gb|KHN21904.1|  Aldehyde dehydrogenase family 3 member F1               258   4e-79    Glycine soja [wild soybean]
ref|XP_003539064.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    258   2e-78    Glycine max [soybeans]
ref|XP_001767194.1|  variable substrate                                 255   2e-77    
ref|XP_003539464.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    255   2e-77    
gb|KJB29204.1|  hypothetical protein B456_005G089100                    252   4e-77    Gossypium raimondii
ref|XP_007132014.1|  hypothetical protein PHAVU_011G059400g             253   2e-76    Phaseolus vulgaris [French bean]
ref|XP_004502484.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    244   6e-74    
ref|XP_001770374.1|  variable substrate                                 244   1e-73    
gb|AFK41010.1|  unknown                                                 239   2e-73    Lotus japonicus
ref|XP_002298405.2|  hypothetical protein POPTR_0001s26630g             244   2e-73    Populus trichocarpa [western balsam poplar]
ref|XP_010045018.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    241   3e-72    Eucalyptus grandis [rose gum]
dbj|BAJ96457.1|  predicted protein                                      240   1e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011006203.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    240   1e-71    Populus euphratica
ref|XP_004507095.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    240   1e-71    Cicer arietinum [garbanzo]
ref|XP_011006204.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    240   1e-71    Populus euphratica
ref|XP_009768441.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    239   3e-71    Nicotiana sylvestris
gb|KDO71077.1|  hypothetical protein CISIN_1g0386172mg                  235   3e-71    Citrus sinensis [apfelsine]
ref|XP_003629375.1|  Aldehyde dehydrogenase family 3 member F1          239   4e-71    Medicago truncatula
gb|AFK48458.1|  unknown                                                 238   5e-71    Medicago truncatula
gb|KCW87154.1|  hypothetical protein EUGRSUZ_B03682                     237   7e-71    Eucalyptus grandis [rose gum]
gb|KCW56679.1|  hypothetical protein EUGRSUZ_I02377                     233   7e-71    Eucalyptus grandis [rose gum]
ref|XP_010031796.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    238   7e-71    Eucalyptus grandis [rose gum]
ref|XP_010271510.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    238   9e-71    Nelumbo nucifera [Indian lotus]
ref|XP_004486968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    238   1e-70    Cicer arietinum [garbanzo]
ref|XP_003547955.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    237   1e-70    
gb|EAZ31491.1|  hypothetical protein OsJ_15627                          234   1e-70    Oryza sativa Japonica Group [Japonica rice]
gb|KHN41688.1|  Aldehyde dehydrogenase family 3 member F1               237   2e-70    Glycine soja [wild soybean]
ref|XP_009355864.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    238   2e-70    
ref|XP_006425564.1|  hypothetical protein CICLE_v10025492mg             236   3e-70    Citrus clementina [clementine]
ref|XP_010045016.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    236   3e-70    Eucalyptus grandis [rose gum]
ref|XP_006345274.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    236   4e-70    
ref|XP_010029722.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    233   5e-70    Eucalyptus grandis [rose gum]
ref|XP_010673629.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    236   5e-70    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008449722.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    235   6e-70    Cucumis melo [Oriental melon]
ref|XP_011629017.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    234   9e-70    Amborella trichopoda
ref|XP_006466887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    235   1e-69    Citrus sinensis [apfelsine]
ref|XP_006829153.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    234   1e-69    Amborella trichopoda
ref|XP_007150367.1|  hypothetical protein PHAVU_005G147600g             234   1e-69    Phaseolus vulgaris [French bean]
ref|XP_008453718.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    234   1e-69    Cucumis melo [Oriental melon]
ref|XP_010045013.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    234   1e-69    
ref|XP_008668343.1|  PREDICTED: hypothetical protein isoform X1         236   2e-69    Zea mays [maize]
ref|XP_002273358.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    234   2e-69    Vitis vinifera
emb|CBI17422.3|  unnamed protein product                                234   2e-69    Vitis vinifera
gb|KCW87152.1|  hypothetical protein EUGRSUZ_B03680                     234   2e-69    Eucalyptus grandis [rose gum]
ref|XP_010555061.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    234   2e-69    Tarenaya hassleriana [spider flower]
ref|XP_010102335.1|  Aldehyde dehydrogenase family 3 member F1          234   2e-69    Morus notabilis
ref|XP_006652592.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    233   5e-69    Oryza brachyantha
ref|XP_002448250.1|  hypothetical protein SORBIDRAFT_06g023975          228   5e-69    
gb|KJB55349.1|  hypothetical protein B456_009G072900                    233   5e-69    Gossypium raimondii
gb|KJE97385.1|  aldehyde dehydrogenase type III-PG                      234   5e-69    Capsaspora owczarzaki ATCC 30864
ref|NP_001053442.1|  Os04g0540600                                       233   6e-69    
ref|XP_010536078.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    233   8e-69    Tarenaya hassleriana [spider flower]
gb|AFW59012.1|  hypothetical protein ZEAMMB73_052021                    228   1e-68    
gb|KHN33348.1|  Aldehyde dehydrogenase family 3 member F1               233   1e-68    Glycine soja [wild soybean]
ref|XP_006283636.1|  hypothetical protein CARUB_v10004694mg             232   1e-68    Capsella rubella
gb|KHG24071.1|  Aldehyde dehydrogenase family 3 member F1               232   1e-68    Gossypium arboreum [tree cotton]
ref|XP_003547154.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    232   1e-68    
gb|KHN00502.1|  Aldehyde dehydrogenase family 3 member F1               232   2e-68    Glycine soja [wild soybean]
ref|XP_004343114.1|  aldehyde dehydrogenase type III-PG                 233   2e-68    Capsaspora owczarzaki ATCC 30864
emb|CAE48163.1|  putative aldehyde dehydrogenase                        232   2e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003520274.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    232   2e-68    Glycine max [soybeans]
emb|CDX75566.1|  BnaA01g01360D                                          230   2e-68    
ref|XP_003543533.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    232   2e-68    Glycine max [soybeans]
ref|XP_002310836.1|  mRNA for putative aldehyde dehydrogenase fam...    231   2e-68    Populus trichocarpa [western balsam poplar]
gb|KFM72617.1|  Aldehyde dehydrogenase, dimeric NADP-preferring         232   2e-68    Stegodyphus mimosarum
ref|NP_195348.2|  aldehyde dehydrogenase 3F1                            231   2e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227591.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    231   3e-68    Prunus mume [ume]
ref|XP_002869039.1|  ALDH3F1                                            231   4e-68    
emb|CDX77447.1|  BnaA07g05850D                                          231   4e-68    
ref|XP_009145598.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    231   4e-68    Brassica rapa
gb|EYU31156.1|  hypothetical protein MIMGU_mgv1a0038971mg               227   5e-68    
ref|XP_010432186.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    230   7e-68    
gb|KHN30135.1|  Aldehyde dehydrogenase family 3 member F1               230   8e-68    
ref|XP_011025893.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    230   8e-68    
emb|CDP01945.1|  unnamed protein product                                230   9e-68    
ref|XP_006412015.1|  hypothetical protein EUTSA_v10025045mg             230   1e-67    
ref|XP_010113456.1|  Aldehyde dehydrogenase family 3 member F1          229   1e-67    
ref|XP_010446811.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    229   1e-67    
ref|XP_009590099.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    228   1e-67    
ref|XP_004228361.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    229   1e-67    
ref|XP_009781320.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    228   1e-67    
gb|KCW51186.1|  hypothetical protein EUGRSUZ_J00772                     229   2e-67    
ref|XP_007015039.1|  Aldehyde dehydrogenase family 3 member F1          234   2e-67    
ref|XP_010034106.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    229   2e-67    
ref|XP_009346294.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    229   2e-67    
gb|KJB55351.1|  hypothetical protein B456_009G072900                    229   2e-67    
ref|XP_003569983.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    229   2e-67    
emb|CDX69216.1|  BnaC01g02370D                                          229   2e-67    
ref|XP_003580245.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    229   2e-67    
gb|AFW59014.1|  hypothetical protein ZEAMMB73_052021                    228   3e-67    
ref|XP_010679827.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    228   3e-67    
ref|NP_001047575.1|  Os02g0646500                                       228   3e-67    
gb|KEH30216.1|  NAD-dependent aldehyde dehydrogenase family protein     228   4e-67    
ref|XP_010437362.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    228   4e-67    
dbj|BAJ86301.1|  predicted protein                                      228   4e-67    
ref|WP_018397546.1|  hypothetical protein                               228   4e-67    
ref|XP_004142118.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    228   5e-67    
ref|XP_004976400.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    228   5e-67    
ref|XP_004953284.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    228   5e-67    
ref|WP_006527043.1|  NAD-dependent aldehyde dehydrogenase               227   5e-67    
gb|KFK30260.1|  hypothetical protein AALP_AA7G238000                    228   5e-67    
ref|WP_012163534.1|  aldehyde dehydrogenase                             227   6e-67    
gb|AAD35089.1|AF148877_1  putative aldehyde dehydrogenase OS-ALDH       228   7e-67    
gb|EPS59682.1|  aldehyde dehydrogenase                                  227   9e-67    
ref|XP_012078389.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    227   9e-67    
ref|XP_009781319.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    227   9e-67    
ref|NP_001151141.1|  aldehyde dehydrogenase 3B1                         227   1e-66    
ref|NP_001147083.1|  LOC100280692                                       227   1e-66    
gb|ACR38486.1|  unknown                                                 227   1e-66    
ref|XP_009378224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    226   1e-66    
gb|AAR21278.1|  fatty aldehyde dehydrogenase 1                          227   1e-66    
ref|XP_002452841.1|  hypothetical protein SORBIDRAFT_04g033420          227   2e-66    
ref|XP_010919366.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    224   3e-66    
emb|CDY35463.1|  BnaC03g61970D                                          226   3e-66    
ref|XP_010316396.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    226   4e-66    
ref|XP_009138416.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    225   5e-66    
ref|WP_010474036.1|  aldehyde dehydrogenase                             224   5e-66    
ref|XP_009138415.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    225   6e-66    
emb|CDY59717.1|  BnaA03g59170D                                          225   6e-66    
ref|XP_005811793.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    224   8e-66    
ref|XP_002285466.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    224   8e-66    
ref|XP_006340688.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    224   1e-65    
ref|XP_008338017.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    224   1e-65    
gb|KJB17711.1|  hypothetical protein B456_003G011600                    218   2e-65    
ref|XP_008803615.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    224   2e-65    
ref|XP_010919365.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    223   2e-65    
emb|CDY24790.1|  BnaA08g15200D                                          224   2e-65    
ref|XP_008241772.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    224   2e-65    
ref|XP_008337865.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    224   2e-65    
ref|WP_041235482.1|  aldehyde dehydrogenase                             223   3e-65    
ref|WP_040008058.1|  aldehyde dehydrogenase                             223   3e-65    
gb|AFZ51141.1|  NAD-dependent aldehyde dehydrogenase                    223   3e-65    
gb|EFA71109.1|  Aldehyde dehydrogenase                                  223   3e-65    
ref|XP_003597427.1|  Aldehyde dehydrogenase family 3 member F1          223   4e-65    
ref|XP_012089991.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    223   5e-65    
ref|XP_007575678.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    222   5e-65    
emb|CDX72584.1|  BnaC07g46060D                                          222   6e-65    
gb|KIE11140.1|  aldehyde dehydrogenase                                  218   1e-64    
ref|XP_010142170.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...    221   1e-64    
gb|KFM06810.1|  Fatty aldehyde dehydrogenase                            222   1e-64    
gb|KFO94567.1|  Fatty aldehyde dehydrogenase                            221   2e-64    
ref|XP_009276469.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    222   2e-64    
ref|XP_007046778.1|  Aldehyde dehydrogenase 3F1 isoform 1               221   2e-64    
ref|XP_007202020.1|  hypothetical protein PRUPE_ppa004971mg             221   2e-64    
ref|XP_008844512.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    221   2e-64    
ref|XP_007156099.1|  hypothetical protein PHAVU_003G258500g             221   2e-64    
ref|XP_010263855.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    221   2e-64    
ref|XP_010548304.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    221   2e-64    
gb|KJB17710.1|  hypothetical protein B456_003G011600                    218   2e-64    
ref|WP_035405643.1|  aldehyde dehydrogenase                             220   2e-64    
ref|WP_016878575.1|  aldehyde dehydrogenase                             220   2e-64    
gb|AGI96739.1|  aldehyde dehydrogenase 3-1 variant B                    221   3e-64    
ref|NP_001047578.1|  Os02g0647900                                       221   3e-64    
ref|XP_001688503.1|  AGAP005124-PA                                      221   3e-64    
gb|ABN13589.1|  aldehyde dehydrogenase                                  213   3e-64    
dbj|BAD25530.1|  putative aldehyde dehydrogenase                        220   3e-64    
ref|XP_009276470.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    221   3e-64    
ref|WP_017292666.1|  hypothetical protein                               219   4e-64    
gb|ERL90558.1|  hypothetical protein D910_07906                         213   4e-64    
ref|WP_007619784.1|  aldehyde dehydrogenase                             220   5e-64    
ref|WP_017306063.1|  hypothetical protein                               219   6e-64    
ref|XP_011285423.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   7e-64    
ref|WP_023072260.1|  aldehyde dehydrogenase                             219   7e-64    
ref|WP_039727975.1|  MULTISPECIES: aldehyde dehydrogenase               219   8e-64    
gb|EEC73696.1|  hypothetical protein OsI_08280                          219   8e-64    
ref|WP_017316439.1|  aldehyde dehydrogenase                             219   9e-64    
ref|XP_005056938.1|  PREDICTED: fatty aldehyde dehydrogenase-like       217   1e-63    
gb|AFW59011.1|  hypothetical protein ZEAMMB73_052021                    215   1e-63    
ref|XP_010034275.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    219   1e-63    
ref|WP_009326028.1|  aldehyde dehydrogenase                             218   1e-63    
ref|WP_036006670.1|  aldehyde dehydrogenase                             218   1e-63    
ref|WP_015186936.1|  Aldehyde Dehydrogenase                             218   1e-63    
ref|XP_003569985.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    219   1e-63    
ref|XP_008413291.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    218   1e-63    
ref|XP_009109317.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    219   1e-63    
gb|KJB17706.1|  hypothetical protein B456_003G011600                    218   2e-63    
gb|KFW86502.1|  Fatty aldehyde dehydrogenase                            219   2e-63    
ref|XP_008928730.1|  PREDICTED: fatty aldehyde dehydrogenase-like       219   2e-63    
ref|XP_006033466.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    217   2e-63    
ref|WP_045872384.1|  aldehyde dehydrogenase                             218   2e-63    
ref|XP_001653928.1|  AAEL009664-PA                                      218   2e-63    
ref|WP_015203433.1|  aldehyde dehydrogenase                             218   2e-63    
ref|XP_011580125.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    217   2e-63    
gb|KFQ29190.1|  Fatty aldehyde dehydrogenase                            219   2e-63    
ref|XP_001362651.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    218   2e-63    
ref|XP_010778363.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   2e-63    
gb|KFO74386.1|  Fatty aldehyde dehydrogenase                            219   3e-63    
ref|WP_015160249.1|  NAD-dependent aldehyde dehydrogenase               218   3e-63    
gb|KCW51189.1|  hypothetical protein EUGRSUZ_J00776                     218   3e-63    
ref|XP_004713785.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   3e-63    
ref|XP_009556787.1|  PREDICTED: fatty aldehyde dehydrogenase            218   4e-63    
ref|XP_010192700.1|  PREDICTED: fatty aldehyde dehydrogenase            219   4e-63    
ref|XP_004598282.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   5e-63    
ref|XP_002115478.1|  hypothetical protein TRIADDRAFT_59449              218   5e-63    
ref|XP_006033465.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    217   6e-63    
ref|WP_006519525.1|  NAD-dependent aldehyde dehydrogenase               217   6e-63    
gb|AGI96742.1|  aldehyde dehydrogenase 3-2                              218   6e-63    
ref|WP_017654159.1|  aldehyde dehydrogenase                             216   6e-63    
ref|XP_011580124.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    217   6e-63    
gb|EYU46263.1|  hypothetical protein MIMGU_mgv1a0057251mg               214   6e-63    
gb|KFP52086.1|  Fatty aldehyde dehydrogenase                            216   6e-63    
ref|XP_001655925.1|  AAEL012162-PA                                      217   7e-63    
ref|XP_004627191.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   7e-63    
ref|XP_004522592.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    217   7e-63    
ref|XP_006647606.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    217   8e-63    
ref|XP_011580115.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    218   8e-63    
ref|XP_004598281.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   9e-63    
ref|XP_003468358.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   9e-63    
gb|KHG21488.1|  Aldehyde dehydrogenase family 3 member F1               216   9e-63    
ref|XP_010835976.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   1e-62    
ref|XP_010819373.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    211   1e-62    
gb|KGL85122.1|  Fatty aldehyde dehydrogenase                            211   1e-62    
ref|XP_011080288.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    217   1e-62    
ref|NP_001276988.1|  aldehyde dehydrogenase family 3 member B1 is...    210   1e-62    
ref|XP_004627190.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   1e-62    
ref|XP_005333387.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   1e-62    
ref|XP_004522591.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    218   2e-62    
ref|XP_006647605.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   2e-62    
ref|XP_010634077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   2e-62    
ref|XP_004522588.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    218   2e-62    
ref|WP_015220115.1|  aldehyde dehydrogenase                             215   2e-62    
ref|XP_010597294.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   2e-62    
ref|XP_011090413.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   2e-62    
ref|XP_009706334.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...    216   2e-62    
ref|WP_017321468.1|  hypothetical protein                               215   2e-62    
ref|XP_003419438.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   2e-62    
gb|KFP68902.1|  Fatty aldehyde dehydrogenase                            216   2e-62    
ref|XP_006033158.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    216   2e-62    
ref|XP_006470601.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    216   3e-62    
ref|WP_044480861.1|  aldehyde dehydrogenase                             215   3e-62    
ref|XP_005384347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   3e-62    
ref|XP_005333386.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   3e-62    
ref|XP_010634073.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   3e-62    
ref|WP_010301979.1|  aldehyde dehydrogenase                             214   4e-62    
ref|WP_012597585.1|  aldehyde dehydrogenase                             214   4e-62    
ref|XP_006173634.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   4e-62    
gb|KGL91398.1|  Fatty aldehyde dehydrogenase                            214   4e-62    
gb|AEE62197.1|  unknown                                                 215   4e-62    
gb|ENN71300.1|  hypothetical protein YQE_12225                          214   4e-62    
ref|XP_009977281.1|  PREDICTED: fatty aldehyde dehydrogenase            213   5e-62    
ref|XP_006033155.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    215   5e-62    
ref|XP_011285421.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   5e-62    
ref|XP_010709095.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   5e-62    
ref|XP_009881041.1|  PREDICTED: fatty aldehyde dehydrogenase-like       215   5e-62    
ref|WP_017740423.1|  hypothetical protein                               214   5e-62    
ref|XP_004852263.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   6e-62    
ref|XP_004900048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   6e-62    
ref|XP_006278584.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   6e-62    
ref|XP_009857901.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    214   6e-62    
ref|WP_044923882.1|  aldehyde dehydrogenase                             214   6e-62    
ref|XP_006173633.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   6e-62    
ref|XP_010634071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   7e-62    
ref|XP_011842431.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    208   7e-62    
ref|XP_006265533.1|  PREDICTED: fatty aldehyde dehydrogenase            214   7e-62    
ref|XP_010634072.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    215   7e-62    
gb|AGI96741.1|  aldehyde dehydrogenase 3-1 varian D                     214   7e-62    
ref|XP_004656828.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   7e-62    
ref|WP_009203343.1|  aldehyde dehydrogenase family protein              214   8e-62    
gb|KFR05497.1|  Fatty aldehyde dehydrogenase                            214   8e-62    
ref|WP_012407600.1|  aldehyde dehydrogenase                             214   8e-62    
ref|XP_001843954.1|  conserved hypothetical protein                     215   9e-62    
ref|XP_008199991.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    214   1e-61    
ref|XP_009944126.1|  PREDICTED: fatty aldehyde dehydrogenase            214   1e-61    
ref|XP_010572041.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    213   1e-61    
ref|WP_022091489.1|  aldehyde dehydrogenase                             213   1e-61    
ref|XP_001688504.1|  AGAP005124-PB                                      214   1e-61    
ref|XP_011285420.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   1e-61    
ref|WP_015130982.1|  aldehyde dehydrogenase                             213   1e-61    
ref|XP_010216864.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...    208   1e-61    
ref|WP_026376419.1|  aldehyde dehydrogenase                             213   1e-61    
ref|XP_010709092.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   1e-61    
ref|XP_314005.4|  AGAP005124-PC                                         214   1e-61    
ref|WP_010997816.1|  aldehyde dehydrogenase                             213   1e-61    
gb|KFV10145.1|  Fatty aldehyde dehydrogenase                            213   1e-61    
ref|WP_006456928.1|  aldehyde dehydrogenase                             213   1e-61    
ref|XP_005864401.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   1e-61    
ref|XP_010364620.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   1e-61    
ref|XP_004656827.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   1e-61    
gb|EOA98684.1|  Fatty aldehyde dehydrogenase                            214   1e-61    
ref|XP_010350240.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    212   1e-61    
ref|XP_008145077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   2e-61    
ref|WP_011320326.1|  aldehyde dehydrogenase                             213   2e-61    
gb|KFM66996.1|  Aldehyde dehydrogenase family 3 member B1               214   2e-61    
ref|XP_009632240.1|  PREDICTED: fatty aldehyde dehydrogenase            214   2e-61    
ref|XP_011285418.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    214   2e-61    
gb|KFP85095.1|  Fatty aldehyde dehydrogenase                            214   2e-61    
ref|XP_004071943.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   2e-61    
ref|XP_010364618.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    213   2e-61    
ref|XP_002587582.1|  hypothetical protein BRAFLDRAFT_230530             213   2e-61    
gb|KFP11933.1|  Fatty aldehyde dehydrogenase                            214   2e-61    
ref|XP_010572039.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    213   2e-61    



>ref|XP_009790112.1| PREDICTED: aldehyde dehydrogenase [Nicotiana sylvestris]
Length=477

 Score =   405 bits (1042),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 190/242 (79%), Positives = 218/242 (90%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTKEN  +LLDAMK+EL+KFYG DPL S D+SRIVN+NHF
Sbjct  235  IAGKWGCNNGQACISPDYIITTKENVPKLLDAMKLELEKFYGNDPLKSGDISRIVNANHF  294

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLLDD+KV  K+VHGG+RDE  LKIAPTIL+DVPED+LIMKEEIFGPLLPILTVNK
Sbjct  295  HRLSKLLDDNKVVDKVVHGGQRDENNLKIAPTILLDVPEDSLIMKEEIFGPLLPILTVNK  354

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED I+ INAR+KPLAAYLFT NKKLE+EFV N+SAGGLLINDT LH+A  TLPFGGVGE
Sbjct  355  VEDSIEFINAREKPLAAYLFTGNKKLEEEFVRNISAGGLLINDTTLHLATSTLPFGGVGE  414

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHG+FSFEAFSHKKAVL+RSFGGD+ ARYPPYTP+K R L+AL++GN++ +IRAL
Sbjct  415  SGMGSYHGRFSFEAFSHKKAVLRRSFGGDVPARYPPYTPEKVRFLKALLNGNILGLIRAL  474

Query  139  LG  134
            LG
Sbjct  475  LG  476



>ref|XP_009593287.1| PREDICTED: aldehyde dehydrogenase [Nicotiana tomentosiformis]
Length=477

 Score =   401 bits (1031),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 189/242 (78%), Positives = 219/242 (90%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTKENA +LLDAMK+EL+KFYGKDPL S DLSRIVN+NHF
Sbjct  235  IAGKWGCNNGQACISPDYIITTKENAPKLLDAMKLELEKFYGKDPLKSGDLSRIVNANHF  294

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLLDD+KV  K+VHGG+RDE  LKIAPTIL+DVPED+LIMKEEIFGPLL ILTVNK
Sbjct  295  HRLSKLLDDNKVVDKVVHGGQRDENNLKIAPTILLDVPEDSLIMKEEIFGPLLLILTVNK  354

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VE+ I+ INAR+KPLAAYLFT +KKLE+EFV N+SAGGLLINDT LH+A  TLPFGGVGE
Sbjct  355  VEESIQFINAREKPLAAYLFTGDKKLEEEFVRNISAGGLLINDTTLHIATSTLPFGGVGE  414

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHG+FSFEAFSHKKAVL+RSFGGD+ ARYPPYTP+K R L+AL++G+++ +IRAL
Sbjct  415  SGMGSYHGRFSFEAFSHKKAVLRRSFGGDVPARYPPYTPEKVRFLKALLNGDILGLIRAL  474

Query  139  LG  134
            LG
Sbjct  475  LG  476



>ref|XP_004242034.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Solanum 
lycopersicum]
Length=474

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 214/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTKE+  +LLDAMK EL+KFYGKDPL S DLSRIVN+NHF
Sbjct  232  IAGKWGCNNGQACISPDYIITTKESVPKLLDAMKQELEKFYGKDPLKSGDLSRIVNANHF  291

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLLDD+KV  K+VHGG+RDE  LKI+PTIL+DVPED+LIMKEEIFGPLLPI+TVNK
Sbjct  292  QRLSKLLDDNKVVDKVVHGGQRDENNLKISPTILLDVPEDSLIMKEEIFGPLLPIITVNK  351

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED I+ I AR+KPLAAYLFTSNKKLE+EFV N+SAGGLLINDT L VA+ TLPFGGVGE
Sbjct  352  VEDSIQFIKAREKPLAAYLFTSNKKLEEEFVMNISAGGLLINDTTLQVALSTLPFGGVGE  411

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GS HGKFSF+ FSHKKAVL+RSF GD+ ARYPPYT  KAR L+AL++G++I +IRAL
Sbjct  412  SGMGSCHGKFSFDTFSHKKAVLRRSFAGDVPARYPPYTAGKARFLKALLNGDIIGLIRAL  471

Query  139  LG  134
            +G
Sbjct  472  IG  473



>ref|XP_002520352.1| Aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF42138.1| Aldehyde dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +L+DA+K EL++FYG++PL SKDLSRIVNSNHF
Sbjct  250  IAGKWGCNNGQACISPDYIITTKDYAPKLVDALKQELERFYGENPLVSKDLSRIVNSNHF  309

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL KLLD+DKVSGKIVHGGERDE  LKIAPTILMDVP+D+LIM EEIFGPLLPI+ VNK
Sbjct  310  SRLIKLLDEDKVSGKIVHGGERDEANLKIAPTILMDVPQDSLIMNEEIFGPLLPIVMVNK  369

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+R KPLAAYLFT+ KKL+Q+FVT +SAGGL++NDT +H+AVHTLPFGGVGE
Sbjct  370  IEESFDLINSRTKPLAAYLFTNKKKLKQQFVTCVSAGGLVVNDTTVHLAVHTLPFGGVGE  429

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SGTG+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++AL+ G +  II AL
Sbjct  430  SGTGAYHGKFSFDAFSHKKAVLYRSFTGDAAIRYPPYTKGKLRLMKALIGGGIWSIISAL  489

Query  139  LG  134
             G
Sbjct  490  FG  491



>gb|KDO80590.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=282

 Score =   367 bits (942),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PD+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  37   IMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHF  96

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLDDDKVSGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  97   ARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDK  156

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV E
Sbjct  157  IEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQE  216

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRAL
Sbjct  217  SGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRAL  276

Query  139  LG  134
            LG
Sbjct  277  LG  278



>gb|KDO80588.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
 gb|KDO80589.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=321

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PD+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  76   IMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHF  135

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLDDDKVSGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  136  ARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDK  195

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV E
Sbjct  196  IEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQE  255

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRAL
Sbjct  256  SGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRAL  315

Query  139  LG  134
            LG
Sbjct  316  LG  317



>ref|XP_004498346.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   372 bits (956),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 212/243 (87%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK  A +L+DA+K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  245  IAGKWGCNNGQACISPDYIITTKNYAPKLVDALKTELEAFYGKNPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLDDDKVSGKIV+GGE+DE +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K
Sbjct  305  ARLTKLLDDDKVSGKIVYGGEKDESKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAY+FT+NK L+++FV N+SAGG++INDT +H+AVHTLPFGGVGE
Sbjct  365  LEESFDVINSGSKPLAAYIFTNNKNLKEKFVMNVSAGGVVINDTTMHLAVHTLPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ I+RA+
Sbjct  425  SGLGAYHGKFSFDAFSHKKAVLYRSFFGDAPIRYPPYTATKMRLLKALVGGGILNIVRAI  484

Query  139  LGL  131
            LG+
Sbjct  485  LGM  487



>gb|KDO80587.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=398

 Score =   369 bits (947),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PD+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  153  IMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHF  212

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLDDDKVSGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  213  ARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDK  272

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV E
Sbjct  273  IEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQE  332

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRAL
Sbjct  333  SGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRAL  392

Query  139  LG  134
            LG
Sbjct  393  LG  394



>gb|KDO80586.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=397

 Score =   369 bits (946),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PD+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  152  IMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHF  211

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLDDDKVSGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  212  ARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDK  271

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV E
Sbjct  272  IEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQE  331

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRAL
Sbjct  332  SGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRAL  391

Query  139  LG  134
            LG
Sbjct  392  LG  393



>ref|XP_006363887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Solanum 
tuberosum]
Length=474

 Score =   371 bits (953),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 186/242 (77%), Positives = 215/242 (89%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTKEN  +LLDAMK EL+KFYGKDPL S DLSRIVN+NHF
Sbjct  232  IAGKWGCNNGQACISPDYIITTKENVPKLLDAMKQELEKFYGKDPLKSGDLSRIVNANHF  291

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLLDD KV  K+VHGG+RDE  LKI+PTIL+DVPED+LIMKEEIFGPLLPI+TVNK
Sbjct  292  QRLSKLLDDKKVVDKVVHGGQRDEDNLKISPTILLDVPEDSLIMKEEIFGPLLPIITVNK  351

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED I+ INAR+KPLAAYLFTSNKKLE+EFV N+SAGGLLINDT L VA+ TLPFGGVGE
Sbjct  352  VEDSIQFINAREKPLAAYLFTSNKKLEEEFVMNISAGGLLINDTTLQVALSTLPFGGVGE  411

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GS HGKFSF++FSHKKAVL+RSF GD+ ARYPPYT  KAR L+AL++G+++ +IRAL
Sbjct  412  SGMGSCHGKFSFDSFSHKKAVLRRSFAGDVPARYPPYTTGKARFLKALLNGDILGLIRAL  471

Query  139  LG  134
            +G
Sbjct  472  IG  473



>gb|AFK46379.1| unknown [Medicago truncatula]
Length=280

 Score =   364 bits (934),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF
Sbjct  37   IAGKWGCNNGQACISPDYIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHF  96

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL +LLDDDKVSGKIVHGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K
Sbjct  97   DRLIRLLDDDKVSGKIVHGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDK  156

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++   +IN+  KPLAAY+FT+N KL+++FV  +SAGGL+I+DT +H+AVHTLPFGGVGE
Sbjct  157  LDESFDVINSAPKPLAAYIFTNNNKLKEQFVKTVSAGGLVIDDTTIHLAVHTLPFGGVGE  216

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL
Sbjct  217  SGVGAYHGKFSFDAFSHKKAVLYRSFFGDAFIRYPPYTSTKTRLMKALMGGGFLAIIRAL  276

Query  139  LG  134
             G
Sbjct  277  FG  278



>ref|XP_004498347.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=526

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 212/243 (87%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK  A +L+DA+K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  283  IAGKWGCNNGQACISPDYIITTKNYAPKLVDALKTELEAFYGKNPLESKDLSRIVNSNHF  342

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLDDDKVSGKIV+GGE+DE +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K
Sbjct  343  ARLTKLLDDDKVSGKIVYGGEKDESKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDK  402

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAY+FT+NK L+++FV N+SAGG++INDT +H+AVHTLPFGGVGE
Sbjct  403  LEESFDVINSGSKPLAAYIFTNNKNLKEKFVMNVSAGGVVINDTTMHLAVHTLPFGGVGE  462

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ I+RA+
Sbjct  463  SGLGAYHGKFSFDAFSHKKAVLYRSFFGDAPIRYPPYTATKMRLLKALVGGGILNIVRAI  522

Query  139  LGL  131
            LG+
Sbjct  523  LGM  525



>gb|KEH40518.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   370 bits (951),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF
Sbjct  245  IAGKWGCNNGQACISPDYIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL +LLDDDKVSGKIVHGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K
Sbjct  305  DRLIRLLDDDKVSGKIVHGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++   +IN+  KPLAAY+FT+N KL+++FV  +SAGGL+INDT +H+AVHTLPFGGVGE
Sbjct  365  LDESFDVINSAPKPLAAYIFTNNNKLKEQFVKTVSAGGLVINDTTIHLAVHTLPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL
Sbjct  425  SGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAIIRAL  484

Query  139  LG  134
             G
Sbjct  485  FG  486



>gb|KDO80584.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=487

 Score =   370 bits (949),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PD+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  242  IMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHF  301

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLDDDKVSGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  302  ARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDK  361

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV E
Sbjct  362  IEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQE  421

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRAL
Sbjct  422  SGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRAL  481

Query  139  LG  134
            LG
Sbjct  482  LG  483



>ref|XP_006472804.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Citrus 
sinensis]
 gb|KDO80585.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=493

 Score =   370 bits (950),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PD+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  248  IMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHF  307

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLDDDKVSGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  308  ARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDK  367

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV E
Sbjct  368  IEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQE  427

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRAL
Sbjct  428  SGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRAL  487

Query  139  LG  134
            LG
Sbjct  488  LG  489



>ref|XP_006434229.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47469.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=493

 Score =   369 bits (948),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PD+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  248  IMGKWGCNNGQACISPDHIITTKDFAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHF  307

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLDDDKVSGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  308  ARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDK  367

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPFGGV E
Sbjct  368  IEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQE  427

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ IIRAL
Sbjct  428  SGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRAL  487

Query  139  LG  134
            LG
Sbjct  488  LG  489



>gb|KEH40517.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF
Sbjct  245  IAGKWGCNNGQACISPDYIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL +LLDDDKVSGKIVHGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K
Sbjct  305  DRLIRLLDDDKVSGKIVHGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++   +IN+  KPLAAY+FT+N KL+++FV  +SAGGL+INDT +H+AVHTLPFGGVGE
Sbjct  365  LDESFDVINSAPKPLAAYIFTNNNKLKEQFVKTVSAGGLVINDTTIHLAVHTLPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL
Sbjct  425  SGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAIIRAL  484

Query  139  LG  134
             G
Sbjct  485  FG  486



>gb|KGN54555.1| hypothetical protein Csa_4G361890 [Cucumis sativus]
Length=395

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACIAPDY+ITTKE A +L++ MK EL+KFYGK+PL +KDLSRIVN+NHF
Sbjct  152  IAGKWGCNNGQACIAPDYVITTKEFAPKLVECMKQELEKFYGKNPLETKDLSRIVNANHF  211

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+LLDDDK+SGKIVHGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  212  DRLTRLLDDDKISGKIVHGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDK  271

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   I+N+  KPLAAYLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPFGGVGE
Sbjct  272  VEDSFDIVNSGTKPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGE  331

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRAL
Sbjct  332  SGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILALIRAL  391

