BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7535

Length=734
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004246762.1|  PREDICTED: acyl-coenzyme A thioesterase 13         253   2e-81   Solanum lycopersicum
ref|XP_006365601.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    251   7e-81   Solanum tuberosum [potatoes]
ref|XP_009603423.1|  PREDICTED: acyl-coenzyme A thioesterase 13         243   2e-77   Nicotiana tomentosiformis
ref|XP_009798726.1|  PREDICTED: acyl-coenzyme A thioesterase 13         236   5e-75   Nicotiana sylvestris
emb|CDP18339.1|  unnamed protein product                                230   1e-72   Coffea canephora [robusta coffee]
ref|XP_008225716.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    223   9e-70   Prunus mume [ume]
ref|XP_011005574.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    221   5e-69   Populus euphratica
gb|EYU31202.1|  hypothetical protein MIMGU_mgv1a015533mg                221   5e-69   Erythranthe guttata [common monkey flower]
ref|XP_012088374.1|  PREDICTED: acyl-coenzyme A thioesterase 13         221   6e-69   Jatropha curcas
gb|ABK94218.1|  unknown                                                 220   1e-68   Populus trichocarpa [western balsam poplar]
ref|XP_004293721.1|  PREDICTED: acyl-coenzyme A thioesterase 13         220   2e-68   Fragaria vesca subsp. vesca
ref|XP_007212178.1|  hypothetical protein PRUPE_ppa012630mg             219   5e-68   Prunus persica
ref|XP_006418144.1|  hypothetical protein EUTSA_v10008953mg             218   6e-68   Eutrema salsugineum [saltwater cress]
ref|XP_006466210.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    218   8e-68   Citrus sinensis [apfelsine]
ref|XP_006426410.1|  hypothetical protein CICLE_v10026677mg             217   2e-67   Citrus clementina [clementine]
ref|XP_006851249.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    216   7e-67   Amborella trichopoda
ref|XP_010547868.1|  PREDICTED: acyl-coenzyme A thioesterase 13         214   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_006418145.1|  hypothetical protein EUTSA_v10008953mg             214   2e-66   
ref|XP_011083209.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    213   4e-66   Sesamum indicum [beniseed]
ref|XP_002892206.1|  thioesterase family protein                        211   4e-65   Arabidopsis lyrata subsp. lyrata
gb|KDO58739.1|  hypothetical protein CISIN_1g031596mg                   211   5e-65   Citrus sinensis [apfelsine]
ref|XP_006303380.1|  hypothetical protein CARUB_v10010530mg             210   1e-64   Capsella rubella
ref|NP_563705.1|  thioesterase-like protein                             209   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371827.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    209   3e-64   
ref|XP_002518008.1|  acyl-CoA thioesterase, putative                    209   4e-64   
ref|XP_010674272.1|  PREDICTED: acyl-coenzyme A thioesterase 13         208   6e-64   Beta vulgaris subsp. vulgaris [field beet]
gb|AAK32936.1|AF367350_1  At1g04290/F19P19_27                           207   1e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42770.1|  hypothetical protein AALP_AA1G037200                    207   1e-63   Arabis alpina [alpine rockcress]
ref|XP_010272560.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    206   2e-63   Nelumbo nucifera [Indian lotus]
gb|KHG28134.1|  Acyl-coenzyme A thioesterase 13                         206   3e-63   Gossypium arboreum [tree cotton]
ref|XP_009119319.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    206   5e-63   Brassica rapa
ref|XP_010096407.1|  hypothetical protein L484_013088                   205   7e-63   Morus notabilis
ref|XP_010483354.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    205   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_003523189.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    205   1e-62   Glycine max [soybeans]
gb|KJB39070.1|  hypothetical protein B456_007G067900                    205   1e-62   Gossypium raimondii
ref|XP_007048646.1|  Thioesterase superfamily protein                   204   1e-62   
gb|AFK13840.1|  putative acyl-CoA thioesterase                          203   5e-62   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY18217.1|  BnaC05g02400D                                          202   7e-62   Brassica napus [oilseed rape]
ref|XP_002271479.1|  PREDICTED: acyl-coenzyme A thioesterase 13         202   9e-62   Vitis vinifera
ref|XP_011083208.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    203   1e-61   
gb|ACU19163.1|  unknown                                                 202   2e-61   Glycine max [soybeans]
emb|CDX89829.1|  BnaA10g02530D                                          202   2e-61   
ref|XP_010256352.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    201   3e-61   Nelumbo nucifera [Indian lotus]
gb|AFK39159.1|  unknown                                                 199   2e-60   Lotus japonicus
ref|XP_008460849.1|  PREDICTED: acyl-coenzyme A thioesterase 13         199   2e-60   Cucumis melo [Oriental melon]
ref|XP_006578750.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    198   6e-60   Glycine max [soybeans]
ref|XP_007048643.1|  Thioesterase superfamily protein isoform 1         197   1e-59   
ref|XP_010027483.1|  PREDICTED: acyl-coenzyme A thioesterase 13         197   1e-59   Eucalyptus grandis [rose gum]
emb|CAN70724.1|  hypothetical protein VITISV_011379                     196   2e-59   Vitis vinifera
ref|XP_007137838.1|  hypothetical protein PHAVU_009G160000g             196   3e-59   Phaseolus vulgaris [French bean]
ref|XP_002271369.1|  PREDICTED: acyl-coenzyme A thioesterase 13         196   3e-59   Vitis vinifera
gb|AFK36943.1|  unknown                                                 194   2e-58   Lotus japonicus
ref|XP_003602702.1|  Acyl-coenzyme A thioesterase                       194   2e-58   Medicago truncatula
gb|ABY67490.1|  At1g04290                                               193   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ABY67504.1|  At1g04290                                               193   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ABY67521.1|  At1g04290                                               191   9e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799061.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    191   2e-57   Phoenix dactylifera
ref|XP_009353902.1|  PREDICTED: acyl-coenzyme A thioesterase 13         191   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_007210246.1|  hypothetical protein PRUPE_ppa015048mg             191   2e-57   
ref|XP_010912580.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    191   3e-57   Elaeis guineensis
ref|XP_007048645.1|  Thioesterase superfamily protein isoform 3         186   1e-55   
ref|XP_004147337.1|  PREDICTED: acyl-coenzyme A thioesterase 13         186   2e-55   Cucumis sativus [cucumbers]
ref|XP_002306008.1|  hypothetical protein POPTR_0004s14170g             184   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011625895.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    184   2e-54   Amborella trichopoda
gb|ABK25910.1|  unknown                                                 184   2e-54   Picea sitchensis
emb|CAN70725.1|  hypothetical protein VITISV_011380                     184   5e-54   Vitis vinifera
emb|CDX86643.1|  BnaC08g00600D                                          182   1e-53   
ref|XP_009111116.1|  PREDICTED: acyl-coenzyme A thioesterase 13         181   2e-53   Brassica rapa
ref|XP_010911767.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    180   4e-53   Elaeis guineensis
ref|XP_009420550.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    180   6e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABY67535.1|  At1g04290-like protein                                  178   9e-53   Arabidopsis lyrata [lyrate rockcress]
gb|ABY67534.1|  At1g04290-like protein                                  178   1e-52   Arabidopsis lyrata [lyrate rockcress]
gb|KJB46874.1|  hypothetical protein B456_008G001500                    179   1e-52   Gossypium raimondii
ref|XP_010457469.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    179   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008805875.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    179   2e-52   Phoenix dactylifera
ref|XP_011005573.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    177   9e-52   Populus euphratica
ref|XP_009415767.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    176   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP18342.1|  unnamed protein product                                173   2e-50   Coffea canephora [robusta coffee]
ref|XP_003602704.1|  Acyl-coenzyme A thioesterase                       172   7e-50   
gb|KHG08141.1|  Acyl-coenzyme A thioesterase 13                         171   1e-49   Gossypium arboreum [tree cotton]
gb|KEH35672.1|  acyl-CoA thioesterase, putative                         172   1e-49   Medicago truncatula
ref|XP_003576557.1|  PREDICTED: acyl-coenzyme A thioesterase 13         171   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_007213390.1|  hypothetical protein PRUPE_ppa026405mg             169   3e-49   
gb|KJB46873.1|  hypothetical protein B456_008G001500                    168   2e-48   Gossypium raimondii
ref|XP_003602708.1|  Acyl-coenzyme A thioesterase                       166   2e-47   Medicago truncatula
dbj|BAJ88253.1|  predicted protein                                      166   3e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK33840.1|  unknown                                                 164   6e-47   Medicago truncatula
ref|XP_003602703.1|  Acyl-coenzyme A thioesterase                       165   1e-46   Medicago truncatula
gb|KFK42769.1|  hypothetical protein AALP_AA1G037200                    162   4e-46   Arabis alpina [alpine rockcress]
ref|XP_003602707.1|  Acyl-coenzyme A thioesterase                       162   1e-45   Medicago truncatula
ref|XP_003602709.1|  Acyl-coenzyme A thioesterase                       160   2e-45   Medicago truncatula
ref|XP_004147338.1|  PREDICTED: putative esterase F42H10.6              159   6e-45   Cucumis sativus [cucumbers]
ref|XP_004975665.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    157   4e-44   Setaria italica
ref|NP_001152553.1|  acyl-CoA thioesterase 13                           154   5e-43   Zea mays [maize]
ref|XP_002447865.1|  hypothetical protein SORBIDRAFT_06g017150          154   7e-43   Sorghum bicolor [broomcorn]
ref|XP_008460848.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    154   8e-43   Cucumis melo [Oriental melon]
ref|XP_008669391.1|  PREDICTED: acyl-coenzyme A thioesterase 13         152   4e-42   Zea mays [maize]
gb|EPS62880.1|  hypothetical protein M569_11909                         150   1e-41   Genlisea aurea
gb|KJB70245.1|  hypothetical protein B456_011G121500                    150   2e-41   Gossypium raimondii
ref|NP_001159026.1|  thioesterase superfamily member 2                  149   5e-41   Zea mays [maize]
ref|XP_004959913.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    148   1e-40   Setaria italica
ref|NP_001052851.1|  Os04g0436100                                       147   2e-40   
ref|XP_004503022.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    147   2e-40   Cicer arietinum [garbanzo]
gb|EAZ30818.1|  hypothetical protein OsJ_14888                          147   3e-40   Oryza sativa Japonica Group [Japonica rice]
gb|AFW58300.1|  hypothetical protein ZEAMMB73_040261                    146   6e-40   
ref|XP_006652310.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    145   1e-39   
ref|XP_002306007.2|  hypothetical protein POPTR_0004s14160g             144   1e-39   
ref|XP_002440980.1|  hypothetical protein SORBIDRAFT_09g018230          145   1e-39   Sorghum bicolor [broomcorn]
ref|XP_004503021.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    145   2e-39   
gb|KDO58741.1|  hypothetical protein CISIN_1g031596mg                   142   7e-39   Citrus sinensis [apfelsine]
gb|KDO58742.1|  hypothetical protein CISIN_1g031596mg                   142   7e-39   Citrus sinensis [apfelsine]
gb|EPS58020.1|  thioesterase family protein                             141   1e-38   Genlisea aurea
ref|XP_006426408.1|  hypothetical protein CICLE_v10026677mg             141   2e-38   
gb|EAY96177.1|  hypothetical protein OsI_18061                          142   3e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_004970781.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    141   8e-38   Setaria italica
dbj|BAJ96777.1|  predicted protein                                      139   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AES72956.2|  acyl-coenzyme A thioesterase-like protein               139   5e-37   Medicago truncatula
gb|EAZ14386.1|  hypothetical protein OsJ_04306                          134   2e-35   Oryza sativa Japonica Group [Japonica rice]
gb|KJB39075.1|  hypothetical protein B456_007G067900                    133   3e-35   Gossypium raimondii
gb|EMT18579.1|  hypothetical protein F775_01155                         134   4e-35   
gb|KJB39074.1|  hypothetical protein B456_007G067900                    132   9e-35   Gossypium raimondii
gb|KJB39073.1|  hypothetical protein B456_007G067900                    132   1e-34   Gossypium raimondii
ref|XP_003579791.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    132   2e-34   Brachypodium distachyon [annual false brome]
gb|KJB39072.1|  hypothetical protein B456_007G067900                    131   2e-34   Gossypium raimondii
gb|KJB39076.1|  hypothetical protein B456_007G067900                    130   3e-34   Gossypium raimondii
ref|XP_003522458.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    130   4e-34   
ref|XP_003564778.2|  PREDICTED: acyl-coenzyme A thioesterase 13-like    131   4e-34   
gb|EEC71905.1|  hypothetical protein OsI_04677                          131   5e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_008225768.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    125   5e-32   Prunus mume [ume]
ref|XP_007213313.1|  hypothetical protein PRUPE_ppb019158mg             125   1e-31   
gb|EMT04341.1|  hypothetical protein F775_12280                         123   2e-31   
gb|EMS53374.1|  hypothetical protein TRIUR3_27835                       124   2e-31   Triticum urartu
ref|XP_003602705.1|  Acyl-coenzyme A thioesterase                       127   3e-31   
gb|KHN31228.1|  Acyl-coenzyme A thioesterase 13                         122   3e-31   Glycine soja [wild soybean]
ref|XP_009505227.1|  PREDICTED: acyl-coenzyme A thioesterase 13         117   4e-29   Phalacrocorax carbo [common cormorant]
ref|XP_009469604.1|  PREDICTED: acyl-coenzyme A thioesterase 13         116   2e-28   Nipponia nippon
ref|XP_010256522.1|  PREDICTED: putative esterase C31F10.02             115   5e-28   Nelumbo nucifera [Indian lotus]
gb|KJB46872.1|  hypothetical protein B456_008G001500                    113   8e-28   Gossypium raimondii
ref|XP_010148546.1|  PREDICTED: acyl-coenzyme A thioesterase 13         113   1e-27   Eurypyga helias
ref|XP_009575678.1|  PREDICTED: acyl-coenzyme A thioesterase 13         114   1e-27   Fulmarus glacialis
gb|KJB46875.1|  hypothetical protein B456_008G001500                    112   2e-27   Gossypium raimondii
ref|XP_005432083.1|  PREDICTED: acyl-coenzyme A thioesterase 13         114   3e-27   
ref|XP_006260599.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    112   4e-27   Alligator mississippiensis
ref|XP_005041905.1|  PREDICTED: acyl-coenzyme A thioesterase 13         112   8e-27   
ref|XP_009937939.1|  PREDICTED: acyl-coenzyme A thioesterase 13         111   1e-26   Opisthocomus hoazin [hoatzin]
ref|XP_006034486.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    111   1e-26   
gb|KFV92668.1|  Acyl-coenzyme A thioesterase 13                         110   1e-26   Eurypyga helias
gb|KFV88395.1|  Acyl-coenzyme A thioesterase 13                         110   1e-26   Struthio camelus australis
gb|KFP54825.1|  Acyl-coenzyme A thioesterase 13                         110   1e-26   Cathartes aura
ref|XP_010179320.1|  PREDICTED: acyl-coenzyme A thioesterase 13         111   1e-26   Mesitornis unicolor
ref|XP_009687024.1|  PREDICTED: acyl-coenzyme A thioesterase 13         110   1e-26   Struthio camelus australis