Query  139  LG  134
            LG
Sbjct  392  LG  393



>gb|ACJ85852.1| unknown [Medicago truncatula]
Length=488

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +L+DA+K EL++FYGK+PL SKDLSRIVNSNHF
Sbjct  245  IAGKWGCNNGQACISPDYIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL +LLDDDKVSGKIVHGGE+D+ +L+I+PT+L+DVP D+LIM EEIFGPLLPI+TV+K
Sbjct  305  DRLIRLLDDDKVSGKIVHGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPIITVDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++   +IN+  KPLAAY+FT+N KL+++FV  +SAGGL+I+DT +H+AVHTLPFGGVGE
Sbjct  365  LDESFDVINSAPKPLAAYIFTNNNKLKEQFVKTVSAGGLVIDDTTIHLAVHTLPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + IIRAL
Sbjct  425  SGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAIIRAL  484

Query  139  LG  134
             G
Sbjct  485  FG  486



>gb|KJB59283.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=283

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 211/243 (87%), Gaps = 1/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF
Sbjct  37   IAGKWGCNNGQACISPDYIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHF  96

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KL+D++KVS KIVHGG+R+EK L+IAPTI +DVP ++LIMKEEIFGPLLPI+TV+K
Sbjct  97   DRLSKLMDEEKVSSKIVHGGQRNEKNLQIAPTIFLDVPVNSLIMKEEIFGPLLPIITVDK  156

Query  499  VEDGIKIINAR-DKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVG  323
            VE    +I++   KPLAAYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPFGGVG
Sbjct  157  VEQSFDLIHSSGGKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVG  216

Query  322  ESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRA  143
            ESG GSYHGKFSF+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRA
Sbjct  217  ESGMGSYHGKFSFDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRA  276

Query  142  LLG  134
            LLG
Sbjct  277  LLG  279



>ref|XP_007161479.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
 gb|ESW33473.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
Length=493

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/242 (73%), Positives = 212/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDY+ITTKE A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF
Sbjct  250  IAGKWGCNNGQACISPDYVITTKEYAAKLVDALKTELEKFYGKNPLESKDLSRIVNSNHF  309

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLDDDKVSGKIV+GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  310  NRLKKLLDDDKVSGKIVYGGEKDESKLKISPTVLLDVPRDSLIMSEEIFGPLLPILTVDK  369

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+  ++IN+  KPLAAY+FT+NKKL++ FV N+SAGGL++NDT LH+AVHTLPFGGVGE
Sbjct  370  LEESFQVINSGPKPLAAYIFTNNKKLKELFVMNISAGGLVVNDTTLHLAVHTLPFGGVGE  429

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ IIRAL
Sbjct  430  SGVGAYHGKFSFDAFSHKKAVLYRSFIGDASVRYPPYTTTKQRLLKALIGGGILGIIRAL  489

Query  139  LG  134
             G
Sbjct  490  FG  491



>ref|XP_002306641.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE93637.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   367 bits (943),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 212/243 (87%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PDYIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  245  IVGKWGCNNGQACISPDYIITTKDCAEKLVDSLKKELEAFYGKNPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRLTKLLD+DKVSGKIV+GGERDE  L+IAPTIL+ VP+++LIMKEEIFGPLLPILTV+K
Sbjct  305  SRLTKLLDEDKVSGKIVYGGERDEANLRIAPTILLGVPQNSLIMKEEIFGPLLPILTVSK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   II +  KPLAAYLFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PFGGVGE
Sbjct  365  IEDSFDIIKSGTKPLAAYLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AF+HKKAV+ RSF GD   RYPPYT  K RL++AL++GN+  I+R L
Sbjct  425  SGMGSYHGKFSFDAFTHKKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNVWTILRTL  484

Query  139  LGL  131
            LG+
Sbjct  485  LGM  487



>ref|XP_010999403.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   367 bits (942),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 170/243 (70%), Positives = 212/243 (87%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWGC +GQACI+PDYIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  245  VVGKWGCNNGQACISPDYIITTKDCAEKLVDSLKKELEAFYGKNPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLD+DKVSGKIV+GGERDE  L+IAPTIL+ VP+++LIMKEEIFGPLLPILTV+K
Sbjct  305  ARLTKLLDEDKVSGKIVYGGERDEANLRIAPTILLGVPQNSLIMKEEIFGPLLPILTVSK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   II +  KPLAAYLFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PFGGVGE
Sbjct  365  IEDSFDIIKSGTKPLAAYLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AF+HKKAV+ RSF GD   RYPPYT  K RL++AL++GNL  I+R L
Sbjct  425  SGMGSYHGKFSFDAFTHKKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNLWTILRTL  484

Query  139  LGL  131
            LG+
Sbjct  485  LGM  487



>ref|XP_004290887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=486

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQAC++PD+IITTKE A +L+DA+K ELD FYGK+PL SKDLSRIVNSNH+
Sbjct  241  IAGKWGCNNGQACVSPDHIITTKEFATKLVDALKSELDNFYGKNPLQSKDLSRIVNSNHY  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLTKLLD+DK+SGK++HGGERD+  L+IAPTIL+DVP+D+LIM+EEIFGPLLPI+TV+K
Sbjct  301  DRLTKLLDEDKISGKVIHGGERDKNNLRIAPTILLDVPQDSLIMQEEIFGPLLPIITVDK  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +I +  KPLAAYLFT+N+KL+  FV N+SAGGLLINDT LH+AV TLPFGGVGE
Sbjct  361  IEDSFDLITSGTKPLAAYLFTNNQKLKDHFVGNVSAGGLLINDTTLHLAVPTLPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSFEAFSHKKAV+ R F GD   RYPPYT  K  L++AL+ G+L+ IIRAL
Sbjct  421  SGMGAYHGKFSFEAFSHKKAVVYRGFFGDAAVRYPPYTKGKLTLMKALVGGSLLGIIRAL  480

Query  139  LG  134
             G
Sbjct  481  FG  482



>ref|XP_004290886.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=489

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQAC++PD+IITTKE A +L+DA+K ELD FYGK+PL SKDLSRIVNSNH+
Sbjct  244  IAGKWGCNNGQACVSPDHIITTKEFATKLVDALKSELDNFYGKNPLQSKDLSRIVNSNHY  303

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLTKLLD+DK+SGK++HGGERD+  L+IAPTIL+DVP+D+LIM+EEIFGPLLPI+TV+K
Sbjct  304  DRLTKLLDEDKISGKVIHGGERDKNNLRIAPTILLDVPQDSLIMQEEIFGPLLPIITVDK  363

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +I +  KPLAAYLFT+N+KL+  FV N+SAGGLLINDT LH+AV TLPFGGVGE
Sbjct  364  IEDSFDLITSGTKPLAAYLFTNNQKLKDHFVGNVSAGGLLINDTTLHLAVPTLPFGGVGE  423

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSFEAFSHKKAV+ R F GD   RYPPYT  K  L++AL+ G+L+ IIRAL
Sbjct  424  SGMGAYHGKFSFEAFSHKKAVVYRGFFGDAAVRYPPYTKGKLTLMKALVGGSLLGIIRAL  483

Query  139  LG  134
             G
Sbjct  484  FG  485



>ref|XP_004142628.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cucumis sativus]
Length=484

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACIAPDY+ITTKE A +L++ MK EL+KFYGK+PL +KDLSRIVN+NHF
Sbjct  241  IAGKWGCNNGQACIAPDYVITTKEFAPKLVECMKQELEKFYGKNPLETKDLSRIVNANHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+LLDDDK+SGKIVHGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  301  DRLTRLLDDDKISGKIVHGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDK  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   I+N+  KPLAAYLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPFGGVGE
Sbjct  361  VEDSFDIVNSGTKPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRAL
Sbjct  421  SGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILALIRAL  480

Query  139  LG  134
            LG
Sbjct  481  LG  482



>ref|XP_002302229.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE81502.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQAC++PDYIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNS HF
Sbjct  245  IAGKWGCNNGQACVSPDYIITTKDCADKLVDSLKKELETFYGKNPLESKDLSRIVNSKHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRLTKLLD+DKVS KIV+GGERDE  LKI+PTIL+DVP D+LIMKEEIFGPLLPIL V+K
Sbjct  305  SRLTKLLDEDKVSRKIVYGGERDEANLKISPTILVDVPCDSLIMKEEIFGPLLPILIVSK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN+  KPLAAYLFT+NKKL+++FV ++SAGG++IND A+H+A+HTLPFGGVGE
Sbjct  365  IEDSFDMINSGTKPLAAYLFTNNKKLKEQFVMSVSAGGVVINDIAMHLAIHTLPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SGTGSYHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++A M+ N   I+RAL
Sbjct  425  SGTGSYHGKFSFDAFSHKKAVLYRSFMGDAALRYPPYTRGKLRLMKAFMTSNFWTILRAL  484

Query  139  LG  134
             G
Sbjct  485  FG  486



>gb|KJB59281.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
 gb|KJB59282.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=402

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 211/243 (87%), Gaps = 1/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF
Sbjct  156  IAGKWGCNNGQACISPDYIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHF  215

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KL+D++KVS KIVHGG+R+EK L+IAPTI +DVP ++LIMKEEIFGPLLPI+TV+K
Sbjct  216  DRLSKLMDEEKVSSKIVHGGQRNEKNLQIAPTIFLDVPVNSLIMKEEIFGPLLPIITVDK  275

Query  499  VEDGIKIINAR-DKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVG  323
            VE    +I++   KPLAAYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPFGGVG
Sbjct  276  VEQSFDLIHSSGGKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVG  335

Query  322  ESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRA  143
            ESG GSYHGKFSF+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRA
Sbjct  336  ESGMGSYHGKFSFDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRA  395

Query  142  LLG  134
            LLG
Sbjct  396  LLG  398



>ref|XP_010243505.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Nelumbo nucifera]
Length=567

 Score =   368 bits (944),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACIAPDYIITTK  A  L+D +K  L++F+GKDPL SKDLSRIVNSNHFS
Sbjct  320  AGKWGCNNGQACIAPDYIITTKAYAPTLIDGLKNILEEFFGKDPLESKDLSRIVNSNHFS  379

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL KLLD+DKVSGKIVHGG+RDE RL IAPTIL+DVPED+LIM EEIFGPLLPI+TV+KV
Sbjct  380  RLAKLLDEDKVSGKIVHGGQRDETRLMIAPTILLDVPEDSLIMNEEIFGPLLPIITVDKV  439

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
            ED   II +R KPLAAYLFTS+KKLE+EFV N+SAGG+LINDT +H+   +LPFGGVGES
Sbjct  440  EDSFDIIKSRSKPLAAYLFTSSKKLEKEFVENISAGGMLINDTVVHLTNPSLPFGGVGES  499

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G GSYHGKFSF+AFSHKKAVL RS  GD   RYPPYTP K R+LRA++ G++I  I AL+
Sbjct  500  GIGSYHGKFSFDAFSHKKAVLYRSLYGDAPVRYPPYTPGKLRILRAILDGSIIGAILALI  559

Query  136  GL  131
            G 
Sbjct  560  GF  561



>ref|XP_010243504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Nelumbo nucifera]
Length=568

 Score =   368 bits (944),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACIAPDYIITTK  A  L+D +K  L++F+GKDPL SKDLSRIVNSNHFS
Sbjct  321  AGKWGCNNGQACIAPDYIITTKAYAPTLIDGLKNILEEFFGKDPLESKDLSRIVNSNHFS  380

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL KLLD+DKVSGKIVHGG+RDE RL IAPTIL+DVPED+LIM EEIFGPLLPI+TV+KV
Sbjct  381  RLAKLLDEDKVSGKIVHGGQRDETRLMIAPTILLDVPEDSLIMNEEIFGPLLPIITVDKV  440

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
            ED   II +R KPLAAYLFTS+KKLE+EFV N+SAGG+LINDT +H+   +LPFGGVGES
Sbjct  441  EDSFDIIKSRSKPLAAYLFTSSKKLEKEFVENISAGGMLINDTVVHLTNPSLPFGGVGES  500

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G GSYHGKFSF+AFSHKKAVL RS  GD   RYPPYTP K R+LRA++ G++I  I AL+
Sbjct  501  GIGSYHGKFSFDAFSHKKAVLYRSLYGDAPVRYPPYTPGKLRILRAILDGSIIGAILALI  560

Query  136  GL  131
            G 
Sbjct  561  GF  562



>gb|KHG28299.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=493

 Score =   365 bits (936),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 212/243 (87%), Gaps = 1/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQAC++PDYIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF
Sbjct  247  IAGKWGCNNGQACVSPDYIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHF  306

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KL+D++KVS KIVHGG+R+EK L+IAPTIL+DVP ++LIMKEEIFGPLLPI+TV+K
Sbjct  307  DRLSKLMDEEKVSSKIVHGGQRNEKNLQIAPTILLDVPVNSLIMKEEIFGPLLPIITVDK  366

Query  499  VEDGIKIINAR-DKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVG  323
            VE    +I++   KPLAAYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPFGGVG
Sbjct  367  VEQSFDLIHSSGGKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVG  426

Query  322  ESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRA  143
            ESG GSYHGKFSF+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRA
Sbjct  427  ESGMGSYHGKFSFDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRA  486

Query  142  LLG  134
            LLG
Sbjct  487  LLG  489



>gb|KJB59280.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=493

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 211/243 (87%), Gaps = 1/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF
Sbjct  247  IAGKWGCNNGQACISPDYIITTKDYATKLVDSFKCELERFYGKDPLESKDLSRIVNSNHF  306

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KL+D++KVS KIVHGG+R+EK L+IAPTI +DVP ++LIMKEEIFGPLLPI+TV+K
Sbjct  307  DRLSKLMDEEKVSSKIVHGGQRNEKNLQIAPTIFLDVPVNSLIMKEEIFGPLLPIITVDK  366

Query  499  VEDGIKIINAR-DKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVG  323
            VE    +I++   KPLAAYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LPFGGVG
Sbjct  367  VEQSFDLIHSSGGKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLPFGGVG  426

Query  322  ESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRA  143
            ESG GSYHGKFSF+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++ IIRA
Sbjct  427  ESGMGSYHGKFSFDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIVGIIRA  486

Query  142  LLG  134
            LLG
Sbjct  487  LLG  489



>ref|XP_011653785.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cucumis sativus]
Length=548

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACIAPDY+ITTKE A +L++ MK EL+KFYGK+PL +KDLSRIVN+NHF
Sbjct  305  IAGKWGCNNGQACIAPDYVITTKEFAPKLVECMKQELEKFYGKNPLETKDLSRIVNANHF  364

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+LLDDDK+SGKIVHGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  365  DRLTRLLDDDKISGKIVHGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDK  424

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   I+N+  KPLAAYLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPFGGVGE
Sbjct  425  VEDSFDIVNSGTKPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGE  484

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRAL
Sbjct  485  SGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILALIRAL  544

Query  139  LG  134
            LG
Sbjct  545  LG  546



>gb|AGC65583.1| fatty aldehyde dehydrogenase [Simmondsia chinensis]
Length=492

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +L+D +K EL++ YG +PL SKDLSRIVNSNHF
Sbjct  240  IAGKWGCNNGQACISPDYIITTKDFAPKLIDTLKRELERCYGTEPLESKDLSRIVNSNHF  299

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+LLD+DKVSG+IV GG+RD  +L+IAPT+L  VP+D+LIM EEIFGPLLP++TV++
Sbjct  300  DRLTRLLDEDKVSGRIVCGGQRDRDKLRIAPTVLQGVPQDSLIMSEEIFGPLLPVITVDR  359

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+R KPLAAYLFT+ KKL+ EFV+N+SAGGL+IND+ALH+AVHTLPFGGV E
Sbjct  360  LEESFDLINSRTKPLAAYLFTNRKKLKHEFVSNVSAGGLVINDSALHLAVHTLPFGGVAE  419

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+ FSHKKAVL RSF GD  ARYPPYT  K RLL+AL+SG+++ II+AL
Sbjct  420  SGMGSYHGKFSFDVFSHKKAVLYRSFMGDAAARYPPYTQGKLRLLKALLSGSILGIIKAL  479

Query  139  LG  134
            +G
Sbjct  480  MG  481



>ref|XP_010268979.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Nelumbo 
nucifera]
Length=489

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/243 (72%), Positives = 209/243 (86%), Gaps = 1/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KWGC +GQ C++PDYIITTK  A +L+DA+K  L++F+GKDPL SKDLSRIVNS+HF
Sbjct  244  VAGKWGCNNGQTCVSPDYIITTKTFATKLIDALKHVLEEFFGKDPLQSKDLSRIVNSSHF  303

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRLTKLLD+DKVSGKIV+GG+RDE +LKIAPTIL+DVPED+LIM EEIFGPLLPI+TV+K
Sbjct  304  SRLTKLLDEDKVSGKIVYGGQRDETQLKIAPTILLDVPEDSLIMNEEIFGPLLPIITVDK  363

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED + IIN+R KPLAAYLFTS+KKLE+EFV  +SAGG+LINDT LH+   +LPFGGVGE
Sbjct  364  VEDSLNIINSRSKPLAAYLFTSSKKLEKEFVEKISAGGMLINDTVLHLTNPSLPFGGVGE  423

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKA+L R F GD+  RYPPYTP+K RLL AL+  +   +I AL
Sbjct  424  SGFGSYHGKFSFDAFSHKKAILYRPFIGDVTVRYPPYTPRKIRLLDALLHHS-TGVIPAL  482

Query  139  LGL  131
            +GL
Sbjct  483  IGL  485



>ref|XP_011003449.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   362 bits (930),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 210/243 (86%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWGC +GQACI+PDYIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNS HF
Sbjct  245  VVGKWGCNNGQACISPDYIITTKDCAEKLVDSLKKELEAFYGKNPLESKDLSRIVNSKHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRLTKLLD+DKVS KIV+GGERDE  L+IAPTIL+ VP+++LIMKEEIFGPLLPILTV+K
Sbjct  305  SRLTKLLDEDKVSRKIVYGGERDEANLRIAPTILLGVPQNSLIMKEEIFGPLLPILTVSK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   II +  KPLAAYLFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PFGGVGE
Sbjct  365  IEDSFDIIKSGTKPLAAYLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AF+HKKAV+ RSF GD   RYPPYT  K RL++AL++GNL  I+R L
Sbjct  425  SGMGSYHGKFSFDAFTHKKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNLWTILRTL  484

Query  139  LGL  131
            LG+
Sbjct  485  LGM  487



>ref|XP_006575169.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=496

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWG  +GQACI+PDYIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSR+VNSNHF
Sbjct  254  IAGKWGSNNGQACISPDYIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRVVNSNHF  313

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLDDDKVSGKIV+GG++DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  314  NRLTKLLDDDKVSGKIVYGGQKDENKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDK  373

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAY+FT+NKKL+++FV  +SAGGL++NDT LH+AVHTLPFGGVGE
Sbjct  374  LEESFDVINSGPKPLAAYIFTNNKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGE  433

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSFEAFSHKKAVL R F GD   RYPPYT  K RLL+A++ G +  I+RAL
Sbjct  434  SGVGAYHGKFSFEAFSHKKAVLYRKFIGDAPVRYPPYTNTKMRLLKAIIGGGIHGIVRAL  493

Query  139  LG  134
             G
Sbjct  494  FG  495



>gb|KHG30796.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   361 bits (927),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A++L+D+ K EL++FYGK+PL SKDLSR+VNSNHF
Sbjct  245  IAGKWGCNNGQACISPDYIITTKDYAVELVDSFKCELERFYGKNPLESKDLSRVVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD+DKVS KIV+GGERD+  LKIAPTIL+DVP+D+LIM EEIFGPLLPI+T++K
Sbjct  305  ARLLKLLDEDKVSSKIVYGGERDKSNLKIAPTILLDVPQDSLIMNEEIFGPLLPIITIDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   +IN+  KPLAAY+FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+
Sbjct  365  VEDSFDLINSGTKPLAAYMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPFGGVGD  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G+++ IIRAL
Sbjct  425  SGMGAYHGKFSFDTFSHKKAVLYRSFAGDAPLRYPPYTNGKLRLLKALLGGSILGIIRAL  484

Query  139  LG  134
            +G
Sbjct  485  MG  486



>ref|XP_012078302.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Jatropha 
curcas]
 gb|KDP32847.1| hypothetical protein JCGZ_12139 [Jatropha curcas]
Length=493

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDY+ITTK+ A +L+++ K EL++FYGK+PL SKDLSRIVN NHF
Sbjct  248  IAGKWGCNNGQACISPDYMITTKDYATKLVESFKKELERFYGKNPLESKDLSRIVNFNHF  307

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRLTKLLD+DKVSGKIVHGGERDE  LKIAPT+L+DVP+++LIMKEEIFGPLLPI+ V+K
Sbjct  308  SRLTKLLDEDKVSGKIVHGGERDEVNLKIAPTLLLDVPQNSLIMKEEIFGPLLPIVMVDK  367

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAYLFT+NKKL+Q+FV ++SAGG+++NDTA+H+AV TLPFGGVGE
Sbjct  368  IEESFDLINSGTKPLAAYLFTNNKKLKQQFVISVSAGGVVVNDTAVHLAVPTLPFGGVGE  427

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SGTG+YHGKFSF+ FSHKKAVL R F GD   RYPPY+  K RLL+ L+ G +  IIRAL
Sbjct  428  SGTGAYHGKFSFDTFSHKKAVLYRGFAGDAPVRYPPYSSGKIRLLKVLLGGGIWDIIRAL  487

Query  139  LG  134
             G
Sbjct  488  FG  489



>ref|XP_010930724.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Elaeis 
guineensis]
Length=495

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/239 (72%), Positives = 204/239 (85%), Gaps = 0/239 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDYIITTK  A  L+D++K  L+KFYGKD   SKDLSRIVN+NHF RL
Sbjct  252  KWGCNNGQACIAPDYIITTKSFAPILVDSLKRTLEKFYGKDASESKDLSRIVNANHFKRL  311

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
            T LLDD+KVSGKIVHGG+RDEKRL IAPT+L+DVP D+LIMKEEIFGPLLPI+TV+KVED
Sbjct  312  TSLLDDEKVSGKIVHGGQRDEKRLYIAPTLLLDVPHDSLIMKEEIFGPLLPIITVDKVED  371

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
               +IN++ KPLAAYLFT +KKLE++FV  +SAGG+LIND ALH+A H LPFGGVGESG 
Sbjct  372  SFDLINSKTKPLAAYLFTKDKKLEEKFVNTVSAGGMLINDIALHLANHYLPFGGVGESGF  431

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  134
            GSYHGKFSF+AFSHKKAVL R F G+  ARYPPYTP+K +L+R L++G++I +  ALLG
Sbjct  432  GSYHGKFSFDAFSHKKAVLSRGFFGEARARYPPYTPRKQKLVRQLLNGSIIAMFFALLG  490



>gb|KHN21716.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=411

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWG  +GQACI+PDY+ITTK+ A +L+DA+K EL+K YGK+PL S+DLSRIV SNHF
Sbjct  168  ISGKWGLNNGQACISPDYVITTKDCAPELVDALKTELEKCYGKNPLESEDLSRIVTSNHF  227

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLDDDKV+GKIV+GGE+DEK+L+IAPT+L+DVP D+LIM +EIFGPLLPI+TVNK
Sbjct  228  ARLSKLLDDDKVAGKIVYGGEKDEKKLRIAPTLLLDVPRDSLIMGDEIFGPLLPIITVNK  287

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VE+ I +IN+  KPLAAY+FT+NKKL+++FV N+ AGGLL+NDT LH+ V TLPFGGVGE
Sbjct  288  VEESIDLINSGTKPLAAYIFTTNKKLKEQFVMNVPAGGLLVNDTVLHLVVDTLPFGGVGE  347

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G  + IIRAL
Sbjct  348  SGMGAYHGKFSFDAFTHKKAVLYRSFAGDSSLRYPPYTDTKLRLMKALIGGRFLGIIRAL  407

Query  139  LG  134
             G
Sbjct  408  FG  409



>ref|XP_006596209.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Glycine max]
Length=422

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWG  +GQACI+PDYIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF
Sbjct  180  IAGKWGSNNGQACISPDYIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRIVNSNHF  239

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLDDDKVSGKIV+GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  240  NRLTKLLDDDKVSGKIVYGGEKDESKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDK  299

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAY+FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPFGGVGE
Sbjct  300  IEESFDVINSGSKPLAAYIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGE  359

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKF+FEAFSHKKAVL R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL
Sbjct  360  SGVGAYHGKFTFEAFSHKKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILGIIRAL  419

Query  139  LG  134
             G
Sbjct  420  FG  421



>ref|XP_003526638.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=491

 Score =   360 bits (925),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWG  +GQACI+PDY+ITTK+ A +L+DA+K EL+K YGK+PL S+DLSRIV SNHF
Sbjct  248  ISGKWGLNNGQACISPDYVITTKDCAPKLVDALKTELEKCYGKNPLESEDLSRIVTSNHF  307

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLDDDKV+GKIV+GGE+DEK+L+IAPT+L+DVP D+LIM EEIFGPLLPI+TVNK
Sbjct  308  ARLSKLLDDDKVAGKIVYGGEKDEKKLRIAPTLLLDVPRDSLIMGEEIFGPLLPIITVNK  367

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VE+ I +IN+  KPLAAY+FT+NKKL+++FV N+ AGGLL+NDT LH+ V TLPFGGVGE
Sbjct  368  VEESIDLINSGTKPLAAYIFTTNKKLKEQFVMNVPAGGLLVNDTVLHLVVDTLPFGGVGE  427

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G  + IIRAL
Sbjct  428  SGMGAYHGKFSFDAFTHKKAVLYRSFAGDSSLRYPPYTDTKLRLMKALIGGRFLGIIRAL  487

Query  139  LG  134
             G
Sbjct  488  FG  489



>ref|XP_007019116.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
 gb|EOY16341.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
Length=489

 Score =   360 bits (924),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 208/243 (86%), Gaps = 1/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +LLD+ K EL++FYGK+PL SKDLSRIVNSNHF
Sbjct  245  IAGKWGCNNGQACISPDYIITTKDYAPKLLDSFKRELEQFYGKNPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLD+DKVSGKIVHGGERD+  LKIAPTIL+DVP D+LIM EEIFGPLLPI+ V+K
Sbjct  305  ARLSKLLDEDKVSGKIVHGGERDKNNLKIAPTILLDVPLDSLIMNEEIFGPLLPIIMVDK  364

Query  499  VEDGIKIINAR-DKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVG  323
            VED   +IN+   KPLAAYLFT+ +KL+++FV  +SAGGL++NDT +H+A HTLPFGGVG
Sbjct  365  VEDSFDVINSSGTKPLAAYLFTNKEKLKEKFVATVSAGGLVVNDTTVHLAEHTLPFGGVG  424

Query  322  ESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRA  143
            +SG G+YHGKFSF+AFSHKKAVL R F  D   RYPPYT +K RLL+AL+ G+L+ IIRA
Sbjct  425  DSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPPYTRRKLRLLQALLGGSLLSIIRA  484

Query  142  LLG  134
            LLG
Sbjct  485  LLG  487



>ref|XP_009420563.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=484

 Score =   360 bits (923),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KWGC SGQACIAPDYIITTK  A +L+DA+K+ L+KFYGKDPL S DLSRIVNSNHF
Sbjct  239  VAGKWGCNSGQACIAPDYIITTKSFAPKLVDALKITLEKFYGKDPLESADLSRIVNSNHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LLDD+KVSG IVHGG+R+EKRL+IAPTIL+DVP D+LIMKEE+FGPLLPI+TV++
Sbjct  299  KRLMNLLDDEKVSGTIVHGGQRNEKRLRIAPTILLDVPSDSLIMKEEVFGPLLPIVTVDE  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            + +G  +IN++ KPLAAYLFT ++KLE++FV ++SAGG++INDT L V    LPFGGVGE
Sbjct  359  LREGFGLINSKGKPLAAYLFTKDRKLEEKFVKSVSAGGMVINDTILQVTNPRLPFGGVGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL R FGGD+  RYPPYT  K ++LR L++GN+I +  AL
Sbjct  419  SGMGSYHGKFSFDAFSHKKAVLSRGFGGDVSMRYPPYTAHKQKILRGLITGNIIAVFLAL  478

Query  139  LG  134
            +G
Sbjct  479  IG  480



>ref|XP_003544699.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX2 
[Glycine max]
Length=487

 Score =   359 bits (922),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWG  +GQACI+PDYIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF
Sbjct  245  IAGKWGSNNGQACISPDYIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLDDDKVSGKIV+GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  305  NRLTKLLDDDKVSGKIVYGGEKDESKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAY+FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPFGGVGE
Sbjct  365  IEESFDVINSGSKPLAAYIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKF+FEAFSHKKAVL R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL
Sbjct  425  SGVGAYHGKFTFEAFSHKKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILGIIRAL  484

Query  139  LG  134
             G
Sbjct  485  FG  486



>ref|XP_003544698.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX1 
[Glycine max]
 gb|KHN20143.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=496

 Score =   359 bits (922),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWG  +GQACI+PDYIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSRIVNSNHF
Sbjct  254  IAGKWGSNNGQACISPDYIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRIVNSNHF  313

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLDDDKVSGKIV+GGE+DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  314  NRLTKLLDDDKVSGKIVYGGEKDESKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDK  373

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAY+FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPFGGVGE
Sbjct  374  IEESFDVINSGSKPLAAYIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGE  433

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKF+FEAFSHKKAVL R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL
Sbjct  434  SGVGAYHGKFTFEAFSHKKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILGIIRAL  493

Query  139  LG  134
             G
Sbjct  494  FG  495



>gb|EYU23873.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=394

 Score =   356 bits (913),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWGC +GQ CI+PDYI+TTKE A +++DA+  EL+KFYGKDPL S DLSRIVN +HF
Sbjct  152  ISGKWGCNNGQTCISPDYILTTKEYAPKVVDALAAELEKFYGKDPLGSNDLSRIVNIHHF  211

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL KL+DD+KVSGKIVHGG+RD+  LKIAPTIL+DV ED+LIM EEIFGPLLPI+TVNK
Sbjct  212  DRLEKLMDDEKVSGKIVHGGQRDKTNLKIAPTILLDVEEDSLIMNEEIFGPLLPIVTVNK  271

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED    INA+ KPLAAYLFT++K L++EFV ++SAG + IN+TALH     LPFGGVGE
Sbjct  272  IEDSFGAINAKGKPLAAYLFTNDKTLKEEFVRSVSAGAIAINETALHFMEVGLPFGGVGE  331

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL+R FGG++ ARYPPY P K +LL+AL+ GN+I I+RAL
Sbjct  332  SGMGSYHGKFSFDAFSHKKAVLRRGFGGEVSARYPPYAPWKLQLLKALVKGNIIEILRAL  391

Query  139  LG  134
            LG
Sbjct  392  LG  393



>ref|XP_007019117.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
 gb|EOY16342.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
Length=515

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 208/243 (86%), Gaps = 1/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +LLD+ K EL++FYGK+PL SKDLSRIVNSNHF
Sbjct  271  IAGKWGCNNGQACISPDYIITTKDYAPKLLDSFKRELEQFYGKNPLESKDLSRIVNSNHF  330

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLD+DKVSGKIVHGGERD+  LKIAPTIL+DVP D+LIM EEIFGPLLPI+ V+K
Sbjct  331  ARLSKLLDEDKVSGKIVHGGERDKNNLKIAPTILLDVPLDSLIMNEEIFGPLLPIIMVDK  390

Query  499  VEDGIKIINAR-DKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVG  323
            VED   +IN+   KPLAAYLFT+ +KL+++FV  +SAGGL++NDT +H+A HTLPFGGVG
Sbjct  391  VEDSFDVINSSGTKPLAAYLFTNKEKLKEKFVATVSAGGLVVNDTTVHLAEHTLPFGGVG  450

Query  322  ESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRA  143
            +SG G+YHGKFSF+AFSHKKAVL R F  D   RYPPYT +K RLL+AL+ G+L+ IIRA
Sbjct  451  DSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPPYTRRKLRLLQALLGGSLLSIIRA  510

Query  142  LLG  134
            LLG
Sbjct  511  LLG  513



>gb|KHN47009.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=491

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWG  +GQACI+PDY+ITTK+ A +L+D +K EL+ FYG++PL S+DLSRIV+SNHF
Sbjct  248  IAGKWGLNNGQACISPDYVITTKDYAPKLVDTLKTELESFYGRNPLESEDLSRIVSSNHF  307

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLL+DDKVSGKIV+GGE+DEK+L+IAPTIL+DVP+D+ IM EEIFGPLLPI+TVNK
Sbjct  308  ARLSKLLNDDKVSGKIVYGGEKDEKKLRIAPTILLDVPQDSSIMGEEIFGPLLPIITVNK  367

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+ I +IN+  KPLAAY+FT++ K +++FV N+SAGGLL+NDTALH+ V TLPFGGVGE
Sbjct  368  LEESIDVINSGAKPLAAYVFTTDNKFKEQFVKNVSAGGLLVNDTALHLVVDTLPFGGVGE  427

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G ++ IIRAL
Sbjct  428  SGMGAYHGKFSFDAFTHKKAVLYRSFAGDSAIRYPPYTDTKLRLMKALVGGRILGIIRAL  487

Query  139  LG  134
             G
Sbjct  488  FG  489



>ref|XP_010095408.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
 gb|EXB60100.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
Length=497

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A +L+D++K  L+KFYGK+PL SKDLSRIVNSNHF
Sbjct  254  IAGKWGCNNGQACISPDYIITTKDFAPKLVDSLKEVLEKFYGKNPLESKDLSRIVNSNHF  313

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD++KVSGK+VHGGER+E  LKIAPTIL+DVP D+LIM EEIFGPLLPI+TV K
Sbjct  314  ARLMKLLDEEKVSGKVVHGGERNETDLKIAPTILLDVPRDSLIMTEEIFGPLLPIITVEK  373

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VE+   IIN+  KPLAAYLFTSN+KL+++FV  +SAGG+++NDT +H+AV TLPFGGVGE
Sbjct  374  VEESYDIINSGPKPLAAYLFTSNEKLKKQFVMTISAGGVVVNDTTIHLAVVTLPFGGVGE  433

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSFEAFSHKKAV+ RSF  D   RYPPYT  K  LL+AL+ G+++ IIRAL
Sbjct  434  SGMGAYHGKFSFEAFSHKKAVVYRSFVADAAVRYPPYTKGKLSLLKALVGGSILGIIRAL  493

Query  139  LG  134
             G
Sbjct  494  FG  495



>ref|XP_003523436.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Glycine max]
 ref|XP_006578967.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Glycine max]
 ref|XP_006578968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X3 [Glycine max]
Length=488

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWG  +GQACI+PDY+ITTK+ A +L+D +K EL+ FYG++PL S+DLSRIV+SNHF
Sbjct  245  IAGKWGLNNGQACISPDYVITTKDYAPKLVDTLKTELESFYGRNPLESEDLSRIVSSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLL+DDKVSGKIV+GGE+DEK+L+IAPTIL+DVP+D+ IM EEIFGPLLPI+TVNK
Sbjct  305  ARLSKLLNDDKVSGKIVYGGEKDEKKLRIAPTILLDVPQDSSIMGEEIFGPLLPIITVNK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+ I +IN+  KPLAAY+FT++ K +++FV N+SAGGLL+NDTALH+ V TLPFGGVGE
Sbjct  365  LEESIDVINSGAKPLAAYVFTTDNKFKEQFVKNVSAGGLLVNDTALHLVVDTLPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G ++ IIRAL
Sbjct  425  SGMGAYHGKFSFDAFTHKKAVLYRSFAGDSAIRYPPYTDTKLRLMKALVGGRILGIIRAL  484

Query  139  LG  134
             G
Sbjct  485  FG  486



>ref|XP_008781593.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Phoenix 
dactylifera]
Length=495

 Score =   358 bits (918),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/239 (71%), Positives = 203/239 (85%), Gaps = 0/239 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDYIITTK  A  L+D+++  L+KFYG+D   SKDLSRIVN+NHF RL
Sbjct  252  KWGCNNGQACIAPDYIITTKSFAPILVDSLRRTLEKFYGEDASESKDLSRIVNANHFKRL  311

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
            T LLDD+KVSGKIVHGG+RDEK L IAPT+L+DVP D+LIMKEEIFGPLLPI+TV+KVED
Sbjct  312  TSLLDDEKVSGKIVHGGQRDEKHLYIAPTLLLDVPHDSLIMKEEIFGPLLPIITVDKVED  371

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
               +IN++ KPLAAYLFT +KKLE++FV  +SAGG+LINDT LH+A   LPFGGVGESG 
Sbjct  372  SFDVINSKSKPLAAYLFTKDKKLEEKFVKIVSAGGMLINDTVLHLANPYLPFGGVGESGF  431

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  134
            GSYHGKFSFEAFSHKKAVL R FGG+  ARYPPYTP+K +LLR L++G++I +  AL+G
Sbjct  432  GSYHGKFSFEAFSHKKAVLSRGFGGETSARYPPYTPQKQKLLRQLLNGSIIALFLALIG  490



>gb|KHN20611.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=614

 Score =   362 bits (928),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWG  +GQACI+PDYIITTK+ A +L+DA+K EL+KFYGK+PL SKDLSR+VNSNHF
Sbjct  372  IAGKWGSNNGQACISPDYIITTKDYAPKLVDALKTELEKFYGKNPLESKDLSRVVNSNHF  431

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLDDDKVSGKIV+GG++DE +LKI+PT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  432  NRLTKLLDDDKVSGKIVYGGQKDENKLKISPTVLLDVPRDSLIMNEEIFGPLLPILTVDK  491

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAY+FT+NKKL+++FV  +SAGGL++NDT LH+AVHTLPFGGVGE
Sbjct  492  LEESFDVINSGPKPLAAYIFTNNKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPFGGVGE  551

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSFEAFSHKKAVL R F GD   RYPPYT  K RLL+A++ G +  I+RAL
Sbjct  552  SGVGAYHGKFSFEAFSHKKAVLYRKFIGDAPVRYPPYTNTKMRLLKAIIGGGIHGIVRAL  611

Query  139  LG  134
             G
Sbjct  612  FG  613



>gb|EYU23872.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=476

 Score =   357 bits (916),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWGC +GQ CI+PDYI+TTKE A +++DA+  EL+KFYGKDPL S DLSRIVN +HF
Sbjct  234  ISGKWGCNNGQTCISPDYILTTKEYAPKVVDALAAELEKFYGKDPLGSNDLSRIVNIHHF  293

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL KL+DD+KVSGKIVHGG+RD+  LKIAPTIL+DV ED+LIM EEIFGPLLPI+TVNK
Sbjct  294  DRLEKLMDDEKVSGKIVHGGQRDKTNLKIAPTILLDVEEDSLIMNEEIFGPLLPIVTVNK  353

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED    INA+ KPLAAYLFT++K L++EFV ++SAG + IN+TALH     LPFGGVGE
Sbjct  354  IEDSFGAINAKGKPLAAYLFTNDKTLKEEFVRSVSAGAIAINETALHFMEVGLPFGGVGE  413

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL+R FGG++ ARYPPY P K +LL+AL+ GN+I I+RAL
Sbjct  414  SGMGSYHGKFSFDAFSHKKAVLRRGFGGEVSARYPPYAPWKLQLLKALVKGNIIEILRAL  473

Query  139  LG  134
            LG
Sbjct  474  LG  475



>ref|XP_008219617.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Prunus mume]
Length=413

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PDYI+TTK+ A +L+D++K EL+ FYG +PL SKDLSRIVNSNHF
Sbjct  168  IVGKWGCNNGQACISPDYIVTTKDFAPKLVDSLKRELENFYGNNPLESKDLSRIVNSNHF  227

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLD+DKVSGKIV GGERD+  L+IAPTIL+DV  D+LIM EEIFGPLLPILTV++
Sbjct  228  ARLTKLLDEDKVSGKIVLGGERDKTNLRIAPTILLDVSRDSLIMNEEIFGPLLPILTVDR  287

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VE+   +IN+  KPLAAYLFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPFGGVGE
Sbjct  288  VEESFDLINSGTKPLAAYLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPFGGVGE  347

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL
Sbjct  348  SGMGAYHGKFSFDAFSHKKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILSIIRAL  407

Query  139  LG  134
             G
Sbjct  408  FG  409



>ref|XP_007137428.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
 gb|ESW09422.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
Length=490

 Score =   354 bits (909),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWG  SGQ CI+PDY+ITTK+ A  L+D +K EL + YGK+PL S+DLSRIV+SNHF
Sbjct  247  ISGKWGLNSGQTCISPDYVITTKDYAPTLVDTLKTELQECYGKNPLESEDLSRIVSSNHF  306

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLL+DDKVSGKIV+GGE+DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK
Sbjct  307  ARLSKLLNDDKVSGKIVYGGEKDENKLRIAPTILLDVPRDSLIMGEEIFGPLLPIITVNK  366

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+ + +IN+ +KPLAAY+FT+++K ++ FV N+SAGGLL+NDT LH+ V TLPFGGVGE
Sbjct  367  LEESLDVINSGEKPLAAYVFTTDEKFKELFVRNVSAGGLLVNDTTLHLLVDTLPFGGVGE  426

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AF+HKKAVL RSF GD  ARYPPYT  K RL++AL++G ++ IIRAL
Sbjct  427  SGMGAYHGKFSFDAFTHKKAVLYRSFAGDSSARYPPYTDTKQRLMKALVAGTVLGIIRAL  486

Query  139  LG  134
            LG
Sbjct  487  LG  488



>ref|XP_007222253.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
 gb|EMJ23452.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
Length=493

 Score =   354 bits (909),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PDYI+TTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  248  IVGKWGCNNGQACISPDYIVTTKDFAPKLVDSLKCELENFYGKNPLESKDLSRIVNSNHF  307

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD+DKVSGKIV GGERD+  L+IAPTIL+DV  D+LIM EEIFGPLLPILTV++
Sbjct  308  ARLIKLLDEDKVSGKIVLGGERDKTNLRIAPTILLDVSRDSLIMNEEIFGPLLPILTVDR  367

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VE+   +IN+  KPLAAYLFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPFGGVGE
Sbjct  368  VEESFDLINSGTKPLAAYLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPFGGVGE  427

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL
Sbjct  428  SGMGAYHGKFSFDAFSHKKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILSIIRAL  487

Query  139  LG  134
             G
Sbjct  488  FG  489



>ref|XP_008444179.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
 ref|XP_008444180.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
Length=484

 Score =   354 bits (908),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWG  +GQAC+APDYIITTKE A +L++++K EL++FYGK+PL SKD+SRIVN+NHF
Sbjct  241  ISGKWGGNNGQACVAPDYIITTKEFAPKLVESLKQELERFYGKNPLESKDISRIVNANHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +R+TKLLDDD+VS KIVHGG++D+ +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TV+K
Sbjct  301  NRVTKLLDDDEVSSKIVHGGQKDKTKLQIAPTILLDVPRDSLIMTEEIFGPLLPIITVDK  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED  +I+N+  KPLAAYLF++NKKL+++FV  +SAGG++INDT +H+AV TLPFGGVGE
Sbjct  361  LEDSFEIVNSGTKPLAAYLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ +IRAL
Sbjct  421  SGMGAYHGKFSFDAFSHKKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILELIRAL  480

Query  139  LG  134
            LG
Sbjct  481  LG  482



>ref|XP_008444183.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Cucumis melo]
Length=484

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACIAPDYIITTKE A +L++ M+ EL+ FYGK+PL +KDLSRIVN+NHF
Sbjct  241  IAGKWGCNNGQACIAPDYIITTKEFAPKLVECMRQELENFYGKNPLETKDLSRIVNANHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+LLDDDK+SGKIVHGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  301  DRLTRLLDDDKISGKIVHGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDK  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   I+N+  KPLAAYLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPFGGVGE
Sbjct  361  VEDSFDIVNSGTKPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRAL
Sbjct  421  SGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILGLIRAL  480

Query  139  LG  134
            LG
Sbjct  481  LG  482



>ref|XP_009383529.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 203/239 (85%), Gaps = 0/239 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQAC+APDYI+TTK  A  L+DAMK  L+KFYGKDPL S DLSRIVN+ HF RL
Sbjct  251  KWGCNNGQACVAPDYILTTKSFAPTLVDAMKKTLEKFYGKDPLESPDLSRIVNAKHFRRL  310

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
            T LLDD+KVSG IV+GG++DEK LKIAPT+L+DVP D+LIMKEEIFGPLLPI+T N+VED
Sbjct  311  TSLLDDEKVSGTIVYGGQQDEKHLKIAPTLLLDVPHDSLIMKEEIFGPLLPIITFNEVED  370

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             +  IN++ KPLAAYLFT +K+LE+ FV  +SAGG+LINDTALH+A   LPFGGVGESG 
Sbjct  371  CLDFINSKAKPLAAYLFTKDKRLEERFVKTVSAGGMLINDTALHLANPHLPFGGVGESGI  430

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  134
            G+YHGKFSF++FSHKKAVL R FGG+  ARYPPYTP+K ++LR L++G++I ++ A+LG
Sbjct  431  GAYHGKFSFDSFSHKKAVLSRGFGGEAPARYPPYTPQKQKILRGLINGSIIALLLAILG  489



>ref|XP_008444182.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Cucumis melo]
Length=488

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACIAPDYIITTKE A +L++ M+ EL+ FYGK+PL +KDLSRIVN+NHF
Sbjct  245  IAGKWGCNNGQACIAPDYIITTKEFAPKLVECMRQELENFYGKNPLETKDLSRIVNANHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+LLDDDK+SGKIVHGGE+D+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  305  DRLTRLLDDDKISGKIVHGGEKDKSKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   I+N+  KPLAAYLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPFGGVGE
Sbjct  365  VEDSFDIVNSGTKPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ +IRAL
Sbjct  425  SGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILGLIRAL  484

Query  139  LG  134
            LG
Sbjct  485  LG  486



>ref|XP_008219616.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=491

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PDYI+TTK+ A +L+D++K EL+ FYG +PL SKDLSRIVNSNHF
Sbjct  246  IVGKWGCNNGQACISPDYIVTTKDFAPKLVDSLKRELENFYGNNPLESKDLSRIVNSNHF  305

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLD+DKVSGKIV GGERD+  L+IAPTIL+DV  D+LIM EEIFGPLLPILTV++
Sbjct  306  ARLTKLLDEDKVSGKIVLGGERDKTNLRIAPTILLDVSRDSLIMNEEIFGPLLPILTVDR  365

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VE+   +IN+  KPLAAYLFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPFGGVGE
Sbjct  366  VEESFDLINSGTKPLAAYLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPFGGVGE  425

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ IIRAL
Sbjct  426  SGMGAYHGKFSFDAFSHKKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILSIIRAL  485

Query  139  LG  134
             G
Sbjct  486  FG  487



>ref|XP_011027504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Populus 
euphratica]
Length=488

 Score =   353 bits (905),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQAC++PDYIITTK+ A +L+D++K EL+ FYGK+PL SKDLSRIVNS HF
Sbjct  245  IAGKWGCNNGQACVSPDYIITTKDCADKLVDSLKKELETFYGKNPLESKDLSRIVNSKHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRLTKLLD+DKVS KIV+GGERDE  LKI PTIL+DVP D+LIMKEEIFGPLLPIL V+K
Sbjct  305  SRLTKLLDEDKVSRKIVYGGERDEANLKICPTILVDVPCDSLIMKEEIFGPLLPILIVSK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN+  KPLAAYLFT+NKKL+++FV ++SAGG++IND A+H+A+HTLPFGGVGE
Sbjct  365  IEDSFDMINSGTKPLAAYLFTNNKKLKEQFVVSVSAGGVVINDIAMHLAIHTLPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SGTGSYHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++A M+ N   I+RAL
Sbjct  425  SGTGSYHGKFSFDAFSHKKAVLYRSFMGDAALRYPPYTRGKLRLMKAFMTSNFWNILRAL  484

Query  139  LG  134
            LG
Sbjct  485  LG  486



>ref|XP_010530214.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
 ref|XP_010530215.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
Length=482

 Score =   352 bits (904),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 209/243 (86%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYI+TTK+ A +++D +K EL+ FYGK+P+ SKDLSRIVNSNHF
Sbjct  239  IAGKWGCNNGQACISPDYILTTKDYAPKVIDVLKHELEAFYGKNPIESKDLSRIVNSNHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL K+LD++KVSGKIV+GG++D   LKIAPTIL+DVP D+LIM EEIFGPLLPILT++K
Sbjct  299  DRLAKMLDEEKVSGKIVYGGQKDRANLKIAPTILLDVPRDSLIMSEEIFGPLLPILTLDK  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+  +++N+R KPLAAYLFT++KKL++ F  N+SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  359  LEECFEVVNSRSKPLAAYLFTNDKKLKERFAMNVSAGGVVVNDIAVHLALHTLPFGGVGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPY+  K RLL+AL++ NL+ +++A+
Sbjct  419  SGMGSYHGKFSFDAFSHKKAVLYRSFLGDASMRYPPYSRGKLRLLKALVNSNLMDLLKAI  478

Query  139  LGL  131
             GL
Sbjct  479  FGL  481



>gb|KHG30273.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   352 bits (904),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIIT K+ A +L+D+ K EL++FYGKDPL SKDLSRIVNSNHF
Sbjct  245  IAGKWGCNNGQACISPDYIITMKDYAQKLIDSFKCELERFYGKDPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLD+DKVS KIVHGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+K
Sbjct  305  ARLSKLLDEDKVSSKIVHGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   +IN+  KPLAAYLFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+
Sbjct  365  VEDSFDVINSGTKPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGGVGD  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL R F  D   RYPPYT  K  LLRAL  G+++ IIRAL
Sbjct  425  SGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGIIRAL  484

Query  139  LG  134
            LG
Sbjct  485  LG  486



>ref|XP_009414877.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414878.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 200/240 (83%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDYI+TTK  A  L+DAMK  L+KFYGKDPL S DLSRIVNSNHF RL
Sbjct  251  KWGCNNGQACIAPDYILTTKSFAPTLVDAMKRTLEKFYGKDPLESADLSRIVNSNHFKRL  310

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
              LLDD+ VSG IV+GG+RDE+ LKIAPT+L+DVP D+ IMKEEIFGP LPI+T ++VED
Sbjct  311  MSLLDDENVSGTIVYGGQRDEQHLKIAPTLLLDVPHDSSIMKEEIFGPFLPIVTFDEVED  370

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I  IN++ KPLAAYLFT ++K+E +FV N+SAGG+L+ND ALH+A   LPFGGVGESG 
Sbjct  371  CIDFINSKSKPLAAYLFTKDRKIEDQFVKNVSAGGILVNDVALHLANPHLPFGGVGESGI  430

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            G+YHGKFSF+AFSHKKAVL R FGG+  ARYPPYTP+K R+LR L++G++I ++ A+LG 
Sbjct  431  GAYHGKFSFDAFSHKKAVLSRGFGGEAPARYPPYTPQKQRILRGLINGSIIALVLAILGF  490



>ref|XP_003602042.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=495

 Score =   352 bits (903),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KW C +GQACI+PDY+ITTK+ A +L+DA+K EL+ F+GK+P+ S DLSRIV+SNHF
Sbjct  252  ISGKWCCNNGQACISPDYVITTKDFAPKLVDALKKELESFFGKNPIESNDLSRIVSSNHF  311

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL K+LDDDKVSGKIV+GGE+DE +L+IAPTI++D P+D+LIM EEIFGPLLPI+TVNK
Sbjct  312  ARLIKMLDDDKVSGKIVYGGEKDESKLRIAPTIVLDAPQDSLIMSEEIFGPLLPIITVNK  371

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +INA  KPLAAYLFT++ K +++FV N+SAGGLLINDT LH+ VHTLPFGGVG+
Sbjct  372  LEESFDVINAGTKPLAAYLFTNDNKFKEQFVKNVSAGGLLINDTVLHLVVHTLPFGGVGD  431

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AF+H+KAVL R F GD   RYPPYT  K +L++AL++G++  ++RAL
Sbjct  432  SGMGAYHGKFSFDAFTHRKAVLYRGFTGDASIRYPPYTDTKQKLMKALVAGDVTGVVRAL  491

Query  139  LG  134
             G
Sbjct  492  FG  493



>ref|XP_011653786.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Cucumis 
sativus]
 gb|KGN54554.1| hypothetical protein Csa_4G361880 [Cucumis sativus]
Length=484

 Score =   351 bits (901),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/242 (67%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWG  +GQAC+APDYIITTKE A +L++++K EL++FYG +PL SKD+SRIVN+NHF
Sbjct  241  ISGKWGGNNGQACVAPDYIITTKEFAPKLVESLKQELERFYGTNPLESKDISRIVNANHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +R++KLLDDD+VS KIVHGGE+D+ +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TV+K
Sbjct  301  NRVSKLLDDDEVSSKIVHGGEKDKSKLQIAPTILLDVPRDSLIMTEEIFGPLLPIITVDK  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED  +I+N+  KPLAAYLF++NKKL+++FV  +SAGG++INDT +H+AV TLPFGGVGE
Sbjct  361  LEDSFEIVNSGTKPLAAYLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ +IRA+
Sbjct  421  SGMGAYHGKFSFDAFSHKKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILELIRAI  480

Query  139  LG  134
            LG
Sbjct  481  LG  482



>gb|AES72293.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=490

 Score =   352 bits (902),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KW C +GQACI+PDY+ITTK+ A +L+DA+K EL+ F+GK+P+ S DLSRIV+SNHF
Sbjct  247  ISGKWCCNNGQACISPDYVITTKDFAPKLVDALKKELESFFGKNPIESNDLSRIVSSNHF  306

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL K+LDDDKVSGKIV+GGE+DE +L+IAPTI++D P+D+LIM EEIFGPLLPI+TVNK
Sbjct  307  ARLIKMLDDDKVSGKIVYGGEKDESKLRIAPTIVLDAPQDSLIMSEEIFGPLLPIITVNK  366

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +INA  KPLAAYLFT++ K +++FV N+SAGGLLINDT LH+ VHTLPFGGVG+
Sbjct  367  LEESFDVINAGTKPLAAYLFTNDNKFKEQFVKNVSAGGLLINDTVLHLVVHTLPFGGVGD  426

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AF+H+KAVL R F GD   RYPPYT  K +L++AL++G++  ++RAL
Sbjct  427  SGMGAYHGKFSFDAFTHRKAVLYRGFTGDASIRYPPYTDTKQKLMKALVAGDVTGVVRAL  486

Query  139  LG  134
             G
Sbjct  487  FG  488



>ref|NP_001077676.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32027.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=421

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQAC++PDYI+TTKE A +L+DAMK+EL+KFYGK+P+ SKD+SRIVNSNHF
Sbjct  178  IVGKWGCNNGQACVSPDYILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHF  237

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLLD+ +VS KIV+GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N 
Sbjct  238  DRLSKLLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNN  297

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  298  LEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGE  357

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + L
Sbjct  358  SGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVL  417

Query  139  LGL  131
            LGL
Sbjct  418  LGL  420



>gb|KJB29203.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=457

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIIT K+ A +L+D+ K EL++FYGK+PL SKDLSRIVNSNHF
Sbjct  212  IAGKWGCNNGQACISPDYIITMKDYAQKLIDSFKCELERFYGKNPLESKDLSRIVNSNHF  271

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLD+DKVS KIVHGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+K
Sbjct  272  ARLSKLLDEDKVSSKIVHGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDK  331

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   +IN+  KPLAAYLFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+
Sbjct  332  VEDSFDVINSGTKPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGGVGD  391

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL R F  D   RYPPYT  K  LLRAL  G+++ IIRAL
Sbjct  392  SGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGIIRAL  451

Query  139  LG  134
            LG
Sbjct  452  LG  453



>gb|KJB29202.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=490

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIIT K+ A +L+D+ K EL++FYGK+PL SKDLSRIVNSNHF
Sbjct  245  IAGKWGCNNGQACISPDYIITMKDYAQKLIDSFKCELERFYGKNPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLD+DKVS KIVHGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+K
Sbjct  305  ARLSKLLDEDKVSSKIVHGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   +IN+  KPLAAYLFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+
Sbjct  365  VEDSFDVINSGTKPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGGVGD  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL R F  D   RYPPYT  K  LLRAL  G+++ IIRAL
Sbjct  425  SGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGIIRAL  484

Query  139  LG  134
            LG
Sbjct  485  LG  486



>ref|XP_011074837.1| PREDICTED: aldehyde dehydrogenase [Sesamum indicum]
Length=476

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWGC SGQ C++PDY+ITTKE A +L+D +  EL+ FYGKDPL SKDLS I+N++HF
Sbjct  234  ISGKWGCNSGQTCVSPDYVITTKEYASKLVDVLSAELENFYGKDPLQSKDLSSIINAHHF  293

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             R+TKLLDD+KVSGKIV GG++D+  LKIAPTI++DVP+D+LIM EEIFGPLLPI+TVNK
Sbjct  294  DRVTKLLDDEKVSGKIVFGGQQDKTNLKIAPTIILDVPDDSLIMNEEIFGPLLPIVTVNK  353

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++   +INA+ KPLAAYLFT+++KL+ EF+ ++SAGG+ IND ALH A   LPFGGVGE
Sbjct  354  IKESFDVINAKGKPLAAYLFTNDQKLKAEFIGSVSAGGITINDVALHFAEAGLPFGGVGE  413

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL+R FGGD+ ARYPPY P K + L+AL+ G+++ ++RAL
Sbjct  414  SGMGAYHGKFSFDTFSHKKAVLQRGFGGDVAARYPPYAPWKLQFLKALLRGSILGVLRAL  473

Query  139  LG  134
            LG
Sbjct  474  LG  475



>ref|XP_010674968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   350 bits (898),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 204/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PDYIITT+E A +L+D +K EL++FYG +PL S DLSRIVNSNHF
Sbjct  234  IVGKWGCNNGQACISPDYIITTREFAPRLIDTLKRELERFYGSEPLQSNDLSRIVNSNHF  293

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL +LLD+DKV+GKIV+GG++D+ +LKIAPT+L DVP D+LIMKEEIFGPLLPI+TV K
Sbjct  294  DRLARLLDEDKVAGKIVYGGQKDKAQLKIAPTLLRDVPLDSLIMKEEIFGPLLPIITVEK  353

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   II +R KPLAAYLFT+ K L+ +FV  +SAGGL+IND+A+H+AVHTLPFGGV E
Sbjct  354  LEESYDIITSRTKPLAAYLFTNRKNLKDQFVRTVSAGGLVINDSAIHLAVHTLPFGGVEE  413

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSFEAFSHKKAVL RSF GD   RYPPYT  K +LL+AL+ G+++ I++AL
Sbjct  414  SGMGAYHGKFSFEAFSHKKAVLYRSFIGDASVRYPPYTHGKMKLLKALIGGSILGILQAL  473

Query  139  LG  134
            +G
Sbjct  474  VG  475



>ref|XP_008338656.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=496

 Score =   350 bits (897),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 202/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PDYIITTK+ A +L+D++K EL+ FYGK+ L SKDLSRIVN +HF
Sbjct  251  IVGKWGCNNGQACISPDYIITTKDFAPKLVDSLKQELENFYGKNQLESKDLSRIVNPHHF  310

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLD+DKVSGKIVHGGE D+  L+IAPTIL+DVP+D+LIM EEIFGPLLPILTV K
Sbjct  311  ARLTKLLDEDKVSGKIVHGGETDKTNLRIAPTILLDVPQDSLIMSEEIFGPLLPILTVEK  370

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN+  KPLAAYLFT+ KKL++ FV  +SAGGL++NDT +H+AV +LPFGGVGE
Sbjct  371  MEDSFDLINSGTKPLAAYLFTNKKKLKEHFVNTVSAGGLVVNDTTIHLAVPSLPFGGVGE  430

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K R+L+AL+SG +  IIRAL
Sbjct  431  SGMGAYHGKFSFDAFSHKKAVVYRGFFGDASIRYPPYTKGKLRILKALISGGISSIIRAL  490

Query  139  LG  134
             G
Sbjct  491  FG  492



>ref|XP_010063405.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Eucalyptus 
grandis]
 gb|KCW70624.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=488

 Score =   349 bits (896),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/242 (68%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWG  +GQACIA DYIITTK+ A +L+D +K EL+ FYGK+PL SKDLSRIVNS+HF
Sbjct  245  IVGKWGNNNGQACIASDYIITTKDLAPKLVDVLKNELETFYGKNPLESKDLSRIVNSDHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLD+DKVS K+V+GGERD  +L+IAPTIL+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  305  TRLTKLLDEDKVSKKVVYGGERDPTKLQIAPTILLDVPRDSLIMNEEIFGPLLPILTVDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   IIN+  KPLAAY+FT++KKL++ FV N+SAGGL++NDT +H+AVH LPFGGVGE
Sbjct  365  LEESFDIINSGAKPLAAYIFTNDKKLKEHFVNNVSAGGLVVNDTTVHLAVHALPFGGVGE  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAV+ RSF GD   RYPPYT  K RL++AL+ G+++ I+RAL
Sbjct  425  SGIGAYHGKFSFDAFSHKKAVVYRSFMGDAAIRYPPYTNGKLRLMKALLGGSILGILRAL  484

Query  139  LG  134
             G
Sbjct  485  FG  486



>ref|XP_009379028.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009379041.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score =   349 bits (896),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQAC++PDYI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF
Sbjct  246  IVGKWGCNNGQACVSPDYIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHF  305

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLD+DKVSGKIVHGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPI+TV+K
Sbjct  306  ARLTKLLDEDKVSGKIVHGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPIVTVDK  365

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN+  KPLAAYLFT+ KKL++ FV  +SAGGLLINDT +H+AV +LPFGGVGE
Sbjct  366  LEDSFDLINSGAKPLAAYLFTNKKKLKEHFVNTVSAGGLLINDTTVHLAVPSLPFGGVGE  425

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL
Sbjct  426  SGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRAL  485

Query  139  LG  134
             G
Sbjct  486  FG  487



>ref|XP_009379029.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009379042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
Length=486

 Score =   349 bits (895),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQAC++PDYI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF
Sbjct  241  IVGKWGCNNGQACVSPDYIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLD+DKVSGKIVHGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPI+TV+K
Sbjct  301  ARLTKLLDEDKVSGKIVHGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPIVTVDK  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN+  KPLAAYLFT+ KKL++ FV  +SAGGLLINDT +H+AV +LPFGGVGE
Sbjct  361  LEDSFDLINSGAKPLAAYLFTNKKKLKEHFVNTVSAGGLLINDTTVHLAVPSLPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL
Sbjct  421  SGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRAL  480

Query  139  LG  134
             G
Sbjct  481  FG  482



>gb|AAM61211.1| aldehyde dehydrogenase, putative [Arabidopsis thaliana]
Length=484

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQAC++PDYI+TTKE A +L+DAMK+EL+KFYGK+P+ SKD+SRIVNSNHF
Sbjct  241  IVGKWGCNNGQACVSPDYILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLLD+ +VS KIV+GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N 
Sbjct  301  DRLSKLLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNN  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  361  LEESFDVIRSRPKPLAAYLFTHNKKLKERFTATVSAGGIVVNDIAVHLALHTLPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + L
Sbjct  421  SGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVL  480

Query  139  LGL  131
            LGL
Sbjct  481  LGL  483



>ref|NP_175081.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 ref|NP_849770.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 sp|Q70DU8.2|AL3H1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member H1; Short=AtALDH4; 
Short=Ath-ALDH4 [Arabidopsis thaliana]
 gb|AAG50550.1|AC074228_5 aldehyde dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAL59944.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE32025.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32026.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=484

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQAC++PDYI+TTKE A +L+DAMK+EL+KFYGK+P+ SKD+SRIVNSNHF
Sbjct  241  IVGKWGCNNGQACVSPDYILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLLD+ +VS KIV+GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N 
Sbjct  301  DRLSKLLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNN  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  361  LEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + L
Sbjct  421  SGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVL  480

Query  139  LGL  131
            LGL
Sbjct  481  LGL  483



>ref|XP_008365201.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Malus domestica]
Length=486

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQAC++PDYI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF
Sbjct  241  IVGKWGCNNGQACVSPDYIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLD+DKVSGKIVHGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPILTV+K
Sbjct  301  ARLTKLLDEDKVSGKIVHGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPILTVDK  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN+  KPLAAYLFT+ KKL++ FV  +SAGGL+INDT +H+AV ++PFGGVGE
Sbjct  361  LEDSFDLINSGAKPLAAYLFTNKKKLKEHFVNTVSAGGLVINDTTVHLAVPSVPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL
Sbjct  421  SGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRAL  480

Query  139  LG  134
             G
Sbjct  481  FG  482



>ref|XP_008378442.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
 ref|XP_008365200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Malus domestica]
Length=491

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 203/242 (84%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQAC++PDYI+TTK+ A +L++++K EL+ FYGK+ L SKDLSRIVN NHF
Sbjct  246  IVGKWGCNNGQACVSPDYIVTTKDFAPKLVESLKQELENFYGKNQLESKDLSRIVNPNHF  305

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLD+DKVSGKIVHGGE D+  L+IAPTIL++VP+D+LIM EEIFGPLLPILTV+K
Sbjct  306  ARLTKLLDEDKVSGKIVHGGEMDKTNLRIAPTILLNVPQDSLIMTEEIFGPLLPILTVDK  365

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN+  KPLAAYLFT+ KKL++ FV  +SAGGL+INDT +H+AV ++PFGGVGE
Sbjct  366  LEDSFDLINSGAKPLAAYLFTNKKKLKEHFVNTVSAGGLVINDTTVHLAVPSVPFGGVGE  425

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ IIRAL
Sbjct  426  SGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILSIIRAL  485

Query  139  LG  134
             G
Sbjct  486  FG  487



>gb|ERN08786.1| hypothetical protein AMTR_s00017p00253390 [Amborella trichopoda]
Length=416

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWG  +GQACIAPDYIIT K NA +++++ K  L+KFYGKDP  SKDLSRIVNSNHF
Sbjct  171  VVGKWGSNNGQACIAPDYIITEKSNAPKVVESFKSTLEKFYGKDPFESKDLSRIVNSNHF  230

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+ +LDD+KV  KIVHGG+RDEK L IAPT++ D P D+L+M +EIFGPLLPI++V+K
Sbjct  231  ARLSNMLDDEKVCDKIVHGGQRDEKHLMIAPTLIQDAPMDSLVMSDEIFGPLLPIISVDK  290

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++  ++IN+R KPLAAYLFTS+KKLE++FV ++SAGGLL+NDT LH+ + +LPFGGVG+
Sbjct  291  IDESFELINSRAKPLAAYLFTSDKKLEEKFVKSISAGGLLVNDTCLHLTISSLPFGGVGD  350

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL+RSFGGDL ARYPPYTP+K + L++L++ +++ I+  L
Sbjct  351  SGIGAYHGKFSFDIFSHKKAVLRRSFGGDLSARYPPYTPRKQQFLKSLLALDILGILLVL  410

Query  139  LG  134
            +G
Sbjct  411  IG  412



>gb|EYU31773.1| hypothetical protein MIMGU_mgv1a018415mg [Erythranthe guttata]
Length=386

 Score =   344 bits (882),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 202/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWG  SGQ C++PDY+ITTKE A +L+DA+  E++ FYGKDPL S DLS IVNS HF
Sbjct  144  ISGKWGGNSGQTCVSPDYVITTKEYASKLVDALSCEIENFYGKDPLQSNDLSSIVNSRHF  203

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LLDD+ VSGKIV GG+RD+ +LKIAPT+++D P+D+ IM EEIFGPLLPI+TVNK
Sbjct  204  DRLINLLDDETVSGKIVLGGQRDKVKLKIAPTVVLDAPKDSPIMNEEIFGPLLPIITVNK  263

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I++I++++KPLAAYLF+++KKL++EF+T++SAGG++INDT LH+    LPFGGVGE
Sbjct  264  IEDSIRLISSKEKPLAAYLFSNDKKLKEEFITSVSAGGMVINDTNLHLVEPNLPFGGVGE  323

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SGTGSYHG+FSF+AFSHKKAVL+R F GD+ ARYPPY   K   L++L SGNLI ++RAL
Sbjct  324  SGTGSYHGRFSFDAFSHKKAVLQRGFTGDIAARYPPYANWKIDFLKSLFSGNLIGVLRAL  383

Query  139  LG  134
             G
Sbjct  384  FG  385



>ref|XP_011069490.1| PREDICTED: aldehyde dehydrogenase-like [Sesamum indicum]
Length=476

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   SGQ CI+ DY ITTKE A  L+DA+  EL+KFYGKDP+ S DLS I+NS HF
Sbjct  234  IAGKWCYNSGQTCISADYAITTKEYASTLVDALSSELEKFYGKDPVKSNDLSSIINSYHF  293

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLTKLLDD+KVSGKIV GG+RD+  LKIAPTI++D PED+LI+ EEIFGPLLPI+TVNK
Sbjct  294  DRLTKLLDDEKVSGKIVLGGQRDKANLKIAPTIVLDAPEDSLILNEEIFGPLLPIVTVNK  353

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I +I A++KPLAAYLFT++KKL++EF+ ++SAGG+ IN+ ALH    TLPFGGVGE
Sbjct  354  IEDSITLIKAKEKPLAAYLFTNDKKLKEEFIRSVSAGGIAINEIALHALEPTLPFGGVGE  413

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKK+VL+R F GD  ARYPPYTP K + L+A++SG++I I+RAL
Sbjct  414  SGMGSYHGKFSFDAFSHKKSVLQRGFSGDPAARYPPYTPGKLKFLQAMLSGSIIRILRAL  473

Query  139  LG  134
            +G
Sbjct  474  IG  475



>gb|EYU22982.1| hypothetical protein MIMGU_mgv1a005625mg [Erythranthe guttata]
Length=476

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 202/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWGC +GQ C++PDY+ITTKE A +L+DA   E++ FYGKDPL S DLS +VNS HF
Sbjct  234  ISGKWGCNNGQTCVSPDYVITTKEYASKLVDAFACEMENFYGKDPLQSNDLSSVVNSRHF  293

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LLDD+KVSGKIV GG+RD+ +LKIAP+I+++  ED+LIM EEIFGPLLPI+TV+K
Sbjct  294  DRLINLLDDEKVSGKIVLGGQRDKTKLKIAPSIILNPSEDSLIMNEEIFGPLLPIITVDK  353

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I II +++KPLAAYLF++N+KL+ +F++N+S+GG++INDT LH+A  +LPFGGVGE
Sbjct  354  IEDCIGIITSKEKPLAAYLFSNNEKLKNDFISNVSSGGMVINDTTLHLAEASLPFGGVGE  413

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVLKR F GD+  RYPPYT  K   ++A++SGN++ IIRAL
Sbjct  414  SGMGSYHGKFSFDAFSHKKAVLKRGFNGDVSVRYPPYTNGKLNFVKAMLSGNILRIIRAL  473

Query  139  LG  134
             G
Sbjct  474  FG  475



>ref|XP_006304446.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
 gb|EOA37344.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
Length=484

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQAC++PDYI+TTKE A +L+D MK EL+KFYGK+P+ SKD+SRI+NSNHF
Sbjct  241  IAGKWGCNNGQACVSPDYILTTKEYAPKLIDTMKHELEKFYGKNPMESKDMSRIINSNHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLL++  VS KIV+GGE+D ++LKI+PTIL+DVP D+LIM EEIFGP+LPI+TVN 
Sbjct  301  DRLSKLLEEKDVSDKIVYGGEKDREKLKISPTILLDVPLDSLIMSEEIFGPILPIITVNN  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT NKKL+++F   +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  361  LEESFDVIRSRPKPLAAYLFTHNKKLKEKFAMTVSAGGIVVNDIAVHLALHTLPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + L
Sbjct  421  SGMGSYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFDIFKVL  480