gb|KFP59616.1|  Acyl-coenzyme A thioesterase 13                         110   1e-26   Cariama cristata
ref|XP_009702573.1|  PREDICTED: acyl-coenzyme A thioesterase 13         110   2e-26   Cariama cristata
ref|XP_005483037.1|  PREDICTED: acyl-coenzyme A thioesterase 13         110   2e-26   
ref|XP_011015990.1|  PREDICTED: putative esterase C31F10.02             110   3e-26   Populus euphratica
ref|XP_011584257.1|  PREDICTED: acyl-coenzyme A thioesterase 13         110   3e-26   Aquila chrysaetos canadensis
gb|KFV60809.1|  Acyl-coenzyme A thioesterase 13                         109   3e-26   Tyto alba [Schleiereule]
gb|KFO14460.1|  Acyl-coenzyme A thioesterase 13                         109   3e-26   Balearica regulorum gibbericeps
gb|KFU99230.1|  Acyl-coenzyme A thioesterase 13                         109   4e-26   Tauraco erythrolophus
ref|XP_009973036.1|  PREDICTED: acyl-coenzyme A thioesterase 13         109   4e-26   Tyto alba [Schleiereule]
ref|XP_006260600.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    109   4e-26   
ref|XP_010167417.1|  PREDICTED: acyl-coenzyme A thioesterase 13         110   4e-26   
gb|KFQ87216.1|  Acyl-coenzyme A thioesterase 13                         109   4e-26   Phoenicopterus ruber ruber
gb|KFQ60450.1|  Acyl-coenzyme A thioesterase 13                         108   4e-26   Pelecanus crispus
ref|XP_010307995.1|  PREDICTED: acyl-coenzyme A thioesterase 13         108   5e-26   Balearica regulorum gibbericeps
gb|KFW04556.1|  Acyl-coenzyme A thioesterase 13                         108   5e-26   Fulmarus glacialis
gb|EOA98726.1|  Thioesterase superfamily member 2                       108   5e-26   Anas platyrhynchos [duck]
ref|XP_010292054.1|  PREDICTED: acyl-coenzyme A thioesterase 13         108   6e-26   Phaethon lepturus
ref|XP_009991401.1|  PREDICTED: acyl-coenzyme A thioesterase 13         108   6e-26   Tauraco erythrolophus
gb|KFQ81540.1|  Acyl-coenzyme A thioesterase 13                         108   6e-26   Phaethon lepturus
gb|KFQ32411.1|  Acyl-coenzyme A thioesterase 13                         108   6e-26   Mesitornis unicolor
gb|KFP18188.1|  Acyl-coenzyme A thioesterase 13                         108   7e-26   Egretta garzetta
ref|XP_009479515.1|  PREDICTED: acyl-coenzyme A thioesterase 13         112   9e-26   Pelecanus crispus
ref|XP_005023122.1|  PREDICTED: acyl-coenzyme A thioesterase 13         108   9e-26   
ref|XP_010120347.1|  PREDICTED: acyl-coenzyme A thioesterase 13         108   1e-25   Chlamydotis macqueenii
gb|KFP36423.1|  Acyl-coenzyme A thioesterase 13                         108   1e-25   Chlamydotis macqueenii
gb|KFQ00745.1|  Acyl-coenzyme A thioesterase 13                         107   1e-25   Haliaeetus albicilla
ref|XP_009913010.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   1e-25   Haliaeetus albicilla
ref|XP_009953803.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   1e-25   Leptosomus discolor
gb|KFQ00125.1|  Acyl-coenzyme A thioesterase 13                         107   1e-25   Leptosomus discolor
ref|XP_009884205.1|  PREDICTED: acyl-coenzyme A thioesterase 13         108   2e-25   Charadrius vociferus
gb|KFV08952.1|  Acyl-coenzyme A thioesterase 13                         107   2e-25   Pterocles gutturalis
gb|KFW96776.1|  Acyl-coenzyme A thioesterase 13                         107   2e-25   Phalacrocorax carbo [common cormorant]
ref|XP_010576245.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    108   2e-25   Haliaeetus leucocephalus
gb|KFM05761.1|  Acyl-coenzyme A thioesterase 13                         107   2e-25   Aptenodytes forsteri
ref|XP_005240365.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   2e-25   
ref|XP_009274940.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   2e-25   Aptenodytes forsteri
ref|XP_005419442.1|  PREDICTED: acyl-coenzyme A thioesterase 13         109   2e-25   
ref|XP_010866002.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   2e-25   Esox lucius
gb|KFQ49729.1|  Acyl-coenzyme A thioesterase 13                         107   3e-25   Nestor notabilis
gb|KGL78544.1|  Acyl-coenzyme A thioesterase 13                         107   3e-25   Tinamus guttatus
ref|XP_010214839.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   3e-25   Tinamus guttatus
ref|XP_009074220.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   3e-25   Acanthisitta chloris
ref|XP_008939949.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   3e-25   Merops nubicus
ref|XP_010074245.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   3e-25   Pterocles gutturalis
ref|XP_002978170.1|  hypothetical protein SELMODRAFT_108421             107   3e-25   Selaginella moellendorffii
gb|KFZ50508.1|  Acyl-coenzyme A thioesterase 13                         106   3e-25   Antrostomus carolinensis
ref|XP_005728490.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    107   3e-25   Pundamilia nyererei
ref|XP_004074278.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   3e-25   Oryzias latipes [Japanese rice fish]
gb|KFR04080.1|  Acyl-coenzyme A thioesterase 13                         106   4e-25   Nipponia nippon
gb|KFO65912.1|  Acyl-coenzyme A thioesterase 13                         107   4e-25   Corvus brachyrhynchos
ref|XP_009099776.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   4e-25   Serinus canaria [canary]
ref|XP_005153649.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   4e-25   
gb|KFP24461.1|  Acyl-coenzyme A thioesterase 13                         106   4e-25   Colius striatus
ref|XP_010013017.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   4e-25   Nestor notabilis
ref|XP_008640918.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   4e-25   Corvus brachyrhynchos
ref|XP_010194714.1|  PREDICTED: acyl-coenzyme A thioesterase 13         106   4e-25   Colius striatus
emb|CDQ94367.1|  unnamed protein product                                107   4e-25   Oncorhynchus mykiss
ref|XP_004549285.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    107   4e-25   Maylandia zebra
ref|XP_006787914.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    107   4e-25   Neolamprologus brichardi [lyretail cichlid]
ref|NP_001045006.1|  Os01g0882100                                       105   4e-25   
ref|XP_009818645.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   4e-25   Gavia stellata
gb|KFR14708.1|  Acyl-coenzyme A thioesterase 13                         106   4e-25   Opisthocomus hoazin [hoatzin]
ref|XP_008420246.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   5e-25   Poecilia reticulata
gb|KFO78633.1|  Acyl-coenzyme A thioesterase 13                         106   5e-25   Cuculus canorus
ref|XP_005517377.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   6e-25   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFU90118.1|  Acyl-coenzyme A thioesterase 13                         107   7e-25   Chaetura pelagica
ref|XP_002966393.1|  hypothetical protein SELMODRAFT_69277              105   7e-25   
ref|XP_009905315.1|  PREDICTED: acyl-coenzyme A thioesterase 13         106   7e-25   Picoides pubescens
gb|KFO83643.1|  Acyl-coenzyme A thioesterase 13                         105   8e-25   Buceros rhinoceros silvestris
ref|XP_009996592.1|  PREDICTED: acyl-coenzyme A thioesterase 13         107   8e-25   Chaetura pelagica
ref|XP_010135910.1|  PREDICTED: acyl-coenzyme A thioesterase 13         105   9e-25   Buceros rhinoceros silvestris
ref|XP_009639750.1|  PREDICTED: acyl-coenzyme A thioesterase 13         108   1e-24   Egretta garzetta
gb|KFZ64967.1|  Acyl-coenzyme A thioesterase 13                         105   1e-24   Podiceps cristatus
gb|KGL94020.1|  Acyl-coenzyme A thioesterase 13                         105   1e-24   Charadrius vociferus
gb|EMS66235.1|  hypothetical protein TRIUR3_31840                       104   1e-24   Triticum urartu
ref|XP_003444129.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    106   1e-24   Oreochromis niloticus
ref|XP_009346893.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    106   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_009562520.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    106   1e-24   Cuculus canorus
gb|EMP35193.1|  Acyl-coenzyme A thioesterase 13                         105   1e-24   Chelonia mydas [green seaturtle]
ref|XP_005728489.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    106   1e-24   
ref|NP_001139872.1|  Thioesterase superfamily member 2                  105   2e-24   Salmo salar
ref|XP_008304638.1|  PREDICTED: acyl-coenzyme A thioesterase 13         105   2e-24   Stegastes partitus
ref|XP_005917539.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    105   2e-24   
gb|KFP85437.1|  Acyl-coenzyme A thioesterase 13                         104   2e-24   Apaloderma vittatum
ref|XP_009864157.1|  PREDICTED: acyl-coenzyme A thioesterase 13         104   2e-24   Apaloderma vittatum
ref|XP_003204950.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    105   2e-24   Meleagris gallopavo [common turkey]
ref|XP_005281460.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    104   2e-24   Chrysemys picta bellii
gb|KFQ18918.1|  Acyl-coenzyme A thioesterase 13                         104   3e-24   Merops nubicus
ref|XP_007547806.1|  PREDICTED: acyl-coenzyme A thioesterase 13         105   3e-24   Poecilia formosa
ref|XP_006635775.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    105   3e-24   Lepisosteus oculatus
ref|XP_007421999.1|  PREDICTED: acyl-coenzyme A thioesterase 13         105   3e-24   Python bivittatus
ref|XP_004294282.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    105   3e-24   Fragaria vesca subsp. vesca
ref|XP_005797423.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    105   3e-24   
gb|KFW77463.1|  Acyl-coenzyme A thioesterase 13                         105   3e-24   Manacus vitellinus
ref|XP_007060448.1|  PREDICTED: acyl-coenzyme A thioesterase 13         105   3e-24   Chelonia mydas [green seaturtle]
ref|XP_005281459.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    104   4e-24   Chrysemys picta bellii
ref|XP_008917907.1|  PREDICTED: acyl-coenzyme A thioesterase 13         105   4e-24   
ref|XP_005478564.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    104   4e-24   
ref|XP_010736256.1|  PREDICTED: acyl-coenzyme A thioesterase 13         104   4e-24   Larimichthys crocea [croceine croaker]
ref|XP_005797424.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...    103   7e-24   
ref|XP_006134059.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    103   9e-24   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010771293.1|  PREDICTED: acyl-coenzyme A thioesterase 13         103   9e-24   Notothenia coriiceps [yellowbelly rockcod]
gb|KFO97349.1|  Acyl-coenzyme A thioesterase 13                         102   1e-23   Calypte anna
ref|XP_009048661.1|  hypothetical protein LOTGIDRAFT_157816             103   1e-23   Lottia gigantea
ref|XP_009337314.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    103   1e-23   Pyrus x bretschneideri [bai li]
ref|NP_001232419.1|  putative thioesterase superfamily member 2         104   1e-23   Taeniopygia guttata
ref|XP_003219792.1|  PREDICTED: acyl-coenzyme A thioesterase 13         103   1e-23   
ref|XP_008503775.1|  PREDICTED: acyl-coenzyme A thioesterase 13         103   2e-23   Calypte anna
ref|XP_003969353.1|  PREDICTED: acyl-coenzyme A thioesterase 13         102   2e-23   Takifugu rubripes [tiger puffer]
ref|XP_006009249.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    102   3e-23   Latimeria chalumnae
gb|EMS45354.1|  hypothetical protein TRIUR3_34046                       100   3e-23   Triticum urartu
ref|XP_006009250.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    102   3e-23   
ref|XP_007454569.1|  PREDICTED: acyl-coenzyme A thioesterase 13         101   3e-23   Lipotes vexillifer [baiji]
ref|XP_004273569.1|  PREDICTED: acyl-coenzyme A thioesterase 13         101   3e-23   Orcinus orca [Orca]
ref|XP_009346891.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    102   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_005159692.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...    102   4e-23   Danio rerio [leopard danio]
ref|XP_003760177.1|  PREDICTED: acyl-coenzyme A thioesterase 13         102   4e-23   
ref|XP_008057579.1|  PREDICTED: acyl-coenzyme A thioesterase 13         101   4e-23   Carlito syrichta
pdb|4ORD|A  Chain A, Crystal Structure Of Zebra Fish Thioesterase...    102   5e-23   Danio rerio [leopard danio]
ref|NP_001074272.1|  acyl-coenzyme A thioesterase 13                    102   5e-23   Danio rerio [leopard danio]
ref|XP_005973917.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    102   6e-23   Pantholops hodgsonii [Tibetan antelope]
ref|XP_007016186.1|  Acyl-CoA thioesterase, putative                    102   6e-23   Theobroma cacao [chocolate]
ref|XP_009014148.1|  hypothetical protein HELRODRAFT_75909              101   9e-23   Helobdella robusta
ref|XP_004294275.2|  PREDICTED: acyl-coenzyme A thioesterase 13-like    101   9e-23   Fragaria vesca subsp. vesca
ref|XP_007116298.1|  PREDICTED: acyl-coenzyme A thioesterase 13         100   1e-22   Physeter catodon
ref|NP_001279122.1|  acyl-CoA thioesterase 13                           100   1e-22   Callorhinchus milii [Australian ghost shark]
ref|XP_009337316.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    100   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_010033034.1|  PREDICTED: acyl-coenzyme A thioesterase 13         100   1e-22   Eucalyptus grandis [rose gum]
ref|XP_003219793.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    100   1e-22   
ref|XP_007197189.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    102   1e-22   
ref|XP_008329894.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  99.8    2e-22   
ref|XP_004088793.1|  PREDICTED: acyl-coenzyme A thioesterase 13       99.8    2e-22   
ref|XP_007206515.1|  hypothetical protein PRUPE_ppa019295mg             100   2e-22   
ref|XP_003263617.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  99.4    2e-22   
ref|XP_003389589.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    100   2e-22   
gb|KEH35673.1|  acyl-coenzyme A thioesterase-like protein             99.8    2e-22   
gb|AER42690.1|  acyl-coenzyme A thioesterase 13                         100   2e-22   
ref|XP_004043395.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  99.4    2e-22   
ref|XP_005665685.1|  PREDICTED: acyl-CoA thioesterase 13 isoform X1   99.0    2e-22   
ref|XP_008220360.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like    100   3e-22   
ref|XP_004043394.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  99.0    3e-22   
gb|EMC87492.1|  Acyl-coenzyme A thioesterase 13                       99.0    3e-22   
gb|KHG20959.1|  Acyl-coenzyme A thioesterase 13                         102   3e-22   
gb|KEH35674.1|  acyl-coenzyme A thioesterase-like protein             99.4    3e-22   
ref|NP_001153566.1|  acyl-coenzyme A thioesterase 13 isoform 2        99.0    3e-22   
ref|XP_006145178.1|  PREDICTED: acyl-coenzyme A thioesterase 13       99.4    3e-22   
ref|NP_001108254.1|  acyl-CoA thioesterase 13                         99.4    3e-22   
ref|XP_003263616.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  99.4    3e-22   
ref|XP_008329893.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  99.8    3e-22   
ref|XP_006034487.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  99.4    4e-22   
ref|NP_001231908.1|  acyl-CoA thioesterase 13                         99.4    4e-22   
ref|XP_004043393.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  99.0    5e-22   
ref|XP_005691391.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  99.4    5e-22   
ref|NP_060943.1|  acyl-coenzyme A thioesterase 13 isoform 1           99.0    5e-22   
ref|XP_007526006.1|  PREDICTED: acyl-coenzyme A thioesterase 13       99.0    5e-22   
ref|XP_011818180.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  98.6    5e-22   
ref|XP_008845316.1|  PREDICTED: acyl-coenzyme A thioesterase 13       99.0    6e-22   
ref|XP_011853569.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  98.2    6e-22   
ref|XP_004670044.1|  PREDICTED: acyl-coenzyme A thioesterase 13       98.6    6e-22   
pdb|2H4U|A  Chain A, Crystal Structure Of Human Thioesterase Supe...  99.0    6e-22   
pdb|3F5O|A  Chain A, Crystal Structure Of Hthem2(Undecan-2-One-Co...  99.0    7e-22   