Query  139  LGL  131
            LGL
Sbjct  481  LGL  483



>ref|XP_002888606.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64865.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score =   345 bits (884),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/243 (66%), Positives = 200/243 (82%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNS HF
Sbjct  241  IAGKWGCNNGQACISPDYILTTKEYAPKVIDAMKKELETFYGKNPMESKDMSRIVNSTHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+K+LD+ +VS KIV+GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N 
Sbjct  301  DRLSKMLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNN  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  361  LEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + L
Sbjct  421  SGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDIFKVL  480

Query  139  LGL  131
            LGL
Sbjct  481  LGL  483



>ref|XP_011624378.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Amborella 
trichopoda]
Length=524

 Score =   346 bits (887),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWG  +GQACIAPDYIIT K NA +++++ K  L+KFYGKDP  SKDLSRIVNSNHF
Sbjct  279  VVGKWGSNNGQACIAPDYIITEKSNAPKVVESFKSTLEKFYGKDPFESKDLSRIVNSNHF  338

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+ +LDD+KV  KIVHGG+RDEK L IAPT++ D P D+L+M +EIFGPLLPI++V+K
Sbjct  339  ARLSNMLDDEKVCDKIVHGGQRDEKHLMIAPTLIQDAPMDSLVMSDEIFGPLLPIISVDK  398

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++  ++IN+R KPLAAYLFTS+KKLE++FV ++SAGGLL+NDT LH+ + +LPFGGVG+
Sbjct  399  IDESFELINSRAKPLAAYLFTSDKKLEEKFVKSISAGGLLVNDTCLHLTISSLPFGGVGD  458

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL+RSFGGDL ARYPPYTP+K + L++L++ +++ I+  L
Sbjct  459  SGIGAYHGKFSFDIFSHKKAVLRRSFGGDLSARYPPYTPRKQQFLKSLLALDILGILLVL  518

Query  139  LG  134
            +G
Sbjct  519  IG  520



>emb|CBI21614.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   343 bits (881),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACI+PDYIITTK+ A +L+D ++ EL++F+GK+P+ S+D+SRIV+  HF
Sbjct  303  IAGKWACNNGQACISPDYIITTKDFAPKLIDVLRHELEEFFGKNPIESEDMSRIVSVQHF  362

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+LLD+D+VS KI+ GG+ DE +LKIAPTIL+DVPED  IMKEEIFGPLLPILTV  
Sbjct  363  KRLTRLLDEDEVSDKIIIGGQSDENQLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVEN  422

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN++ KPLAAYLF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPFGGVGE
Sbjct  423  LEESFDVINSKSKPLAAYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGE  482

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL R F G+  ARYPPYTP K +LL+ L SGN++ I+ AL
Sbjct  483  SGMGSYHGKFSFDAFSHKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLAL  542

Query  139  LGL  131
            LG 
Sbjct  543  LGF  545



>ref|XP_002273730.2| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Vitis 
vinifera]
Length=549

 Score =   343 bits (881),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACI+PDYIITTK+ A +L+D ++ EL++F+GK+P+ S+D+SRIV+  HF
Sbjct  304  IAGKWACNNGQACISPDYIITTKDFAPKLIDVLRHELEEFFGKNPIESEDMSRIVSVQHF  363

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+LLD+D+VS KI+ GG+ DE +LKIAPTIL+DVPED  IMKEEIFGPLLPILTV  
Sbjct  364  KRLTRLLDEDEVSDKIIIGGQSDENQLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVEN  423

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN++ KPLAAYLF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPFGGVGE
Sbjct  424  LEESFDVINSKSKPLAAYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGE  483

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL R F G+  ARYPPYTP K +LL+ L SGN++ I+ AL
Sbjct  484  SGMGSYHGKFSFDAFSHKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLAL  543

Query  139  LGL  131
            LG 
Sbjct  544  LGF  546



>gb|KJB64495.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=442

 Score =   340 bits (872),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A++L+D+ K EL+ FYGK+PL SKDLSR+VNSNHF
Sbjct  197  IAGKWGCNNGQACISPDYIITTKDYAVELVDSFKCELELFYGKNPLESKDLSRVVNSNHF  256

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD+DKVS KIV+GGERD+  LKIAPTIL+DVP+D+LIM EEIFGPLLPI+T++K
Sbjct  257  ARLLKLLDEDKVSSKIVYGGERDKSNLKIAPTILLDVPQDSLIMNEEIFGPLLPIITIDK  316

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   +I +  KPLAAY+FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+
Sbjct  317  VEDSFDLITSGAKPLAAYMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPFGGVGD  376

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL RSF GD   RYPPYT  K  LL+AL+ G+++ IIRAL
Sbjct  377  SGMGAYHGKFSFDTFSHKKAVLYRSFAGDAPLRYPPYTDGKLGLLKALLGGSILGIIRAL  436

Query  139  LG  134
            +G
Sbjct  437  MG  438



>ref|XP_010664200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Vitis vinifera]
Length=488

 Score =   341 bits (875),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 204/239 (85%), Gaps = 0/239 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KW   +GQACIAPDYI+TTK+ A +L+DA+K EL+ +YGKDPL SKDL+ IVNSNHF+RL
Sbjct  248  KWASNNGQACIAPDYIVTTKDFAPKLIDALKHELEAWYGKDPLESKDLAHIVNSNHFARL  307

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
             KLLDDDKVSGKI+HGG+RD+  LK APTIL+DVPED+L+M EEIFGPLLPILTV+K+ED
Sbjct  308  AKLLDDDKVSGKIIHGGQRDKANLKFAPTILLDVPEDSLVMNEEIFGPLLPILTVDKLED  367

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
               +I +R KPLAAYLFT+NKKL+++FV  +SAGGL+INDT LH A  TLPFGGVGESG 
Sbjct  368  SFDMITSRGKPLAAYLFTNNKKLKEKFVKTVSAGGLVINDTVLHFAEKTLPFGGVGESGM  427

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  134
            GSYHGKFS+EAFSH+K+VL R F GD  ARYPPY+ +K +LL+AL+SG+++ +I AL+G
Sbjct  428  GSYHGKFSYEAFSHRKSVLYRGFAGDASARYPPYSDRKLKLLKALLSGSVVGVILALIG  486



>ref|NP_001065921.1| Os11g0186200 [Oryza sativa Japonica Group]
 gb|AAY23278.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91775.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27766.1| Os11g0186200 [Oryza sativa Japonica Group]
 dbj|BAG96824.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96923.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67818.1| hypothetical protein OsI_35395 [Oryza sativa Indica Group]
 gb|EEE51777.1| hypothetical protein OsJ_33226 [Oryza sativa Japonica Group]
Length=482

 Score =   341 bits (875),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 200/240 (83%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDY+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RL
Sbjct  238  KWGCNNGQACIAPDYVITTKSFAPELVDSLKRVLKRFYGEDPLQSEDLSRIVNSNHFRRL  297

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
            T L++D KV+ KIV+GG+ DEK+LKIAPT+L+DVP D  +M EEIFGPLLPI+TV+K+ED
Sbjct  298  TNLIEDKKVAQKIVYGGQTDEKQLKIAPTVLLDVPLDTTLMAEEIFGPLLPIVTVDKIED  357

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I+ IN+R KPLAAYLFT +KKL++EFV+N+ AGG+L+ND ALH+A   LPFGGVG+SG 
Sbjct  358  SIQFINSRTKPLAAYLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGI  417

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            GSYHGKFSF+ F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+   +I ALLG 
Sbjct  418  GSYHGKFSFDCFTHKKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFALILALLGF  477



>gb|AAX96338.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
Length=494

 Score =   341 bits (875),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 200/240 (83%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDY+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RL
Sbjct  250  KWGCNNGQACIAPDYVITTKSFAPELVDSLKRVLKRFYGEDPLQSEDLSRIVNSNHFRRL  309

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
            T L++D KV+ KIV+GG+ DEK+LKIAPT+L+DVP D  +M EEIFGPLLPI+TV+K+ED
Sbjct  310  TNLIEDKKVAQKIVYGGQTDEKQLKIAPTVLLDVPLDTTLMAEEIFGPLLPIVTVDKIED  369

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I+ IN+R KPLAAYLFT +KKL++EFV+N+ AGG+L+ND ALH+A   LPFGGVG+SG 
Sbjct  370  SIQFINSRTKPLAAYLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGI  429

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            GSYHGKFSF+ F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+   +I ALLG 
Sbjct  430  GSYHGKFSFDCFTHKKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFALILALLGF  489



>ref|XP_010500136.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Camelina 
sativa]
Length=486

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/243 (65%), Positives = 201/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQAC++PDYI+TTKE A +LLDAMK EL+ FYGK P+ SKD+SRIVNSNHF
Sbjct  243  IAGKWGCNNGQACVSPDYILTTKEFAPKLLDAMKHELETFYGKKPMDSKDMSRIVNSNHF  302

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLL++ +VS KIV+GG++D + LKIAPTIL+DVP D+LIM EEIFGPLLPI+T+N 
Sbjct  303  DRLSKLLEEKEVSDKIVYGGDKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPIITLNN  362

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I++R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  363  LEESFDVIHSRPKPLAAYLFTHNQKLKERFAMKVSAGGIVVNDIAVHLALHTLPFGGVGE  422

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + L
Sbjct  423  SGMGAYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFNIFKVL  482

Query  139  LGL  131
            LGL
Sbjct  483  LGL  485



>gb|KJB64493.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=490

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIITTK+ A++L+D+ K EL+ FYGK+PL SKDLSR+VNSNHF
Sbjct  245  IAGKWGCNNGQACISPDYIITTKDYAVELVDSFKCELELFYGKNPLESKDLSRVVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD+DKVS KIV+GGERD+  LKIAPTIL+DVP+D+LIM EEIFGPLLPI+T++K
Sbjct  305  ARLLKLLDEDKVSSKIVYGGERDKSNLKIAPTILLDVPQDSLIMNEEIFGPLLPIITIDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED   +I +  KPLAAY+FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPFGGVG+
Sbjct  365  VEDSFDLITSGAKPLAAYMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPFGGVGD  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSHKKAVL RSF GD   RYPPYT  K  LL+AL+ G+++ IIRAL
Sbjct  425  SGMGAYHGKFSFDTFSHKKAVLYRSFAGDAPLRYPPYTDGKLGLLKALLGGSILGIIRAL  484

Query  139  LG  134
            +G
Sbjct  485  MG  486



>emb|CAE51203.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=480

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 199/243 (82%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQAC++PDYI+TTKE A +L+D MK+EL+KFYGK+P+ SKD+SRIVNSNH 
Sbjct  237  IVGKWGCNNGQACVSPDYILTTKEYAPKLIDDMKLELEKFYGKNPIESKDMSRIVNSNHL  296

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLLD+ +VS KIV+GGE+D + LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N 
Sbjct  297  DRLSKLLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNN  356

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  357  LEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGE  416

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+A SHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  + + L
Sbjct  417  SGMGAYHGKFSFDASSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVL  476

Query  139  LGL  131
            LGL
Sbjct  477  LGL  479



>ref|XP_010461437.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 201/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQAC++PDYI+TTKE A +L+DAMK EL+ FYGK P+ SKD+SRIVNSNHF
Sbjct  242  IAGKWGCNNGQACVSPDYILTTKEFAPKLIDAMKHELETFYGKKPMDSKDMSRIVNSNHF  301

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLL++ +VS KIV+GG++D + LKIAPTIL+DVP D+LIM EEIFGPLLPI+T+N 
Sbjct  302  DRLSKLLEEKEVSDKIVYGGDKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPIITLNN  361

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I++R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  362  LEESFDVIHSRPKPLAAYLFTHNQKLKERFAMTVSAGGIVVNDIAVHLALHTLPFGGVGE  421

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + L
Sbjct  422  SGMGAYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFNIFKVL  481

Query  139  LGL  131
            LGL
Sbjct  482  LGL  484



>ref|XP_004502482.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   340 bits (871),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWGC +GQACI+PDYIITTK+ A  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF
Sbjct  245  ISGKWGCNNGQACISPDYIITTKDFAPLLVDALKTELENFFGKNPLESNDLSRIVSSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KL+D+DKVS KIV+GG +DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK
Sbjct  305  NRLIKLMDEDKVSDKIVYGGAKDESKLRIAPTILLDVPRDSLIMSEEIFGPLLPIITVNK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAYLFT++ K +++FV  +SAGGLLINDT LH+ V TLPFGGVG+
Sbjct  365  LEESFDVINSGTKPLAAYLFTNDNKFKEQFVKKVSAGGLLINDTVLHLVVCTLPFGGVGD  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AF+H+KAVL R F GD   RYPPYT  K + ++AL++G++  I+RAL
Sbjct  425  SGMGAYHGKFSFDAFTHRKAVLYRGFTGDSSLRYPPYTDTKQKCMKALVAGDVPGIVRAL  484

Query  139  LG  134
             G
Sbjct  485  FG  486



>ref|XP_004502483.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=493

 Score =   340 bits (872),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWGC +GQACI+PDYIITTK+ A  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF
Sbjct  250  ISGKWGCNNGQACISPDYIITTKDFAPLLVDALKTELENFFGKNPLESNDLSRIVSSNHF  309

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KL+D+DKVS KIV+GG +DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK
Sbjct  310  NRLIKLMDEDKVSDKIVYGGAKDESKLRIAPTILLDVPRDSLIMSEEIFGPLLPIITVNK  369

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAYLFT++ K +++FV  +SAGGLLINDT LH+ V TLPFGGVG+
Sbjct  370  LEESFDVINSGTKPLAAYLFTNDNKFKEQFVKKVSAGGLLINDTVLHLVVCTLPFGGVGD  429

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AF+H+KAVL R F GD   RYPPYT  K + ++AL++G++  I+RAL
Sbjct  430  SGMGAYHGKFSFDAFTHRKAVLYRGFTGDSSLRYPPYTDTKQKCMKALVAGDVPGIVRAL  489

Query  139  LG  134
             G
Sbjct  490  FG  491



>ref|XP_003577758.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=481

 Score =   339 bits (870),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 197/240 (82%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDYIITTK    +L+D++K  L++FYG+DPL S DLSRIVNS HF R+
Sbjct  237  KWGCNNGQACIAPDYIITTKTFVTELVDSLKRVLERFYGEDPLQSADLSRIVNSKHFHRI  296

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
             KL++D KV+ KIV GG+ DEK+LKIAPT+L+DVP D  +M EEIFGPLLPI+TV+K+E+
Sbjct  297  AKLIEDKKVAEKIVLGGQTDEKQLKIAPTVLVDVPHDTALMTEEIFGPLLPIVTVDKIEE  356

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I+ INA  KPLAAYLF+ NKKL+QEF+ N+S+GG+L+ND ALH+A   LPFGGVG+SGT
Sbjct  357  SIEHINAGTKPLAAYLFSRNKKLQQEFIANVSSGGMLVNDVALHLANPHLPFGGVGDSGT  416

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            GSYHGKF+F+ FSHKKAVL R FGG+  ARYPPYTP+K R+LR L+ G+   +I ALLG 
Sbjct  417  GSYHGKFTFDCFSHKKAVLVRGFGGEANARYPPYTPEKQRILRGLIKGSFFALILALLGF  476



>ref|XP_010479042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   339 bits (870),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/243 (65%), Positives = 200/243 (82%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQAC++PDYI+TTKE A +L+DAMK EL+ FYGK P+ SKD+SRIVNSNHF
Sbjct  242  IAGKWGCNNGQACVSPDYILTTKEFAPKLIDAMKHELETFYGKKPMDSKDMSRIVNSNHF  301

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLL++  VS KIV+GG++D + LKIAPTIL+DVP D+LIM EEIFGPLLPI+T+N 
Sbjct  302  DRLSKLLEEKDVSDKIVYGGDKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPIITLNN  361

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I++R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  362  LEESFDVIHSRPKPLAAYLFTHNQKLKERFAMTVSAGGIVVNDIAVHLALHTLPFGGVGE  421

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I + L
Sbjct  422  SGMGAYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFNIFKVL  481

Query  139  LGL  131
            LGL
Sbjct  482  LGL  484



>ref|XP_006662790.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Oryza brachyantha]
Length=400

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 156/240 (65%), Positives = 199/240 (83%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDY+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RL
Sbjct  155  KWGCNNGQACIAPDYVITTKSFAPELVDSLKRALIRFYGEDPLQSEDLSRIVNSNHFCRL  214

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
            T L++D  VS KIV+GG+ DEK+LKIAPT+L+DVP D+ +M  EIFGPLLPI+TV+K+ED
Sbjct  215  TNLIEDKTVSQKIVYGGQTDEKQLKIAPTVLVDVPLDSALMTSEIFGPLLPIVTVDKIED  274

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I+ IN++ KPLAAYLFT +KKL++ FV+N+ AGG+L+ND ALH+A   LPFGGVG+SG 
Sbjct  275  SIEFINSKTKPLAAYLFTKDKKLQEAFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGI  334

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            GSYHGKFSF+ F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  335  GSYHGKFSFDCFTHKKAVLIRGFGGEAAARYPPYTTEKQKILRGLINGSFIALILALLGF  394



>ref|XP_007213817.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
 gb|EMJ15016.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
Length=451

 Score =   338 bits (866),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   +GQACI  DYIITTK+ A +L++A+K+EL++F+GKDP+ SKD+SR+V+S  F
Sbjct  207  IAGKWALNNGQACIGVDYIITTKDFAPKLIEALKIELEQFFGKDPMNSKDISRVVSSTQF  266

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL K+LD+DKVS KIV GG+ DE +LKIAPTIL+D+PE++ +M+EEIFGPL+PI+TV  
Sbjct  267  KRLAKMLDEDKVSDKIVLGGQMDENQLKIAPTILLDIPEESQLMQEEIFGPLMPIVTVET  326

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN+R KPLA Y+FT+N++L++ FV N+S+GG+LINDT LHV++  LPFGGVGE
Sbjct  327  IEDSFDVINSRPKPLAVYVFTNNEQLKKGFVENISSGGMLINDTVLHVSITGLPFGGVGE  386

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+ FSHKKAVL RSF GD   RYPPYTP+K RLL+A++SG++  II AL
Sbjct  387  SGMGSYHGKFSFDGFSHKKAVLYRSFSGDSSLRYPPYTPEKQRLLKAVISGDIFSIILAL  446

Query  139  LG  134
            +G
Sbjct  447  IG  448



>emb|CDY36336.1| BnaC08g05150D [Brassica napus]
Length=482

 Score =   338 bits (868),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/243 (64%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNSNHF
Sbjct  239  IAGKWGCNNGQACISPDYILTTKEYAPKVIDAMKQELEAFYGKNPMESKDMSRIVNSNHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+K+L++ +VS KIV+GG+++   LKIAPTIL+DVP D+LIM EEIFGPLLPILT+N 
Sbjct  299  DRLSKILEEKEVSDKIVYGGQKNRDNLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNN  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+++ TLPFGGVGE
Sbjct  359  LEECFDVIRSRPKPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPFGGVGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ + + L
Sbjct  419  SGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVEVFKVL  478

Query  139  LGL  131
            LGL
Sbjct  479  LGL  481



>ref|XP_008227590.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=549

 Score =   341 bits (874),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 202/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   +GQACI  DYIITTK+ A +L++A+K+EL++F+GKDP+ SKD+SRIV+S  F
Sbjct  305  IAGKWALNNGQACIGVDYIITTKDFAPKLIEALKIELEQFFGKDPMNSKDISRIVSSTQF  364

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL K+LD+DKVS KIV GG+ DE +LKIAPTIL+D+PE++ +M+EEIFGPL+PI+TV K
Sbjct  365  KRLAKMLDEDKVSDKIVLGGQMDENQLKIAPTILLDIPEESQLMQEEIFGPLMPIVTVEK  424

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN+R KPLA Y+FT+N++L++ FV N+S+GG+LINDT LHV++  LPFGGVGE
Sbjct  425  IEDSFDVINSRPKPLAVYVFTNNEQLKKGFVENISSGGMLINDTVLHVSISGLPFGGVGE  484

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+ FSHKKAVL RSF GD   RYPPYTP+K RLL+A++SG++  II AL
Sbjct  485  SGMGSYHGKFSFDGFSHKKAVLYRSFSGDSSLRYPPYTPEKQRLLKAVISGDIFSIILAL  544

Query  139  LG  134
            +G
Sbjct  545  IG  546



>emb|CBI19000.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 204/239 (85%), Gaps = 0/239 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KW   +GQACIAPDYI+TTK+ A +L+DA+K EL+ +YGKDPL SKDL+ IVNSNHF+RL
Sbjct  310  KWASNNGQACIAPDYIVTTKDFAPKLIDALKHELEAWYGKDPLESKDLAHIVNSNHFARL  369

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
             KLLDDDKVSGKI+HGG+RD+  LK APTIL+DVPED+L+M EEIFGPLLPILTV+K+ED
Sbjct  370  AKLLDDDKVSGKIIHGGQRDKANLKFAPTILLDVPEDSLVMNEEIFGPLLPILTVDKLED  429

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
               +I +R KPLAAYLFT+NKKL+++FV  +SAGGL+INDT LH A  TLPFGGVGESG 
Sbjct  430  SFDMITSRGKPLAAYLFTNNKKLKEKFVKTVSAGGLVINDTVLHFAEKTLPFGGVGESGM  489

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  134
            GSYHGKFS+EAFSH+K+VL R F GD  ARYPPY+ +K +LL+AL+SG+++ +I AL+G
Sbjct  490  GSYHGKFSYEAFSHRKSVLYRGFAGDASARYPPYSDRKLKLLKALLSGSVVGVILALIG  548



>ref|XP_007159875.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
 gb|ESW31869.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
Length=566

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 202/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQACI+ DYIIT KE A +L+ A+K EL++F+GKDPL SKD+SRIV+ N F
Sbjct  323  IASKWACNSGQACISVDYIITRKEFAPKLISALKEELEQFFGKDPLESKDMSRIVSPNQF  382

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD+DKVSGKIV GG+RDEK+LKI+PTI++DVPEDAL+M+EEIFGP++PI+TV+ 
Sbjct  383  ARLVKLLDEDKVSGKIVLGGQRDEKKLKISPTIILDVPEDALVMQEEIFGPIMPIITVDN  442

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   II +R KPLAAYLFT+N++L++++V  +S+GG+LIND  +HVA   LPFGGV E
Sbjct  443  IEDCYSIIKSRPKPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVEE  502

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF++FSH+K VL RSF GD   RYPPYTP+K +LL+A+++GN++ I  AL
Sbjct  503  SGMGCYHGKFSFDSFSHRKPVLYRSFDGDSSIRYPPYTPQKEKLLKAIITGNIVQIFLAL  562

Query  139  LG  134
            LG
Sbjct  563  LG  564



>ref|XP_009107480.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Brassica 
rapa]
Length=482

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 201/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNSNHF
Sbjct  239  IAGKWGCNNGQACISPDYILTTKEYAPKVIDAMKQELEAFYGKNPMESKDMSRIVNSNHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+K+L++ +VS KIV+GG+++   LKIAPTI +DVP D+LIM EEIFGPLLPILT+N 
Sbjct  299  DRLSKILEEKEVSDKIVYGGQKNRDNLKIAPTIFLDVPLDSLIMSEEIFGPLLPILTLNN  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+++ TLPFGGVGE
Sbjct  359  LEECFDVIRSRPKPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPFGGVGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ + + L
Sbjct  419  SGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVEVFKVL  478

Query  139  LGL  131
            LGL
Sbjct  479  LGL  481



>emb|CDY36018.1| BnaA08g04430D [Brassica napus]
Length=482

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 201/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNSNHF
Sbjct  239  IAGKWGCNNGQACISPDYILTTKEYAPKVIDAMKQELEAFYGKNPMESKDMSRIVNSNHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+K+L++ +VS KIV+GG+++   LKIAPTI +DVP D+LIM EEIFGPLLPILT+N 
Sbjct  299  DRLSKILEEKEVSDKIVYGGQKNRDNLKIAPTIFLDVPLDSLIMSEEIFGPLLPILTLNN  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+++ TLPFGGVGE
Sbjct  359  LEECFDVIRSRPKPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPFGGVGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ + + L
Sbjct  419  SGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVEVFKVL  478

Query  139  LGL  131
            LGL
Sbjct  479  LGL  481



>ref|XP_006662789.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Oryza brachyantha]
Length=482

 Score =   337 bits (863),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/240 (65%), Positives = 199/240 (83%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDY+ITTK  A +L+D++K  L +FYG+DPL S+DLSRIVNSNHF RL
Sbjct  237  KWGCNNGQACIAPDYVITTKSFAPELVDSLKRALIRFYGEDPLQSEDLSRIVNSNHFCRL  296

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
            T L++D  VS KIV+GG+ DEK+LKIAPT+L+DVP D+ +M  EIFGPLLPI+TV+K+ED
Sbjct  297  TNLIEDKTVSQKIVYGGQTDEKQLKIAPTVLVDVPLDSALMTSEIFGPLLPIVTVDKIED  356

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I+ IN++ KPLAAYLFT +KKL++ FV+N+ AGG+L+ND ALH+A   LPFGGVG+SG 
Sbjct  357  SIEFINSKTKPLAAYLFTKDKKLQEAFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGI  416

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            GSYHGKFSF+ F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+ I +I ALLG 
Sbjct  417  GSYHGKFSFDCFTHKKAVLIRGFGGEAAARYPPYTTEKQKILRGLINGSFIALILALLGF  476



>ref|XP_009404859.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=487

 Score =   337 bits (863),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 196/241 (81%), Gaps = 0/241 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWGC SGQACIAPDYIITTK  A +L+DA+K+ L+KFYGK+PL S DLSRIVNS+HF
Sbjct  239  VVGKWGCNSGQACIAPDYIITTKAFAPKLVDALKITLEKFYGKNPLGSTDLSRIVNSSHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL  LLD++KVSG IVHGG+ DEK LKIAPT+L+DVP DA IMKEEIFGPLLPI+TV+ 
Sbjct  299  TRLKNLLDEEKVSGTIVHGGQEDEKHLKIAPTLLLDVPSDASIMKEEIFGPLLPIITVDD  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E    +IN++ KPLAAYLFT + KLE++FV  +SAGG+LIND  L      LPFGGVGE
Sbjct  359  LEQSFDVINSKPKPLAAYLFTKDHKLEKKFVKTVSAGGMLINDAILQFTNPHLPFGGVGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHG+FSF+AFSHKKAVL R F G++  RYPPYTP K ++LR L++GN++ ++ AL
Sbjct  419  SGMGSYHGRFSFDAFSHKKAVLSRGFYGEIPMRYPPYTPLKQKVLRGLIAGNILPLLHAL  478

Query  139  L  137
            +
Sbjct  479  V  479



>ref|XP_009145048.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brassica 
rapa]
Length=482

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYI+TTKE + +++DA+K EL+ FYGK+P+ SKD+SRIVNSNHF
Sbjct  239  IAGKWGCNNGQACISPDYILTTKEFSPKVIDALKQELEAFYGKNPMESKDMSRIVNSNHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+K+L++ +VS KIV+GG+++  +LKIAPTIL+DVP D+ IM EEIFGPLLPI+T+N 
Sbjct  299  DRLSKMLEEKEVSDKIVYGGQKNRDKLKIAPTILVDVPLDSQIMSEEIFGPLLPIITLNN  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+AV TLPFGGVGE
Sbjct  359  LEECFDVIRSRPKPLAAYLFTQNQKLKERFALTVSAGGIVVNDIAVHLAVPTLPFGGVGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ N++ I R +
Sbjct  419  SGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPPYSTGKLRLLKALVNSNILEIFRVI  478

Query  139  LGL  131
            LGL
Sbjct  479  LGL  481



>ref|XP_010025727.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW62440.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=545

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 198/241 (82%), Gaps = 0/241 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACIA DYI+TTK  A +L+ A+++ L++F+GK+PL S+D+SRIVN  HF
Sbjct  300  IAGKWACNNGQACIAIDYIVTTKSFAPKLVAALQLTLEEFFGKNPLESQDMSRIVNLYHF  359

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL KLLD+D  S KIV GG+RDE  L+IAPTIL+DVPED+LIM+EEIFGPLLPILTV+ 
Sbjct  360  KRLAKLLDEDGTSDKIVLGGQRDENNLRIAPTILLDVPEDSLIMQEEIFGPLLPILTVDN  419

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG  +IN++ KPLAAYLF+ +  L+++FV N+SAGG+LIND  LH+ V TLPFGGVG+
Sbjct  420  IEDGFHMINSKPKPLAAYLFSDDNGLQKQFVQNISAGGMLINDAVLHLTVPTLPFGGVGD  479

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKK +L RSF GD   RYPPYTP+K RLL+AL+S N+I II AL
Sbjct  480  SGMGAYHGKFSFDAFSHKKGILYRSFKGDASTRYPPYTPEKQRLLKALISFNIIGIILAL  539

Query  139  L  137
            L
Sbjct  540  L  540



>gb|KCW70625.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=479

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 198/242 (82%), Gaps = 9/242 (4%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWG  +GQACIA DYIITTK+           EL+ FYGK+PL SKDLSRIVNS+HF
Sbjct  245  IVGKWGNNNGQACIASDYIITTKDLN---------ELETFYGKNPLESKDLSRIVNSDHF  295

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLTKLLD+DKVS K+V+GGERD  +L+IAPTIL+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  296  TRLTKLLDEDKVSKKVVYGGERDPTKLQIAPTILLDVPRDSLIMNEEIFGPLLPILTVDK  355

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   IIN+  KPLAAY+FT++KKL++ FV N+SAGGL++NDT +H+AVH LPFGGVGE
Sbjct  356  LEESFDIINSGAKPLAAYIFTNDKKLKEHFVNNVSAGGLVVNDTTVHLAVHALPFGGVGE  415

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAV+ RSF GD   RYPPYT  K RL++AL+ G+++ I+RAL
Sbjct  416  SGIGAYHGKFSFDAFSHKKAVVYRSFMGDAAIRYPPYTNGKLRLMKALLGGSILGILRAL  475

Query  139  LG  134
             G
Sbjct  476  FG  477



>ref|XP_010025726.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW62439.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=550

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 198/241 (82%), Gaps = 0/241 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACIA DYI+TTK  A +L+ A+++ L++F+GK+PL S+D+SRIVN  HF
Sbjct  305  IAGKWACNNGQACIAIDYIVTTKSFAPKLVAALQLTLEEFFGKNPLESQDMSRIVNLYHF  364

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL KLLD+D  S KIV GG+RDE  L+IAPTIL+DVPED+LIM+EEIFGPLLPILTV+ 
Sbjct  365  KRLAKLLDEDGTSDKIVLGGQRDENNLRIAPTILLDVPEDSLIMQEEIFGPLLPILTVDN  424

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG  +IN++ KPLAAYLF+ +  L+++FV N+SAGG+LIND  LH+ V TLPFGGVG+
Sbjct  425  IEDGFHMINSKPKPLAAYLFSDDNGLQKQFVQNISAGGMLINDAVLHLTVPTLPFGGVGD  484

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKK +L RSF GD   RYPPYTP+K RLL+AL+S N+I II AL
Sbjct  485  SGMGAYHGKFSFDAFSHKKGILYRSFKGDASTRYPPYTPEKQRLLKALISFNIIGIILAL  544

Query  139  L  137
            L
Sbjct  545  L  545



>gb|KDO52216.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=507

 Score =   335 bits (859),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 199/242 (82%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   +GQACI  DYIITTK+ A +L+D+++ EL +F+GK+P+ SKDLSRIVN  HF
Sbjct  262  IAGKWMANNGQACIGVDYIITTKDFAPKLIDSLRNELKEFFGKNPMESKDLSRIVNPFHF  321

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL  LLD+DKVS KIV+GG+RDEK+LKIAPTIL+DVP+D+ IMKEEIFGPLLPI+TV K
Sbjct  322  ARLASLLDEDKVSDKIVYGGQRDEKQLKIAPTILLDVPDDSTIMKEEIFGPLLPIVTVEK  381

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +I ++ KPLAAY F+ ++++++EFV N+SAGG++ NDT +H  V +LPFGGVGE
Sbjct  382  IEDSFDVIKSKPKPLAAYFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPFGGVGE  441

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYT +K +LLRAL +GN+  ++ AL
Sbjct  442  SGMGSYHGKFSFDAFSHKKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFGLLLAL  501

Query  139  LG  134
            +G
Sbjct  502  IG  503



>gb|KCW70623.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=514

 Score =   335 bits (858),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/268 (62%), Positives = 205/268 (76%), Gaps = 26/268 (10%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLL--------------------------DAMK  758
            I  KWG  +GQACIA DYIITTK+ A +L+                          D +K
Sbjct  245  IVGKWGNNNGQACIASDYIITTKDLAPKLVRLPYPHVLVFSLYGVVSCTLPYLFQVDVLK  304

Query  757  VELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTIL  578
             EL+ FYGK+PL SKDLSRIVNS+HF+RLTKLLD+DKVS K+V+GGERD  +L+IAPTIL
Sbjct  305  NELETFYGKNPLESKDLSRIVNSDHFTRLTKLLDEDKVSKKVVYGGERDPTKLQIAPTIL  364

Query  577  MDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNL  398
            +DVP D+LIM EEIFGPLLPILTV+K+E+   IIN+  KPLAAY+FT++KKL++ FV N+
Sbjct  365  LDVPRDSLIMNEEIFGPLLPILTVDKLEESFDIINSGAKPLAAYIFTNDKKLKEHFVNNV  424

Query  397  SAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARY  218
            SAGGL++NDT +H+AVH LPFGGVGESG G+YHGKFSF+AFSHKKAV+ RSF GD   RY
Sbjct  425  SAGGLVVNDTTVHLAVHALPFGGVGESGIGAYHGKFSFDAFSHKKAVVYRSFMGDAAIRY  484

Query  217  PPYTPKKARLLRALMSGNLIFIIRALLG  134
            PPYT  K RL++AL+ G+++ I+RAL G
Sbjct  485  PPYTNGKLRLMKALLGGSILGILRALFG  512



>ref|XP_008387507.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Malus domestica]
Length=550

 Score =   336 bits (861),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 199/242 (82%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW   +GQACI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F
Sbjct  306  MAGKWALNNGQACIGVDYIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQF  365

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD+DKVS KIV GG+ DEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K
Sbjct  366  TRLAKLLDEDKVSNKIVLGGQMDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEK  425

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN++ KPLA Y FT+N++L++ FV N+S+GG+LINDT LHV++  LPFGGVGE
Sbjct  426  IEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGE  485

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+ FSHKKAVL R F GD   RYPPYTP+K RL RA+++G++  II AL
Sbjct  486  SGMGSYHGKFSFDGFSHKKAVLYRGFAGDSDLRYPPYTPEKQRLFRAVINGDIFTIILAL  545

Query  139  LG  134
            +G
Sbjct  546  IG  547



>gb|KFK24209.1| hypothetical protein AALP_AAs42301U000200 [Arabis alpina]
Length=483

 Score =   333 bits (855),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/243 (64%), Positives = 199/243 (82%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYI+TTK+ A +L+DAMK EL+ FYGK+P+ SKD+SRIVNSNHF
Sbjct  240  IAGKWGCNNGQACISPDYILTTKDYAPKLIDAMKNELEAFYGKNPMESKDMSRIVNSNHF  299

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+K+L++ +VS KIV GG++D + LKIAPTIL+DVP D+L+M EEIFGPLLPILTVN 
Sbjct  300  DRLSKMLEEKEVSDKIVLGGQKDRENLKIAPTILLDVPLDSLMMSEEIFGPLLPILTVNN  359

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+A+ TLPFGGVGE
Sbjct  360  LEESFDVIRSRPKPLAAYLFTQNEKLKERFANTVSAGGIVVNDIAVHLALPTLPFGGVGE  419

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL +SF GD   RY PY+  K RLL+AL++ NL+ + + L
Sbjct  420  SGMGSYHGKFSFDAFSHKKAVLYKSFLGDSTVRYAPYSRGKLRLLKALVNSNLLEVFKVL  479

Query  139  LGL  131
             G 
Sbjct  480  FGF  482



>ref|XP_008367720.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=560

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 199/242 (82%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW   +GQACI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F
Sbjct  316  MAGKWALNNGQACIGVDYIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQF  375

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD+DKVS KIV GG+ DEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K
Sbjct  376  TRLAKLLDEDKVSNKIVLGGQMDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEK  435

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN++ KPLA Y FT+N++L++ FV N+S+GG+LINDT LHV++  LPFGGVGE
Sbjct  436  IEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGE  495

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+ FSHKKAVL R F GD   RYPPYTP+K RL RA+++G++  II AL
Sbjct  496  SGMGSYHGKFSFDGFSHKKAVLYRGFAGDSDLRYPPYTPEKQRLFRAVINGDIFTIILAL  555

Query  139  LG  134
            +G
Sbjct  556  IG  557



>gb|KDO52215.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=543

 Score =   335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 199/242 (82%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   +GQACI  DYIITTK+ A +L+D+++ EL +F+GK+P+ SKDLSRIVN  HF
Sbjct  298  IAGKWMANNGQACIGVDYIITTKDFAPKLIDSLRNELKEFFGKNPMESKDLSRIVNPFHF  357

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL  LLD+DKVS KIV+GG+RDEK+LKIAPTIL+DVP+D+ IMKEEIFGPLLPI+TV K
Sbjct  358  ARLASLLDEDKVSDKIVYGGQRDEKQLKIAPTILLDVPDDSTIMKEEIFGPLLPIVTVEK  417

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +I ++ KPLAAY F+ ++++++EFV N+SAGG++ NDT +H  V +LPFGGVGE
Sbjct  418  IEDSFDVIKSKPKPLAAYFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPFGGVGE  477

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYT +K +LLRAL +GN+  ++ AL
Sbjct  478  SGMGSYHGKFSFDAFSHKKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFGLLLAL  537

Query  139  LG  134
            +G
Sbjct  538  IG  539



>ref|XP_003532071.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Glycine max]
 gb|KHN16935.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Glycine 
soja]
Length=541

 Score =   335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQACI+ DYIIT KE A +L+DA+K EL++F+GKDP+ SKD+SRIV+ N F
Sbjct  298  IAGKWACNSGQACISVDYIITRKEFAPKLVDALKEELEQFFGKDPMESKDMSRIVSPNQF  357

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL  LLD+DKVS KIV GG+RDEK+LKIAPTI++ VPEDA+IM+EEIFGP++PI+TV+ 
Sbjct  358  ARLVNLLDEDKVSDKIVLGGQRDEKKLKIAPTIILGVPEDAMIMQEEIFGPIMPIVTVDN  417

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   II ++ KPLAAYLFT+N++L++++V  +S+GG+LIND  +HVA   LPFGGV E
Sbjct  418  IEDCYSIIKSKPKPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVEE  477

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF++FSH+K+VL RSF  D   RYPPYTP+K +LL+AL+SGN++ II +L
Sbjct  478  SGMGCYHGKFSFDSFSHRKSVLYRSFDADSTIRYPPYTPQKEKLLKALISGNIVQIILSL  537

Query  139  LG  134
            LG
Sbjct  538  LG  539



>ref|XP_009355863.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=560

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW   +GQACI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F
Sbjct  316  MAGKWALNNGQACIGVDYIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQF  375

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD+DKVS KIV GG+RDEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K
Sbjct  376  TRLAKLLDEDKVSNKIVLGGQRDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEK  435

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN++ KPLA Y FT+N++L++ FV N+S+GG+LINDT LHV++  LPFGGVGE
Sbjct  436  IEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGE  495

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+ FSHKKAVL R FGGD   RYPPYTP+K RL +A+++ +++ II +L
Sbjct  496  SGMGSYHGKFSFDGFSHKKAVLYRGFGGDSDLRYPPYTPEKQRLFKAVINRDILTIILSL  555

Query  139  LG  134
            +G
Sbjct  556  IG  557



>gb|EAZ19830.1| hypothetical protein OsJ_35414 [Oryza sativa Japonica Group]
Length=464

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 196/242 (81%), Gaps = 0/242 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACI+PD+IITTK  A +LL+A++  L+KFYG+DPL S DLSRIVNSNHF+
Sbjct  219  AGKWGCNNGQACISPDFIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFN  278

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL KL+DD+ VS KIV GG+RDE +LKIAPTI MDVP D+ IMKEEIFGPLLPI+TV+K+
Sbjct  279  RLKKLMDDENVSDKIVFGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKI  338

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  K LAAYLFT + KL++++   +SAGG+L+NDTA+H+    LPFGGVGES
Sbjct  339  HESFALINSMTKALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGES  398

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G G+YHG+FSFEAFSHKKAVL R F G+  ARYPPY+P K ++LR ++ GNL  +I+A+L
Sbjct  399  GMGAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAIL  458

Query  136  GL  131
            G 
Sbjct  459  GF  460



>gb|EAY82454.1| hypothetical protein OsI_37671 [Oryza sativa Indica Group]
Length=464

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 196/242 (81%), Gaps = 0/242 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACI+PD+IITTK  A +LL+A++  L+KFYG+DPL S DLSRIVNSNHF+
Sbjct  219  AGKWGCNNGQACISPDFIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFN  278

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL KL+DD+ VS KIV GG+RDE +LKIAPTI MDVP D+ IMKEEIFGPLLPI+TV+K+
Sbjct  279  RLKKLMDDENVSDKIVFGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKI  338

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  K LAAYLFT + KL++++   +SAGG+L+NDTA+H+    LPFGGVGES
Sbjct  339  HESFALINSMTKALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGES  398

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G G+YHG+FSFEAFSHKKAVL R F G+  ARYPPY+P K ++LR ++ GNL  +I+A+L
Sbjct  399  GMGAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAIL  458

Query  136  GL  131
            G 
Sbjct  459  GF  460



>ref|XP_004502485.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cicer 
arietinum]
Length=486

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 198/242 (82%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWGC +GQACI+PDYIITTK+ +  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF
Sbjct  245  ISGKWGCNNGQACISPDYIITTKDFSPLLVDALKTELENFFGKNPLESNDLSRIVSSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL KL+D+DKVS KIV+GG +DE +L+IAPTIL+D P D+LIM EEIFGPLLPI+TVNK
Sbjct  305  HRLIKLMDEDKVSDKIVYGGAKDESKLRIAPTILLDTPRDSLIMSEEIFGPLLPIITVNK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +IN+  KPLAAYLFT++ K +++FV  +SAGGL+IND+ LH    TLPFGGVG+
Sbjct  365  LEESFDVINSGTKPLAAYLFTNDNKFKEQFVKKVSAGGLVINDSVLHFVACTLPFGGVGD  424

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AF+H+KAVL R F GD   RYPPYT KK + ++AL++G++  ++RAL
Sbjct  425  SGMGAYHGKFSFDAFTHRKAVLYRGFTGDSSLRYPPYTDKKQKCMKALVAGDVPGLVRAL  484

Query  139  LG  134
             G
Sbjct  485  FG  486



>ref|XP_006432086.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006464930.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR45326.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
Length=543

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 199/242 (82%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   +GQACI  DYIITTK+ A +L+D+++ EL +F+GK+P+ SKDLSRIVN  HF
Sbjct  298  IAGKWMANNGQACIGVDYIITTKDFAPKLIDSLRNELKEFFGKNPMESKDLSRIVNPFHF  357

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL  LLD+DKVS KIV+GG+RDEK+LKIAPTIL+DVP+D+ IMKEEIFGPLLPI+TV K
Sbjct  358  ARLASLLDEDKVSDKIVYGGQRDEKQLKIAPTILLDVPDDSTIMKEEIFGPLLPIVTVEK  417

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +I ++ KPLAAY F+ ++++++EFV N+SAGG++ NDT +H  V +LPFGGVGE
Sbjct  418  IEDSFDVIKSKPKPLAAYFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPFGGVGE  477

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYT +K +LLRAL +GN+  ++ AL
Sbjct  478  SGMGSYHGKFSFDAFSHKKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFGLLLAL  537

Query  139  LG  134
            +G
Sbjct  538  IG  539



>gb|ABA96616.1| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=484

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 196/242 (81%), Gaps = 0/242 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACI+PD+IITTK  A +LL+A++  L+KFYG+DPL S DLSRIVNSNHF+
Sbjct  239  AGKWGCNNGQACISPDFIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFN  298

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL KL+DD+ VS KIV GG+RDE +LKIAPTI MDVP D+ IMKEEIFGPLLPI+TV+K+
Sbjct  299  RLKKLMDDENVSDKIVFGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKI  358

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  K LAAYLFT + KL++++   +SAGG+L+NDTA+H+    LPFGGVGES
Sbjct  359  HESFALINSMTKALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGES  418

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G G+YHG+FSFEAFSHKKAVL R F G+  ARYPPY+P K ++LR ++ GNL  +I+A+L
Sbjct  419  GMGAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAIL  478

Query  136  GL  131
            G 
Sbjct  479  GF  480



>ref|XP_006393739.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
 gb|ESQ31025.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
Length=483

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 201/243 (83%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWGC +GQACI+PDYI+TTKE A +++DA+K EL+ FYGK+P+ SKD+SRIVNSNHF
Sbjct  240  ISGKWGCNNGQACISPDYILTTKEYAPKVIDALKHELEGFYGKNPMESKDMSRIVNSNHF  299

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLL++ +VS +IV+GG+++ + LKIAPTIL+DVP D+ IM EEIFGPLLPILT+N 
Sbjct  300  DRLSKLLEEKEVSERIVYGGQKNRESLKIAPTILLDVPLDSQIMNEEIFGPLLPILTLNN  359

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+A+ TLPFGGVGE
Sbjct  360  LEECFDVIRSRPKPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLALPTLPFGGVGE  419

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ N++   + L
Sbjct  420  SGMGSYHGKFSFDAFSHKKAVLYKSFFGDSAIRYPPYSRGKLRLLKALVNSNIVEFFKVL  479

Query  139  LGL  131
            LGL
Sbjct  480  LGL  482



>gb|ABR16899.1| unknown [Picea sitchensis]
Length=556

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 200/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWG  +GQACI+PDY+IT +  A +L+DA+KV L+KF+GKDP  S DLSRIVN +HF
Sbjct  312  IAGKWGSNNGQACISPDYVITLESFAPKLIDALKVTLEKFFGKDPFQSADLSRIVNFSHF  371

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RLT+LLDD KVS K+++GG+RDEKRL IAPT+L+D P D+LIM EEIFGPLLPI+TV K
Sbjct  372  ARLTRLLDDPKVSDKVIYGGQRDEKRLIIAPTLLLDAPMDSLIMTEEIFGPLLPIITVQK  431

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+ ++++++  KPLAAYLFT NK  E++ V ++SAGG+++NDTALH+  H LPFGGVGE
Sbjct  432  MEEALEVVSSLPKPLAAYLFTKNKMFERQVVASISAGGMVVNDTALHLVNHHLPFGGVGE  491

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSFE FSH+KAVL R F GDL ARYPPYT +K +++R L++G+ + ++ AL
Sbjct  492  SGMGAYHGKFSFENFSHRKAVLYRGFMGDLMARYPPYTRRKQKIVRCLLNGDFLGLLYAL  551

Query  139  LG  134
            +G
Sbjct  552  IG  553



>ref|XP_010444975.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like, 
partial [Camelina sativa]
Length=256

 Score =   322 bits (825),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/243 (62%), Positives = 191/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACI  DY+IT K+ +L+L+DA+K EL  F+G+ PL SKDLSRIVNS HF
Sbjct  9    IAGKWACNNGQACIGVDYVITKKDFSLKLIDALKTELKTFFGETPLESKDLSRIVNSFHF  68

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ V+ KIVHGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K
Sbjct  69   KRLESMLKENGVANKIVHGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEK  128

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT+NK+L+++FV ++SAGG+ INDT LHV V  LPFGGVGE
Sbjct  129  IEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPFGGVGE  188

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A 
Sbjct  189  SGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAF  248

Query  139  LGL  131
             G 
Sbjct  249  FGF  251



>ref|XP_010437649.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like, 
partial [Camelina sativa]
Length=308

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 192/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACI  DY+ITTK+ +L+L+DA+K EL  F+G+ PL SKDLSRIVNS HF
Sbjct  61   IAGKWACNNGQACIGVDYVITTKDFSLKLIDALKTELKTFFGETPLESKDLSRIVNSFHF  120

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ V+ KIVHGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K
Sbjct  121  KRLESMLKENGVANKIVHGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEK  180

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT+NK+L+++FV ++SAGG+ INDT LHV V  LPFGGVGE
Sbjct  181  IEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPFGGVGE  240

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A 
Sbjct  241  SGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAF  300

Query  139  LGL  131
             G 
Sbjct  301  FGF  303



>ref|NP_001168661.1| hypothetical protein [Zea mays]
 gb|ACN29088.1| unknown [Zea mays]
 tpg|DAA38941.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=478

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 195/243 (80%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWGC +GQACIAPDYIITTK  A +L+ ++K  L++FYG+DPL S DLSRIVNS HF
Sbjct  231  VVGKWGCNNGQACIAPDYIITTKSFAPELVASLKRVLERFYGEDPLQSADLSRIVNSKHF  290

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+L+++  V+ KIV+GGE DEK+LKIAPT+L+DVP+D+ IM  EIFGPLLPI+TV K
Sbjct  291  RRLTELIEEKSVADKIVYGGEVDEKQLKIAPTLLLDVPQDSAIMTGEIFGPLLPIVTVEK  350

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +INAR KPLAAYLFT NKKL++EFV ++ AGG+L+NDT LH+A   +PFGGVG+
Sbjct  351  IEESFDLINARPKPLAAYLFTKNKKLQEEFVADVPAGGMLVNDTVLHLANPYMPFGGVGD  410

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKF F+ FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I AL
Sbjct  411  SGMGCYHGKFGFDCFSHKKGVLVRGFGGEANARYPPYTTEKQKILRGLINGSFIALILAL  470

Query  139  LGL  131
            LG 
Sbjct  471  LGF  473



>ref|XP_006663868.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like, partial 
[Oryza brachyantha]
Length=479

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 195/242 (81%), Gaps = 0/242 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACI+PD+IITTK  A +LL+A++  L+KFYGKDPL S DLSRIVNSNHF+
Sbjct  234  AGKWGCNNGQACISPDFIITTKSFAPKLLEALEKVLEKFYGKDPLRSSDLSRIVNSNHFN  293

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL +L+DD+ VS KIV GG+R E  LKIAPTI MDVP D++IMKEEIFGPLLPI+TV+K+
Sbjct  294  RLKRLMDDESVSDKIVFGGQRSEHLLKIAPTIFMDVPLDSVIMKEEIFGPLLPIITVDKI  353

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             + + +IN+  KPLAAYLFT + KL++++V  +SAGG+L+NDTA+H+    LPFGGVGES
Sbjct  354  HESLALINSMTKPLAAYLFTKDSKLQEQYVAAISAGGMLVNDTAVHLTNQYLPFGGVGES  413

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G G+YHG FSFEAFSHKKAVL R F  +  ARYPPY+  K ++LR ++ GNL  +I+A+L
Sbjct  414  GMGAYHGSFSFEAFSHKKAVLVRGFACEAAARYPPYSMAKLKILRGVLKGNLGAMIQAIL  473

Query  136  GL  131
            G 
Sbjct  474  GF  475



>ref|XP_011031097.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=553

 Score =   331 bits (849),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 199/242 (82%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   +GQACI+ DYIITTK+ A +L+DA++  +++F+G DP+ SK +SRIV+SNHF
Sbjct  308  IAGKWQLNNGQACISVDYIITTKDFAPKLIDALRNGIEEFFGADPMESKYISRIVSSNHF  367

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL +LLD+DKV  KIV GG+R++K+LKIAPTI +DVPED+ +M+EEIFGPLLPI+TV  
Sbjct  368  SRLERLLDEDKVCNKIVVGGQRNQKKLKIAPTIFLDVPEDSQLMQEEIFGPLLPIITVEN  427

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
             +D I +IN++ +PL AYLFT+N+KL  +FV N+S GG++INDT LHV V +LPFGGVGE
Sbjct  428  AKDSIDLINSKPEPLVAYLFTNNQKLRNDFVQNVSCGGMVINDTVLHVTVSSLPFGGVGE  487

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP+  +L+RA+M+G ++ II AL
Sbjct  488  SGMGSYHGKFSFDAFSHKKAVLYRSFSGDSPVRYPPYTPENKKLMRAVMNGGILDIILAL  547

Query  139  LG  134
            +G
Sbjct  548  MG  549



>ref|XP_010674356.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=550

 Score =   331 bits (848),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 193/237 (81%), Gaps = 0/237 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQ C A DY+ITTK+ A QL+ A++ ELDKF+GKD + SKD+SR+VNS HF
Sbjct  305  IAGKWSCNSGQTCTAADYVITTKDFAPQLIAALRSELDKFFGKDHMESKDMSRVVNSYHF  364

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KL+++D VS KIV GG+ +  +LKIAPT+L+D PED+L+M EEIFGPLLPI+TV K
Sbjct  365  TRLMKLMEEDGVSDKIVLGGKTNAMQLKIAPTVLLDAPEDSLLMTEEIFGPLLPIVTVEK  424

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED  ++I ++ KPLAAYLFT+N+KL+ EF+ ++SAGG+LINDT LH+ V TLPFGGVGE
Sbjct  425  IEDSFEVIKSKPKPLAAYLFTNNEKLKTEFIKDISAGGMLINDTILHLTVSTLPFGGVGE  484

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  149
            SG G YHGKFSFEAFSHKKAV+ RSF GD   RYPPYT KK  LL+ALMSG++  II
Sbjct  485  SGMGYYHGKFSFEAFSHKKAVMYRSFEGDSSIRYPPYTSKKLNLLKALMSGSIFRII  541



>ref|XP_010674357.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   330 bits (847),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 193/237 (81%), Gaps = 0/237 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQ C A DY+ITTK+ A QL+ A++ ELDKF+GKD + SKD+SR+VNS HF
Sbjct  304  IAGKWSCNSGQTCTAADYVITTKDFAPQLIAALRSELDKFFGKDHMESKDMSRVVNSYHF  363

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KL+++D VS KIV GG+ +  +LKIAPT+L+D PED+L+M EEIFGPLLPI+TV K
Sbjct  364  TRLMKLMEEDGVSDKIVLGGKTNAMQLKIAPTVLLDAPEDSLLMTEEIFGPLLPIVTVEK  423

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED  ++I ++ KPLAAYLFT+N+KL+ EF+ ++SAGG+LINDT LH+ V TLPFGGVGE
Sbjct  424  IEDSFEVIKSKPKPLAAYLFTNNEKLKTEFIKDISAGGMLINDTILHLTVSTLPFGGVGE  483

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  149
            SG G YHGKFSFEAFSHKKAV+ RSF GD   RYPPYT KK  LL+ALMSG++  II
Sbjct  484  SGMGYYHGKFSFEAFSHKKAVMYRSFEGDSSIRYPPYTSKKLNLLKALMSGSIFRII  540



>sp|Q8VXQ2.1|ALDH_CRAPL RecName: Full=Aldehyde dehydrogenase; AltName: Full=Cp-ALDH [Craterostigma 
plantagineum]
 emb|CAC84900.1| aldehyde dehydrogenase [Craterostigma plantagineum]
Length=479

 Score =   328 bits (841),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 193/242 (80%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KW   SGQ CI+PDYIITT+ENA +L+DA+K EL+ FYGKDPL S+D+S I+N   F
Sbjct  235  ISWKWSGNSGQTCISPDYIITTEENAPKLVDAIKCELESFYGKDPLKSQDMSSIINERQF  294

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             R+T LLDD KVS KIV+GG+ D+  LKIAPTIL+DV ED+ +M EEIFGPLLPI+TV K
Sbjct  295  ERMTGLLDDKKVSDKIVYGGQSDKSNLKIAPTILLDVSEDSSVMSEEIFGPLLPIITVGK  354

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+  KII ++ KPLAAYLFT++KK  +EFV+N+SAGG+ IND ALH     LPFGGVGE
Sbjct  355  IEECYKIIASKPKPLAAYLFTNDKKRTEEFVSNVSAGGITINDIALHFLEPRLPFGGVGE  414

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKK+VLKRSFGG++ ARYPPY P K   + A++ G++  +++A 
Sbjct  415  SGMGSYHGKFSFDAFSHKKSVLKRSFGGEVAARYPPYAPWKLHFMEAILQGDIFGLLKAW  474

Query  139  LG  134
            LG
Sbjct  475  LG  476



>ref|XP_010539000.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Tarenaya 
hassleriana]
Length=482

 Score =   328 bits (841),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 194/232 (84%), Gaps = 0/232 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQAC++PDYI+TTK++A +++D +K EL+ FYGK+P+ SKDLSRIVNSNHF
Sbjct  239  IAGKWGCNNGQACVSPDYILTTKDHAPKVIDVLKHELEAFYGKNPMESKDLSRIVNSNHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL ++LD+DKV+ KIV+ G++D   LKIAPTIL+DVP D+LIM EEIFGPLLPILT+  
Sbjct  299  DRLARILDEDKVADKIVYRGQKDRANLKIAPTILLDVPRDSLIMNEEIFGPLLPILTLEN  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN+  KPLAAYLFT++KKL+++F   +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  359  LEDSFDVINSGSKPLAAYLFTNDKKLKEKFARIVSAGGVVVNDIAVHLALHTLPFGGVGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGN  164
            SG GSYHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL++ N
Sbjct  419  SGMGSYHGKFSFDAFSHKKAVLYRSLLGDASMRYPPYSRWKLRLLKALVNRN  470



>gb|AET04825.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=543

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 197/242 (81%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQ CI+ DYIITTK+ A  L+DA+K EL++F+GKD + SKD+SRIV+   +
Sbjct  298  IAGKWACNSGQTCISVDYIITTKDFAPTLVDALKEELEQFFGKDLIESKDMSRIVSPTQY  357

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD+DKVS KIV GG+RDEK+LKIAPTIL+DVP++A++M+EEIFGP+LPI+TV+ 
Sbjct  358  ARLVKLLDEDKVSDKIVLGGQRDEKKLKIAPTILLDVPQEAMVMQEEIFGPILPIITVDS  417

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   II +R KPLAAYLFT+N++L++++V  +S+GG+LIND  +HVA   LPFGGVGE
Sbjct  418  IEDSFSIIQSRPKPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGGVGE  477

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF++FSHKK+VL ++F  D   RYPPYTP+K  +LRA+  GN+  II AL
Sbjct  478  SGMGCYHGKFSFDSFSHKKSVLYKTFDSDPSIRYPPYTPEKENILRAIFGGNIFQIILAL  537

Query  139  LG  134
            LG
Sbjct  538  LG  539



>dbj|BAK01937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 195/240 (81%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDYIITTK    +L+D++K  L++FYG+DPL S DLSRIVN +HF RL
Sbjct  245  KWGCNNGQACIAPDYIITTKAFVTELVDSLKRVLERFYGEDPLQSADLSRIVNISHFHRL  304

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
             KLLDD KV+ KI+ GG+ D ++LKIAPT+L+DVP D  +MK EIFGP+LPI+TV+K+E+
Sbjct  305  AKLLDDKKVAEKILLGGQTDMEQLKIAPTVLVDVPLDTELMKGEIFGPMLPIITVDKIEE  364

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
            GI  INA  KPLAAYLFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPFGGVG+SGT
Sbjct  365  GITHINAGAKPLAAYLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPFGGVGDSGT  424

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            GSYHGKFSF+ F+H+KAVL R FGG+  ARYPPYT +K R+LR L+ G+   +I ALLG 
Sbjct  425  GSYHGKFSFDCFTHRKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFALILALLGF  484



>emb|CAC84903.1| aldehyde dehydrogenase [Arabidopsis thaliana]
Length=550

 Score =   328 bits (841),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 191/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQACI  DY+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF
Sbjct  304  IAGKWACNSGQACIGVDYVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHF  363

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ V+ KIVHGG   E +LKI+PTIL+DVPE + +M+EEIFGPLLPI+TV K
Sbjct  364  KRLESMLKENGVANKIVHGGRITEDKLKISPTILLDVPEASSMMQEEIFGPLLPIITVQK  423

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT+NK+LE++FV ++SAGG+ INDT LHV V  LPFGGVGE
Sbjct  424  IEDGFQVIRSKSKPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGE  483

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A 
Sbjct  484  SGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNMFAAILAF  543

Query  139  LGL  131
             G 
Sbjct  544  FGF  546



>ref|XP_002307060.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
 gb|EEE94056.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
Length=488

 Score =   326 bits (836),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 197/242 (81%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   +GQACI+ DYII TK+ A +L+DA++  +++F+G DP+ SK +SRIV+SNHF
Sbjct  243  IAGKWQLNNGQACISVDYIIATKDFAPKLIDALRNGIEEFFGADPMESKYISRIVSSNHF  302

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL +LLD+ KV  KIV GG+R++K+LKIAPTI +DVPED+ +M+EEIFGPLLPI+TV  
Sbjct  303  SRLERLLDEYKVFNKIVVGGQRNQKKLKIAPTIFLDVPEDSQLMQEEIFGPLLPIITVEN  362

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            V+D I +IN++ +PL AYLFT+N+KL  +FV N+S GG++INDT LHV V +LPFGGVGE
Sbjct  363  VKDSIDLINSKPEPLVAYLFTNNQKLRNDFVQNVSCGGMVINDTVLHVTVSSLPFGGVGE  422

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP+  +L+RA+M+G +  II AL
Sbjct  423  SGMGSYHGKFSFDAFSHKKAVLYRSFSGDSPVRYPPYTPENKKLMRAVMNGGIFDIILAL  482

Query  139  LG  134
            +G
Sbjct  483  MG  484



>ref|XP_004503900.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=534

 Score =   327 bits (839),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 198/242 (82%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQACI+ D+IIT K+ A +L++A+K EL+ F+GK+P+ SKD+SRIV+   F
Sbjct  290  IAGKWACNSGQACISVDHIITRKDFAPKLINALKEELEIFFGKNPMESKDMSRIVSPMQF  349

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL +LLD+DKVS KIV GG+RDEK+LKIAPTIL+DVPE+A++M+EEIFGP++PI+TV+ 
Sbjct  350  SRLVRLLDEDKVSDKIVLGGQRDEKKLKIAPTILLDVPEEAMVMQEEIFGPIMPIITVDN  409

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   II +R KPLAAYLFT+N++L++E+V  +S+GG+LIND  +HVA   LPFGGV E
Sbjct  410  IEDSFSIIKSRPKPLAAYLFTNNEQLKKEYVDKISSGGMLINDAVIHVATRGLPFGGVEE  469

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKF+F++FSHKK+VL +SF  D   RYPPYTP+K +LLRA++ GN+  II AL
Sbjct  470  SGMGCYHGKFTFDSFSHKKSVLYKSFDADPSIRYPPYTPQKEKLLRAILGGNIFDIILAL  529

Query  139  LG  134
             G
Sbjct  530  FG  531



>emb|CAB36701.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 emb|CAB80141.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=533

 Score =   327 bits (839),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 191/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQACI  DY+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF
Sbjct  287  IAGKWACNSGQACIGVDYVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHF  346

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ V+ KIVHGG   E +LKI+PTIL+DVPE + +M+EEIFGPLLPI+TV K
Sbjct  347  KRLESMLKENGVANKIVHGGRITEDKLKISPTILLDVPEASSMMQEEIFGPLLPIITVQK  406

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT+NK+LE++FV ++SAGG+ INDT LHV V  LPFGGVGE
Sbjct  407  IEDGFQVIRSKPKPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGE  466

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A 
Sbjct  467  SGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAF  526

Query  139  LGL  131
             G 
Sbjct  527  FGF  529



>ref|XP_002449124.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
 gb|EES08112.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
Length=478

 Score =   325 bits (834),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 193/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWGC +GQACIAPDYIITTK  A +L+ ++K  L +FYG+DPL S DLSRIVNS  F
Sbjct  231  VVGKWGCNNGQACIAPDYIITTKSFAPELVASLKRVLVRFYGEDPLQSADLSRIVNSKQF  290

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  L+++ +V+ KIV GGE DE++LKIAPT+L+DVP+D+ IM  EIFGPLLPI+TV K
Sbjct  291  KRLQDLIEEKRVADKIVFGGEADEEQLKIAPTVLLDVPQDSAIMTGEIFGPLLPIVTVEK  350

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +INA+ KPLAAYLFT NKKL++EFV N+ AGG+L+NDTALH+A   LPFGGVG+
Sbjct  351  IEESFNLINAKPKPLAAYLFTKNKKLQEEFVANVPAGGMLVNDTALHLANPYLPFGGVGD  410

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKF F+ FSHKKAVL R FGG+  ARYPPYT +K ++LR L++G+ I +I AL
Sbjct  411  SGMGCYHGKFGFDCFSHKKAVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILAL  470

Query  139  LGL  131
            LG 
Sbjct  471  LGF  473



>ref|XP_011468213.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Fragaria 
vesca subsp. vesca]
Length=545

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/242 (63%), Positives = 196/242 (81%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   +GQACI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F
Sbjct  303  IAGKWALNNGQACIGVDYIITTKDFAPKLIEALKDGLEQFFGKDPMNSKDISRIVSSTQF  362

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLL++D+VS KIV GG+ DEK+LKIAPTIL+D+PED  IM EEIFGPL+PI+TV+K
Sbjct  363  ARLVKLLEEDRVSDKIVLGGQTDEKQLKIAPTILLDIPEDTQIMNEEIFGPLMPIVTVDK  422

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E    +I +R KPLA Y+FT+N++L++ FV N+S+GG+LINDT LHVAV  LPFGGVGE
Sbjct  423  IEGSFDVIKSRPKPLAVYVFTNNEQLKKSFVENISSGGMLINDTVLHVAVAGLPFGGVGE  482

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+ FSHKK+V+ RS  GD   RYPPYTP+K +L +A +SGN+  II AL
Sbjct  483  SGMGSYHGKFSFDGFSHKKSVMYRSLSGDSTLRYPPYTPEKEKLFKAALSGNIFRIILAL  542

Query  139  LG  134
            +G
Sbjct  543  IG  544



>ref|NP_567962.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 sp|Q8W033.2|AL3I1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member I1, chloroplastic; 
Short=AtALDH3; Short=Ath-ALDH3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK96824.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM10094.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE86347.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=550

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 191/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQACI  DY+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF
Sbjct  304  IAGKWACNSGQACIGVDYVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHF  363

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ V+ KIVHGG   E +LKI+PTIL+DVPE + +M+EEIFGPLLPI+TV K
Sbjct  364  KRLESMLKENGVANKIVHGGRITEDKLKISPTILLDVPEASSMMQEEIFGPLLPIITVQK  423

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT+NK+LE++FV ++SAGG+ INDT LHV V  LPFGGVGE
Sbjct  424  IEDGFQVIRSKPKPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGGVGE  483

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A 
Sbjct  484  SGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAF  543

Query  139  LGL  131
             G 
Sbjct  544  FGF  546



>ref|XP_010664198.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
 ref|XP_010664199.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
Length=516

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 204/267 (76%), Gaps = 28/267 (10%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQL----------------------------LDAMKV  755
            KW   +GQACIAPDYI+TTK+ A +L                            +DA+K 
Sbjct  248  KWASNNGQACIAPDYIVTTKDFAPKLVRLLICMKLVWYLFLCLFHFPLLLLFLQIDALKH  307

Query  754  ELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILM  575
            EL+ +YGKDPL SKDL+ IVNSNHF+RL KLLDDDKVSGKI+HGG+RD+  LK APTIL+
Sbjct  308  ELEAWYGKDPLESKDLAHIVNSNHFARLAKLLDDDKVSGKIIHGGQRDKANLKFAPTILL  367

Query  574  DVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLS  395
            DVPED+L+M EEIFGPLLPILTV+K+ED   +I +R KPLAAYLFT+NKKL+++FV  +S
Sbjct  368  DVPEDSLVMNEEIFGPLLPILTVDKLEDSFDMITSRGKPLAAYLFTNNKKLKEKFVKTVS  427

Query  394  AGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYP  215
            AGGL+INDT LH A  TLPFGGVGESG GSYHGKFS+EAFSH+K+VL R F GD  ARYP
Sbjct  428  AGGLVINDTVLHFAEKTLPFGGVGESGMGSYHGKFSYEAFSHRKSVLYRGFAGDASARYP  487

Query  214  PYTPKKARLLRALMSGNLIFIIRALLG  134
            PY+ +K +LL+AL+SG+++ +I AL+G
Sbjct  488  PYSDRKLKLLKALLSGSVVGVILALIG  514



>ref|XP_004503899.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=542

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 198/242 (82%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQACI+ D+IIT K+ A +L++A+K EL+ F+GK+P+ SKD+SRIV+   F
Sbjct  298  IAGKWACNSGQACISVDHIITRKDFAPKLINALKEELEIFFGKNPMESKDMSRIVSPMQF  357

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL +LLD+DKVS KIV GG+RDEK+LKIAPTIL+DVPE+A++M+EEIFGP++PI+TV+ 
Sbjct  358  SRLVRLLDEDKVSDKIVLGGQRDEKKLKIAPTILLDVPEEAMVMQEEIFGPIMPIITVDN  417

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   II +R KPLAAYLFT+N++L++E+V  +S+GG+LIND  +HVA   LPFGGV E
Sbjct  418  IEDSFSIIKSRPKPLAAYLFTNNEQLKKEYVDKISSGGMLINDAVIHVATRGLPFGGVEE  477

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKF+F++FSHKK+VL +SF  D   RYPPYTP+K +LLRA++ GN+  II AL
Sbjct  478  SGMGCYHGKFTFDSFSHKKSVLYKSFDADPSIRYPPYTPQKEKLLRAILGGNIFDIILAL  537

Query  139  LG  134
             G
Sbjct  538  FG  539



>ref|XP_010437650.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   325 bits (834),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 192/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACI  DY+ITTK+ +L+L+DA+K EL  F+G+ PL SKDLSRIVNS HF
Sbjct  302  IAGKWACNNGQACIGVDYVITTKDFSLKLIDALKTELKTFFGETPLESKDLSRIVNSFHF  361

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ V+ KIVHGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K
Sbjct  362  KRLESMLKENGVANKIVHGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEK  421

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT+NK+L+++FV ++SAGG+ INDT LHV V  LPFGGVGE
Sbjct  422  IEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPFGGVGE  481

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A 
Sbjct  482  SGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAF  541

Query  139  LGL  131
             G 
Sbjct  542  FGF  544



>ref|XP_002869163.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45422.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score =   325 bits (834),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/243 (62%), Positives = 190/243 (78%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQACI  DY+ITTK+ A +L+DA+K EL+ F+G++ L SKDLSRIVNS HF
Sbjct  302  IAGKWACNSGQACIGVDYVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNSFHF  361