ref|XP_003927347.1|  PREDICTED: acyl-coenzyme A thioesterase 13       98.6    7e-22   
ref|XP_008785433.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  99.0    7e-22   
ref|XP_003416523.1|  PREDICTED: acyl-coenzyme A thioesterase 13       98.6    8e-22   
ref|XP_001375508.3|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  98.6    8e-22   
ref|XP_004019151.1|  PREDICTED: acyl-coenzyme A thioesterase 13       98.6    9e-22   
ref|XP_002714270.1|  PREDICTED: acyl-coenzyme A thioesterase 13       98.2    9e-22   
ref|XP_005505324.1|  PREDICTED: acyl-coenzyme A thioesterase 13       99.0    1e-21   
ref|NP_001165421.1|  acyl-coenzyme A thioesterase 13                  98.2    1e-21   
ref|XP_004384094.1|  PREDICTED: acyl-coenzyme A thioesterase 13       98.2    1e-21   
ref|XP_007971737.1|  PREDICTED: acyl-coenzyme A thioesterase 13       98.2    1e-21   
ref|XP_011818179.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  98.2    1e-21   
ref|XP_006051255.1|  PREDICTED: acyl-coenzyme A thioesterase 13       98.6    1e-21   
ref|XP_003434240.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  97.8    1e-21   
ref|XP_011886856.1|  PREDICTED: acyl-coenzyme A thioesterase 13       98.2    1e-21   
ref|XP_008975045.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  97.4    1e-21   
ref|XP_003897177.1|  PREDICTED: acyl-coenzyme A thioesterase 13       97.8    1e-21   
ref|XP_010685625.1|  PREDICTED: putative esterase C31F10.02           98.2    2e-21   
ref|XP_853542.1|  PREDICTED: acyl-coenzyme A thioesterase 13 isof...  97.8    2e-21   
ref|XP_006888747.1|  PREDICTED: acyl-coenzyme A thioesterase 13       97.4    2e-21   
ref|XP_001171713.1|  PREDICTED: acyl-coenzyme A thioesterase 13       97.4    2e-21   
ref|XP_007249358.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  97.1    2e-21   
ref|XP_006350817.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  97.8    2e-21   
ref|XP_004712533.1|  PREDICTED: acyl-coenzyme A thioesterase 13       97.4    2e-21   
ref|XP_003788430.1|  PREDICTED: acyl-coenzyme A thioesterase 13       97.4    2e-21   
ref|XP_004406545.1|  PREDICTED: acyl-coenzyme A thioesterase 13       97.4    3e-21   
ref|XP_002280576.1|  PREDICTED: acyl-coenzyme A thioesterase 13       97.4    3e-21   
ref|XP_009614740.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  97.4    3e-21   
ref|XP_010363572.1|  PREDICTED: acyl-coenzyme A thioesterase 13       97.1    3e-21   
ref|NP_001095315.1|  acyl-coenzyme A thioesterase 13                  97.4    3e-21   
ref|XP_007249357.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  97.1    3e-21   
ref|XP_006198738.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...  97.4    3e-21   
ref|XP_004828488.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA thi...  96.7    4e-21   
ref|XP_008691154.1|  PREDICTED: acyl-coenzyme A thioesterase 13       96.7    4e-21   
ref|XP_006260601.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  96.7    4e-21   
ref|XP_009374287.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  97.1    4e-21   
ref|XP_010923137.1|  PREDICTED: acyl-coenzyme A thioesterase 13       97.4    5e-21   
ref|XP_006872951.1|  PREDICTED: acyl-coenzyme A thioesterase 13       97.8    5e-21   
ref|NP_080066.1|  acyl-coenzyme A thioesterase 13                     96.3    5e-21   
ref|NP_001005098.1|  acyl-CoA thioesterase 13                         96.3    5e-21   
ref|XP_010685620.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  96.7    5e-21   
ref|XP_006739369.1|  PREDICTED: acyl-coenzyme A thioesterase 13       96.3    5e-21   
pdb|2F0X|A  Chain A, Crystal Structure And Function Of Human Thio...  96.3    5e-21   
ref|XP_009374291.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  96.3    6e-21   
ref|XP_008364467.1|  PREDICTED: uncharacterized protein LOC103428147  98.2    6e-21   
ref|XP_006260611.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  95.9    7e-21   
ref|XP_008220367.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  96.7    8e-21   
gb|KHG14017.1|  Acyl-coenzyme A thioesterase 13                       96.3    9e-21   
ref|XP_009337318.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  95.9    9e-21   
ref|XP_004294281.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  95.9    1e-20   
ref|XP_010978430.1|  PREDICTED: acyl-coenzyme A thioesterase 13       95.5    1e-20   
ref|XP_003468817.2|  PREDICTED: acyl-coenzyme A thioesterase 13       94.7    1e-20   
ref|XP_005066501.1|  PREDICTED: acyl-coenzyme A thioesterase 13       95.5    1e-20   
ref|XP_006977191.1|  PREDICTED: acyl-coenzyme A thioesterase 13       95.5    1e-20   
ref|XP_010621259.1|  PREDICTED: acyl-coenzyme A thioesterase 13       95.1    1e-20   
ref|XP_006182296.1|  PREDICTED: acyl-coenzyme A thioesterase 13       95.5    1e-20   
ref|XP_008373324.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  95.9    1e-20   
ref|XP_003502239.1|  PREDICTED: acyl-coenzyme A thioesterase 13       95.1    1e-20   
ref|XP_004294272.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  95.9    1e-20   
gb|ERE77275.1|  acyl-coenzyme A thioesterase 13-like protein          95.1    1e-20   
ref|XP_010841805.1|  PREDICTED: acyl-coenzyme A thioesterase 13       95.5    1e-20   
ref|XP_011880670.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  95.1    1e-20   
ref|XP_006410016.1|  hypothetical protein EUTSA_v10017356mg           95.5    2e-20   
ref|XP_006350818.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  95.1    2e-20   
ref|NP_001099581.1|  acyl-coenzyme A thioesterase 13                  94.7    2e-20   
ref|XP_004693379.1|  PREDICTED: acyl-coenzyme A thioesterase 13       94.7    2e-20   
gb|KFO33845.1|  Acyl-coenzyme A thioesterase 13                       95.5    2e-20   
ref|XP_004895027.1|  PREDICTED: acyl-coenzyme A thioesterase 13       94.7    2e-20   
ref|XP_004143143.1|  PREDICTED: uncharacterized protein LOC101209449  95.1    2e-20   
ref|XP_011880669.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  94.7    2e-20   
ref|XP_008355407.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  95.1    2e-20   
ref|XP_008145293.1|  PREDICTED: acyl-coenzyme A thioesterase 13       94.4    2e-20   
ref|XP_007948003.1|  PREDICTED: acyl-coenzyme A thioesterase 13       94.0    2e-20   
gb|EFB28339.1|  hypothetical protein PANDA_003872                     94.0    2e-20   
ref|WP_041792467.1|  hypothetical protein                             93.6    2e-20   
ref|XP_002520431.1|  acyl-CoA thioesterase, putative                  94.7    2e-20   
ref|XP_005403423.1|  PREDICTED: acyl-coenzyme A thioesterase 13       94.4    3e-20   
gb|AEP25854.1|  putative acyl-CoA thioesterase                        94.4    3e-20   
ref|XP_011629555.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  94.4    3e-20   
ref|XP_011880664.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  94.7    3e-20   
ref|XP_008363419.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  94.4    3e-20   
ref|XP_008505636.1|  PREDICTED: acyl-coenzyme A thioesterase 13       93.2    3e-20   
pdb|2CY9|A  Chain A, Crystal Structure Of Thioesterase Superfamil...  94.0    3e-20   
ref|XP_005863223.1|  PREDICTED: acyl-coenzyme A thioesterase 13       94.0    3e-20   
ref|XP_004640229.1|  PREDICTED: acyl-coenzyme A thioesterase 13       94.4    4e-20   
ref|XP_009374292.1|  PREDICTED: uncharacterized protein LOC103963...  95.5    4e-20   
ref|XP_009374289.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  94.4    4e-20   
ref|XP_002915855.1|  PREDICTED: acyl-coenzyme A thioesterase 13       94.4    4e-20   
ref|XP_004241184.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  94.4    4e-20   
gb|KDO66786.1|  hypothetical protein CISIN_1g031440mg                 94.4    4e-20   
ref|XP_006425012.1|  hypothetical protein CICLE_v10029463mg           94.4    4e-20   
gb|EYU45972.1|  hypothetical protein MIMGU_mgv1a014917mg              94.7    4e-20   
ref|XP_007142234.1|  hypothetical protein PHAVU_008G263600g           94.0    5e-20   
ref|XP_005355034.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  93.2    5e-20   
gb|ADO71313.1|  uncharacterized protein STAUR_3523                    93.6    5e-20   
gb|KJB46871.1|  hypothetical protein B456_008G001500                  91.7    7e-20   
ref|XP_308560.2|  AGAP007238-PA                                       93.2    7e-20   
ref|XP_009784389.1|  PREDICTED: acyl-coenzyme A thioesterase 13       93.6    8e-20   
gb|ADE77689.1|  unknown                                               94.0    8e-20   
ref|XP_003363790.1|  PREDICTED: acyl-coenzyme A thioesterase 13       93.2    8e-20   
ref|XP_006106533.1|  PREDICTED: acyl-coenzyme A thioesterase 13       92.8    8e-20   
gb|AAM65417.1|  unknown                                               93.2    9e-20   
ref|NP_565683.1|  thioesterase-like protein                           93.6    9e-20   
ref|XP_010944079.1|  PREDICTED: acyl-coenzyme A thioesterase 13       95.1    9e-20   
emb|CDY53360.1|  BnaC04g54400D                                        93.2    1e-19   
ref|XP_009144361.1|  PREDICTED: acyl-coenzyme A thioesterase 13       93.2    1e-19   
gb|KJB55779.1|  hypothetical protein B456_009G094000                  93.2    1e-19   
emb|CDP09147.1|  unnamed protein product                              93.2    1e-19   
ref|XP_006931469.1|  PREDICTED: acyl-coenzyme A thioesterase 13       92.8    1e-19   
ref|XP_002046626.1|  GJ12379                                          92.8    1e-19   
ref|XP_012055529.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  92.8    1e-19   
ref|XP_006919594.1|  PREDICTED: acyl-coenzyme A thioesterase 13       92.4    1e-19   
ref|XP_005355033.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  92.4    1e-19   
emb|CDY45458.1|  BnaA05g12430D                                        92.8    1e-19   
gb|EPQ05834.1|  Acyl-coenzyme A thioesterase 13                       92.0    2e-19   
ref|XP_008785432.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  92.8    2e-19   
gb|EFZ15456.1|  hypothetical protein SINV_00619                       92.0    2e-19   
gb|AEL79850.1|  thioesterase superfamily member 2                     92.0    2e-19   
ref|XP_011163913.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  92.0    2e-19   
ref|XP_008992136.1|  PREDICTED: acyl-coenzyme A thioesterase 13       92.0    2e-19   
ref|XP_004485115.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA thi...  92.4    2e-19   
ref|XP_004347012.1|  thioesterase superfamily member 2                92.8    2e-19   
ref|XP_007208636.1|  hypothetical protein PRUPE_ppa019870mg           92.0    2e-19   
gb|KJB55781.1|  hypothetical protein B456_009G094100                  92.0    2e-19   
ref|XP_007074481.1|  PREDICTED: acyl-coenzyme A thioesterase 13       92.0    3e-19   
ref|XP_010104689.1|  hypothetical protein L484_022072                 92.0    3e-19   
ref|XP_004623770.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  94.4    3e-19   
ref|XP_011380478.1|  PREDICTED: acyl-coenzyme A thioesterase 13       91.7    3e-19   
ref|XP_010418788.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  92.0    3e-19   
gb|ELK05802.1|  Acyl-coenzyme A thioesterase 13                       92.8    3e-19   
ref|XP_011460918.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  91.7    4e-19   
ref|XP_009624178.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  92.0    4e-19   
ref|XP_008553881.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  91.3    4e-19   
ref|XP_011242633.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  90.1    4e-19   
ref|XP_004294278.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  91.7    4e-19   
ref|XP_004241183.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  91.7    4e-19   
ref|XP_009346895.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  91.7    4e-19   
ref|XP_009624177.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  91.3    4e-19   
ref|XP_001984334.1|  GH16394                                          90.9    5e-19   
ref|XP_002881059.1|  thioesterase family protein                      91.3    5e-19   
ref|XP_006833365.1|  PREDICTED: acyl-coenzyme A thioesterase 13       91.3    5e-19   
ref|XP_006295147.1|  hypothetical protein CARUB_v10024222mg           90.9    7e-19   
gb|EGI62779.1|  Acyl-coenzyme A thioesterase 13                       89.7    8e-19   
ref|XP_002007261.1|  GI12477                                          90.1    9e-19   
ref|XP_008464061.1|  PREDICTED: acyl-coenzyme A thioesterase 13       91.3    9e-19   
ref|XP_004490572.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  90.5    9e-19   
ref|XP_012068289.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  90.5    9e-19   
ref|XP_007208603.1|  hypothetical protein PRUPE_ppa022342mg           90.5    1e-18   
ref|XP_010510468.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  90.5    1e-18   
ref|XP_008355379.1|  PREDICTED: uncharacterized protein LOC103419...  91.3    1e-18   
ref|XP_007207558.1|  hypothetical protein PRUPE_ppa016575mg           90.1    1e-18   
ref|XP_012068277.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  90.1    1e-18   
ref|XP_012068300.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  89.7    1e-18   
ref|XP_009337320.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  90.1    2e-18   
gb|ABW81107.1|  AcylCoa-1                                             89.7    2e-18   
ref|XP_010521923.1|  PREDICTED: putative esterase C31F10.02           89.7    2e-18   
ref|XP_011058923.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  89.4    2e-18   
gb|KFB40367.1|  AGAP007238-PA-like protein                            89.4    2e-18   
ref|XP_002119944.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  89.0    2e-18   
ref|XP_009402301.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  89.4    2e-18   
gb|EHB09598.1|  Acyl-coenzyme A thioesterase 13                       87.8    3e-18   
ref|XP_006578749.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  88.6    3e-18   
ref|XP_008220332.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  89.4    3e-18   
gb|ETN68123.1|  thioesterase superfamily member 2                     88.6    4e-18   
ref|XP_010510433.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  89.0    4e-18   
tpg|DAA37715.1|  TPA: hypothetical protein ZEAMMB73_461834            87.8    4e-18   
ref|XP_008220351.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  88.6    5e-18   
gb|KFM73650.1|  Acyl-coenzyme A thioesterase 13                       91.3    5e-18   
dbj|GAA93768.1|  hypothetical protein E5Q_00414                       88.2    6e-18   
ref|XP_010256675.1|  PREDICTED: acyl-coenzyme A thioesterase 13       87.8    8e-18   
gb|KHN46174.1|  Acyl-coenzyme A thioesterase 13                       87.8    8e-18   
ref|XP_004444110.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA thi...  86.7    1e-17   
ref|XP_001866940.1|  conserved hypothetical protein                   87.4    1e-17   
gb|EHJ70148.1|  acyl-CoA thioesterase 13                              87.4    1e-17   
ref|XP_002504470.1|  predicted protein                                87.4    1e-17   
ref|XP_011330137.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  87.0    1e-17   
ref|XP_010414900.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  87.4    1e-17   
ref|XP_003396964.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  86.7    2e-17   
ref|XP_011419355.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  86.7    2e-17   
ref|XP_008373325.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  87.0    2e-17   
ref|XP_006083594.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  86.3    2e-17   
ref|XP_010685104.1|  PREDICTED: uncharacterized protein LOC104899...  86.7    2e-17   
ref|XP_011703657.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  85.5    2e-17   
gb|EKC18944.1|  Acyl-coenzyme A thioesterase 13                       86.7    3e-17   
gb|KDE09456.1|  hypothetical protein MVLG_00358                       86.7    3e-17   
ref|XP_011703656.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  85.5    3e-17   
ref|XP_010510470.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  86.3    3e-17   
ref|XP_008373323.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  86.7    3e-17   
ref|NP_001237069.1|  uncharacterized protein LOC100305814             86.3    3e-17   