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ V  KIVHGG+  E +LKI+PTIL+DVPE + +M+EEIFGPLLP+ TV K
Sbjct  362  KRLESMLKENGVDNKIVHGGQTTEDKLKISPTILLDVPEASSMMQEEIFGPLLPVFTVQK  421

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT++ +L+++FV N+SAGG+ INDT LHV V  +PFGGVGE
Sbjct  422  IEDGFQVIRSKPKPLAAYLFTNSAELQKQFVQNVSAGGMTINDTVLHVTVKDMPFGGVGE  481

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A 
Sbjct  482  SGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALISSNIFAAILAF  541

Query  139  LGL  131
             GL
Sbjct  542  FGL  544



>ref|XP_010447116.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 192/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACI  DY+ITTK+ AL+L+DA+K EL+ F+G+ PL SKDLSRIVNS HF
Sbjct  302  IAGKWACNNGQACIGVDYVITTKDFALKLIDALKTELNTFFGETPLESKDLSRIVNSFHF  361

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ V+ KIVHGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLPI+TV K
Sbjct  362  RRLESMLKENGVANKIVHGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPIVTVEK  421

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT+NK+L+++FV  +SAGG+ INDT LHV +  LPFGGVGE
Sbjct  422  IEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQGVSAGGISINDTVLHVTLKDLPFGGVGE  481

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A 
Sbjct  482  SGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFAAIWAF  541

Query  139  LGL  131
             G 
Sbjct  542  FGF  544



>ref|XP_010432443.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
[Camelina sativa]
Length=547

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/243 (62%), Positives = 192/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACI  DY+ITTK+ A +L+DA+K EL  F+G+ PL SKDLSRIVNS HF
Sbjct  300  IAGKWACNNGQACIGVDYVITTKDFASRLIDALKTELKTFFGEKPLESKDLSRIVNSFHF  359

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL ++L ++ V+ KIVHGG+  E++LKI+PTI++DVPE + IM+EEIFGPLLP++TV K
Sbjct  360  KRLERMLKENGVANKIVHGGQTIEEKLKISPTIVVDVPEASSIMQEEIFGPLLPVVTVEK  419

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLF++NK+L+++FV  +SAGG+ INDT LHV V  LPFGGVGE
Sbjct  420  IEDGFQVIRSKPKPLAAYLFSNNKELQEQFVQGVSAGGISINDTVLHVTVKDLPFGGVGE  479

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A 
Sbjct  480  SGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAILAF  539

Query  139  LGL  131
             G 
Sbjct  540  FGF  542



>gb|AFW65463.1| hypothetical protein ZEAMMB73_893012 [Zea mays]
Length=456

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 193/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWGC +GQACIAPDYIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F
Sbjct  209  VVGKWGCNNGQACIAPDYIITTKSFAPELVASFKRVLERFYGEDPLESADLSRIVNSKQF  268

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT L+++ +V+ KIV+GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K
Sbjct  269  KRLTNLIEEKRVADKIVYGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEK  328

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +INA+ KPLAAYLFT N+KL++EFV ++ AGG+L+NDTALH+    +PFGGVG+
Sbjct  329  IEESFDLINAKPKPLAAYLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPFGGVGD  388

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKF F+ FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I AL
Sbjct  389  SGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILAL  448

Query  139  LGL  131
            LG 
Sbjct  449  LGF  451



>gb|ACG29168.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 193/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWGC +GQACIAPDYIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F
Sbjct  231  VVGKWGCNNGQACIAPDYIITTKSFAPELVASFKRVLERFYGEDPLQSADLSRIVNSKQF  290

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT L+++ +V+ KIV+GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K
Sbjct  291  KRLTNLIEEKRVADKIVYGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEK  350

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +INA+ KPLAAYLFT N+KL++EFV ++ AGG+L+NDTALH+    +PFGGVG+
Sbjct  351  IEESFDLINAKPKPLAAYLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPFGGVGD  410

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKF F+ FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I AL
Sbjct  411  SGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILAL  470

Query  139  LGL  131
            LG 
Sbjct  471  LGF  473



>ref|XP_009350139.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=450

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 197/242 (81%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW   +GQACI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F
Sbjct  206  MAGKWALNNGQACIGVDYIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQF  265

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL K+LD+DKVS KIV GG+ DEK+LKIAPTIL+DVPEDA IM+EEIFGPL+ I+TV K
Sbjct  266  TRLAKVLDEDKVSNKIVLGGQMDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMSIVTVEK  325

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +I+++ KPLA   FT+N++ ++ FV N+S+GG+LINDT LHV++  LPFGGVGE
Sbjct  326  IEDSFSVIHSKPKPLAVCAFTNNEQPKKGFVDNVSSGGMLINDTVLHVSISGLPFGGVGE  385

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+ FSHKKAVL R FGGD   RYPPYTP+K RL +A+++ N++ II +L
Sbjct  386  SGMGSYHGKFSFDGFSHKKAVLYRGFGGDSDLRYPPYTPEKQRLFKAVINRNILTIILSL  445

Query  139  LG  134
            +G
Sbjct  446  IG  447



>gb|ACF85700.1| unknown [Zea mays]
 gb|AFW65462.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 193/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWGC +GQACIAPDYIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F
Sbjct  231  VVGKWGCNNGQACIAPDYIITTKSFAPELVASFKRVLERFYGEDPLESADLSRIVNSKQF  290

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT L+++ +V+ KIV+GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K
Sbjct  291  KRLTNLIEEKRVADKIVYGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEK  350

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +INA+ KPLAAYLFT N+KL++EFV ++ AGG+L+NDTALH+    +PFGGVG+
Sbjct  351  IEESFDLINAKPKPLAAYLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPFGGVGD  410

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKF F+ FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I AL
Sbjct  411  SGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILAL  470

Query  139  LGL  131
            LG 
Sbjct  471  LGF  473



>ref|XP_007048537.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
 gb|EOX92694.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
Length=487

 Score =   321 bits (823),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 192/242 (79%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW C +GQACI  DYIITTK+ A QL+DA++  L++ +GKDP+ SKD SRIVNS HF
Sbjct  242  VAGKWACNNGQACIGVDYIITTKDFAPQLIDALRSVLEECFGKDPMESKDRSRIVNSFHF  301

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LLD+DKVS KIV GG+RD   L+IAPTIL+DVP+D+ IM+EEIFGPLLPI TV K
Sbjct  302  MRLVNLLDEDKVSDKIVVGGQRDRSHLQIAPTILLDVPDDSRIMQEEIFGPLLPITTVEK  361

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN + K LAAYLF+ ++++E++FV N+SAGG+ INDT L + V TLPFGGVGE
Sbjct  362  LEDAFDMINRKPKALAAYLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFGGVGE  421

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSH KAVL RSF G+   RYPPYTP K + ++AL+SG++  I+ AL
Sbjct  422  SGMGSYHGKFSFDAFSHNKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNIMLAL  481

Query  139  LG  134
            LG
Sbjct  482  LG  483



>gb|KHG17901.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Gossypium 
arboreum]
 gb|KHG21723.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Gossypium 
arboreum]
Length=366

 Score =   317 bits (811),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/243 (62%), Positives = 193/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW C +GQACI  DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF
Sbjct  121  VAGKWVCNNGQACIGVDYIITTKELAPKLIATLVNVVEEIFGKDLMESKERSRIINSFHF  180

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL++DKVS KIV GG+RDE +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV +
Sbjct  181  KRLVNLLEEDKVSNKIVFGGQRDESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVER  240

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGE
Sbjct  241  LEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNIYAGGMAINDTILQVTVPTLPFGGVGE  300

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ AL
Sbjct  301  SGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLAL  360

Query  139  LGL  131
            LG 
Sbjct  361  LGF  363



>gb|ABK24239.1| unknown [Picea sitchensis]
Length=478

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 202/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KWGC +GQACIAPDYIIT +  A +L+DA+K  L+KFYG+DP+ S DLSRIVNS+HF
Sbjct  233  VAGKWGCNNGQACIAPDYIITPESFAPKLIDALKNTLEKFYGQDPIQSADLSRIVNSSHF  292

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+LLDD KVS K+++GG+RDEKRL IAPT+++D P D+LIM EEIFGPLL I+TV K
Sbjct  293  VRLTRLLDDPKVSDKVIYGGQRDEKRLIIAPTLVLDAPMDSLIMIEEIFGPLLTIITVQK  352

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+ ++++++  KPLAAY+FT NKK E++ V ++SAGG+L+NDTALHV  H LPFGGVGE
Sbjct  353  MEEALEVVSSFSKPLAAYVFTKNKKFERQVVASVSAGGMLVNDTALHVTNHHLPFGGVGE  412

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSFEAFSHKKAVL R F GDL ARYPPYT +K +++R L+SG+ + ++ A+
Sbjct  413  SGVGSYHGKFSFEAFSHKKAVLYRGFMGDLMARYPPYTTRKQKIVRCLLSGDFLGLLYAI  472

Query  139  LG  134
            LG
Sbjct  473  LG  474



>ref|XP_003630349.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=550

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 197/249 (79%), Gaps = 7/249 (3%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C SGQ CI+ DYIITTK+ A  L+DA+K EL++F+GKD + SKD+SRIV+   +
Sbjct  298  IAGKWACNSGQTCISVDYIITTKDFAPTLVDALKEELEQFFGKDLIESKDMSRIVSPTQY  357

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILT---  509
            +RL KLLD+DKVS KIV GG+RDEK+LKIAPTIL+DVP++A++M+EEIFGP+LPI+T   
Sbjct  358  ARLVKLLDEDKVSDKIVLGGQRDEKKLKIAPTILLDVPQEAMVMQEEIFGPILPIITVST  417

Query  508  ----VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTL  341
                V+ +ED   II +R KPLAAYLFT+N++L++++V  +S+GG+LIND  +HVA   L
Sbjct  418  IKGKVDSIEDSFSIIQSRPKPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGL  477

Query  340  PFGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNL  161
            PFGGVGESG G YHGKFSF++FSHKK+VL ++F  D   RYPPYTP+K  +LRA+  GN+
Sbjct  478  PFGGVGESGMGCYHGKFSFDSFSHKKSVLYKTFDSDPSIRYPPYTPEKENILRAIFGGNI  537

Query  160  IFIIRALLG  134
              II ALLG
Sbjct  538  FQIILALLG  546



>ref|XP_006283479.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
 gb|EOA16377.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
Length=546

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 192/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI  DY+ITTK+ A +L+DA+K EL+ F+G++PL SKD+SRIVNS HF
Sbjct  299  IAGKWGCNNGQACIGVDYVITTKDFASKLIDALKTELETFFGENPLESKDISRIVNSFHF  358

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ V+ KIVHGG+  E++LKI+PTI++DVPE + +M+EEIFGPLLP++TV K
Sbjct  359  KRLESMLKENGVANKIVHGGQTIEEKLKISPTIVVDVPEASSMMQEEIFGPLLPVVTVAK  418

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT+NK+L+++FV  +SAGG+ INDT LHV    LPFGGVGE
Sbjct  419  IEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQGVSAGGISINDTVLHVTQKDLPFGGVGE  478

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A 
Sbjct  479  SGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTTKKKMVLKALISSNIFAAILAF  538

Query  139  LGL  131
             G 
Sbjct  539  FGF  541



>ref|XP_011002476.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=756

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 197/242 (81%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   +GQACI+ DYIITTKE A +L+DA++  +++F+G DP+ SKD+S IV+SNHF
Sbjct  511  IAGKWQLNNGQACISVDYIITTKEFAPKLIDALRKGIEEFFGTDPMESKDISCIVSSNHF  570

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL  L+DD KV  KIV GG+R++K+LKIAPTI +DVP D+ +M+EEIFGPLLPI+TV  
Sbjct  571  SRLESLMDDYKVFYKIVVGGQRNQKKLKIAPTIFLDVPGDSQLMQEEIFGPLLPIITVEN  630

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            V+D I +IN++ KPL AYLFT+N+KL+  FV ++S+GG++INDT LHV V +LPFGGVGE
Sbjct  631  VKDSIDLINSKPKPLTAYLFTNNEKLKNNFVQSVSSGGMVINDTVLHVTVSSLPFGGVGE  690

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP+K +L+RA+M+G +  II A 
Sbjct  691  SGMGSYHGKFSFDAFSHKKAVLYRSFSGDTSVRYPPYTPEKQKLVRAVMNGGIFDIILAF  750

Query  139  LG  134
            +G
Sbjct  751  MG  752



>ref|NP_001148092.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG29697.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=481

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 192/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWGC +GQACIAPDYIITTK  A +L+ + K  L++FYG+DPL S DLSRIVNS  F
Sbjct  234  VVGKWGCNNGQACIAPDYIITTKSFAPELVASFKRVLERFYGEDPLQSADLSRIVNSKQF  293

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT L+++ +V+ KIV+GG+ DEK+LKI+PT+L+DVPED+ IM  EIFGPLLPI+TV K
Sbjct  294  KRLTNLIEEKRVADKIVYGGKADEKQLKISPTLLLDVPEDSEIMTGEIFGPLLPIVTVEK  353

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+   +INA+ KPLAAYLFT N+KL++EFV ++ AGG+L+ND ALH+    +PFGGVG+
Sbjct  354  IEESFDLINAKPKPLAAYLFTKNRKLQEEFVASVPAGGMLVNDIALHLTNPYMPFGGVGD  413

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKF F+ FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I +I AL
Sbjct  414  SGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIALILAL  473

Query  139  LGL  131
            LG 
Sbjct  474  LGF  476



>gb|EMS62407.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=450

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 193/240 (80%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDYIITTK    +L+D++K  L++FYG+DPL S DLSRIV+ +HF RL
Sbjct  206  KWGCNNGQACIAPDYIITTKAFVTELVDSLKRVLERFYGEDPLQSADLSRIVSISHFERL  265

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
             KL++D +V+ KI  GG+ D+++LKIAPT+L+DVP D  +M  EIFGP+LPI+TV+K+E+
Sbjct  266  AKLIEDKEVATKIQLGGQTDQEQLKIAPTVLVDVPLDTELMTGEIFGPMLPIITVDKIEE  325

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I  INA  KPLAAYLFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPFGGVG+SGT
Sbjct  326  SITHINAGAKPLAAYLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPFGGVGDSGT  385

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            GSYHGKFSF+ F+H+KAVL R FGG+  ARYPPYT +K R+LR L+ G+   +I ALLG 
Sbjct  386  GSYHGKFSFDCFTHRKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFALILALLGF  445



>gb|KJB75337.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=443

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 194/243 (80%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW C +GQACI+ DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF
Sbjct  198  VAGKWVCNNGQACISVDYIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHF  257

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL++DKVS KIV GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV +
Sbjct  258  KRLVNLLEEDKVSNKIVFGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVER  317

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGE
Sbjct  318  LEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGE  377

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ AL
Sbjct  378  SGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLAL  437

Query  139  LGL  131
            LG 
Sbjct  438  LGF  440



>ref|XP_007048536.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
 gb|EOX92693.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
Length=542

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 192/242 (79%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW C +GQACI  DYIITTK+ A QL+DA++  L++ +GKDP+ SKD SRIVNS HF
Sbjct  297  VAGKWACNNGQACIGVDYIITTKDFAPQLIDALRSVLEECFGKDPMESKDRSRIVNSFHF  356

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LLD+DKVS KIV GG+RD   L+IAPTIL+DVP+D+ IM+EEIFGPLLPI TV K
Sbjct  357  MRLVNLLDEDKVSDKIVVGGQRDRSHLQIAPTILLDVPDDSRIMQEEIFGPLLPITTVEK  416

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN + K LAAYLF+ ++++E++FV N+SAGG+ INDT L + V TLPFGGVGE
Sbjct  417  LEDAFDMINRKPKALAAYLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFGGVGE  476

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSH KAVL RSF G+   RYPPYTP K + ++AL+SG++  I+ AL
Sbjct  477  SGMGSYHGKFSFDAFSHNKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNIMLAL  536

Query  139  LG  134
            LG
Sbjct  537  LG  538



>ref|XP_007048535.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
 gb|EOX92692.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
Length=547

 Score =   321 bits (822),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 192/242 (79%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW C +GQACI  DYIITTK+ A QL+DA++  L++ +GKDP+ SKD SRIVNS HF
Sbjct  302  VAGKWACNNGQACIGVDYIITTKDFAPQLIDALRSVLEECFGKDPMESKDRSRIVNSFHF  361

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LLD+DKVS KIV GG+RD   L+IAPTIL+DVP+D+ IM+EEIFGPLLPI TV K
Sbjct  362  MRLVNLLDEDKVSDKIVVGGQRDRSHLQIAPTILLDVPDDSRIMQEEIFGPLLPITTVEK  421

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN + K LAAYLF+ ++++E++FV N+SAGG+ INDT L + V TLPFGGVGE
Sbjct  422  LEDAFDMINRKPKALAAYLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFGGVGE  481

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSH KAVL RSF G+   RYPPYTP K + ++AL+SG++  I+ AL
Sbjct  482  SGMGSYHGKFSFDAFSHNKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNIMLAL  541

Query  139  LG  134
            LG
Sbjct  542  LG  543



>gb|EMT24757.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=334

 Score =   313 bits (803),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 193/242 (80%), Gaps = 0/242 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACIAPD+IITT+  A +LL+++K  L+KFYGKDPL S DLSR+VN++HF 
Sbjct  89   AGKWGCNNGQACIAPDFIITTQAFAPKLLESLKKVLEKFYGKDPLLSADLSRVVNASHFG  148

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL  L+D++ VS KIV GG+RDE++LKIAPTI +DVP D+ IMKEEIFGPLLPILTV+K+
Sbjct  149  RLKGLMDEEMVSDKIVFGGQRDEQQLKIAPTIFLDVPLDSAIMKEEIFGPLLPILTVDKI  208

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  KPLAAYLFT + +L+ +F   +SAGG+L NDT++H+    LPFGGVGES
Sbjct  209  HESFGLINSMAKPLAAYLFTRDSELQNQFEGAISAGGMLFNDTSIHLTNPYLPFGGVGES  268

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            GTG+YHGKFSF+AFSH+KAV+ R F G+  ARYPPY+  K ++L+ ++ G L  +I+A+L
Sbjct  269  GTGAYHGKFSFDAFSHRKAVMNRGFAGEARARYPPYSAPKLKILKGVLEGKLGDMIQAIL  328

Query  136  GL  131
            G 
Sbjct  329  GF  330



>gb|KJB75341.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
 gb|KJB75342.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=488

 Score =   318 bits (816),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 194/243 (80%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW C +GQACI+ DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF
Sbjct  243  VAGKWVCNNGQACISVDYIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHF  302

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL++DKVS KIV GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV +
Sbjct  303  KRLVNLLEEDKVSNKIVFGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVER  362

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGE
Sbjct  363  LEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGE  422

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ AL
Sbjct  423  SGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLAL  482

Query  139  LGL  131
            LG 
Sbjct  483  LGF  485



>emb|CDX69039.1| BnaC01g04140D [Brassica napus]
Length=549

 Score =   320 bits (820),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 193/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KW C +GQACI+ DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF
Sbjct  303  ITGKWACNNGQACISVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHF  362

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  ++ ++ V+ KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K
Sbjct  363  KRLESMMKENGVADKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSK  422

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT NK+L+ +FV N+SAGG+ IN+T LHV +  LPFGGVGE
Sbjct  423  IEDGFQVIRSKPKPLAAYLFTDNKELQNQFVQNVSAGGMGINETVLHVTLKDLPFGGVGE  482

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A 
Sbjct  483  SGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAF  542

Query  139  LGL  131
             G 
Sbjct  543  FGF  545



>ref|XP_002893982.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70241.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   318 bits (815),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/243 (63%), Positives = 191/243 (79%), Gaps = 5/243 (2%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYI+TTKE A +++DAMK EL+ FYGK+P+ SKD+SRIVNS HF
Sbjct  254  IAGKWGCNNGQACISPDYILTTKEYAPKVIDAMKKELETFYGKNPMESKDMSRIVNSTHF  313

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+KLLD+ +VS KIV+GGE+D + LKIAPTIL+DVP D+LIM EE   P     + + 
Sbjct  314  DRLSKLLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEENIWP-----SPSN  368

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
              +   +I +R KPLAAYLFT NKKL++ F T +SAGG+++ND A+H+A+HTLPFGGVGE
Sbjct  369  SHESFDMIRSRPKPLAAYLFTHNKKLKERFATTVSAGGIVVNDIAVHLALHTLPFGGVGE  428

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I +AL
Sbjct  429  SGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDIFKAL  488

Query  139  LGL  131
            LGL
Sbjct  489  LGL  491



>gb|KFK30059.1| hypothetical protein AALP_AA7G211500 [Arabis alpina]
Length=560

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 192/243 (79%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACI  DY+ITT++ A +L+DA+K EL+ F+GK+PL SKDLSRIVNS HF
Sbjct  314  IAGKWACNNGQACIGVDYVITTEDFASKLIDAVKTELESFFGKNPLESKDLSRIVNSFHF  373

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ V+ KIVHGG+  E +LKI+PTIL+DV E++ +M+EEIFGPLLPI+TV K
Sbjct  374  KRLEGMLKENGVANKIVHGGQTIEDKLKISPTILVDVSEESSMMREEIFGPLLPIVTVQK  433

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDGI++I ++ KPLAAYLFT NK+L+Q+FV +++AGG+ +NDT LHV V  LPFGGVGE
Sbjct  434  IEDGIQVIRSKPKPLAAYLFTDNKELQQQFVQDVAAGGIGVNDTILHVTVKDLPFGGVGE  493

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS++ FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+   I A 
Sbjct  494  SGIGAYHGKFSYDTFSHKKGVLYRSFVGDSDIRYPPYTTKKKTVLKALLSSNIFRAILAF  553

Query  139  LGL  131
             G 
Sbjct  554  FGF  556



>ref|XP_006412252.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
 dbj|BAJ33838.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53705.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
Length=547

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 189/243 (78%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KW C +GQACI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKDLSRIVNS HF
Sbjct  301  ISGKWACNNGQACIGVDYVITTKDFASKLIDALKTELKTFFGENPLESKDLSRIVNSFHF  360

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L ++ ++ KIV GG+  E +LKI+PTIL+DVPE   +M+EEIFGPLLPI+TV K
Sbjct  361  KRLESMLKENGMADKIVKGGQTSEDKLKISPTILLDVPEACSMMQEEIFGPLLPIITVQK  420

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT NK+L+++FV +++AGG+ INDT LHV V  LPFGGVGE
Sbjct  421  IEDGFQVIRSKAKPLAAYLFTDNKELQKKFVQDVAAGGIGINDTVLHVTVKDLPFGGVGE  480

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+   I A 
Sbjct  481  SGIGAYHGKFSYETFSHKKGVLYRSFAGDSDLRYPPYTPKKKMVLKALLSSNIFAAILAF  540

Query  139  LGL  131
             G 
Sbjct  541  FGF  543



>emb|CAN73659.1| hypothetical protein VITISV_044129 [Vitis vinifera]
Length=541

 Score =   318 bits (815),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = -3

Query  814  PDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRLTKLLDDDKVSGK  635
            PDYIITTK+ A +L+D ++ EL++F+GK+P+ S+D+SRIV+  HF RLT+LLD+D+VS K
Sbjct  311  PDYIITTKDFAPKLIDVLRHELEEFFGKNPIESEDMSRIVSVQHFKRLTRLLDEDEVSDK  370

Query  634  IVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVEDGIKIINARDKPL  455
            I+ GG+ DE +LKIAPTIL+DVPED  IMKEEIFGPLLPILTV  +E+   +IN++ KPL
Sbjct  371  IIIGGQSDENQLKIAPTILVDVPEDTEIMKEEIFGPLLPILTVENLEESFDVINSKSKPL  430

Query  454  AAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSFEAF  275
            AAYLF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPFGGVGESG GSYHGKFSF+AF
Sbjct  431  AAYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSFDAF  490

Query  274  SHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            SHKKAVL R F G+  ARYPPYTP K +LL+ L SGN++ I+ ALLG 
Sbjct  491  SHKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVSILLALLGF  538



>gb|EMS67813.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=334

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 192/242 (79%), Gaps = 0/242 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACIAPD+IITT+  A +LL+++K  L+KFYGKDPL S DLSR+VN++HF 
Sbjct  89   AGKWGCNNGQACIAPDFIITTQAFAPKLLESLKKVLEKFYGKDPLLSADLSRVVNASHFG  148

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL  L+D++ VS KIV GG RDE++LKIAPTI +DVP D+ IMKEEIFGPLLPI+TV+K+
Sbjct  149  RLKGLMDEEMVSDKIVFGGHRDEQQLKIAPTIFLDVPLDSAIMKEEIFGPLLPIITVDKI  208

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  KPLAAYLFT + +L+ +F   +SAGG+L NDT++H+    LPFGGVGES
Sbjct  209  HESFGLINSMAKPLAAYLFTRDSELQNQFEGAISAGGMLFNDTSIHLTNPYLPFGGVGES  268

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            GTGSYHGKFSF+AFSH+KAV+ R F G+  ARYPPY+  + ++L+ ++ G L  +I+A+L
Sbjct  269  GTGSYHGKFSFDAFSHRKAVMNRGFAGEARARYPPYSAPRLKILKGVLEGKLGDMIQAIL  328

Query  136  GL  131
            G 
Sbjct  329  GF  330



>gb|KJB75338.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=544

 Score =   318 bits (814),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 194/243 (80%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW C +GQACI+ DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF
Sbjct  299  VAGKWVCNNGQACISVDYIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHF  358

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL++DKVS KIV GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV +
Sbjct  359  KRLVNLLEEDKVSNKIVFGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVER  418

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGE
Sbjct  419  LEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGE  478

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ AL
Sbjct  479  SGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLAL  538

Query  139  LGL  131
            LG 
Sbjct  539  LGF  541



>gb|KJB75340.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   317 bits (813),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 194/243 (80%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW C +GQACI+ DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF
Sbjct  302  VAGKWVCNNGQACISVDYIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHF  361

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL++DKVS KIV GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV +
Sbjct  362  KRLVNLLEEDKVSNKIVFGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVER  421

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGE
Sbjct  422  LEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGE  481

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ I+ AL
Sbjct  482  SGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLNIMLAL  541

Query  139  LGL  131
            LG 
Sbjct  542  LGF  544



>ref|XP_009115014.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Brassica rapa]
Length=556

 Score =   317 bits (813),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 190/243 (78%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KW C +GQACI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF
Sbjct  310  ITGKWACNNGQACIGVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHF  369

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  ++ ++ V+ KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K
Sbjct  370  KRLESMMKENGVANKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSK  429

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT NK L+  FV N+SAGG+ IN+T LHV +  LPFGGVGE
Sbjct  430  IEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGE  489

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A 
Sbjct  490  SGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAF  549

Query  139  LGL  131
             G 
Sbjct  550  FGF  552



>ref|NP_001288985.1| aldehyde dehydrogenase family 3 member I1, chloroplastic [Brassica 
rapa]
 gb|ABC41273.1| putative aldehyde dehydrogenase [Brassica rapa]
Length=555

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 190/243 (78%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KW C +GQACI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF
Sbjct  309  ITGKWACNNGQACIGVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHF  368

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  ++ ++ V+ KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K
Sbjct  369  KRLESMMKENGVANKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSK  428

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT NK L+  FV N+SAGG+ IN+T LHV +  LPFGGVGE
Sbjct  429  IEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGE  488

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A 
Sbjct  489  SGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAF  548

Query  139  LGL  131
             G 
Sbjct  549  FGF  551



>ref|XP_009115077.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Brassica rapa]
Length=554

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 190/243 (78%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KW C +GQACI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF
Sbjct  308  ITGKWACNNGQACIGVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHF  367

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  ++ ++ V+ KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K
Sbjct  368  KRLESMMKENGVANKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSK  427

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT NK L+  FV N+SAGG+ IN+T LHV +  LPFGGVGE
Sbjct  428  IEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGE  487

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A 
Sbjct  488  SGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAF  547

Query  139  LGL  131
             G 
Sbjct  548  FGF  550



>ref|XP_002441918.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
 gb|EES15756.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
Length=487

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 193/242 (80%), Gaps = 1/242 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC SGQACI+PDYI+TTK  A +LL+++K  L KFYG+DPL S DLSRIVNSNHF+
Sbjct  238  AGKWGCNSGQACISPDYIVTTKSLAPKLLESLKKVLRKFYGEDPLRSPDLSRIVNSNHFN  297

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL  L+DD  V+GKI  GG+ DE++L+IAPT+L+DVP D+ IMKEEIFGPLLPI+TV+K+
Sbjct  298  RLRTLMDDGTVAGKIAFGGQSDEQQLRIAPTLLLDVPLDSAIMKEEIFGPLLPIITVDKI  357

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  KPLAAYLFT++ +L+Q+F  N+S+GG++ NDTA+H+    LPFGGVGES
Sbjct  358  SESFAVINSVSKPLAAYLFTNDSRLKQQFERNISSGGMIFNDTAIHLTNPHLPFGGVGES  417

Query  316  GTGSYHGKFSFEAFSHKKAVLKR-SFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            G G+YHG FSF+AF+H+KAVL R SF G+  ARYPPYTP K  +LR ++ GN + ++ A 
Sbjct  418  GMGAYHGAFSFDAFTHRKAVLDRSSFLGEARARYPPYTPAKLGILRGVLKGNPLAMVLAA  477

Query  139  LG  134
            +G
Sbjct  478  VG  479



>emb|CDX75414.1| BnaA01g02880D [Brassica napus]
Length=556

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 190/243 (78%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KW C +GQACI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF
Sbjct  310  ITGKWACNNGQACIGVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHF  369

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  ++ ++ V+ KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K
Sbjct  370  KRLESMMKENGVADKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSK  429

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT NK L+  FV N+SAGG+ IN+T LHV +  LPFGGVGE
Sbjct  430  IEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGE  489

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A 
Sbjct  490  SGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAF  549

Query  139  LGL  131
             G 
Sbjct  550  FGF  552



>gb|AID60136.1| aldehyde dehydrogenase 3 [Brassica napus]
Length=554

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 190/243 (78%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KW C +GQACI  DY+ITTK+ A +L+DA+K EL  F+G++PL SKD+SRIVNS HF
Sbjct  308  ITGKWACNNGQACIGVDYVITTKDFAPKLIDALKTELKTFFGENPLKSKDVSRIVNSFHF  367

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  ++ ++ V+ KIVHGG+  E +LKI+PTIL+DVPE++ +M+EEIFGPLLP++TV+K
Sbjct  368  KRLESMMKENGVADKIVHGGQTMEDKLKISPTILVDVPEESSMMQEEIFGPLLPVITVSK  427

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG ++I ++ KPLAAYLFT NK L+  FV N+SAGG+ IN+T LHV +  LPFGGVGE
Sbjct  428  IEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPFGGVGE  487

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++   I A 
Sbjct  488  SGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFGAILAF  547

Query  139  LGL  131
             G 
Sbjct  548  FGF  550



>gb|EMT33845.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=517

 Score =   314 bits (805),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 194/246 (79%), Gaps = 6/246 (2%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQL------LDAMKVELDKFYGKDPLCSKDLSRIVNS  689
            KWGC +GQACIAPDYIITTK    +L      +D++K  L++FYG+DPL S DLSRIV+ 
Sbjct  267  KWGCNNGQACIAPDYIITTKAFVTELEINFLQVDSLKRVLERFYGEDPLQSADLSRIVSI  326

Query  688  NHFSRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILT  509
            +HF RLTKL++D +V+ KI  GG+ D+++LKIAPT+L+DVP D  +M  EIFGP+LPI+T
Sbjct  327  SHFKRLTKLIEDKEVATKIQLGGQTDQEQLKIAPTVLVDVPLDTELMTGEIFGPMLPIIT  386

Query  508  VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  329
            V+K+E+ I  INA  KPLAAYLFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPFGG
Sbjct  387  VDKIEESIAHINAGAKPLAAYLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPFGG  446

Query  328  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  149
            VG+SGTGSYHGKFSF+ F+H+KAVL R FGG+  ARYPPYT +K R+LR L+ G+   +I
Sbjct  447  VGDSGTGSYHGKFSFDCFTHRKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFALI  506

Query  148  RALLGL  131
             ALLG 
Sbjct  507  LALLGF  512



>gb|EPS67421.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=250

 Score =   305 bits (781),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 187/242 (77%), Gaps = 0/242 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWG  +GQ CI+PDY+ITTK+ A +++DA+  ELD FYGK PL S DLSRIVN  HF
Sbjct  9    ISGKWGSNNGQTCISPDYLITTKDYASRVVDAISTELDNFYGKHPLRSHDLSRIVNPKHF  68

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D+KVS +IV GGE D   L+IAPT++ DVP D+++M++EIFGPLLPILTV +
Sbjct  69   ERLLTLLQDEKVSCRIVRGGEHDRTTLRIAPTVIFDVPRDSVLMEDEIFGPLLPILTVER  128

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+ + +I+A++K LAAYLFT++ KL+ EFV  +SAG + IN+T LH    +LPFGGVGE
Sbjct  129  IEESLDVIDAKEKALAAYLFTNSPKLKSEFVRKVSAGAVCINETNLHFMEPSLPFGGVGE  188

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSFEAFSH+KAVL+R   GD+ ARYPPY+ +K  LL+ L+ G L+   +AL
Sbjct  189  SGMGAYHGKFSFEAFSHRKAVLERVLFGDVPARYPPYSRRKMDLLKNLLQGRLVAATQAL  248

Query  139  LG  134
            LG
Sbjct  249  LG  250



>gb|AFW56225.1| hypothetical protein ZEAMMB73_146423 [Zea mays]
Length=420

 Score =   306 bits (783),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 190/241 (79%), Gaps = 0/241 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC SGQAC++PDY++TTK  A +LL+++K  L +FYG++PL S DLSR+VNSNHF+
Sbjct  172  AGKWGCNSGQACVSPDYVVTTKSFAPKLLESLKRVLFEFYGEEPLRSPDLSRVVNSNHFN  231

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL  L+DD  VSG +  GG+ DE+RL+IAPT+L+DVP D+ +MKEEIFGPLLPI+TV+K+
Sbjct  232  RLMALMDDYSVSGNVAFGGQIDERRLRIAPTLLLDVPLDSAMMKEEIFGPLLPIITVDKI  291

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  KPLAAYLF+++ +L+Q+F   +SAGG++ NDT +H+    LPFGGVGES
Sbjct  292  GESFAVINSMPKPLAAYLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPFGGVGES  351

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G G+YHG FSF+AFSH+KAVL RSF G+  ARYPPYTP K  +LR +++G+ +  ++A  
Sbjct  352  GMGAYHGAFSFDAFSHRKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLATVQAAA  411

Query  136  G  134
            G
Sbjct  412  G  412



>ref|XP_010238657.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=479

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 188/242 (78%), Gaps = 0/242 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACIAPD+IITT   A +L++ +K  L KFYGKDPL S DLSRIVNSNHF+
Sbjct  234  AGKWGCNNGQACIAPDFIITTSSFAPKLIEELKKVLGKFYGKDPLGSADLSRIVNSNHFN  293

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL  L+D++ V  KIV GG+ D  +LKIAPTIL+DVP D+ IM+EEIFGP LPI+TV+K+
Sbjct  294  RLKTLMDEEMVFEKIVFGGQMDAYQLKIAPTILLDVPLDSAIMREEIFGPFLPIITVDKI  353

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  KPLAAYLF+ N KL+ +F  ++SAGG+L+NDT++H+    LPFGGVGES
Sbjct  354  NECFGLINSMSKPLAAYLFSRNSKLQDKFERSISAGGMLLNDTSIHLTNPYLPFGGVGES  413