>ref|XP_004246762.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Solanum lycopersicum]
Length=153

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD+ES+KKFLEKEGG YE  VDSMP RF+EPF+ HGIKVDL E GRI+C+FKVPLRLVN 
Sbjct  1    MDIESLKKFLEKEGGSYETSVDSMPSRFIEPFVCHGIKVDLVEPGRILCSFKVPLRLVNA  60

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            GNFLHGGATATLVDI+GSA ++T+G P +GVS+EINVSYLD A+L EE+E+EAKVLR+GK
Sbjct  61   GNFLHGGATATLVDIMGSAVVHTVGAPLTGVSLEINVSYLDAAYLGEEIELEAKVLRVGK  120

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            SIA V+VELRKKKTGKI+AQGRHTKYLAV SKL
Sbjct  121  SIAAVTVELRKKKTGKIVAQGRHTKYLAVNSKL  153



>ref|XP_006365601.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Solanum tuberosum]
Length=153

 Score =   251 bits (641),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD+ES+KKFLEKEGG YE  VDSMP RF+EPF++HGIKVDL E GRI+C+F+VPLRLVN 
Sbjct  1    MDIESLKKFLEKEGGNYETSVDSMPSRFIEPFVTHGIKVDLVEPGRILCSFEVPLRLVNA  60

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            GNFLHGGATATLVDI+GSA I+T+G P +GVS+EINVSYLD A+L EE+E+EAK LR+GK
Sbjct  61   GNFLHGGATATLVDIMGSAVIHTVGAPLTGVSLEINVSYLDAAYLGEEIELEAKALRVGK  120

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            SIA V+VELRKKKTGKI+AQGRHTKYLAV SKL
Sbjct  121  SIAAVTVELRKKKTGKIVAQGRHTKYLAVNSKL  153



>ref|XP_009603423.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Nicotiana tomentosiformis]
Length=156

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  36   KEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            K+MD+ES+KKFLEKEGG YE+ VDSMP RFLE F+SHGIKVDL E GRI+ +F+VP RLV
Sbjct  2    KQMDIESVKKFLEKEGGNYESTVDSMPSRFLEAFVSHGIKVDLVEPGRILYSFQVPSRLV  61

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GNFLHGGATA LVDI GSA I+T+G P +GVSVEINVSYLD AF+ EE+E+EAKVLR+
Sbjct  62   NAGNFLHGGATAALVDIFGSAVIHTVGAPFTGVSVEINVSYLDAAFVGEEIEVEAKVLRV  121

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK+I  VSVELRKK+TGKI+A+GRHTKYLAV SKL
Sbjct  122  GKTIGVVSVELRKKETGKIVARGRHTKYLAVNSKL  156



>ref|XP_009798726.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Nicotiana sylvestris]
Length=156

 Score =   236 bits (603),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  36   KEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            K+MD+E +KKFLEKEGG  E+ VDSMP RFLE F+S+GIKVDL E GRI+ +F+VP RLV
Sbjct  2    KQMDIELVKKFLEKEGGNNESTVDSMPSRFLEAFVSYGIKVDLVEPGRILYSFQVPPRLV  61

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GNFLHGGATATLVDI+GSA I+T+G P +GVSVEINVSYLD AF+ EE+E+EAKVLR+
Sbjct  62   NAGNFLHGGATATLVDILGSAVIHTVGAPFTGVSVEINVSYLDAAFVGEEIEVEAKVLRV  121

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK+I  VSVELRKK+TGKI+A+GRHTKYLAV SKL
Sbjct  122  GKTIGVVSVELRKKETGKIVARGRHTKYLAVNSKL  156



>emb|CDP18339.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   230 bits (587),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD ES+K+ LEKEGG YE+ VDSMP R+ EPF+  G+KVDL ERGRI+C+  VP RL+N 
Sbjct  1    MDFESVKRLLEKEGGPYESTVDSMPQRYFEPFVVQGLKVDLIERGRIVCSMVVPSRLLNT  60

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            G  LHGGATATLVD+VGSA IYT+G P +GVSVEINVSYLD A++ +E+EIEAK LR+GK
Sbjct  61   GTSLHGGATATLVDMVGSAVIYTVGSPVTGVSVEINVSYLDGAYVGDEIEIEAKTLRVGK  120

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            +IA VSVEL+ KKTGKIIAQGRHTKYLA++SKL
Sbjct  121  AIAVVSVELKNKKTGKIIAQGRHTKYLALSSKL  153



>ref|XP_008225716.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Prunus mume]
Length=160

 Score =   223 bits (568),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  36   KEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            +E  +ES+KKFLEKEG E    +D +P +F EPFI  GI+VDL E GRI+C+FKVP RL+
Sbjct  7    EETSMESVKKFLEKEG-EMAITMDGLPEKFFEPFIMKGIQVDLLEPGRIVCSFKVPPRLL  65

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GNF+HGGATATLVD++GSAAI T+G+P+SGVSVEINVSYLD A+  EEVE+EAK LR+
Sbjct  66   NGGNFMHGGATATLVDLIGSAAILTVGIPSSGVSVEINVSYLDSAYPGEEVEVEAKALRV  125

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++   SVELRKKKTGKIIAQGRHTKYLA+ASKL
Sbjct  126  GKAVGVASVELRKKKTGKIIAQGRHTKYLALASKL  160



>ref|XP_011005574.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Populus euphratica]
Length=156

 Score =   221 bits (563),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYE---AIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
            MDLES+K++LEK G E +   + ++ MPLRF E FI  G+ +DL E GR++C+ KVP RL
Sbjct  1    MDLESVKRYLEKGGYEEDKNASTIEKMPLRFFERFIMQGLHIDLIEPGRVVCSMKVPSRL  60

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLR  392
            +N GNFLHGGATATLVD+VGSAAI+T+G P +GVSVEINVSYLD AF DEE+EIEA+VLR
Sbjct  61   LNGGNFLHGGATATLVDLVGSAAIFTVGAPVTGVSVEINVSYLDAAFADEEIEIEARVLR  120

Query  393  MGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            +GK++  VSVEL+KKKTGKIIAQGRHTKYLAV SK+
Sbjct  121  VGKAVGVVSVELKKKKTGKIIAQGRHTKYLAVPSKM  156



>gb|EYU31202.1| hypothetical protein MIMGU_mgv1a015533mg [Erythranthe guttata]
Length=154

 Score =   221 bits (563),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MDLES+KKF+EK+GG+YE  VDSMP RF+EP +  G+K+D  ERGR++C+  VP RL+N 
Sbjct  1    MDLESVKKFVEKDGGDYEFTVDSMPARFIEPIVMQGLKIDRIERGRVVCSLTVPPRLLNT  60

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            GN LHGGATA LVDI GSA IYTMG PT+GVSVEINVSYL  A++ EE+EI++K LR+GK
Sbjct  61   GNTLHGGATAALVDIAGSAVIYTMGAPTTGVSVEINVSYLSGAYVGEEIEIDSKALRVGK  120

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVAS  494
            S+A VSV+   KKTGK+IAQGRHTKYL VA+
Sbjct  121  SVAVVSVDFTSKKTGKLIAQGRHTKYLPVAT  151



>ref|XP_012088374.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Jatropha curcas]
 gb|KDP24210.1| hypothetical protein JCGZ_25867 [Jatropha curcas]
Length=154

 Score =   221 bits (562),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEG-GEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDLE +K+FLEKE  G+  + ++ MPLRF E F+  GI+VDL E GR++C+ KVP RL+N
Sbjct  1    MDLEKVKRFLEKEDDGKNRSAIEEMPLRFFERFVMQGIRVDLIEPGRLVCSMKVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
             GNFLHGGATATLVD+VGSA IYT+G P +GVSVEINVSYLD A+ DEE+EI+A+VLR+G
Sbjct  61   AGNFLHGGATATLVDLVGSAVIYTVGAPFTGVSVEINVSYLDAAYADEEIEIDARVLRVG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K++  VSVE RKK+TGKIIAQGRHTKYLAV+SK+
Sbjct  121  KAVGVVSVEFRKKETGKIIAQGRHTKYLAVSSKM  154



>gb|ABK94218.1| unknown [Populus trichocarpa]
Length=156

 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 130/156 (83%), Gaps = 3/156 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYE---AIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
            MDLES+K++LE  G E +   + ++ MPLRF E FI  G+ +DL E GR++C+ KVP RL
Sbjct  1    MDLESVKRYLETGGYEEDKNASTIEKMPLRFFERFIMQGLHIDLIEPGRVVCSMKVPPRL  60

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLR  392
            +N GNFLHGGATATLVD+VGSAAI+T+G P +GVSVEINVSYLD AF DEE+EIEA+VLR
Sbjct  61   LNGGNFLHGGATATLVDLVGSAAIFTVGAPATGVSVEINVSYLDAAFADEEIEIEARVLR  120

Query  393  MGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            +GK++  VSVEL+KKKTGKIIAQGRHTKYLAV SKL
Sbjct  121  VGKAVGVVSVELKKKKTGKIIAQGRHTKYLAVPSKL  156



>ref|XP_004293721.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Fragaria vesca subsp. 
vesca]
Length=166

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  39   EMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            ++D+E+ +++LEKEG E  A +DS+P +F EPFI  GIKVD  ERG I+C+FKVP RL+N
Sbjct  14   QIDMEAARRYLEKEG-ETAASMDSLPDKFFEPFIMKGIKVDRIERGTIVCSFKVPPRLLN  72

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
             G FLHGGATATLVD+VGSA IYT+G PT GVSVEIN+SYLD A+  E+VEIEAK LR+G
Sbjct  73   GGGFLHGGATATLVDLVGSAVIYTVGAPTVGVSVEINISYLDSAYAGEDVEIEAKALRVG  132

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K++A VS+E RKKKTGKIIAQGRHTKYLA+ASKL
Sbjct  133  KAVAVVSIEFRKKKTGKIIAQGRHTKYLALASKL  166



>ref|XP_007212178.1| hypothetical protein PRUPE_ppa012630mg [Prunus persica]
 gb|EMJ13377.1| hypothetical protein PRUPE_ppa012630mg [Prunus persica]
Length=160

 Score =   219 bits (557),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = +3

Query  36   KEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            +E  +ES+KKFLEKEG E    +D +P +F EPFI  GI+VDL E GRI+C+FKVP RL+
Sbjct  7    EETSMESVKKFLEKEG-EMAISMDGLPDKFFEPFIMKGIQVDLLEPGRIVCSFKVPPRLL  65

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GNF+HGGATATLVD++GSAAI T+G P+ GVSVEINVSYLD A+  EEVE+EAK LR+
Sbjct  66   NGGNFMHGGATATLVDLIGSAAILTVGTPSVGVSVEINVSYLDSAYPGEEVEVEAKALRV  125

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++   SVELRKKKTGKIIAQGRHTKYLA+ASKL
Sbjct  126  GKAVGVASVELRKKKTGKIIAQGRHTKYLALASKL  160



>ref|XP_006418144.1| hypothetical protein EUTSA_v10008953mg [Eutrema salsugineum]
 gb|ESQ36497.1| hypothetical protein EUTSA_v10008953mg [Eutrema salsugineum]
Length=160

 Score =   218 bits (556),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 129/160 (81%), Gaps = 7/160 (4%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEY-------EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKV  200
            M+LES+K++LE EG E        E+ V ++P RFLE F++ GIKVDL E GRI+C+ KV
Sbjct  1    MNLESVKQYLEGEGAENDEGGMEKESKVANLPHRFLERFVTKGIKVDLIEPGRIVCSMKV  60

Query  201  PLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEA  380
            P  L+N GNFLHGGATATLVD++GSAAIYT G   +GVSVEINVSYLD AFLDEE+EIE+
Sbjct  61   PPHLLNAGNFLHGGATATLVDLIGSAAIYTTGATQTGVSVEINVSYLDAAFLDEEIEIES  120

Query  381  KVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K LR+GK++A VSVELRKKKTGKIIAQGRHTKYL   SKL
Sbjct  121  KTLRVGKAVAVVSVELRKKKTGKIIAQGRHTKYLPPRSKL  160



>ref|XP_006466210.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Citrus sinensis]
Length=156

 Score =   218 bits (555),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 133/156 (85%), Gaps = 3/156 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGE---YEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
            M+LES+K++LEK GG+    ++ ++ MP +F E FI  G++VDL+E GR+IC+ KVP RL
Sbjct  1    MELESVKRYLEKGGGDDDKNKSTMEEMPTKFFERFIMQGLRVDLSEPGRVICSMKVPPRL  60

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLR  392
            +N GNF+HGGATATLVD+VGSAAI+T+G P+ GVSVEINVSYLD AF  EE+EIEAKVLR
Sbjct  61   LNAGNFMHGGATATLVDLVGSAAIFTVGAPSVGVSVEINVSYLDAAFGGEEIEIEAKVLR  120

Query  393  MGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            +GK++A VSVELRKK TGKI+AQGRHTKYLA++SK+
Sbjct  121  VGKAVAVVSVELRKKDTGKIVAQGRHTKYLAISSKM  156



>ref|XP_006426410.1| hypothetical protein CICLE_v10026677mg [Citrus clementina]
 gb|ESR39650.1| hypothetical protein CICLE_v10026677mg [Citrus clementina]
 gb|KDO58740.1| hypothetical protein CISIN_1g031596mg [Citrus sinensis]
Length=157

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 133/157 (85%), Gaps = 4/157 (3%)
 Frame = +3

Query  42   MDLESIKKFLEKEGG----EYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLR  209
            M+LES+K++LEK GG    + ++ ++ MP +F E FI  G++VDL+E GR+IC+ KVP R
Sbjct  1    MELESVKRYLEKGGGGDDDKNKSTMEEMPTKFFERFIMQGLRVDLSEPGRVICSMKVPPR  60

Query  210  LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            L+N GNF+HGGATATLVD+VGSAAI+T+G P+ GVSVEINVSYLD AF  EE+EIEAKVL
Sbjct  61   LLNAGNFMHGGATATLVDLVGSAAIFTVGAPSVGVSVEINVSYLDAAFGGEEIEIEAKVL  120

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            R+GK++A VSVELRKK TGKI+AQGRHTKYLA++SK+
Sbjct  121  RVGKAVAVVSVELRKKDTGKIVAQGRHTKYLAISSKM  157



>ref|XP_006851249.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X1 [Amborella 
trichopoda]
 gb|ERN12830.1| hypothetical protein AMTR_s00180p00041530 [Amborella trichopoda]
Length=153

 Score =   216 bits (549),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MDL+++K+ LE  G    A VDS+P RF + FI HG+K+D  E GR+IC+FKVP RLVN 
Sbjct  1    MDLQAVKQSLESTGESLSASVDSLPGRFFDSFILHGLKIDTIEPGRVICSFKVPQRLVNT  60

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            GNFLHGGATA+LVDIVGSAA+   G  TSGVSVEIN+SYLD AFL E VEIEA VLRMGK
Sbjct  61   GNFLHGGATASLVDIVGSAALMAAGALTSGVSVEINISYLDAAFLGEGVEIEANVLRMGK  120

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            +I  V+V+LRKKKTG ++AQGRHTKYLA +SKL
Sbjct  121  AIGVVNVDLRKKKTGTLVAQGRHTKYLAASSKL  153



>ref|XP_010547868.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Tarenaya hassleriana]
Length=157

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 129/157 (82%), Gaps = 4/157 (3%)
 Frame = +3

Query  42   MDLESIKKFLE----KEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLR  209
            MD+E++K++LE     EG +     ++MP RF E F +  +K++L ERGR+IC+ KVP R
Sbjct  1    MDIETVKRYLEGKAGDEGDDSSGSKNTMPDRFFERFFAGCLKIELIERGRVICSMKVPPR  60

Query  210  LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            L+N GNFLHGGATATLVD+VGSA I+T+G P +GVSVEINVSYLD A++DEE+EIEAK L
Sbjct  61   LLNSGNFLHGGATATLVDLVGSAVIFTLGAPQTGVSVEINVSYLDAAYVDEEIEIEAKSL  120

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            R+GK++A VSVELRKKKTGKIIAQGRHTKYLA+ SKL
Sbjct  121  RVGKAVAVVSVELRKKKTGKIIAQGRHTKYLAITSKL  157



>ref|XP_006418145.1| hypothetical protein EUTSA_v10008953mg [Eutrema salsugineum]
 gb|ESQ36498.1| hypothetical protein EUTSA_v10008953mg [Eutrema salsugineum]
Length=164

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 127/158 (80%), Gaps = 7/158 (4%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEY-------EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKV  200
            M+LES+K++LE EG E        E+ V ++P RFLE F++ GIKVDL E GRI+C+ KV
Sbjct  1    MNLESVKQYLEGEGAENDEGGMEKESKVANLPHRFLERFVTKGIKVDLIEPGRIVCSMKV  60

Query  201  PLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEA  380
            P  L+N GNFLHGGATATLVD++GSAAIYT G   +GVSVEINVSYLD AFLDEE+EIE+
Sbjct  61   PPHLLNAGNFLHGGATATLVDLIGSAAIYTTGATQTGVSVEINVSYLDAAFLDEEIEIES  120

Query  381  KVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVAS  494
            K LR+GK++A VSVELRKKKTGKIIAQGRHTKYL   S
Sbjct  121  KTLRVGKAVAVVSVELRKKKTGKIIAQGRHTKYLPPRS  158



>ref|XP_011083209.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X2 [Sesamum 
indicum]
Length=153

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD +++K+ +EKEGG+YE  VDSMP RF+EP +  G+K+D  ERG ++C+F VP RL+N 
Sbjct  1    MDFDTVKRLVEKEGGDYEFTVDSMPPRFIEPIVMQGLKIDHIERGLVVCSFTVPPRLLNT  60

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            GN LHGGATA LVDIVGSA I+TMG PT+GVSVEINVSYL  A + EE+EIE+K LR+GK
Sbjct  61   GNTLHGGATAALVDIVGSAVIFTMGAPTTGVSVEINVSYLSGADVGEEIEIESKALRVGK  120

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            ++A VSV+ R KKTGK+IAQGRHTKYL + SK+
Sbjct  121  ALAVVSVDFRSKKTGKLIAQGRHTKYLVLPSKM  153



>ref|XP_002892206.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68465.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=155

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 126/155 (81%), Gaps = 2/155 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEY--EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            MDLES+K++LE +  E   E+ V  +P RFLE F+++G+KVDL E GRI+C+ K+P  L+
Sbjct  1    MDLESVKRYLEGDEDEKAKESKVAKLPHRFLERFVTNGLKVDLIEPGRIVCSMKIPPHLL  60

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GNFLHGGATATLVD++GSA IYT GV  SGVSVEINVSYLD AFLDEE+EIE+K LR+
Sbjct  61   NAGNFLHGGATATLVDLIGSAVIYTAGVSHSGVSVEINVSYLDAAFLDEEIEIESKALRV  120

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A VSVELRKKKT KIIAQGRHTKY A  S +
Sbjct  121  GKAVAVVSVELRKKKTAKIIAQGRHTKYFAPRSNI  155



>gb|KDO58739.1| hypothetical protein CISIN_1g031596mg [Citrus sinensis]
Length=156

 Score =   211 bits (537),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 132/157 (84%), Gaps = 5/157 (3%)
 Frame = +3

Query  42   MDLESIKKFLEKEGG----EYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLR  209
            M+LES+K++LEK GG    + ++ ++ MP +F E FI  G++VDL+E GR+IC+ KVP R
Sbjct  1    MELESVKRYLEKGGGGDDDKNKSTMEEMPTKFFERFIMQGLRVDLSEPGRVICSMKVPPR  60

Query  210  LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            L+N GNF+HGGATATLVD+VGSAAI+T+G P+ GVSVEINVSYLD AF   E+EIEAKVL
Sbjct  61   LLNAGNFMHGGATATLVDLVGSAAIFTVGAPSVGVSVEINVSYLDAAF-GGEIEIEAKVL  119

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            R+GK++A VSVELRKK TGKI+AQGRHTKYLA++SK+
Sbjct  120  RVGKAVAVVSVELRKKDTGKIVAQGRHTKYLAISSKM  156



>ref|XP_006303380.1| hypothetical protein CARUB_v10010530mg [Capsella rubella]
 gb|EOA36278.1| hypothetical protein CARUB_v10010530mg [Capsella rubella]
Length=157

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGE----YEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLR  209
            MDLES+K++LE +G E     E+ V ++P RFLE F+++G+KVDL E GR++C+ K+P  
Sbjct  1    MDLESVKRYLEGDGEEESKAKESKVANLPHRFLERFVTNGLKVDLIEPGRLVCSMKIPSH  60

Query  210  LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            L+N GNFLHGGATATLVD++GSA IYT GV  SGVSVEINVSYLD AFL EE+EIE+K L
Sbjct  61   LLNAGNFLHGGATATLVDLIGSAVIYTAGVSHSGVSVEINVSYLDAAFLHEEIEIESKAL  120

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            R+GK++A  SVELRKKK GKIIAQGRHTKY A  S L
Sbjct  121  RVGKAVAVTSVELRKKKNGKIIAQGRHTKYFAPRSNL  157



>ref|NP_563705.1| thioesterase-like protein [Arabidopsis thaliana]
 gb|AAB70447.1| EST gb|T45093 comes from this gene [Arabidopsis thaliana]
 gb|AAM66935.1| unknown [Arabidopsis thaliana]
 gb|AEE27679.1| thioesterase-like protein [Arabidopsis thaliana]
Length=155

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 124/155 (80%), Gaps = 2/155 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEY--EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            MDLES+KK+LE +  E   E +V  +P RFLE F+++G+KVDL E GRI+C+ K+P  L+
Sbjct  1    MDLESVKKYLEGDEDEKAKEPMVAKLPHRFLERFVTNGLKVDLIEPGRIVCSMKIPPHLL  60

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N G FLHGGATATLVD++GSA IYT G   SGVSVEINVSYLD AFLDEE+EIE+K LR+
Sbjct  61   NAGKFLHGGATATLVDLIGSAVIYTAGASHSGVSVEINVSYLDAAFLDEEIEIESKALRV  120

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A VSVELRKK TGKIIAQGRHTKY A  S L
Sbjct  121  GKAVAVVSVELRKKTTGKIIAQGRHTKYFAPRSNL  155



>ref|XP_008371827.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Malus domestica]
Length=160

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = +3

Query  36   KEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            +E  +E +KKFLEKEG E    +DS+P RF EPFI  G  VDL E G I+C+FKVP RLV
Sbjct  7    EETSMEIVKKFLEKEG-EMAIAMDSLPDRFFEPFILKGXNVDLLEPGXIVCSFKVPPRLV  65

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GNFLHGGATATLVD++GSAAI + G  +SGVSVEINVSYLD A+  EEVE+E++ LR+
Sbjct  66   NGGNFLHGGATATLVDLIGSAAILSSGALSSGVSVEINVSYLDSAYPGEEVEVESRTLRV  125

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++   SVE+RKKKTGKIIAQGRHTKYLAV+SKL
Sbjct  126  GKTVGVASVEIRKKKTGKIIAQGRHTKYLAVSSKL  160



>ref|XP_002518008.1| acyl-CoA thioesterase, putative [Ricinus communis]
 gb|EEF44526.1| acyl-CoA thioesterase, putative [Ricinus communis]
Length=190

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 124/151 (82%), Gaps = 4/151 (3%)
 Frame = +3

Query  57   IKKFLEKEGGEYE---AIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGN  227
            +K++LEK GGE +   + ++ MPLRF E FI  GI VDL E GR++C+ KVP RL+N GN
Sbjct  41   VKRYLEK-GGEDDKNGSTIEGMPLRFFERFIMQGIHVDLIEYGRLVCSMKVPPRLLNSGN  99

Query  228  FLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSI  407
            FLHGGATATLVD+VGSA IYT+G P +GVSVEINVSYLD A+ DEE+EIE KVLR+GK++
Sbjct  100  FLHGGATATLVDLVGSAVIYTVGAPFTGVSVEINVSYLDAAYPDEEIEIEGKVLRVGKAV  159

Query  408  AFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
              VSVELRKKKTGKIIAQGRHTKYLA  SK+
Sbjct  160  GVVSVELRKKKTGKIIAQGRHTKYLAFTSKM  190



>ref|XP_010674272.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Beta vulgaris subsp. 
vulgaris]
Length=154

 Score =   208 bits (529),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAI-VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            M+ E++KK+LEK G E E   + ++P RF + FI HG+  ++ E GR++C+FKVP RL+N
Sbjct  1    MEFETVKKYLEKPGKEDEPTKIHNLPFRFFDSFIIHGLHPEIIEPGRVLCSFKVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
              N LHGGA A+LVD+VGSA IYT+G P++GVSVEINVSYLD A +DEE+EIEAK LR+G
Sbjct  61   TANTLHGGAIASLVDLVGSAVIYTVGAPSTGVSVEINVSYLDAALIDEEIEIEAKALRVG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            KSIA VSVELRKK +GKIIAQGRHTKYL V+SKL
Sbjct  121  KSIAVVSVELRKKGSGKIIAQGRHTKYLPVSSKL  154



>gb|AAK32936.1|AF367350_1 At1g04290/F19P19_27 [Arabidopsis thaliana]
 gb|AAL69536.1| At1g04290/F19P19_27 [Arabidopsis thaliana]
Length=155

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 123/153 (80%), Gaps = 2/153 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEY--EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            MDLES+KK+LE +  E   E +V  +P RFLE F+++G+KVDL E GRI+C+ K+P  L+
Sbjct  1    MDLESVKKYLEGDEDEKAKEPMVAKLPHRFLERFVTNGLKVDLIEPGRIVCSMKIPPHLL  60

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N G FLHGGATATLVD++GSA IYT G   SGVSVEINVSYLD AFLDEE+EIE+K LR+
Sbjct  61   NAGKFLHGGATATLVDLIGSAVIYTAGASHSGVSVEINVSYLDAAFLDEEIEIESKALRV  120

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVAS  494
            GK++A VSVELRKK TGKIIAQGRHTKY A  S
Sbjct  121  GKAVAVVSVELRKKTTGKIIAQGRHTKYFAPRS  153



>gb|KFK42770.1| hypothetical protein AALP_AA1G037200 [Arabis alpina]
Length=158

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDS-----MPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            MDLES+KK+LE E  E     DS     +P RF+E F++ G+KVDL E GRIIC+ K+P 
Sbjct  1    MDLESVKKYLEGEETENNEGADSSKVTKLPNRFIERFVTQGVKVDLIEPGRIICSMKIPP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKV  386
             L+N GNFLHGGATAT+VD++GSA +YT G+  +GVSVEINVSYLD AFL+EE+EIEA+ 
Sbjct  61   HLLNAGNFLHGGATATIVDVIGSAVVYTSGLTQTGVSVEINVSYLDAAFLNEEIEIEART  120

Query  387  LRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            LR+GK++A VSVELRKKK GKIIAQGRHTKYLA  SKL
Sbjct  121  LRVGKAVAVVSVELRKKKNGKIIAQGRHTKYLAPRSKL  158



>ref|XP_010272560.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Nelumbo nucifera]
Length=153

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYE-AIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDLES+KKFLE+ G E E A VD +PLRF + FI  GIKVDL E GRIICT +VP RL+N
Sbjct  1    MDLESVKKFLERGGYESENASVDGLPLRFFDLFIMQGIKVDLIEPGRIICTMEVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
             GN LHGGATA++VD+V SA I+T+G   +GVS+EIN+SYLD AF++E +EIEAK LR+G
Sbjct  61   SGNILHGGATASIVDLVSSAVIFTVGRVNTGVSIEINISYLDAAFVNEPIEIEAKALRIG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVA  491
            K++A +SVELRKK TGKIIAQGRHTKYL V+
Sbjct  121  KAVAVISVELRKKSTGKIIAQGRHTKYLPVS  151



>gb|KHG28134.1| Acyl-coenzyme A thioesterase 13 [Gossypium arboreum]
Length=158

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = +3

Query  42   MDLESIKKFLEK----EGGEYEA-IVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            MDLE++KK+LEK    +G +  A  ++ MP RF E FI  G+ VD  E+GR++C+ KVP 
Sbjct  1    MDLETVKKYLEKGVGADGDDKNASTINGMPSRFFENFIMQGLHVDQIEKGRVLCSMKVPP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKV  386
            RL+N GNFLHGGATA+LVD+VGSA IYT GV TSGVSVEI+++YLD A++ EE+EIEAK 
Sbjct  61   RLLNAGNFLHGGATASLVDLVGSAVIYTYGVSTSGVSVEISITYLDAAYVGEEIEIEAKA  120

Query  387  LRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            LR+GK++A V+VE RKKKTGKIIAQGRHTKYL   SK+
Sbjct  121  LRVGKTVAVVTVEFRKKKTGKIIAQGRHTKYLTAQSKM  158



>ref|XP_009119319.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Brassica rapa]
Length=154

 Score =   206 bits (523),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEG-GEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            M+LES+K++LE +   E E+ V ++P RF+E F++ GIKVD  E GRI+C+ KV   L+N
Sbjct  1    MNLESVKQYLEGDKEKEKESEVANLPPRFIERFVAKGIKVDFIEHGRIVCSMKVQPHLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
             GNFLHGGATATLVD++GSA I+T G+P +GVSVEINVSYLD AFLDEE+EIE+K LR+G
Sbjct  61   AGNFLHGGATATLVDLIGSAVIHTTGLPHTGVSVEINVSYLDSAFLDEEIEIESKALRVG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K++A  SVELRKKK GK+IAQGRHTKYLA  SKL
Sbjct  121  KAVAVASVELRKKKDGKLIAQGRHTKYLAPRSKL  154



>ref|XP_010096407.1| hypothetical protein L484_013088 [Morus notabilis]
 gb|EXB64078.1| hypothetical protein L484_013088 [Morus notabilis]
Length=153

 Score =   205 bits (522),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            M +E +KK LE+ G E    V S+P +F E  +  G++VDL E GRI+C+F VP RL+N 
Sbjct  1    MGMEEVKKVLER-GEENAEAVGSLPAKFFERLVMKGLRVDLIETGRIVCSFTVPSRLLNE  59

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVP-TSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
            GNFLHGGATATLVD+VGSA IYT+G P T+GVSVEINVSYLD A+  EE+E+EAK LR+G
Sbjct  60   GNFLHGGATATLVDLVGSAVIYTVGAPVTTGVSVEINVSYLDAAYAGEEIEVEAKALRVG  119

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K+I  VSVELRKKKTGKI+AQGRHTKYLAV+SK+
Sbjct  120  KAIGVVSVELRKKKTGKIVAQGRHTKYLAVSSKM  153



>ref|XP_010483354.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Camelina sativa]
 ref|XP_010475081.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Camelina sativa]
Length=155

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAI-VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDLES+K++LE +G E +   V ++P RFLE F+++G+KVDL E GR+IC+ KVP  L+N
Sbjct  1    MDLESVKRYLEGDGEEEKKTKVANLPHRFLERFVTNGLKVDLIEPGRLICSMKVPPHLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTM-GVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
             G+FLHGGATATLVD++GSA IYT  GV  SGVSVEINVSYLD AFL EE+EIE++ LR+
Sbjct  61   AGSFLHGGATATLVDLIGSAVIYTAAGVTHSGVSVEINVSYLDAAFLHEEIEIESRALRV  120