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            GTG+YHGKFSF+AFSHKKAVL R F G+  ARYPPY+  K ++++ ++ G L  +I+A L
Sbjct  414  GTGAYHGKFSFDAFSHKKAVLNRGFFGEAKARYPPYSEPKLKIMKGVLEGKLGDMIQAFL  473

Query  136  GL  131
            G 
Sbjct  474  GF  475



>gb|ACL53721.1| unknown [Zea mays]
 gb|AFW56224.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 190/241 (79%), Gaps = 0/241 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC SGQAC++PDY++TTK  A +LL+++K  L +FYG++PL S DLSR+VNSNHF+
Sbjct  243  AGKWGCNSGQACVSPDYVVTTKSFAPKLLESLKRVLFEFYGEEPLRSPDLSRVVNSNHFN  302

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL  L+DD  VSG +  GG+ DE+RL+IAPT+L+DVP D+ +MKEEIFGPLLPI+TV+K+
Sbjct  303  RLMALMDDYSVSGNVAFGGQIDERRLRIAPTLLLDVPLDSAMMKEEIFGPLLPIITVDKI  362

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  KPLAAYLF+++ +L+Q+F   +SAGG++ NDT +H+    LPFGGVGES
Sbjct  363  GESFAVINSMPKPLAAYLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPFGGVGES  422

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G G+YHG FSF+AFSH+KAVL RSF G+  ARYPPYTP K  +LR +++G+ +  ++A  
Sbjct  423  GMGAYHGAFSFDAFSHRKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLATVQAAA  482

Query  136  G  134
            G
Sbjct  483  G  483



>ref|NP_001152171.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG46203.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   306 bits (783),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 190/241 (79%), Gaps = 0/241 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC SGQAC++PDY++TTK  A +LL+++K  L +FYG++PL S DLSR+VNSNHF+
Sbjct  243  AGKWGCNSGQACVSPDYVVTTKSFAPKLLESLKRVLFEFYGEEPLRSPDLSRVVNSNHFN  302

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL  L+DD  VSG +  GG+ DE+RL+IAPT+L+DVP D+ +MKEEIFGPLLPI+TV+K+
Sbjct  303  RLMALMDDYSVSGNVAFGGQIDERRLRIAPTLLLDVPLDSAMMKEEIFGPLLPIITVDKI  362

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  KPLAAYLF+++ +L+Q+F   +SAGG++ NDT +H+    LPFGGVGES
Sbjct  363  GESFAVINSMPKPLAAYLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPFGGVGES  422

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G G+YHG FSF+AFSH+KAVL RSF G+  ARYPPYTP K  +LR +++G+ +  ++A  
Sbjct  423  GMGAYHGAFSFDAFSHRKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLATVQAAA  482

Query  136  G  134
            G
Sbjct  483  G  483



>gb|KJB75339.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 185/230 (80%), Gaps = 0/230 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW C +GQACI+ DYIITTKE A +L+  +   +++ +GKD + SK+ SRI+NS HF
Sbjct  299  VAGKWVCNNGQACISVDYIITTKELAPKLIATLVSVVEEIFGKDLMESKERSRIINSFHF  358

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL++DKVS KIV GG+R+E +L+IAPTIL+DVPED++IM+EEIFGPLLPI+TV +
Sbjct  359  KRLVNLLEEDKVSNKIVFGGQREESQLQIAPTILLDVPEDSMIMQEEIFGPLLPIITVER  418

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPFGGVGE
Sbjct  419  LEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPFGGVGE  478

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMS  170
            SG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+S
Sbjct  479  SGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLS  528



>ref|XP_004977224.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Setaria italica]
Length=482

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 192/241 (80%), Gaps = 0/241 (0%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACI+PDYIITTK  A +LLD++   L+KFYGKDPL S DLSRIVNSNHF+
Sbjct  237  AGKWGCNNGQACISPDYIITTKSFAPKLLDSLSKVLEKFYGKDPLRSADLSRIVNSNHFN  296

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL  L+D++ V  KIV GG+ DE++LKIAPT+L+D P D+ IMKEE+FGPLLPI+TV+K+
Sbjct  297  RLKALMDEEMVYDKIVFGGQSDEQQLKIAPTLLLDPPLDSAIMKEEVFGPLLPIITVDKI  356

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGES  317
             +   +IN+  KPLAAYLF+ + KL+ +F  N+SAGG++ NDT++H+    LPFGGVGES
Sbjct  357  HESFALINSMSKPLAAYLFSKDSKLKHQFERNVSAGGMVFNDTSIHLTNQHLPFGGVGES  416

Query  316  GTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G GSYHG FSF+AF+HKKAVL RSF G+  ARYPPYTP K ++L+ ++ GN + +++A +
Sbjct  417  GVGSYHGTFSFDAFAHKKAVLDRSFLGEAKARYPPYTPGKLKILKGVLKGNPLAMVQAAV  476

Query  136  G  134
            G
Sbjct  477  G  477



>ref|XP_010547359.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=438

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/241 (61%), Positives = 190/241 (79%), Gaps = 0/241 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACI  DY+ITTK+ A +L++A+K EL   +G++PL SKD+SRIV+S HF
Sbjct  198  IAGKWACNNGQACIGVDYVITTKDFAPKLIEALKSELVTSFGENPLESKDISRIVSSFHF  257

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L++  V+ KIV GG+++E++L+I+PTIL+DVPE + +M+EEIFGPLLPI+TV K
Sbjct  258  KRLESMLNESGVADKIVIGGQKNEEKLQISPTILLDVPEGSSMMQEEIFGPLLPIITVQK  317

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG +II ++ KPLAAYLFT+N+ L+++FV N+SAGG+ IND  LHV V  LPFGGVGE
Sbjct  318  IEDGFEIIRSKPKPLAAYLFTNNELLKKKFVENISAGGMGINDAVLHVTVDGLPFGGVGE  377

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSFE FSHKK VL RSF  D   RYPPYTPKK ++L AL+SGNL   I AL
Sbjct  378  SGMGGYHGKFSFETFSHKKGVLYRSFSWDSDLRYPPYTPKKQKVLTALLSGNLFDAILAL  437

Query  139  L  137
             
Sbjct  438  F  438



>ref|XP_001780129.1| variable substrate [Physcomitrella patens]
 gb|EDQ55048.1| variable substrate [Physcomitrella patens]
Length=500

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 178/240 (74%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWG  +GQACI+PDYI+  +  A +L+D +K  ++ FYGK+P+ S +LSRIVN+ H+ RL
Sbjct  259  KWGNNNGQACISPDYILVDESIASELVDNLKEIIETFYGKNPISSTNLSRIVNTKHYLRL  318

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
               L+D ++  KIVHGGERDEK+L IAPT++ D   D+ +M EEIFGP+LPI+ V   ++
Sbjct  319  ISFLEDPQICSKIVHGGERDEKKLYIAPTLVCDALMDSFLMSEEIFGPILPIIKVQGEQE  378

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I IINAR KPLAAY+FT+NK +E+  V N+S+GG+++NDT +H     LPFGGVGESG 
Sbjct  379  AIDIINARPKPLAAYVFTTNKAVEERMVKNVSSGGMVVNDTVMHFVNPGLPFGGVGESGM  438

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            GSYHGKFSF+AFSHKKAVL R+  GD  ARYPP+T KK   LR ++ G+ I  I +L GL
Sbjct  439  GSYHGKFSFDAFSHKKAVLYRTSLGDFPARYPPFTTKKQNFLRCVLDGDYIGAILSLTGL  498



>ref|XP_010093107.1| Aldehyde dehydrogenase family 3 member I1 [Morus notabilis]
 gb|EXB53545.1| Aldehyde dehydrogenase family 3 member I1 [Morus notabilis]
Length=588

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/315 (49%), Positives = 199/315 (63%), Gaps = 73/315 (23%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW   +GQACIA DYIITTK+ A  L+D+++ EL++ +G++PL ++D+SRIVN  HF
Sbjct  272  IAGKWALNNGQACIAIDYIITTKDFAPTLIDSLRRELEQSFGQNPLETRDVSRIVNKYHF  331

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL KLLD+DKVS KIV GG+ +E +L+IAPTIL+DVP+D  IMKEEIFGP LPI+TV K
Sbjct  332  SRLLKLLDEDKVSDKIVLGGQSNEDQLRIAPTILLDVPDDTEIMKEEIFGPFLPIVTVEK  391

Query  499  VEDGIKIINARDKPLAAYL-----------------------------FTSNKKLEQEFV  407
            +ED   +IN+R +PL AYL                             FT+N +L++++V
Sbjct  392  IEDSFDVINSRPQPLVAYLFTNNDQLKKDYVQNVSSGGMLVNDTVLHIFTNNDQLKKDYV  451

Query  406  TNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSFEAFSHKKAVLKRS------  245
             N+S+GG+L+NDT LHV V  LPFGGVGESG GSYHGKFSF+ FSHKK+V+ R       
Sbjct  452  QNVSSGGMLVNDTVLHVTVDGLPFGGVGESGMGSYHGKFSFDGFSHKKSVMYRGFEPDAS  511

Query  244  -------FGG-------------------------------DLGARYPPYTPKKARLLRA  179
                   FGG                               D   RYPPYTP+K RLL+A
Sbjct  512  VTVDGLPFGGVGESGMGSYHGKFSFDGFSHKKSVMYRGFEPDASVRYPPYTPQKQRLLKA  571

Query  178  LMSGNLIFIIRALLG  134
            L+SG ++ II+AL+G
Sbjct  572  LLSGKILAIIQALIG  586



>ref|XP_010547357.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010547358.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=540

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/241 (61%), Positives = 190/241 (79%), Gaps = 0/241 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KW C +GQACI  DY+ITTK+ A +L++A+K EL   +G++PL SKD+SRIV+S HF
Sbjct  300  IAGKWACNNGQACIGVDYVITTKDFAPKLIEALKSELVTSFGENPLESKDISRIVSSFHF  359

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  +L++  V+ KIV GG+++E++L+I+PTIL+DVPE + +M+EEIFGPLLPI+TV K
Sbjct  360  KRLESMLNESGVADKIVIGGQKNEEKLQISPTILLDVPEGSSMMQEEIFGPLLPIITVQK  419

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDG +II ++ KPLAAYLFT+N+ L+++FV N+SAGG+ IND  LHV V  LPFGGVGE
Sbjct  420  IEDGFEIIRSKPKPLAAYLFTNNELLKKKFVENISAGGMGINDAVLHVTVDGLPFGGVGE  479

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSFE FSHKK VL RSF  D   RYPPYTPKK ++L AL+SGNL   I AL
Sbjct  480  SGMGGYHGKFSFETFSHKKGVLYRSFSWDSDLRYPPYTPKKQKVLTALLSGNLFDAILAL  539

Query  139  L  137
             
Sbjct  540  F  540



>ref|XP_002978104.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
 gb|EFJ20761.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
Length=479

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 173/240 (72%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWG  +GQAC++PDY++     + + ++AMK  L  FYG++P  S D+SR+VN NHF+RL
Sbjct  238  KWGNNNGQACVSPDYVLVDSSCSTKFIEAMKDTLKSFYGENPRESMDISRVVNINHFNRL  297

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
              LLDD  ++ KI HGGE+DE +L IAPT+L DVP D+ +M EEIFGP+LPI++V  +++
Sbjct  298  VGLLDDPNIASKIAHGGEKDETKLYIAPTLLEDVPLDSKVMSEEIFGPILPIISVRSIDE  357

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I I+N+R KPLA YLFT   K++++ +   SAGG+++ND  LH    TLPFGGVGESG 
Sbjct  358  AIDIVNSRPKPLALYLFTKKDKVKEKVIAETSAGGMVVNDCCLHFLTTTLPFGGVGESGM  417

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            GSYHGKFSF+AFSH KA+L R F  D+ ARYPPY+  K   +R L+  + + +I  LLGL
Sbjct  418  GSYHGKFSFDAFSHHKAILTRPFWMDIMARYPPYSAHKKTFIRCLLEADFVGVILCLLGL  477



>ref|XP_002966639.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
 gb|EFJ32666.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
Length=479

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 173/240 (72%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWG  +GQAC++PDY++     + + ++AMK  L  FYG++P  S D+SR+VN NHF+RL
Sbjct  238  KWGNNNGQACVSPDYVLVDSSCSTKFIEAMKDTLKSFYGENPRESMDISRVVNINHFNRL  297

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
              LLDD  ++ KI HGGE+DE +L IAPT+L DVP D+ +M EEIFGP+LPI++V  +++
Sbjct  298  VGLLDDPNIASKIAHGGEKDETKLYIAPTLLEDVPLDSKVMSEEIFGPILPIISVRSIDE  357

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I I+N+R KPLA YLFT   K++++ +   SAGG+++ND  LH    TLPFGGVGESG 
Sbjct  358  AIDIVNSRPKPLALYLFTKKDKVKEKVIAETSAGGMVVNDCCLHFLTTTLPFGGVGESGM  417

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            GSYHGKFSF+AFSH KA+L R F  D+ ARYPPY+  K   +R L+  + + +I  LLGL
Sbjct  418  GSYHGKFSFDAFSHHKAILTRPFWMDIMARYPPYSAHKKTFIRCLLEADFVGVILCLLGL  477



>ref|XP_001764841.1| variable substrate [Physcomitrella patens]
 gb|EDQ70283.1| variable substrate [Physcomitrella patens]
Length=492

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 178/240 (74%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWGC +GQACIAPDY++  +  A +++D +   ++ FYGKDP  S+DLSRIVN+ H+SRL
Sbjct  251  KWGCNNGQACIAPDYLLIDEIIASEVVDTLIDVIETFYGKDPKTSQDLSRIVNTKHYSRL  310

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
               LDD K+S KIVHGG RD+ +L I+PT++ DVP D+ +M EEIFGP+LPI+ V  V++
Sbjct  311  AGFLDDPKISSKIVHGGARDDNKLYISPTLVCDVPMDSTLMSEEIFGPILPIIKVKGVQE  370

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I II+ R KPL AY+FT NK++E+  V ++S+GG+++NDT +H     LPFGGVGESG 
Sbjct  371  AIDIISDRPKPLVAYVFTKNKEVEKRIVASISSGGMVVNDTIVHFLNPGLPFGGVGESGM  430

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
             SYHGKFSF+AFSHKKAVL R+  GD+ AR+PP+T  K    RA+M G+ +  + +L GL
Sbjct  431  SSYHGKFSFDAFSHKKAVLYRNNLGDVPARFPPFTTMKQNFRRAIMDGHYLSAVISLTGL  490



>ref|XP_002978037.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
 gb|EFJ20694.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
Length=480

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 171/238 (72%), Gaps = 0/238 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWG  + QACI+PDYI+  +    +L+ A+K  L +FYG DP  SKD++R+VN +HF RL
Sbjct  238  KWGNNNAQACISPDYILADESVVPKLITAIKECLLEFYGDDPSKSKDIARVVNGSHFERL  297

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
            T LLD+D V  KIV GG RD  +L IAPT+++D P D+ +M EEIFGPLLP++ V+ +E 
Sbjct  298  TGLLDEDGVKDKIVFGGARDSNKLFIAPTVILDPPADSAVMTEEIFGPLLPVIPVDSMES  357

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             +  +N R KPLA YLFT +K LE++ V+  SAGG+++NDT LH    T+PFGGVG SG 
Sbjct  358  AMSFVNTRPKPLALYLFTRDKALEKKVVSETSAGGMVVNDTVLHFVTETMPFGGVGHSGM  417

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G+YHGKFSF+AFSH+KAVL R F GD+ +RYPPYT  K   ++  + GN +  I+ALL
Sbjct  418  GAYHGKFSFDAFSHRKAVLYRGFWGDMASRYPPYTIAKQTFVKNFLQGNYLEAIKALL  475



>ref|XP_002966702.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
 gb|EFJ32729.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
Length=480

 Score =   279 bits (714),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 170/238 (71%), Gaps = 0/238 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWG  + QACI+PDYI+  +    +L+ A+K  L +FYG DP  SKD++R+VN +HF RL
Sbjct  238  KWGNNNAQACISPDYILADESVVPKLITAIKECLLEFYGDDPSRSKDIARVVNGSHFERL  297

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
            T LLD+D V  KIV GG RD  +L IAPT+++D P D+ +M EEIFGPLLP++ V+ +E 
Sbjct  298  TGLLDEDGVKDKIVFGGARDSNKLFIAPTVILDPPADSAVMTEEIFGPLLPVIPVDSMES  357

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             +  +N R KPLA YLFT +K LE++ V+  SAGG+++NDT LH    T+PFGGVG SG 
Sbjct  358  AMSFVNTRPKPLALYLFTRDKALEKKVVSETSAGGMVVNDTVLHFVTETMPFGGVGHSGM  417

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALL  137
            G+YHGKFSF+AFSH+KAVL R F  D+ +RYPPYT  K   +R  + GN +  I+ALL
Sbjct  418  GAYHGKFSFDAFSHRKAVLYRGFWADMASRYPPYTIAKQNFVRNFLQGNYLEAIKALL  475



>ref|XP_004977223.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Setaria italica]
Length=520

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/279 (53%), Positives = 193/279 (69%), Gaps = 38/279 (14%)
 Frame = -3

Query  856  AXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFS  677
            A KWGC +GQACI+PDYIITTK  A +LLD++   L+KFYGKDPL S DLSRIVNSNHF+
Sbjct  237  AGKWGCNNGQACISPDYIITTKSFAPKLLDSLSKVLEKFYGKDPLRSADLSRIVNSNHFN  296

Query  676  RLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKV  497
            RL  L+D++ V  KIV GG+ DE++LKIAPT+L+D P D+ IMKEE+FGPLLPI+TV+K+
Sbjct  297  RLKALMDEEMVYDKIVFGGQSDEQQLKIAPTLLLDPPLDSAIMKEEVFGPLLPIITVDKI  356

Query  496  EDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHT---------  344
             +   +IN+  KPLAAYLF+ + KL+ +F  N+SAGG++ NDT++HV  +          
Sbjct  357  HESFALINSMSKPLAAYLFSKDSKLKHQFERNVSAGGMVFNDTSIHVRKNCTEPELQSVS  416

Query  343  -----------------------------LPFGGVGESGTGSYHGKFSFEAFSHKKAVLK  251
                                         LPFGGVGESG GSYHG FSF+AF+HKKAVL 
Sbjct  417  ELRILFSFITDGCSLPYKLVATLQLTNQHLPFGGVGESGVGSYHGTFSFDAFAHKKAVLD  476

Query  250  RSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  134
            RSF G+  ARYPPYTP K ++L+ ++ GN + +++A +G
Sbjct  477  RSFLGEAKARYPPYTPGKLKILKGVLKGNPLAMVQAAVG  515



>ref|XP_001757163.1| variable substrate [Physcomitrella patens]
 gb|EDQ78022.1| variable substrate [Physcomitrella patens]
Length=479

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 174/239 (73%), Gaps = 0/239 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            K+G  +GQACI+PDY++  +  A  L+  ++  L +FYG DP  S DL+RI+N NHF RL
Sbjct  238  KYGSNAGQACISPDYVLVEEHFAPTLIKQLQKTLLEFYGPDPSASVDLARIINKNHFQRL  297

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
            + +LDD  ++ KIVHGGERDEK L IAPT++ + P D+ +M EEIFGP+LPI+TV  V+ 
Sbjct  298  SSMLDDPSIADKIVHGGERDEKSLYIAPTLIDNPPLDSPVMVEEIFGPMLPIITVRNVDH  357

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             + IIN + KPL  Y+F++NK L   F    S+GG+++ND  L   +  LPFGGVGESGT
Sbjct  358  ALNIINDKPKPLEVYVFSNNKDLFNRFRDETSSGGIVMNDCVLQFIIPELPFGGVGESGT  417

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  134
            G+YHGK +F+AFSH+KAVL ++ GGD+ ARYPP+T +K  L++AL++G +I II A LG
Sbjct  418  GAYHGKATFDAFSHRKAVLVKNMGGDVFARYPPFTVRKQSLIKALLTGTIIDIILAALG  476



>gb|EPS67391.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=432

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 160/207 (77%), Gaps = 1/207 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            ++ KWGC SGQ C+ PDY+IT+++ +L+L+DA+  ELD F   DPL S D +RIVNS HF
Sbjct  226  VSGKWGCNSGQTCVCPDYVITSRDYSLKLIDAISSELDNFCSGDPLQSDDSTRIVNSGHF  285

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL +LL+D K+SGKIV GG+ D+ +LKI+PT++MD P+D+L+M EEIFGPLLPI+TV  
Sbjct  286  ERLVRLLEDPKISGKIVIGGKWDKAKLKISPTVIMDAPKDSLVMNEEIFGPLLPIITVED  345

Query  499  VEDGIKIINAR-DKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVG  323
            +E+ I +IN + +KPLAAY+FT N+KL  +F+ N+SAG + IND  L V    LPFGGVG
Sbjct  346  IEESIAVINGKGNKPLAAYIFTRNEKLRDDFIRNVSAGSMAINDVNLQVVEPELPFGGVG  405

Query  322  ESGTGSYHGKFSFEAFSHKKAVLKRSF  242
            ESG G YHGKFSF+AFSH+K VL R F
Sbjct  406  ESGMGCYHGKFSFDAFSHRKPVLDRHF  432



>gb|KDO80591.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=434

 Score =   262 bits (670),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KWGC +GQACI+PD+IITTK+ A +LL+++K EL+ FYGK+PL SKDLSRIVNSNHF
Sbjct  248  IMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHF  307

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLDDDKVSGKIVHGGERD+ +L+IAPT+L+DVP D+LIM EEIFGPLLPILTV+K
Sbjct  308  ARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDK  367

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTL  341
            +ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+HV +  L
Sbjct  368  IEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHVIMLAL  420



>gb|KHN21904.1| Aldehyde dehydrogenase family 3 member F1 [Glycine soja]
Length=446

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 160/227 (70%), Gaps = 0/227 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  K+G  +GQACI  DY++  K   L+L++ MKV + K +G++P  SK +++IVN +HF
Sbjct  192  IVGKYGTCAGQACITIDYVLVEKGYCLKLVELMKVWIKKMFGQNPRKSKTIAKIVNKHHF  251

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL  LL D +V G +V+GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K
Sbjct  252  SRLKNLLADKQVKGSVVYGGSMDEQNLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEK  311

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED IK INAR KPLA Y+FT N  L++  ++  S+G + IND  L  A  T+PFGGVGE
Sbjct  312  IEDSIKFINARPKPLALYVFTKNHTLQRRMISETSSGSVTINDAVLQYAADTIPFGGVGE  371

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  179
            SG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  372  SGFGMYHGKFSFDTFSHQKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  418



>ref|XP_003539064.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Glycine 
max]
Length=494

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 160/227 (70%), Gaps = 0/227 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  K+G  +GQACI  DY++  K   L+L++ MKV + K +G++P  SK +++IVN +HF
Sbjct  240  IVGKYGTCAGQACITIDYVLVEKGYCLKLVELMKVWIKKMFGQNPRKSKTIAKIVNKHHF  299

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL  LL D +V G +V+GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K
Sbjct  300  SRLKNLLADKQVKGSVVYGGSMDEQNLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEK  359

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED IK INAR KPLA Y+FT N  L++  ++  S+G + IND  L  A  T+PFGGVGE
Sbjct  360  IEDSIKFINARPKPLALYVFTKNHTLQRRMISETSSGSVTINDAVLQYAADTIPFGGVGE  419

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  179
            SG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  420  SGFGMYHGKFSFDTFSHQKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  466



>ref|XP_001767194.1| variable substrate [Physcomitrella patens]
 gb|EDQ68115.1| variable substrate [Physcomitrella patens]
Length=485

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 165/243 (68%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A K+G  SGQACI+PDYI+  +  A +L+   +  L +F+G+DP  SKDLSRIVN NHF
Sbjct  241  MAGKYGSNSGQACISPDYILVEEHLAPKLIKQFRSTLVEFFGEDPRTSKDLSRIVNKNHF  300

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL++LLDD   + +IVHGGERDE  L IAPT++ D   D+ IM +EIFGPLLPI+TV  
Sbjct  301  QRLSRLLDDPATADRIVHGGERDEDSLYIAPTLIEDPALDSPIMADEIFGPLLPIITVRN  360

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            V   I +IN + K L  +LF++NK   + F    S+GGL++ND  +   V  LPFGGVGE
Sbjct  361  VNAAIDLINDKPKALVVHLFSTNKDYVKMFTEETSSGGLVMNDCIMQFIVPELPFGGVGE  420

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SGTG+YHGK SF+ FSH K++  +S  GD   RYPP+T  K  +LRA + G    +I+ L
Sbjct  421  SGTGAYHGKASFDTFSHFKSIFNKSQSGDAPIRYPPFTLWKQAMLRAFLEGRFFKLIQLL  480

Query  139  LGL  131
            LGL
Sbjct  481  LGL  483



>ref|XP_003539464.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Glycine 
max]
Length=494

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 160/227 (70%), Gaps = 0/227 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  K+G  +GQACIA DY++  K    +L++ MKV + K  G++P  SK +++IVN +HF
Sbjct  240  IVGKYGACAGQACIAIDYVLVEKVYCFKLVELMKVWIKKMCGENPQQSKTIAKIVNKHHF  299

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL  LL D KV   +++GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K
Sbjct  300  SRLKNLLADKKVKESVIYGGSMDEQNLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEK  359

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED IK IN+R KPLA Y+FT N+ L++  ++  S+G + IND  L  AV T+PFGGVGE
Sbjct  360  IEDSIKFINSRPKPLALYVFTKNQTLQRRMISETSSGSVTINDAILQYAVDTVPFGGVGE  419

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  179
            SG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  420  SGFGMYHGKFSFDTFSHQKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  466



>gb|KJB29204.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=415

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            IA KWGC +GQACI+PDYIIT K+ A +L+D+ K EL++FYGK+PL SKDLSRIVNSNHF
Sbjct  245  IAGKWGCNNGQACISPDYIITMKDYAQKLIDSFKCELERFYGKNPLESKDLSRIVNSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+KLLD+DKVS KIVHGGERD++ LKI PTIL+DVP D+LIM EEIFGPLLP+  V+K
Sbjct  305  ARLSKLLDEDKVSSKIVHGGERDKENLKITPTILLDVPRDSLIMNEEIFGPLLPVFLVDK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHV  356
            VED   +IN+  KPLAAYLFT+ KKL+++FV  +SAGGL+INDT +HV
Sbjct  365  VEDSFDVINSGTKPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHV  412



>ref|XP_007132014.1| hypothetical protein PHAVU_011G059400g [Phaseolus vulgaris]
 gb|ESW04008.1| hypothetical protein PHAVU_011G059400g [Phaseolus vulgaris]
Length=492

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 159/227 (70%), Gaps = 0/227 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  K+G  +GQACIA DY++  K+   +L++ MKV + K +G++P  SK +++IVN +HF
Sbjct  238  IVGKFGTCAGQACIAIDYVLVEKKYCSKLVELMKVWIKKMFGENPQHSKTITKIVNKHHF  297

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL  LL D  V   +V+GG  DE+ L I PTIL+D P +A IM EEIFGPLLPI+TV K
Sbjct  298  SRLNNLLTDKMVKESVVYGGSMDEENLFIEPTILVDPPLEAAIMSEEIFGPLLPIITVEK  357

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED IK I++R KPLA Y+F+ NK LE+  V+  S+G L  ND  +  A  TLPFGGVGE
Sbjct  358  IEDSIKFISSRPKPLALYVFSRNKTLERRMVSETSSGSLTFNDAIVQYAADTLPFGGVGE  417

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  179
            SG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  418  SGFGMYHGKFSFDTFSHQKAIVRRSFLTDFWFRYPPWTLNKLQLLEV  464



>ref|XP_004502484.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Cicer arietinum]
Length=422

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I+ KWGC +GQACI+PDYIITTK+ A  L+DA+K EL+ F+GK+PL S DLSRIV+SNHF
Sbjct  245  ISGKWGCNNGQACISPDYIITTKDFAPLLVDALKTELENFFGKNPLESNDLSRIVSSNHF  304

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KL+D+DKVS KIV+GG +DE +L+IAPTIL+DVP D+LIM EEIFGPLLPI+TVNK
Sbjct  305  NRLIKLMDEDKVSDKIVYGGAKDESKLRIAPTILLDVPRDSLIMSEEIFGPLLPIITVNK  364

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHV  356
            +E+   +IN+  KPLAAYLFT++ K +++FV  +SAGGLLINDT LHV
Sbjct  365  LEESFDVINSGTKPLAAYLFTNDNKFKEQFVKKVSAGGLLINDTVLHV  412



>ref|XP_001770374.1| variable substrate [Physcomitrella patens]
 gb|EDQ64864.1| variable substrate [Physcomitrella patens]
Length=466

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 164/243 (67%), Gaps = 1/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            ++ K+   +GQACIAPDYI+  +  A +L+  ++  L +FYG+DP  +KDL+RIVN NHF
Sbjct  223  MSGKFSSNNGQACIAPDYILVEEHLAPKLIKQLQSTLVQFYGEDPRSTKDLARIVNKNHF  282

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL++LLD    +  I+HGGERDE+ L IAPT++ D P  + IM+EEIFGPLLPI+T + 
Sbjct  283  QRLSRLLDHPSTAENIIHGGERDEESLYIAPTLIKDPPLSSPIMEEEIFGPLLPIIT-DH  341

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            V+  + +IN + K L  YLF++ K    +F    S+GGL++ND  +  AV  LPFGGVGE
Sbjct  342  VDAAVDLINDKPKALEIYLFSTRKDYAMKFAEETSSGGLVMNDCIVQFAVSELPFGGVGE  401

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SGTG+YHG  SF  FSH K++  +S G D+  RYPP+T +K  ++RA + G  +  I   
Sbjct  402  SGTGAYHGVASFNTFSHYKSIFNKSLGVDVAFRYPPFTTQKQGMMRAFLEGRFVNFILLA  461

Query  139  LGL  131
            LGL
Sbjct  462  LGL  464



>gb|AFK41010.1| unknown [Lotus japonicus]
Length=293

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 151/224 (67%), Gaps = 0/224 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            K+G  +GQACIA  Y++      L+L++ MKV + K +G+ P  S  ++RIVN  HF RL
Sbjct  43   KYGTCAGQACIAVYYVLVENRYCLKLVELMKVWIKKMFGEVPQHSNSIARIVNEKHFFRL  102

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
              LL D KV   +V+GG  DE+ L I PTIL++ P DA IM +EIFGPLLPI+T++K+ED
Sbjct  103  KNLLTDQKVLKSVVYGGSVDEENLFIEPTILVNPPLDAAIMSDEIFGPLLPIITLDKIED  162

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             +  IN+  KPLA Y+FT NK L+   ++  S+G L+ ND+ L  A  TLPFGGVGESG 
Sbjct  163  SVNFINSMPKPLALYVFTKNKTLQNRMISETSSGSLMFNDSMLQYAADTLPFGGVGESGF  222

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  179
            G YHGKFSF+ FSH K +++RS+  D   RYPP+T  K +LL  
Sbjct  223  GMYHGKFSFDTFSHHKGIVRRSYLTDFWYRYPPWTLNKFQLLEV  266



>ref|XP_002298405.2| hypothetical protein POPTR_0001s26630g [Populus trichocarpa]
 gb|EEE83210.2| hypothetical protein POPTR_0001s26630g [Populus trichocarpa]
Length=485

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 160/243 (66%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+G  +GQACIA DYI+  K  A  L++ MKV + K +G++P  +  ++RIVN  HF
Sbjct  239  LVSKFGACAGQACIAIDYILVEKRFASILVELMKVMIKKMFGENPRETNTVARIVNEQHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D  V   IV+GG  DEK L + PTIL+D P DA IM EEIFGPLLPI+T++K
Sbjct  299  LRLKNLLSDSAVQNSIVYGGSMDEKNLFVEPTILVDPPLDAAIMTEEIFGPLLPIITLDK  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED I  IN++ KPLA Y FT+N+K  +  ++  S+G L+ ND  +  A   LPFGG+GE
Sbjct  359  VEDSIAFINSKPKPLAIYAFTNNEKFRRRMLSETSSGSLVFNDAVIQYAADALPFGGIGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF+ FSH KAV +RSF  D   R+PP+   K  LL A  + + + ++  +
Sbjct  419  SGIGKYHGKFSFDTFSHYKAVTRRSFLTDFWFRFPPWNDYKLLLLEATYNYDYLGMLLVI  478

Query  139  LGL  131
            LGL
Sbjct  479  LGL  481



>ref|XP_010045018.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
 gb|KCW87156.1| hypothetical protein EUGRSUZ_B03683 [Eucalyptus grandis]
Length=487

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 162/243 (67%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+   +GQACIA DY+I  K+ +  LL+ MKV + K  G++P  S+ ++RIVN +HF
Sbjct  239  VGSKFSACAGQACIAIDYVIVEKKFSSTLLELMKVRIGKMLGENPRESRSMARIVNKHHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL+D  V   IV+GG  DEK L I PTIL+D P ++ +M++EIFGPLLPI+T+ K
Sbjct  299  LRLKTLLEDPNVKASIVYGGSMDEKSLFIEPTILLDPPLESDLMQDEIFGPLLPIITLKK  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I  IN+R KPLA Y+FT N  L +  V   S+G +  ND  +     TLPFGG+GE
Sbjct  359  IEDSINFINSRPKPLALYVFTHNDSLRKRMVAETSSGSVTFNDAMIQYMADTLPFGGIGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G+YHGKFSF+ FSH KAVL+RSF  D   R+PP+   K +L R++   + + ++  +
Sbjct  419  SGMGNYHGKFSFDTFSHHKAVLRRSFLVDFWFRFPPWNDHKLQLFRSVYLFDYLGMLLTV  478

Query  139  LGL  131
            LGL
Sbjct  479  LGL  481



>dbj|BAJ96457.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 167/244 (68%), Gaps = 5/244 (2%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  KW   +GQACIA DYI+  ++ A  L++ +K  L++F+ K     +D++RIVN   F
Sbjct  244  IGGKWSTCAGQACIAIDYILVEEQFAPILIELLKSTLERFFTK----PEDMARIVNERQF  299

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL+ LL+D KVS  IVHGG+ D K L I PTIL++ P D+ +M EEIFGPLLPI+TV K
Sbjct  300  NRLSGLLEDHKVSCSIVHGGDLDPKTLSIEPTILLNPPLDSDVMTEEIFGPLLPIITVKK  359

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I+ +N+R KPLA Y FT+++ L+Q+ +   S+G +  ND  +   + ++PFGGVG+
Sbjct  360  IEDSIEFVNSRPKPLAIYAFTTSEALKQQIIKETSSGSVTFNDAIVQYGLESIPFGGVGQ  419

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPK-KARLLRALMSGNLIFIIRA  143
            SG G YHGK+SFE FSHKKAV +RSF  +   RYPP+  + K  LLR +   + + ++ A
Sbjct  420  SGFGQYHGKYSFEMFSHKKAVFRRSFLVEFMFRYPPWNDESKLGLLRHVFRYDYVSLVLA  479

Query  142  LLGL  131
            LLGL
Sbjct  480  LLGL  483



>ref|XP_011006203.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X1 [Populus euphratica]
Length=485

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 157/243 (65%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+G  +GQACIA DYI+  K  A  L++ MKV + K +G+ P  +  ++RIVN  HF
Sbjct  239  LVSKFGACAGQACIAIDYILVEKRFASTLVELMKVLIKKMFGETPRETNTVARIVNEQHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D  V   +V+GG  DE+ L + PTIL+D P DA IM EEIFGPLLP++T++K
Sbjct  299  LRLKNLLSDSAVRNSVVYGGSMDERNLFVEPTILVDPPLDAAIMTEEIFGPLLPVITLDK  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED I  IN++ KPLA Y F++N+K  +   +  S+G L+ ND  +  A   LPFGG+GE
Sbjct  359  VEDSIAFINSKPKPLAIYAFSNNEKFRRRISSETSSGSLVFNDAVIQYAAEGLPFGGIGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF+ FSH KAV KRSF  D   R+PP+   K  LL A    + + ++  +
Sbjct  419  SGLGKYHGKFSFDTFSHYKAVTKRSFLTDFWFRFPPWNDYKLLLLEATYYSDYLGMLLVI  478