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A VSVELRKKKTGKIIAQGRHTKY A  S L
Sbjct  121  GKAVAVVSVELRKKKTGKIIAQGRHTKYFAPRSNL  155



>ref|XP_003523189.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Glycine 
max]
 gb|KHN31227.1| Acyl-coenzyme A thioesterase 13 [Glycine soja]
Length=154

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 126/155 (81%), Gaps = 3/155 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MDLE++K++LEK GGE  + VD +P RFLEP I + +KVDL E GR++C+ K+P RL+N 
Sbjct  1    MDLEAVKRYLEK-GGETASAVDGLPPRFLEPLIMNALKVDLIETGRVVCSMKIPPRLLNA  59

Query  222  GNFLHGGATATLVDIVGSAAIYTMG--VPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            GN LHGGA A LVD+VGSAAI T+G   P +GVSVEINVSYLD A+ DEE+EIEA+ LR+
Sbjct  60   GNSLHGGAIAALVDVVGSAAIPTVGYSAPNTGVSVEINVSYLDAAYADEEIEIEARALRV  119

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A +SVE +KKKTGK+ AQGRHTK+L ++SK+
Sbjct  120  GKAVAVISVEFKKKKTGKVFAQGRHTKFLPLSSKM  154



>gb|KJB39070.1| hypothetical protein B456_007G067900 [Gossypium raimondii]
 gb|KJB39071.1| hypothetical protein B456_007G067900 [Gossypium raimondii]
Length=158

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = +3

Query  42   MDLESIKKFLEK----EGGEYEA-IVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            MDLE++KK+LEK    +G +  A  ++ MP RF E FI  G+ VD  E+GR++C+ KVP 
Sbjct  1    MDLETVKKYLEKGVGADGDDKNASTINGMPSRFFENFIMQGLHVDQIEKGRVLCSMKVPP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKV  386
            RL+N GNFLHGGATA+LVD+VGSA IY+ G  TSGVSVEI+++YLD A++ EE+EIEAK 
Sbjct  61   RLLNAGNFLHGGATASLVDLVGSAVIYSYGASTSGVSVEISITYLDAAYVGEEIEIEAKA  120

Query  387  LRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            LR+GK++A V+VE RKKKTGKIIAQGRHTKYL V SK+
Sbjct  121  LRVGKTVAVVTVEFRKKKTGKIIAQGRHTKYLTVQSKM  158



>ref|XP_007048646.1| Thioesterase superfamily protein [Theobroma cacao]
 gb|EOX92803.1| Thioesterase superfamily protein [Theobroma cacao]
Length=157

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYE----AIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLR  209
            MDLE++KK+LEK GG+ +      +   P RF E FI  G++VDL E+G ++C+ KVP R
Sbjct  1    MDLETVKKYLEKGGGDDDDKNAPTIHGFPSRFFENFIMQGLRVDLIEKGHLLCSMKVPPR  60

Query  210  LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            L+N GNFLHGGATA+LVD++G+  +YT GV +SGVSVEINV+YLD A++DEE+EIEA+ L
Sbjct  61   LLNAGNFLHGGATASLVDMIGAGVLYTYGVSSSGVSVEINVTYLDSAYVDEEIEIEARAL  120

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            R+GK++A VSVE RKK+TGKI+AQGRHTKYL V SK+
Sbjct  121  RVGKTVAVVSVEFRKKETGKIVAQGRHTKYLPVQSKM  157



>gb|AFK13840.1| putative acyl-CoA thioesterase [Beta vulgaris subsp. vulgaris]
Length=155

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 125/155 (81%), Gaps = 2/155 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAI-VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            M+ E++KK+LEK G E E   + ++P RF + FI HG+  ++ E GR++C+FKVP RL+N
Sbjct  1    MEFETVKKYLEKPGKEDEPTKIHNLPFRFFDSFIIHGLHPEIIEPGRVLCSFKVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLD-EEVEIEAKVLRM  395
              N LHGGA A+LVD+VGSA IYT+G P++GVSVEINVSYLD A +D EE+EIEAK LR+
Sbjct  61   TANTLHGGAIASLVDLVGSAVIYTVGAPSTGVSVEINVSYLDAALVDVEEIEIEAKALRV  120

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GKSIA VSVELRKK +GKIIAQGRHTKYL V+SKL
Sbjct  121  GKSIAVVSVELRKKGSGKIIAQGRHTKYLPVSSKL  155



>emb|CDY18217.1| BnaC05g02400D [Brassica napus]
Length=154

 Score =   202 bits (515),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLE-KEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            M+LE +K++LE  +  E E+ V ++P RF+E F++ GIKVDL E GRI+C+ KV   L+N
Sbjct  1    MNLELVKQYLEGDKKDEDESKVANLPPRFIERFVAKGIKVDLIEPGRIVCSMKVQPHLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
             G+FLHGGATATLVD++GSA I+T GV +SGVSVEINVSYLD AFLDEE+EIE+K LR+G
Sbjct  61   AGSFLHGGATATLVDLIGSAVIFTTGVSSSGVSVEINVSYLDSAFLDEEIEIESKALRVG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K++A VSVELRKKK GK+IAQGRHTKYLA  SKL
Sbjct  121  KAVAVVSVELRKKKDGKLIAQGRHTKYLAPRSKL  154



>ref|XP_002271479.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Vitis vinifera]
 emb|CBI27696.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEK-EGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDLES+K+ LE  +G E E+ ++S+P R  +PFI  G+ VDL E GR+IC+ KVP RL+N
Sbjct  1    MDLESVKRLLENGQGTENESSINSLPTRLFDPFILQGLHVDLVEPGRLICSMKVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
             GNFLHGGA A+LVD+VGSAAI++ G P SGVSVEINVSYLD A+ DEE+EIE KVLR+G
Sbjct  61   NGNFLHGGAMASLVDLVGSAAIFSTGAPNSGVSVEINVSYLDAAYADEEIEIECKVLRVG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            KS+  VSVE+RKKKTGKIIAQGRHTKYL V SK+
Sbjct  121  KSVGVVSVEIRKKKTGKIIAQGRHTKYLLVRSKI  154



>ref|XP_011083208.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X1 [Sesamum 
indicum]
Length=176

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 126/176 (72%), Gaps = 23/176 (13%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD +++K+ +EKEGG+YE  VDSMP RF+EP +  G+K+D  ERG ++C+F VP RL+N 
Sbjct  1    MDFDTVKRLVEKEGGDYEFTVDSMPPRFIEPIVMQGLKIDHIERGLVVCSFTVPPRLLNT  60

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYL---DVAFL------------  356
            GN LHGGATA LVDIVGSA I+TMG PT+GVSVEINVSYL   DV  L            
Sbjct  61   GNTLHGGATAALVDIVGSAVIFTMGAPTTGVSVEINVSYLSGADVGHLHCLANQNHQQTL  120

Query  357  --------DEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
                     EE+EIE+K LR+GK++A VSV+ R KKTGK+IAQGRHTKYL + SK+
Sbjct  121  LTCIHYLFQEEIEIESKALRVGKALAVVSVDFRSKKTGKLIAQGRHTKYLVLPSKM  176



>gb|ACU19163.1| unknown [Glycine max]
Length=154

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 124/155 (80%), Gaps = 3/155 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MDLE++K++LEK GGE  + VD +P RFLEP I + +KVD  E GR++C+ K+P RL+N 
Sbjct  1    MDLEAVKRYLEK-GGETASAVDGLPPRFLEPLIMNALKVDFIETGRVVCSMKIPPRLLNA  59

Query  222  GNFLHGGATATLVDIVGSAAIYTMG--VPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            GN LHGGA A LVD+ GSAAI T+G   P +GVSVEINVSYLD A+ DEE+EIEA+ LR+
Sbjct  60   GNSLHGGAIAALVDVAGSAAIPTVGYSAPNTGVSVEINVSYLDAAYADEEIEIEARALRV  119

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A +SVE +KKKTGK+ AQGRHTK+L ++SK+
Sbjct  120  GKAVAVISVEFKKKKTGKVFAQGRHTKFLPLSSKM  154



>emb|CDX89829.1| BnaA10g02530D [Brassica napus]
Length=154

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 123/149 (83%), Gaps = 1/149 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEG-GEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            M+LES+K++LE +   E E+ V ++P RF+E F++ GIKVD  E GRI+C+ KV   L+N
Sbjct  1    MNLESVKQYLEGDKEKEKESEVANLPPRFIERFVAKGIKVDFIEHGRIVCSMKVQPHLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
             GNFLHGGATATLVD++GSA I+T G+P +GVSVEINVSYLD AFLDEE+EIE+K LR+G
Sbjct  61   AGNFLHGGATATLVDLIGSAVIHTTGLPHTGVSVEINVSYLDSAFLDEEIEIESKALRVG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLA  485
            K++A  SVELRKKK GK+IAQGRHTKYLA
Sbjct  121  KAVAVASVELRKKKDGKLIAQGRHTKYLA  149



>ref|XP_010256352.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Nelumbo nucifera]
Length=154

 Score =   201 bits (511),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEK-EGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDLES+K+ LE+ +     A +D++P +F + FI  G+KVDL E GRIICT KVP RL+N
Sbjct  1    MDLESVKRMLERGDNKSGNASLDALPPKFFDQFIVQGLKVDLIEPGRIICTMKVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
             GNFLHGGATA+L+D+VGSA I ++G   +GVS+EINVSYLD AF DEE+EIE K LR+G
Sbjct  61   SGNFLHGGATASLIDLVGSAVISSVGYVITGVSLEINVSYLDAAFPDEEIEIEGKALRIG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            ++I  VSVELRKKKT KI+AQGRHTKYLA++SK+
Sbjct  121  RTIGVVSVELRKKKTRKIVAQGRHTKYLAISSKM  154



>gb|AFK39159.1| unknown [Lotus japonicus]
Length=154

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 126/155 (81%), Gaps = 3/155 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            M+L+S+KKFLEK+G E  ++VD +P +FLEP     + VDL E GR++C+ K+P RL+N 
Sbjct  1    MNLDSVKKFLEKKG-ETASMVDGLPPKFLEPLTLSSLHVDLIEPGRVVCSMKIPPRLLNG  59

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPT--SGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            GN LHGGATATLVD+VGSAAI T+G  +  +GVSVEINVSYLD A++DEE+EIEA+ LR+
Sbjct  60   GNSLHGGATATLVDVVGSAAIPTVGYSSASTGVSVEINVSYLDAAYVDEEIEIEARALRV  119

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A VSVE RKK+TGK+ AQGRHTKYL + SK+
Sbjct  120  GKAVAVVSVEFRKKETGKVFAQGRHTKYLVLPSKI  154



>ref|XP_008460849.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Cucumis melo]
Length=150

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 122/151 (81%), Gaps = 1/151 (1%)
 Frame = +3

Query  48   LESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGN  227
            +E  K++LEK G +  AI D +P RF E FI  GI+VDL + GRI+C+ KVP RL+N  N
Sbjct  1    MEKTKRYLEKLGDDASAI-DVLPFRFYENFIMTGIRVDLIQPGRILCSLKVPARLLNENN  59

Query  228  FLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSI  407
             LHGGA+A+LVD +GSAA+ T+G  T+GVS+EIN+SYLD A+LDEE+EI++KVLRMGK+I
Sbjct  60   SLHGGASASLVDCIGSAALKTLGATTTGVSLEINLSYLDAAYLDEEIEIDSKVLRMGKTI  119

Query  408  AFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            A ++VELR+K  GKIIAQGRHTKYLA +SKL
Sbjct  120  AVINVELRRKSNGKIIAQGRHTKYLAFSSKL  150



>ref|XP_006578750.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X2 [Glycine 
max]
Length=161

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 126/162 (78%), Gaps = 10/162 (6%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MDLE++K++LEK GGE  + VD +P RFLEP I + +KVDL E GR++C+ K+P RL+N 
Sbjct  1    MDLEAVKRYLEK-GGETASAVDGLPPRFLEPLIMNALKVDLIETGRVVCSMKIPPRLLNA  59

Query  222  GNFLHGGATATLVDIVGSAAIYTMG--VPTSGVSVEINVSYLDVAFLD-------EEVEI  374
            GN LHGGA A LVD+VGSAAI T+G   P +GVSVEINVSYLD A+ D       EE+EI
Sbjct  60   GNSLHGGAIAALVDVVGSAAIPTVGYSAPNTGVSVEINVSYLDAAYADVSRLLSLEEIEI  119

Query  375  EAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            EA+ LR+GK++A +SVE +KKKTGK+ AQGRHTK+L ++SK+
Sbjct  120  EARALRVGKAVAVISVEFKKKKTGKVFAQGRHTKFLPLSSKM  161



>ref|XP_007048643.1| Thioesterase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007048644.1| Thioesterase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX92800.1| Thioesterase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX92801.1| Thioesterase superfamily protein isoform 1 [Theobroma cacao]
Length=150

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD+E++K++LE          D +PLRF E  I HG++VDL E  R+ICTFKV  RL+N 
Sbjct  1    MDMETVKEYLENSAN---IDGDELPLRFFERLIMHGLRVDLIETSRVICTFKVSPRLLNG  57

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
             N+LHGG TATLVD+VGSAA+YT+G P +GVSVEINVSY+D A+ DEE+EIEA+ L +GK
Sbjct  58   SNYLHGGVTATLVDLVGSAAVYTVGAPFTGVSVEINVSYMDAAYADEEIEIEARALHVGK  117

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            ++A +SVE RKK TGKIIAQGRHTK+L++ SK+
Sbjct  118  AVAVLSVEFRKKNTGKIIAQGRHTKHLSLPSKM  150



>ref|XP_010027483.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Eucalyptus grandis]
 gb|KCW54027.1| hypothetical protein EUGRSUZ_I00015 [Eucalyptus grandis]
Length=151

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 121/152 (80%), Gaps = 5/152 (3%)
 Frame = +3

Query  51   ESIKKFLEKE--GGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMG  224
            + ++++LEK   GG+ +   D +P +  E  +  G+++DL ERGRI+C+  VP RL+N G
Sbjct  3    DQVRRYLEKAAAGGDGD---DKLPPKLFESLVMSGLRLDLVERGRIVCSMNVPPRLLNAG  59

Query  225  NFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKS  404
            NFLHGGATATLVD+VGSA ++T+G P +GVSVEINVSYLD AFL+EEVEIEAKVLR+GK+
Sbjct  60   NFLHGGATATLVDVVGSAVMFTVGAPLTGVSVEINVSYLDAAFLNEEVEIEAKVLRVGKA  119

Query  405  IAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            +   SVE RKK +GKIIAQGRHTKYLAV SK+
Sbjct  120  VGVTSVEFRKKSSGKIIAQGRHTKYLAVPSKI  151



>emb|CAN70724.1| hypothetical protein VITISV_011379 [Vitis vinifera]
Length=154

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEK-EGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDL S+K+ LEK EG E  ++++SMP +  +PFI HG+ +DL ERGR+IC+ KVP RL+N
Sbjct  1    MDLGSVKRXLEKKEGTESASLINSMPSQVFDPFILHGLHIDLVERGRLICSMKVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
                LHGGATA+LVD+VG+AAI T+G P +GVSVEI+VS+LD AF+DEE+EIEAKVLR+G
Sbjct  61   TAKTLHGGATASLVDLVGAAAIATVGSPLTGVSVEISVSFLDAAFVDEEIEIEAKVLRVG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            KS+  VSVE+RKKKTGKI+AQGRHTK+LAV SK+
Sbjct  121  KSVGVVSVEIRKKKTGKIVAQGRHTKFLAVPSKM  154



>ref|XP_007137838.1| hypothetical protein PHAVU_009G160000g [Phaseolus vulgaris]
 gb|ESW09832.1| hypothetical protein PHAVU_009G160000g [Phaseolus vulgaris]
Length=154

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MDLE++K++LEK  G   + VD +P RFLEP + + +KVDL + GRI+C+ K+P RL+N 
Sbjct  1    MDLEAVKRYLEKGVGT-SSEVDGLPPRFLEPLVMNSLKVDLIQPGRIVCSMKIPQRLLNA  59

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVP--TSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            GN LHGGATA LVD+VGSA I T+G    T+GVSVEINVSYLD A++DEE+EIEA+ LR+
Sbjct  60   GNSLHGGATAALVDVVGSAVIPTVGYSGSTTGVSVEINVSYLDAAYVDEEIEIEARALRV  119

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A +SVE +KKKTGKI AQGRHTK+L ++SK+
Sbjct  120  GKAVAVISVEFKKKKTGKIFAQGRHTKFLPLSSKM  154



>ref|XP_002271369.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Vitis vinifera]
 emb|CBI27697.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEK-EGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDL S+K+ LEK EG E  ++++SMP +  +PFI HG+ +DL ERGR+IC+ KVP RL+N
Sbjct  1    MDLGSVKRNLEKKEGTESASLINSMPSQVFDPFILHGLHIDLVERGRLICSMKVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
                LHGGATA+LVD+VG+AAI T+G P +GVSVEI+VS+LD AF+DEE+EIEAKVLR+G
Sbjct  61   TAKTLHGGATASLVDLVGAAAIATVGSPLTGVSVEISVSFLDAAFVDEEIEIEAKVLRVG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            KS+  VSVE+RKKKTGKI+AQGRHTK+LAV SK+
Sbjct  121  KSVGVVSVEIRKKKTGKIVAQGRHTKFLAVPSKM  154



>gb|AFK36943.1| unknown [Lotus japonicus]
Length=154

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            M+L+S+KKFLEK+G E  ++VD +P +FLE      + VDL E GR++C+ K+P RL+N 
Sbjct  1    MNLDSVKKFLEKKG-ETASMVDGLPPKFLELLTLSSLHVDLIEPGRVVCSMKIPPRLLNG  59

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPT--SGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            GN LHGGATATLVD+VGSAAI T+G  +  +GVSVEINVSYLD A++DEE+EIEA+ LR+
Sbjct  60   GNSLHGGATATLVDVVGSAAIPTVGYSSASTGVSVEINVSYLDAAYVDEEIEIEARALRV  119

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A VSVE RKK+TGK+ AQGRHTKYL + SK+
Sbjct  120  GKAVAVVSVEFRKKETGKVFAQGRHTKYLVLPSKI  154



>ref|XP_003602702.1| Acyl-coenzyme A thioesterase [Medicago truncatula]
 gb|AES72953.1| acyl-CoA thioesterase, putative [Medicago truncatula]
 gb|AFK44404.1| unknown [Medicago truncatula]
Length=155

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 118/155 (76%), Gaps = 2/155 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            M+LES+K+ LEK  GE  + V+ +PL FL+P I   ++VDL E GR+IC+  +P RL+N 
Sbjct  1    MNLESVKRNLEKREGETTSTVNGLPLGFLQPLIMSSLRVDLIEPGRVICSMNIPPRLLNS  60

Query  222  GNFLHGGATATLVDIVGSAAIYTMGV--PTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            GN LHGGATA LVD+VGSAAI   G     +GVSVEINVSYLD A+  EE+EIEAK LR+
Sbjct  61   GNSLHGGATAALVDVVGSAAIPASGYLGRNTGVSVEINVSYLDAAYAHEEIEIEAKALRV  120

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A +SVE RKKKTG++ AQGRHTKYL  ASKL
Sbjct  121  GKTLATISVEFRKKKTGRVFAQGRHTKYLPTASKL  155



>gb|ABY67490.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67491.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67492.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67493.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67494.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67495.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67496.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67497.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67498.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67499.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67500.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67501.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67502.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67503.1| At1g04290, partial [Arabidopsis thaliana]
Length=141

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +3

Query  93   EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVG  272
            E +V  +P RFLE F+++G+KVDL E GRI+C+ K+P  L+N G FLHGGATATLVD++G
Sbjct  8    EPMVAKLPHRFLERFVTNGLKVDLIEPGRIVCSMKIPPHLLNAGKFLHGGATATLVDLIG  67

Query  273  SAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKI  452
            SA IYT G   SGVSVEINVSYLD AFLDEE+EIE+K LR+GK++A VSVELRKK TGKI
Sbjct  68   SAVIYTAGASHSGVSVEINVSYLDAAFLDEEIEIESKALRVGKAVAVVSVELRKKTTGKI  127

Query  453  IAQGRHTKYLAVAS  494
            IAQGRHTKY A  S
Sbjct  128  IAQGRHTKYFAPRS  141



>gb|ABY67504.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67505.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67506.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67507.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67508.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67509.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67510.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67511.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67512.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67513.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67514.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67515.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67516.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67517.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67518.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67519.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67520.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67522.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67523.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67524.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67525.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67526.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67527.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67528.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67529.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67530.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67531.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67532.1| At1g04290, partial [Arabidopsis thaliana]
 gb|ABY67533.1| At1g04290, partial [Arabidopsis thaliana]
Length=134

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  93   EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVG  272
            E +V  +P RFLE F+++G+KVDL E GRI+C+ K+P  L+N G FLHGGATATLVD++G
Sbjct  3    EPMVAKLPHRFLERFVTNGLKVDLIEPGRIVCSMKIPPHLLNAGKFLHGGATATLVDLIG  62

Query  273  SAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKI  452
            SA IYT G   SGVSVEINVSYLD AFLDEE+EIE+K LR+GK++A VSVELRKK TGKI
Sbjct  63   SAVIYTAGASHSGVSVEINVSYLDAAFLDEEIEIESKALRVGKAVAVVSVELRKKTTGKI  122

Query  453  IAQGRHTKYLA  485
            IAQGRHTKY A
Sbjct  123  IAQGRHTKYFA  133



>gb|ABY67521.1| At1g04290, partial [Arabidopsis thaliana]
Length=134

 Score =   191 bits (486),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  93   EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVG  272
            E +V  +P RFLE F+++G+KVDL E GRI+C+ K+P  L+N G FLHGGATATLVD++G
Sbjct  3    EPMVAKLPHRFLERFVTNGLKVDLIEPGRIVCSMKIPPHLLNAGKFLHGGATATLVDLIG  62

Query  273  SAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKI  452
            SA IYT G   SGVSVEINVSYLD AFLDE++EIE+K LR+GK++A VSVELRKK TGKI
Sbjct  63   SAVIYTAGASHSGVSVEINVSYLDAAFLDEDIEIESKALRVGKAVAVVSVELRKKTTGKI  122

Query  453  IAQGRHTKYLA  485
            IAQGRHTKY A
Sbjct  123  IAQGRHTKYFA  133



>ref|XP_008799061.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Phoenix dactylifera]
Length=149

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 118/153 (77%), Gaps = 4/153 (3%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MDLE+++  LE  GG+     D++P RF + F+ HG+++DL E GR++C+  VP RL + 
Sbjct  1    MDLEAVRSSLEASGGD----TDALPPRFFDEFVLHGLRIDLVEPGRVLCSMPVPPRLTSG  56

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            G+FLHGG TATLVD++GSA  Y++G+PT GVS+EI VSY+D AF+ EE+EIEAK+L  GK
Sbjct  57   GSFLHGGVTATLVDLIGSAVFYSIGLPTCGVSLEITVSYMDAAFIKEEIEIEAKLLHAGK  116

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            ++   SVE RKK TGKIIAQ RHTKYLAV+SKL
Sbjct  117  AVGVSSVEFRKKGTGKIIAQARHTKYLAVSSKL  149



>ref|XP_009353902.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Pyrus x bretschneideri]
Length=160

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 124/155 (80%), Gaps = 1/155 (1%)
 Frame = +3

Query  36   KEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            +E  +E +K FLEK G E    +D++P +F EPFI  G+KVDL E GRI+C+FKVP RL+
Sbjct  7    EETSMEMVKLFLEKRG-EMAVAMDTLPDKFFEPFIMKGVKVDLLEPGRIVCSFKVPPRLL  65

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GNF+HGGATATLVD+VGSAA+ + G    GVSVEINVSYLD A+  EEVEIE++ LR+
Sbjct  66   NGGNFMHGGATATLVDLVGSAALLSSGALNFGVSVEINVSYLDSAYPGEEVEIESRTLRV  125

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GKS+  VSVELRKKKTGKIIAQGRHTKYLAV SKL
Sbjct  126  GKSVGVVSVELRKKKTGKIIAQGRHTKYLAVPSKL  160



>ref|XP_007210246.1| hypothetical protein PRUPE_ppa015048mg [Prunus persica]
 gb|EMJ11445.1| hypothetical protein PRUPE_ppa015048mg [Prunus persica]
Length=142

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +3

Query  48   LESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGN  227
            ++S+KKFL+KEG E    +D +P +F EPFI  GI+VDL + GRI+C+FK   RL+N GN
Sbjct  1    MKSVKKFLKKEG-EMAITMDGLPEKFFEPFIMKGIQVDLLKPGRIVCSFKGTYRLLNGGN  59

Query  228  FLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSI  407
            F+HGGAT TLVD++GSAAI T+G P+ G+SVEINVSYLD A+  EEVEIEAK LR+GK +
Sbjct  60   FMHGGATTTLVDLIGSAAILTIGTPSFGISVEINVSYLDSAYPGEEVEIEAKALRVGKGV  119

Query  408  AFVSVELRKKKTGKIIAQGRHTK  476
               SVELRKKKTGKIIAQGRHTK
Sbjct  120  GVASVELRKKKTGKIIAQGRHTK  142



>ref|XP_010912580.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Elaeis guineensis]
Length=149

 Score =   191 bits (484),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 119/153 (78%), Gaps = 4/153 (3%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MDLE++++ LE  GG+     D++P R  E F+ HG+++DL E GR++C+  VP RL + 
Sbjct  1    MDLEAVRRSLEASGGD----ADALPPRLFEEFVLHGLRIDLIEPGRVLCSMPVPPRLTSA  56

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            G+FLHGG TA LVD++GSA  Y++G+PTSGVS+EI+VSY+D AF+ EEVEIEAK+L +GK
Sbjct  57   GSFLHGGVTAALVDVIGSAVFYSVGLPTSGVSLEISVSYMDAAFIKEEVEIEAKLLHIGK  116

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            ++   SVELR+K TGKIIAQ RH KYLA +SKL
Sbjct  117  AVGVSSVELRRKGTGKIIAQARHAKYLAASSKL  149



>ref|XP_007048645.1| Thioesterase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOX92802.1| Thioesterase superfamily protein isoform 3 [Theobroma cacao]
Length=144

 Score =   186 bits (473),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 9/153 (6%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD+E++K++LE          D +PLRF E  I HG++VDL E  R+ICTFK      N 
Sbjct  1    MDMETVKEYLENSAN---IDGDELPLRFFERLIMHGLRVDLIETSRVICTFK------NG  51

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
             N+LHGG TATLVD+VGSAA+YT+G P +GVSVEINVSY+D A+ DEE+EIEA+ L +GK
Sbjct  52   SNYLHGGVTATLVDLVGSAAVYTVGAPFTGVSVEINVSYMDAAYADEEIEIEARALHVGK  111

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            ++A +SVE RKK TGKIIAQGRHTK+L++ SK+
Sbjct  112  AVAVLSVEFRKKNTGKIIAQGRHTKHLSLPSKM  144



>ref|XP_004147337.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Cucumis sativus]
 gb|KGN62224.1| hypothetical protein Csa_2G336710 [Cucumis sativus]
Length=151

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 117/150 (78%), Gaps = 1/150 (1%)
 Frame = +3

Query  51   ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNF  230
            E  K +LEK G +   I D +P RF E FI  GI+V L + GRI+C+ KVP RL+N  N 
Sbjct  3    EKTKGYLEKHGDDASTI-DLLPSRFYENFILTGIRVLLIQPGRILCSLKVPARLLNENNS  61

Query  231  LHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIA  410
            LHGGA+A+LVD +GSAA+ T+G  T+GVS+EI+VSYLD A+LDEE+EI++KVLRMGK+I 
Sbjct  62   LHGGASASLVDCIGSAALATLGAITTGVSLEISVSYLDAAYLDEEIEIDSKVLRMGKTIG  121

Query  411  FVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
             V+VELR+K  GKIIAQGRHTKYLA +SKL
Sbjct  122  VVNVELRRKGNGKIIAQGRHTKYLAFSSKL  151



>ref|XP_002306008.1| hypothetical protein POPTR_0004s14170g [Populus trichocarpa]
 gb|EEE86519.1| hypothetical protein POPTR_0004s14170g [Populus trichocarpa]
Length=156

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 119/156 (76%), Gaps = 3/156 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYE---AIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
            MDLES+++++EK G E +   + ++  PLRF E F+  G+ +DL E GR++C+ KVP RL
Sbjct  1    MDLESVRRYIEKGGHEDDKKASKIEETPLRFFEKFVMEGLHIDLIEPGRVVCSMKVPPRL  60

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLR  392
            +N  + LH GATA LVD+VGSAA+   GV  +GVSVEINVSYLD A+ DEE+EIEA+VLR
Sbjct  61   LNGSDCLHAGATAMLVDVVGSAALIAAGVFLTGVSVEINVSYLDAAYADEEIEIEARVLR  120

Query  393  MGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
             GK++   SV+ RKKK+G IIAQGRHTKYL ++SK+
Sbjct  121  AGKAVGSASVDFRKKKSGAIIAQGRHTKYLLISSKM  156



>ref|XP_011625895.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X2 [Amborella 
trichopoda]
Length=148

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MDL+++K+ LE  G    A VDS+P RF + FI HG+K+D  E GR+IC+FKVP RLVN 
Sbjct  1    MDLQAVKQSLESTGESLSASVDSLPGRFFDSFILHGLKIDTIEPGRVICSFKVPQRLVNT  60

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            GNFLHGGATA+LVDIVGSAA+   G  TSGVSVEIN+SYLD AFL E VEIEA VLRMGK
Sbjct  61   GNFLHGGATASLVDIVGSAALMAAGALTSGVSVEINISYLDAAFLGEGVEIEANVLRMGK  120

Query  402  SIAFVSVELRKKKT  443
            +I  V+V+LRKKKT
Sbjct  121  AIGVVNVDLRKKKT  134



>gb|ABK25910.1| unknown [Picea sitchensis]
Length=178

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 1/157 (1%)
 Frame = +3

Query  30   MGKEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLR  209
            + +   LE ++++L        A +D +P  F +  +  G +VD AE GRI+C+  VP R
Sbjct  23   LPRSSTLEGVREWLYNMSNNLPASIDELPSGFYDALLLQGTRVDHAEPGRIVCSLIVPPR  82

Query  210  LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            LVN GNFLHGGA A  VDI+GSAAI+T G  +SGVSVEINVSYLD A   EE+EIE KVL
Sbjct  83   LVNSGNFLHGGAIAAFVDIIGSAAIFTTGAKSSGVSVEINVSYLDAAKSGEEIEIEGKVL  142

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            R+G++IAFV+VELR KKTGK++AQGRHTKYLAV SKL
Sbjct  143  RVGRAIAFVTVELR-KKTGKLVAQGRHTKYLAVTSKL  178



>emb|CAN70725.1| hypothetical protein VITISV_011380 [Vitis vinifera]
Length=193

 Score =   184 bits (467),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 127/193 (66%), Gaps = 40/193 (21%)
 Frame = +3

Query  42   MDLESIKKFLEK-EGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDLES+K+ LE  +G E E+ ++S+P R  +PFI  G+ VDL E GR+IC+ KVP RL+N
Sbjct  1    MDLESVKRLLENGQGTENESSINSLPTRLFDPFILQGLHVDLVEPGRLICSMKVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLD-------------  359
             GNFLHGGATA+LVD+VGSAAI++ G P SGVSVEINVSYLD A+ D             
Sbjct  61   NGNFLHGGATASLVDLVGSAAIFSTGAPISGVSVEINVSYLDAAYADIMNWFFFSLMPDY  120