Query  139  LGL  131
            LGL
Sbjct  479  LGL  481



>ref|XP_004507095.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cicer 
arietinum]
Length=488

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 154/227 (68%), Gaps = 0/227 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  K+G  SGQA IA DY+I  + N  ++++ MK+ + K +G +P  SK ++RIVN  H 
Sbjct  236  IVGKYGTCSGQARIAIDYVIVERSNCSKVVELMKMWIKKMFGDNPKHSKSIARIVNKQHL  295

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D KV   +V GG  DE+ L + PTIL++ P DA IM +E+FGPLLPI+TV K
Sbjct  296  FRLKNLLTDKKVQKSVVCGGSVDEENLFVEPTILVNPPLDATIMTDEVFGPLLPIITVEK  355

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I+ I+ R KPLA Y+FT N+ L++  ++  S+G ++ ND  L  A  +LPFGGVGE
Sbjct  356  IEDSIEFISCRPKPLALYVFTKNQTLQKRMISETSSGSVVFNDAILQYAADSLPFGGVGE  415

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  179
            SG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+ P K +LL  
Sbjct  416  SGFGMYHGKFSFDTFSHQKAIVRRSFFTDFWYRYPPWKPHKFQLLEV  462



>ref|XP_011006204.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like isoform 
X2 [Populus euphratica]
Length=485

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 157/243 (65%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+G  +GQACIA DYI+  K  A  L++ MKV + K +G+ P  +  ++RIVN  HF
Sbjct  239  LVSKFGACAGQACIAIDYILVEKRFASTLVELMKVLIKKMFGETPRETNTVARIVNEQHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D  V   +V+GG  DE+ L + PTIL+D P DA IM EEIFGPLLP++T++K
Sbjct  299  LRLKNLLSDSAVRNSVVYGGSMDERNLFVEPTILVDPPLDAAIMTEEIFGPLLPVITLDK  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            VED I  IN++ KPLA Y F++N+K  +   +  S+G L+ ND  +  A   LPFGG+GE
Sbjct  359  VEDSIAFINSKPKPLAIYAFSNNEKFRRRISSETSSGSLVFNDAVIQYAAEGLPFGGIGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF+ FSH KAV KRSF  D   R+PP+   K  LL A    + + ++  +
Sbjct  419  SGLGKYHGKFSFDTFSHYKAVTKRSFLTDFWFRFPPWNDYKLLLLEATYYSDYLGMLLVI  478

Query  139  LGL  131
            LGL
Sbjct  479  LGL  481



>ref|XP_009768441.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nicotiana 
sylvestris]
Length=481

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 162/243 (67%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A K+G  +GQACI  DYI+  K  A +L+  +K  + K +G++P  S  +SRI+N  HF
Sbjct  236  LAGKFGTCAGQACIGIDYILVEKTYANELVQLIKDAIPKTFGENPKESHSISRIINRTHF  295

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LLD+ KV   IV+GG  DE  L I PT+L+D P  A IM EEIFGPLLPI+T++K
Sbjct  296  LRLKNLLDEPKVKASIVYGGSTDEDNLFIEPTVLLDPPLKAAIMTEEIFGPLLPIITLDK  355

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I+ INAR K L  Y FT ++ L+++ ++  S+G ++ NDT +  AV TLPFGGVG+
Sbjct  356  IEDSIEFINARPKTLTIYAFTKDEALKKKIISRTSSGSVVFNDTIIQYAVDTLPFGGVGQ  415

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF+ FSH+K V +RSF  D+  RYPP+  K  +L R+    + + ++   
Sbjct  416  SGFGRYHGKFSFDTFSHEKTVARRSFLTDIWFRYPPWNNKSLQLFRSAYRYDYLSVVLIT  475

Query  139  LGL  131
            LGL
Sbjct  476  LGL  478



>gb|KDO71077.1| hypothetical protein CISIN_1g0386172mg, partial [Citrus sinensis]
Length=361

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 155/226 (69%), Gaps = 0/226 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  K+   +GQ C+  DYI+  K+ A  L++++K  + KFYG++P  SK +SRI+N  HF
Sbjct  117  IGGKFASCNGQVCVGVDYILVEKKFAATLIESLKTTIKKFYGENPKDSKSISRIINEYHF  176

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL KLL D  V+  IVHGG  D++ L I PTIL+D P DA IM EEIFGP+LPI+T+N 
Sbjct  177  ERLRKLLKDPLVADAIVHGGLLDKENLFIEPTILLDPPLDAEIMTEEIFGPILPIITLNN  236

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++ I+ IN+R KPLA Y FT ++  +++ V+  S+G L+ NDT +      LPFGGVG+
Sbjct  237  IQESIEFINSRPKPLAIYAFTKDETFKKQIVSGTSSGSLIFNDTLVQQLCDVLPFGGVGQ  296

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  182
            SG G YHG +SFE FSH+KA+++RSF  +L  RYPP+   K + LR
Sbjct  297  SGIGRYHGHYSFETFSHEKAIMQRSFFLELEPRYPPWNDFKMKFLR  342



>ref|XP_003629375.1| Aldehyde dehydrogenase family 3 member F1 [Medicago truncatula]
 gb|AET03851.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   239 bits (609),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 154/226 (68%), Gaps = 0/226 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWG  SGQACIA DY++  ++ + +L++ +K  + KFYG + + SK LSRI+N +HF
Sbjct  238  VGAKWGVCSGQACIAIDYLLVEEKYSSELIELLKKFMRKFYGDNMMESKALSRIINKHHF  297

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D  V+  IVHGG  DE  L I PTIL+D P DA IM EEIFGPLLP++TVNK
Sbjct  298  ERLCNLLKDPLVAASIVHGGSVDETNLFIEPTILLDPPLDAEIMTEEIFGPLLPVITVNK  357

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++ I+ IN+R KPLA Y FT +   +++ V+  S+G +  NDT +     TLPFGGVG+
Sbjct  358  IQESIEFINSRPKPLAIYAFTKDATFKKKIVSETSSGSVTFNDTLVQFLCDTLPFGGVGQ  417

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  182
            SG G YHGK+SF+ FSH+KAVL R    ++  RYPP++  K   LR
Sbjct  418  SGFGRYHGKYSFDTFSHEKAVLHRHLCLEIEPRYPPWSKFKLEFLR  463



>gb|AFK48458.1| unknown [Medicago truncatula]
Length=488

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 163/247 (66%), Gaps = 4/247 (2%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWG  SGQACIA DY++  ++ + +L++ +K  + KFYG + + SK LSRI+N +HF
Sbjct  238  VGAKWGVCSGQACIAIDYLLVEEKYSSELIELLKKFMRKFYGDNMMESKALSRIINKHHF  297

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D  V+  IVHGG  DE  L I PTIL+D P DA IM EEIFGPLLP++TVNK
Sbjct  298  ERLRNLLKDPLVAASIVHGGSVDETNLFIEPTILLDPPLDAEIMTEEIFGPLLPVITVNK  357

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++ I+ IN+R KPLA Y FT +   +++ V+  S+G +  NDT +     TLPFGGVG+
Sbjct  358  IQESIEFINSRPKPLAIYAFTKDATFKKKIVSETSSGSVTFNDTLVQFLCDTLPFGGVGQ  417

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGN----LIFI  152
            SG G YHGK+SF+ FSH+KAVL R    ++  RYPP++  K   LR     N    ++ +
Sbjct  418  SGFGRYHGKYSFDTFSHEKAVLHRHLCLEIEPRYPPWSKFKLEFLRLAYRLNYFGLVLHM  477

Query  151  IRALLGL  131
            +  +LGL
Sbjct  478  VLHMLGL  484



>gb|KCW87154.1| hypothetical protein EUGRSUZ_B03682 [Eucalyptus grandis]
Length=441

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 151/228 (66%), Gaps = 0/228 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+   +GQACIA DY++   + +  LL+ MKV + K  G++P  S  ++RIVN NHF
Sbjct  193  LGSKFSACAGQACIAIDYVLVETKFSSTLLELMKVWIGKMLGENPRESHSMARIVNKNHF  252

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL  LL+D  V   IV+GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K
Sbjct  253  SRLKTLLEDPNVKASIVYGGSMDENSLFIEPTILLDPPLESDLMQDEIFGPLLPIITLKK  312

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I  IN+R KPLA Y FT N  L +  V   S+G +  ND  +     TLPFGG+GE
Sbjct  313  IEDSINFINSRPKPLAIYAFTHNDSLRKRMVAETSSGSVTFNDAMIQYMADTLPFGGIGE  372

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRAL  176
            SG G+YHGKFSF+ FSH KAVL+RSF  D   R+PP+   K +L R++
Sbjct  373  SGMGNYHGKFSFDTFSHHKAVLRRSFLVDFWFRFPPWNDHKLQLFRSM  420



>gb|KCW56679.1| hypothetical protein EUGRSUZ_I02377 [Eucalyptus grandis]
Length=325

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 151/226 (67%), Gaps = 0/226 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWG  SGQACI+ DY++  ++ A  L+D +K+ +  FYG +P  SK++ +I+N +HF
Sbjct  81   VGAKWGPCSGQACISTDYVLVERKFAPTLIDLLKLTIKNFYGDEPRNSKNMCKIINKHHF  140

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  L+++  V+  IVHGG   EK   I P+IL+D P DA IM EEIFGPLLPI+T+N 
Sbjct  141  ERLRNLIEEPAVAASIVHGGSLHEKEQFIEPSILLDPPLDAEIMTEEIFGPLLPIITLNN  200

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            + + ++ IN+R KPL  Y FT ++  +++ V   S+GG+  NDT +      LPFGGVG+
Sbjct  201  IRESVEFINSRPKPLVIYAFTKDESFKRQLVLETSSGGVTFNDTMVQFLCDDLPFGGVGQ  260

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  182
            SG G YHGK+SFE FSH+KA++ R F  ++  RYPP+   K R +R
Sbjct  261  SGFGRYHGKYSFETFSHEKAIMTRGFFPEIEPRYPPWNRFKLRFIR  306



>ref|XP_010031796.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
 gb|KCW51187.1| hypothetical protein EUGRSUZ_J00773 [Eucalyptus grandis]
Length=495

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/243 (48%), Positives = 162/243 (67%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+   +GQACI  DY++  K+ +  L++ MKV + K +G+ P  S+ ++RIVN +HF
Sbjct  243  LGAKFSFSAGQACIGVDYVLVEKKFSSALVELMKVVMKKMFGESPRESQSVARIVNKHHF  302

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D  V   IV+GG  DE+ L I PTILMD P  A IM +EIFGPLLPI+T+NK
Sbjct  303  LRLRSLLLDPLVKSSIVYGGSMDEESLFIEPTILMDPPLQAAIMMDEIFGPLLPIVTLNK  362

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I+ IN+R KPLA Y+FT ++ L +  V+  S+G ++ ND  +     TLPFGG+GE
Sbjct  363  IEDSIEFINSRPKPLAIYVFTKDEPLRRSMVSKTSSGSIVFNDAIIQYLADTLPFGGIGE  422

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF+ FSH+KAV++RSF  D   R+PP+   K +L R+    + + I+  +
Sbjct  423  SGMGRYHGKFSFDTFSHQKAVVRRSFLVDFWFRFPPWNDHKLQLFRSSYHYDYLGIVLTV  482

Query  139  LGL  131
            LGL
Sbjct  483  LGL  485



>ref|XP_010271510.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nelumbo 
nucifera]
Length=484

 Score =   238 bits (606),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 162/240 (68%), Gaps = 0/240 (0%)
 Frame = -3

Query  850  KWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHFSRL  671
            KWG  +GQ+C+  DYI+  ++ A  L+D +K  +D+FYG+     KDL+RIVN +HF RL
Sbjct  243  KWGLCNGQSCVGVDYILVEEKFAPTLIDLLKKSIDQFYGRKAKDFKDLTRIVNRHHFERL  302

Query  670  TKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNKVED  491
              L+ D  VS  IVHGG+ D++R+ I PTIL+D P +A IM EEIFGP LPI+T+  +E+
Sbjct  303  HNLIKDPAVSDSIVHGGQVDKERMFIEPTILLDPPLEAEIMTEEIFGPFLPIITLKNIEE  362

Query  490  GIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGT  311
             I+ +++R KPL  Y FT ++ L++  ++  S+G +  ND A+      LPFGG+G+SG 
Sbjct  363  SIEFVSSRPKPLVLYAFTKDETLKRLVLSRTSSGSVTFNDIAVQFMSDDLPFGGIGQSGL  422

Query  310  GSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  131
            G YHGKFSFEAF+H+KAVL+R+F  DL +RYPP++  K   +R L   +   II   LGL
Sbjct  423  GKYHGKFSFEAFTHEKAVLRRNFIFDLESRYPPWSDFKLNFIRLLYKYDYFGIILLFLGL  482



>ref|XP_004486968.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cicer 
arietinum]
Length=494

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 161/243 (66%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+G  +GQACIA DY++  K  +  L++ MK  + K +G +P  S  ++RIVN  H 
Sbjct  240  LVAKYGACAGQACIAIDYVLVEKSFSSTLVELMKEGIKKMFGDNPKASNTIARIVNKKHS  299

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +R+  LL + KV   +V GG  D+  L I PTIL+D P D+ IM EEIF PLLPI+T+ K
Sbjct  300  NRIKSLLSEPKVKESVVFGGSMDDDDLFIEPTILLDPPLDSAIMTEEIFAPLLPIITLEK  359

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +EDGIK I ++ KPLA Y+FT +K L++  V+  S+G ++ ND  +  AV TLPFGGVGE
Sbjct  360  IEDGIKFIKSKPKPLAIYVFTKSKTLQRRMVSETSSGSIVFNDAIIQYAVDTLPFGGVGE  419

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF+ FSH KAV +RSF  D   R+PP+T +K +LL    + + I I  A+
Sbjct  420  SGLGRYHGKFSFDTFSHHKAVARRSFYTDFWFRFPPWTLEKFQLLEEAYNLDYIGIPLAI  479

Query  139  LGL  131
            LGL
Sbjct  480  LGL  482



>ref|XP_003547955.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Glycine 
max]
Length=485

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 163/243 (67%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWG  SGQACIA DY++  K+ +  L++ +K  + +FYG++P+ SK +SRI+N  HF
Sbjct  239  VGGKWGPCSGQACIAIDYLLVEKKFSYALIELLKKIIRRFYGENPVESKVISRILNKQHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D  V+  IVHGG  DE+ L I PTIL+D P D+ IM EEIFGPLLPI+T++K
Sbjct  299  ERLCNLLKDPLVAASIVHGGSVDEENLFIEPTILLDPPLDSQIMSEEIFGPLLPIITMDK  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++ I+ INA+ KPLA Y FT ++  ++  ++  S+G ++ NDT +     TLPFGGVG+
Sbjct  359  IQESIEFINAKPKPLAIYAFTKDETFKRNILSETSSGSVVFNDTMVQFLCDTLPFGGVGQ  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGK+SF+ FSH+KAV+ R    ++  RYPP++  K   +R     N   ++  +
Sbjct  419  SGFGRYHGKYSFDTFSHEKAVMHRKLFLEIEPRYPPWSKFKLEFIRLAYRLNYFGLLLHM  478

Query  139  LGL  131
            LGL
Sbjct  479  LGL  481



>gb|EAZ31491.1| hypothetical protein OsJ_15627 [Oryza sativa Japonica Group]
Length=363

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/243 (47%), Positives = 151/243 (62%), Gaps = 4/243 (2%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KW   +GQAC+A DY++  +     L+ A+K  L KF+      S  ++RIVN+ HF
Sbjct  123  VGGKWSSCAGQACLAIDYVLVEERFVPVLIKALKSTLKKFFAD----SDHMARIVNARHF  178

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL+ LL D  V+  ++HGG  D K L I PTIL++ P D+ IM EEIFGPLLPI+TV K
Sbjct  179  QRLSDLLKDKSVAASVLHGGTLDAKNLCIEPTILLNPPLDSAIMTEEIFGPLLPIITVKK  238

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I  + AR +PLA Y FT N  L +  V   S+G +  ND  +   + +LPFGGVGE
Sbjct  239  IEDSIAFVRARPRPLAVYAFTKNAALRRRIVEETSSGSVTFNDAVVQYGIDSLPFGGVGE  298

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGK+SFE FSHKKAVL R +  +L ARYPP+   K  ++R L   N +  +   
Sbjct  299  SGFGQYHGKYSFEMFSHKKAVLTRGYLIELTARYPPWDDSKISMMRQLYRYNYVGFVLTF  358

Query  139  LGL  131
            LGL
Sbjct  359  LGL  361



>gb|KHN41688.1| Aldehyde dehydrogenase family 3 member F1 [Glycine soja]
Length=511

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 163/243 (67%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWG  SGQACIA DY++  K+ +  L++ +K  + +FYG++P+ SK +SRI+N  HF
Sbjct  265  VGGKWGPCSGQACIAIDYLLVEKKFSYALIELLKKIIRRFYGENPVESKVISRILNKQHF  324

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D  V+  IVHGG  DE+ L I PTIL+D P D+ IM EEIFGPLLPI+T++K
Sbjct  325  ERLCNLLKDPLVAASIVHGGSVDEENLFIEPTILLDPPLDSQIMSEEIFGPLLPIITMDK  384

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++ I+ INA+ KPLA Y FT ++  ++  ++  S+G ++ NDT +     TLPFGGVG+
Sbjct  385  IQESIEFINAKPKPLAIYAFTKDETFKRNILSETSSGSVVFNDTMVQFLCDTLPFGGVGQ  444

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGK+SF+ FSH+KAV+ R    ++  RYPP++  K   +R     N   ++  +
Sbjct  445  SGFGRYHGKYSFDTFSHEKAVMHRKLFLEIEPRYPPWSKFKLEFIRLAYRLNYFGLLLHM  504

Query  139  LGL  131
            LGL
Sbjct  505  LGL  507



>ref|XP_009355864.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=534

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 149/194 (77%), Gaps = 6/194 (3%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +A KW   +GQACI  DYIITTK+ A +L++A+K  L++F+GKDP+ SKD+SRIV+S  F
Sbjct  316  MAGKWALNNGQACIGVDYIITTKDFAPKLIEALKYGLEQFFGKDPMNSKDISRIVSSTQF  375

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL KLLD+DKVS KIV GG+RDEK+LKIAPTIL+DVPEDA IM+EEIFGPL+PI+TV K
Sbjct  376  TRLAKLLDEDKVSNKIVLGGQRDEKQLKIAPTILLDVPEDAQIMQEEIFGPLMPIVTVEK  435

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG---  329
            +ED   +IN++ KPLA Y FT+N++L++ FV N+S+GG+LINDT LH  V  LP      
Sbjct  436  IEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHAMVSRLPDKAEKI  495

Query  328  ---VGESGTGSYHG  296
               +G  GTG   G
Sbjct  496  QKQIGVLGTGEVEG  509



>ref|XP_006425564.1| hypothetical protein CICLE_v10025492mg [Citrus clementina]
 gb|ESR38804.1| hypothetical protein CICLE_v10025492mg [Citrus clementina]
Length=484

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 156/226 (69%), Gaps = 0/226 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  K+   +GQ C+  DYI+  K+ A  L++++K  + KFYG++P  SK +SRI+N  HF
Sbjct  240  IGGKFASCNGQVCVGVDYILVEKKFAATLIESLKTTIKKFYGENPKDSKSISRIINEYHF  299

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL KLL+D  V+  IVHGG  D++ L I PTIL+D P DA IM EEIFGP+LPI+T+N 
Sbjct  300  ERLRKLLEDPLVADAIVHGGLLDKENLFIEPTILLDPPLDAEIMTEEIFGPILPIITLNN  359

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++ I+ IN+R KPLA Y FT ++  +++ V+  S+G L+ NDT +      LPFGGVG+
Sbjct  360  IQESIEFINSRPKPLAIYAFTKDETFKKQIVSGTSSGSLIFNDTLVQQLCDVLPFGGVGQ  419

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  182
            SG G YHG +SFE FSH+KA+++RSF  +L  RYPP+   K + LR
Sbjct  420  SGIGRYHGHYSFETFSHEKAIMQRSFFLELEPRYPPWNDFKMKFLR  465



>ref|XP_010045016.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=487

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 151/228 (66%), Gaps = 0/228 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+   +GQACIA DY++   + +  LL+ MKV + K  G++P  S  ++RIVN NHF
Sbjct  239  LGSKFSACAGQACIAIDYVLVETKFSSTLLELMKVWIGKMLGENPRESHSMARIVNKNHF  298

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            SRL  LL+D  V   IV+GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K
Sbjct  299  SRLKTLLEDPNVKASIVYGGSMDENSLFIEPTILLDPPLESDLMQDEIFGPLLPIITLKK  358

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I  IN+R KPLA Y FT N  L +  V   S+G +  ND  +     TLPFGG+GE
Sbjct  359  IEDSINFINSRPKPLAIYAFTHNDSLRKRMVAETSSGSVTFNDAMIQYMADTLPFGGIGE  418

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRAL  176
            SG G+YHGKFSF+ FSH KAVL+RSF  D   R+PP+   K +L R++
Sbjct  419  SGMGNYHGKFSFDTFSHHKAVLRRSFLVDFWFRFPPWNDHKLQLFRSM  466



>ref|XP_006345274.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Solanum 
tuberosum]
Length=495

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 161/243 (66%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            ++ K+G  +GQACI  DYI+  K    +L+  +K+ + K +G++P  S  +SRIVN NHF
Sbjct  250  LSGKFGSCAGQACIGIDYILVDKTFVNELVKLIKLGIPKMFGENPKESHSISRIVNRNHF  309

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LLD+  V   +++GG  DE  L I PT+L+D P  + IM EEIFGPLLPI+T++K
Sbjct  310  LRLKNLLDEPMVKKSVIYGGSSDEDNLYIEPTVLLDPPMQSTIMTEEIFGPLLPIITLDK  369

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I+ INAR KPL  Y FT N++ +++     S+G L+ NDT +  A  TLPFGGVG+
Sbjct  370  IEDSIEFINARPKPLTIYAFTKNEEFKRKITKGTSSGSLVFNDTIIQYAADTLPFGGVGQ  429

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF+ FSH+KA+ +RSF  D+  RYPP++    +L ++    + + I+   
Sbjct  430  SGFGRYHGKFSFDTFSHEKAIARRSFLTDIWFRYPPWSDHTLQLFKSAFIYDYLSIVLIT  489

Query  139  LGL  131
            LGL
Sbjct  490  LGL  492



>ref|XP_010029722.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Eucalyptus 
grandis]
 gb|KCW56678.1| hypothetical protein EUGRSUZ_I02377 [Eucalyptus grandis]
Length=399

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 151/226 (67%), Gaps = 0/226 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWG  SGQACI+ DY++  ++ A  L+D +K+ +  FYG +P  SK++ +I+N +HF
Sbjct  155  VGAKWGPCSGQACISTDYVLVERKFAPTLIDLLKLTIKNFYGDEPRNSKNMCKIINKHHF  214

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  L+++  V+  IVHGG   EK   I P+IL+D P DA IM EEIFGPLLPI+T+N 
Sbjct  215  ERLRNLIEEPAVAASIVHGGSLHEKEQFIEPSILLDPPLDAEIMTEEIFGPLLPIITLNN  274

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            + + ++ IN+R KPL  Y FT ++  +++ V   S+GG+  NDT +      LPFGGVG+
Sbjct  275  IRESVEFINSRPKPLVIYAFTKDESFKRQLVLETSSGGVTFNDTMVQFLCDDLPFGGVGQ  334

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  182
            SG G YHGK+SFE FSH+KA++ R F  ++  RYPP+   K R +R
Sbjct  335  SGFGRYHGKYSFETFSHEKAIMTRGFFPEIEPRYPPWNRFKLRFIR  380



>ref|XP_010673629.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Beta 
vulgaris subsp. vulgaris]
Length=483

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 159/243 (65%), Gaps = 2/243 (1%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  K+G   GQ CI  DYI+  K+ +  L++ +K  + K +G++P   + ++RI+N +HF
Sbjct  233  IGGKFGTCGGQVCIGVDYILVEKKLSSTLVELLKDGIKKSFGENP--EECVARIINKHHF  290

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
            +RL  LLDD +V   IVHGG   E +L I PTIL+D P DA IM EEIFGPLLPI+T+  
Sbjct  291  NRLKGLLDDPRVKTSIVHGGSIHEDKLFIEPTILVDPPLDAEIMTEEIFGPLLPIITLEN  350

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E  I+ IN+R KPL  Y FT+N K  +   +  S+G +L NDT +  A  T+PFGGVGE
Sbjct  351  IEGSIEFINSRSKPLVIYCFTNNNKFMKRVSSETSSGAVLFNDTIVQYAADTIPFGGVGE  410

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKF+F+AFSH+K ++KR    D   R+PP+T KK  LLRA  S N   I+  +
Sbjct  411  SGFGRYHGKFTFDAFSHEKPIVKRDLFPDFWFRFPPWTSKKLELLRAAFSYNYFLIVLIV  470

Query  139  LGL  131
            LGL
Sbjct  471  LGL  473



>ref|XP_008449722.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cucumis 
melo]
Length=481

 Score =   235 bits (600),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/243 (47%), Positives = 160/243 (66%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+G  +GQACIA DYI+   +    L++ +K  + KF+ K    +K+++RIVN  +F
Sbjct  236  VVGKFGACAGQACIAIDYILVEHKFISTLVELLKKYIKKFFDKGSNEAKNMARIVNKQNF  295

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  ++D+  V   I++GG  DE +L + PTIL++ P DA IM+EEIFGP+LPI+ ++K
Sbjct  296  LRLKNMVDEPAVQATIIYGGSMDEDKLFVEPTILLNPPNDAEIMREEIFGPILPIIGMDK  355

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I  IN+R KPLA Y FT +K  ++  V+  ++G L  ND  +  AV TLPFGGVGE
Sbjct  356  IEDSIDFINSRAKPLAIYAFTKDKAFQRRLVSETTSGSLTFNDAIIQYAVDTLPFGGVGE  415

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF+ FSH+KAV+KRSF  D   RYPP+   K  LLR   + N   ++  +
Sbjct  416  SGIGRYHGKFSFDTFSHEKAVVKRSFLIDFWFRYPPWNNHKLELLRHAYNFNYFQLVLTV  475

Query  139  LGL  131
            LGL
Sbjct  476  LGL  478



>ref|XP_011629017.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 isoform 
X2 [Amborella trichopoda]
Length=468

 Score =   234 bits (598),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/243 (46%), Positives = 157/243 (65%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            ++ KWG  +GQAC A DY++  ++ A   +  +K  L  FYG DP  S  +SRIVN +H+
Sbjct  220  VSAKWGSCNGQACAAVDYVLIDEKFASTWIVTLKSTLKTFYGDDPKQSNAISRIVNKHHY  279

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D +VS  +VHGG  D+  + I PTIL+D P D+ IM EEIFGPLLPI+T+ +
Sbjct  280  LRLKSLLADPRVSNSVVHGGGVDDDNMYIEPTILLDPPLDSEIMTEEIFGPLLPIITLKR  339

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+ I+ IN+R KPL  Y+FTS   L  + V   S+G + +ND  +  AV +LPFGGVG+
Sbjct  340  IEESIEFINSRPKPLCLYVFTSRSALADKIVVETSSGSVTVNDATVQYAVDSLPFGGVGQ  399

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF+ FSH K +L R F  ++ +RYPP+   K   ++++ + N   ++  L
Sbjct  400  SGFGRYHGKFSFDTFSHTKPILCRGFMFEVYSRYPPWNGSKLNFIKSVYAFNYWKLVLHL  459

Query  139  LGL  131
            LG 
Sbjct  460  LGF  462



>ref|XP_006466887.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Citrus 
sinensis]
Length=484

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 155/226 (69%), Gaps = 0/226 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            I  K+   +GQ C+  DYI+  K+ A  L++++K  + KFYG++P  SK +SRI+N  HF
Sbjct  240  IGGKFASCNGQVCVGVDYILVEKKFAATLIESLKTTIKKFYGENPKDSKSISRIINEYHF  299

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL KLL D  V+  IVHGG  D++ L I PTIL+D P DA IM EEIFGP+LPI+T+N 
Sbjct  300  ERLRKLLKDPLVADAIVHGGLLDKENLFIEPTILLDPPLDAEIMTEEIFGPILPIITLNN  359

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +++ I+ IN+R KPLA Y FT ++  +++ V+  S+G L+ NDT +      LPFGGVG+
Sbjct  360  IQESIEFINSRPKPLAIYAFTKDETFKKQIVSGTSSGSLIFNDTLVQQLCDVLPFGGVGQ  419

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  182
            SG G YHG +SFE FSH+KA+++RSF  +L  RYPP+   K + LR
Sbjct  420  SGIGRYHGHYSFETFSHEKAIMQRSFFLELEPRYPPWNDFKMKFLR  465



>ref|XP_006829153.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 isoform 
X1 [Amborella trichopoda]
 gb|ERM96569.1| hypothetical protein AMTR_s00001p00269720 [Amborella trichopoda]
Length=480

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/243 (46%), Positives = 157/243 (65%), Gaps = 0/243 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            ++ KWG  +GQAC A DY++  ++ A   +  +K  L  FYG DP  S  +SRIVN +H+
Sbjct  232  VSAKWGSCNGQACAAVDYVLIDEKFASTWIVTLKSTLKTFYGDDPKQSNAISRIVNKHHY  291

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D +VS  +VHGG  D+  + I PTIL+D P D+ IM EEIFGPLLPI+T+ +
Sbjct  292  LRLKSLLADPRVSNSVVHGGGVDDDNMYIEPTILLDPPLDSEIMTEEIFGPLLPIITLKR  351

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+ I+ IN+R KPL  Y+FTS   L  + V   S+G + +ND  +  AV +LPFGGVG+
Sbjct  352  IEESIEFINSRPKPLCLYVFTSRSALADKIVVETSSGSVTVNDATVQYAVDSLPFGGVGQ  411

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRAL  140
            SG G YHGKFSF+ FSH K +L R F  ++ +RYPP+   K   ++++ + N   ++  L
Sbjct  412  SGFGRYHGKFSFDTFSHTKPILCRGFMFEVYSRYPPWNGSKLNFIKSVYAFNYWKLVLHL  471

Query  139  LGL  131
            LG 
Sbjct  472  LGF  474



>ref|XP_007150367.1| hypothetical protein PHAVU_005G147600g [Phaseolus vulgaris]
 gb|ESW22361.1| hypothetical protein PHAVU_005G147600g [Phaseolus vulgaris]
Length=490

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 151/226 (67%), Gaps = 0/226 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+G  +GQACIA DY++  K  +  L+  MK  + K +G++P  S  ++RIVN  HF
Sbjct  240  LVAKFGACAGQACIAIDYVLVEKSFSSTLVTLMKAGIKKMFGENPKESNTVARIVNHKHF  299

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL D +V   +V+GG  +EK L I PTIL++ P D+ IM +EIFGP+LPI+TV K
Sbjct  300  MRLKNLLTDPRVKDSVVYGGSMNEKDLFIEPTILLNPPLDSPIMADEIFGPVLPIITVEK  359

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I+ IN+R KPLA Y FT NK L +  ++  S+G L+ ND  L   V TLPFGGVGE
Sbjct  360  IEDSIEFINSRPKPLAIYAFTKNKTLHKRLLSETSSGSLVFNDAILQYVVDTLPFGGVGE  419

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  182
             G G YHGKFSF+AFSH KAV +RS+  D   R+PP+T  K +LL 
Sbjct  420  CGFGKYHGKFSFDAFSHHKAVARRSYFTDFWYRFPPWTLNKLQLLE  465



>ref|XP_008453718.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Cucumis 
melo]
Length=477

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 157/226 (69%), Gaps = 0/226 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWG  +GQACI  DY++   + A +L+D++K  L KFYG++   S  ++RIVN  + 
Sbjct  233  VGGKWGPCAGQACIGIDYVLVEDKFASELIDSLKRILKKFYGENSKNSTSIARIVNEKNV  292

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             R++ LL D KV+  IVHGG  D+++L I PTIL++ P D  IM EEIFGPLLPI+T+NK
Sbjct  293  ERISNLLKDPKVAASIVHGGSVDKEKLFIEPTILLNPPLDTDIMTEEIFGPLLPIITLNK  352

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +E+ I+ INAR KPLA Y FT ++ L++  +   S+G +  NDT +     +LPFGGVG+
Sbjct  353  IEESIEFINARPKPLALYAFTEDETLKKRILYKTSSGSVTFNDTMVQFVCDSLPFGGVGQ  412

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  182
            SG GSYHGK+SF+ FSH+KAV++RSF  +L  RYPP+   K + +R
Sbjct  413  SGFGSYHGKYSFDTFSHEKAVMQRSFLIELEPRYPPWNDFKLKFIR  458



>ref|XP_010045013.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=474

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 151/228 (66%), Gaps = 0/228 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  K+   +GQACIA DY++   + +  LL+ MK  + K  G++P  S+ ++RIVN NHF
Sbjct  226  LGSKFSACAGQACIAIDYVLVETKFSSTLLELMKAWISKMLGENPRESRSMARIVNKNHF  285

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RL  LL+D  V   IV+GG  DE  L I PTIL+D P ++ +M++EIFGPLLPI+T+ K
Sbjct  286  FRLKTLLEDPNVKASIVYGGSMDENSLFIEPTILLDPPLESGLMQDEIFGPLLPIITLKK  345

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  320
            +ED I  IN+R KPLA Y+FT N  L +  V   S+G +  ND  +     TLPFGG+GE
Sbjct  346  IEDSINFINSRPKPLAIYVFTHNDSLRKRMVAETSSGSVTFNDAMVQYVADTLPFGGIGE  405

Query  319  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRAL  176
            SG G+YHGKFSF+ FSH KAV++RSF  D   R+PP+   K +L R++
Sbjct  406  SGMGNYHGKFSFDTFSHHKAVVRRSFLVDFWFRFPPWNDHKLQLFRSM  453



>ref|XP_008668343.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=541

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = -3

Query  859  IAXKWGCXSGQACIAPDYIITTKENALQLLDAMKVELDKFYGKDPLCSKDLSRIVNSNHF  680
            +  KWGC +GQACIAPDYIITTK  A +L+ ++K  L++FYG+DPL S DLSRIVNS HF
Sbjct  231  VVGKWGCNNGQACIAPDYIITTKSFAPELVASLKRVLERFYGEDPLQSADLSRIVNSKHF  290

Query  679  SRLTKLLDDDKVSGKIVHGGERDEKRLKIAPTILMDVPEDALIMKEEIFGPLLPILTVNK  500
             RLT+L+++  V+ KIV+GGE DEK+LKIAPT+L+DVP+D+ IM  EIFGPLLPI+TV K
Sbjct  291  RRLTELIEEKSVADKIVYGGEVDEKQLKIAPTLLLDVPQDSAIMTGEIFGPLLPIVTVEK  350

Query  499  VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVA  353
            +E+   +INAR KPLAAYLFT NKKL++EFV ++ AGG+L+NDT LHV+
Sbjct  351  IEESFDLINARPKPLAAYLFTKNKKLQEEFVADVPAGGMLVNDTVLHVS  399



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1908683925587