Query  360  --------------------------EEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQ  461
                                      EE+EIE KVLR+GKS+  VSVE+RKKKTGKIIAQ
Sbjct  121  STIPYAHLAISPFFLALCSLSYIMNQEEIEIECKVLRVGKSVGVVSVEIRKKKTGKIIAQ  180

Query  462  GRHTKYLAVASKL  500
            GRHTKYL V SK+
Sbjct  181  GRHTKYLLVRSKI  193



>emb|CDX86643.1| BnaC08g00600D [Brassica napus]
Length=160

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 119/160 (74%), Gaps = 7/160 (4%)
 Frame = +3

Query  42   MDLESIKKFLEKE-----GGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            M+L S+ ++LE E     G + E+ V  +P RF+E F+  GIKVDL E GRI+C+ KV  
Sbjct  1    MNLGSVTRYLEGEVIDEGGKDKESQVAKLPSRFIERFVLKGIKVDLIEPGRIVCSMKVQP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTM--GVPTSGVSVEINVSYLDVAFLDEEVEIEA  380
             L+N G FLHGGA AT+VD++G+AAIYT      + GVSVEINVSYLD AFLDEE+EIE+
Sbjct  61   HLLNAGKFLHGGAMATVVDLIGTAAIYTNVDSDQSEGVSVEINVSYLDAAFLDEEIEIES  120

Query  381  KVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            + LR+GK++A  SVELR+KK GK+IAQGRHTKYLA   KL
Sbjct  121  RALRVGKAVAVASVELRRKKNGKMIAQGRHTKYLAPRPKL  160



>ref|XP_009111116.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Brassica rapa]
 emb|CDY15497.1| BnaA08g27810D [Brassica napus]
Length=160

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 119/160 (74%), Gaps = 7/160 (4%)
 Frame = +3

Query  42   MDLESIKKFLEKE-----GGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            M+L S+ ++LE E     G + E+ V  +P RF+E F+  GIKVDL E GRI+C+ KV  
Sbjct  1    MNLGSVTRYLEGEVIDEGGKDKESKVAKLPSRFIERFVLKGIKVDLIEPGRIVCSMKVQP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTM--GVPTSGVSVEINVSYLDVAFLDEEVEIEA  380
             L+N G FLHGGA AT+VD++G+AAIYT      + GVSVEINVSYLD AFLDEE+EIE+
Sbjct  61   HLLNAGKFLHGGAMATVVDLIGTAAIYTNVDSDQSEGVSVEINVSYLDAAFLDEEIEIES  120

Query  381  KVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            + LR+GK++A  SVELR+KK GK+IAQGRHTKYLA   KL
Sbjct  121  RALRVGKAVAVASVELRRKKNGKMIAQGRHTKYLAPRPKL  160



>ref|XP_010911767.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Elaeis guineensis]
Length=155

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 115/155 (74%), Gaps = 2/155 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEY--EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            MD E++K+ LE    E      +D++P +F + F+ HG++VDL E GR++C+  VP RL+
Sbjct  1    MDFEAVKRSLEAAAEETLPSPSLDTLPSKFYDAFVLHGLRVDLVEPGRLLCSMTVPPRLL  60

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GNFLHGGATA+LVD+VGSAA YT G  T G  +E++++YLD AF+ E++EIE KVLR 
Sbjct  61   NTGNFLHGGATASLVDLVGSAAFYTAGARTKGSPLEMSIAYLDAAFVHEDIEIEVKVLRA  120

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++   +VELRKKK+GKIIA  R+TKYLAV S L
Sbjct  121  GKAVGVATVELRKKKSGKIIAHARYTKYLAVPSNL  155



>ref|XP_009420550.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Musa acuminata 
subsp. malaccensis]
Length=151

 Score =   180 bits (456),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 117/153 (76%), Gaps = 3/153 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD E++KK+L +  G     V ++P RF +  + +G+++DL E GR++C++ VP RL + 
Sbjct  2    MDPEAVKKYLTESAGN---AVAALPARFFDVLVLNGLRLDLFEPGRVLCSYAVPPRLSSS  58

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            GN LHGG  ATLVD+VGSAAI + G+PT+GVS++INVSYLD AF  EE+E+E+K+L  GK
Sbjct  59   GNVLHGGVVATLVDVVGSAAIISSGLPTTGVSLDINVSYLDPAFTGEEIEMESKLLHAGK  118

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            ++A  SVE R K+TGK++AQGRHTKYLA +SKL
Sbjct  119  AVAVASVEFRNKRTGKLLAQGRHTKYLAASSKL  151



>gb|ABY67535.1| At1g04290-like protein, partial [Arabidopsis lyrata]
Length=129

 Score =   178 bits (452),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  93   EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVG  272
            E+ V  +P RFLE F+++G+KVDL E GRI+C+ K+P  L+N GNFLHGGATATLVD++G
Sbjct  8    ESKVAKLPHRFLERFVTNGLKVDLIEPGRIVCSMKIPPHLLNAGNFLHGGATATLVDLIG  67

Query  273  SAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKI  452
            SA IYT GV  SGVSVEINVSYLD AFLDEE+EIE+K LR+GK++A VSVELRKKKT KI
Sbjct  68   SAVIYTAGVSHSGVSVEINVSYLDAAFLDEEIEIESKALRVGKAVAVVSVELRKKKTAKI  127

Query  453  IA  458
            IA
Sbjct  128  IA  129



>gb|ABY67534.1| At1g04290-like protein, partial [Arabidopsis lyrata]
Length=129

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +3

Query  93   EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVG  272
            E+ V  +P RFLE F+++G+KVDL E GRI+C+ K+P  L+N GNFLHGGATATLVD++G
Sbjct  8    ESKVAELPHRFLERFVTNGLKVDLIEPGRIVCSMKIPPHLLNAGNFLHGGATATLVDLIG  67

Query  273  SAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKI  452
            SA IYT GV  SGVSVEINVSYLD AFLDEE+EIE+K LR+GK++A VSVELRKKKT KI
Sbjct  68   SAVIYTAGVSHSGVSVEINVSYLDAAFLDEEIEIESKALRVGKAVAVVSVELRKKKTAKI  127

Query  453  IA  458
            IA
Sbjct  128  IA  129



>gb|KJB46874.1| hypothetical protein B456_008G001500 [Gossypium raimondii]
Length=150

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 116/155 (75%), Gaps = 7/155 (5%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVD--SMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            M++E +K++LE       A +D   +PLRF +  I HG++V+L E  R++C+FKV  RL+
Sbjct  1    MEVEKVKRYLESS-----ATIDGDKLPLRFFQRLIMHGLRVELIETNRVVCSFKVTPRLL  55

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GN+LHGGA AT +D+V SAAIYT G   +G SVEIN+S++D A+ DE++EIEAK L +
Sbjct  56   NEGNYLHGGAVATFLDMVSSAAIYTAGGTLTGTSVEINISFMDAAYADEDIEIEAKALHV  115

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A +SVE RKK TGKIIAQGRHTKYL + SK+
Sbjct  116  GKAVAVLSVEFRKKSTGKIIAQGRHTKYLPLPSKM  150



>ref|XP_010457469.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Camelina sativa]
Length=164

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 114/138 (83%), Gaps = 2/138 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAI-VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDLES+K++LE +G E +   V ++P RFLE F+++G+KVDL E GR+IC+ KVP  L+N
Sbjct  1    MDLESVKRYLEGDGEEEKKTKVANLPHRFLERFVTNGLKVDLIEPGRLICSMKVPPHLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYT-MGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
             G+FLHGGATATLVD++GSA IYT  GV  SGVSVEINVSYLD AFL EE+EIE++ LR+
Sbjct  61   AGSFLHGGATATLVDLIGSAVIYTAAGVTHSGVSVEINVSYLDAAFLHEEIEIESRALRV  120

Query  396  GKSIAFVSVELRKKKTGK  449
            GK++A VSVELRKKKTGK
Sbjct  121  GKAVAVVSVELRKKKTGK  138



>ref|XP_008805875.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Phoenix dactylifera]
Length=155

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEY--EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            MD E++K+ LE    E      +D++P +F + F+ HG++VDL E GR++C+  VP RL+
Sbjct  1    MDFEAVKRSLEAAAEEILPSPSLDALPSKFYDAFVLHGLRVDLLEPGRLLCSMTVPPRLL  60

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N G FLHGGATA+LVD+VGSAA YT G  T G  +E++++YLD AF+ E++EIE KVLR 
Sbjct  61   NTGKFLHGGATASLVDLVGSAAFYTAGARTKGAPLEMSIAYLDAAFVHEDIEIEVKVLRA  120

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++   +VELRKKKTGKIIA  R+TKYLAV S L
Sbjct  121  GKAVGVATVELRKKKTGKIIAHARYTKYLAVPSNL  155



>ref|XP_011005573.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Populus euphratica]
Length=154

 Score =   177 bits (448),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMP-LRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDLES+++++EK G E +     +  +RF E F+  G+ +DL E GR++C+ KVP RL+N
Sbjct  1    MDLESVRRYIEKGGHEDDKRASKIEEMRFFESFVMEGLHIDLIEPGRVVCSMKVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
              + LH GA A LVD+VGSAA+   GV  +GVSVEINVSYLD A+ DEE+EIEA+VLR G
Sbjct  61   GSDCLHAGAIAMLVDVVGSAALVAAGVFLTGVSVEINVSYLDAAYADEEIEIEARVLRAG  120

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K++   SV+ RKKK+G IIAQGRHTKYL ++SK+
Sbjct  121  KAVGSASVDFRKKKSGAIIAQGRHTKYLLISSKM  154



>ref|XP_009415767.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009415768.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEY--EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            M L+S K+ LE    E      +D++P +F + FI  G++VDL E G ++C+  VP RL+
Sbjct  1    MALDSAKRSLEAAAEEILPTPALDALPSKFYDAFILRGLRVDLVEPGHLLCSMTVPPRLL  60

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GNFLHGGATA+LVD+VGSAA YT G  + GV +EI +SYLD AF +EE+EIEAK+LR 
Sbjct  61   NTGNFLHGGATASLVDLVGSAAFYTAGAQSRGVPMEIGISYLDAAFANEEIEIEAKILRA  120

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++  V+VELRKKKT KI+A  R+TKYLA +S L
Sbjct  121  GKAVGVVNVELRKKKTRKIVANARYTKYLAPSSNL  155



>emb|CDP18342.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 117/160 (73%), Gaps = 7/160 (4%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGE------YEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVP  203
            MDL+ +K  LEK+  E       ++ ++S+P RF EPFI  GIK+D+ E GR+IC+  VP
Sbjct  1    MDLKLVKNSLEKQNEEDDKENGNQSTLESLPHRFFEPFIMQGIKLDILEPGRLICSLTVP  60

Query  204  LRLVNMG-NFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEA  380
             RLV+   N +H GA A+LVD VG++ +YTMG   SGVSVEINVSY D A++ EE++I+A
Sbjct  61   PRLVSKDENSMHYGAIASLVDSVGASVVYTMGASASGVSVEINVSYYDTAYVGEEIDIDA  120

Query  381  KVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K L +GK I  V+VELRKKKTGK+IA+GRHT Y+AV SKL
Sbjct  121  KALLVGKVIGIVNVELRKKKTGKLIARGRHTMYMAVPSKL  160



>ref|XP_003602704.1| Acyl-coenzyme A thioesterase [Medicago truncatula]
 gb|AES72955.1| acyl-CoA thioesterase, putative [Medicago truncatula]
Length=163

 Score =   172 bits (436),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = +3

Query  45   DLESIKKFLEKEGGEYEAIVDS-MPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            DLES+K++LEK+G E    VD+ +P  FL   +  G+++DL E GRI+ + K+P  L+N 
Sbjct  10   DLESVKRYLEKKGEESAPTVDNELPQEFLGHLVVRGLRLDLIEPGRIVFSMKIPPNLLNS  69

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVP-TSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
             N LHGGA  TLVD+VG+ A+ T G   +SGVSVEINVS LD A++DEE+EI+ +VLR+G
Sbjct  70   SNCLHGGAITTLVDLVGATAVPTAGFSWSSGVSVEINVSCLDAAYVDEEIEIDGRVLRVG  129

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K+IA +SVELRKKKTG+I AQGRHTKY+   SK+
Sbjct  130  KTIAVISVELRKKKTGQIFAQGRHTKYIPFISKM  163



>gb|KHG08141.1| Acyl-coenzyme A thioesterase 13 [Gossypium arboreum]
Length=150

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 111/155 (72%), Gaps = 7/155 (5%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVD--SMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            M++E +K++LE       A +D   +PLRF E  I HG++V+L E  R++C+FKV  RL+
Sbjct  1    MEVEKVKRYLESS-----ATIDGDKLPLRFFERLIMHGLRVELIETNRVVCSFKVTPRLL  55

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GN+LH GA AT VD+V SAAIYT G    G SVEIN+S++D A  DE++EIEAK L +
Sbjct  56   NEGNYLHSGAVATFVDLVSSAAIYTAGGTFVGTSVEINISFMDAAHADEDIEIEAKALHV  115

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A +S E RKK TGKIIAQGRHT YL + SK+
Sbjct  116  GKAVAVLSAEFRKKSTGKIIAQGRHTMYLPLPSKM  150



>gb|KEH35672.1| acyl-CoA thioesterase, putative [Medicago truncatula]
Length=201

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 116/154 (75%), Gaps = 2/154 (1%)
 Frame = +3

Query  45   DLESIKKFLEKEGGEYEAIVDS-MPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            DLES+K++LEK+G E    VD+ +P  FL   +  G+++DL E GRI+ + K+P  L+N 
Sbjct  48   DLESVKRYLEKKGEESAPTVDNELPQEFLGHLVVRGLRLDLIEPGRIVFSMKIPPNLLNS  107

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVP-TSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
             N LHGGA  TLVD+VG+ A+ T G   +SGVSVEINVS LD A++DEE+EI+ +VLR+G
Sbjct  108  SNCLHGGAITTLVDLVGATAVPTAGFSWSSGVSVEINVSCLDAAYVDEEIEIDGRVLRVG  167

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K+IA +SVELRKKKTG+I AQGRHTKY+   SK+
Sbjct  168  KTIAVISVELRKKKTGQIFAQGRHTKYIPFISKM  201



>ref|XP_003576557.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Brachypodium distachyon]
Length=159

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = +3

Query  48   LESIKKFLEKEGGEYEAI--VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            LE+ ++ LE   GE      VD++P  F + F+  GI+V + E GR++C F VP RL+N 
Sbjct  8    LETARRLLEDAAGETLPTEQVDALPSGFYDAFVLCGIRVHVVEPGRLLCHFTVPSRLLNS  67

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            GNFLHGGATA+LVD+VGSA  YT G  T G  +E+N+SYLD AF DEE++IEAKVLR GK
Sbjct  68   GNFLHGGATASLVDLVGSAVFYTTGAQTRGSPLEMNISYLDAAFSDEEIDIEAKVLRAGK  127

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            ++   +VEL KKK+GKIIAQ R++KYL  +SKL
Sbjct  128  AVGVATVEL-KKKSGKIIAQARYSKYLGASSKL  159



>ref|XP_007213390.1| hypothetical protein PRUPE_ppa026405mg [Prunus persica]
 gb|EMJ14589.1| hypothetical protein PRUPE_ppa026405mg [Prunus persica]
Length=123

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 3/121 (2%)
 Frame = +3

Query  147  GIKVDLAERGRIICTFKV--PLR-LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVS  317
            GI+VDL E  RI+C+FKV  PL  L+N GNF+HGGATATLVD++GSAAI T+G P+ GVS
Sbjct  3    GIQVDLLEPDRIVCSFKVTPPLPPLLNGGNFMHGGATATLVDLIGSAAILTVGTPSFGVS  62

Query  318  VEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASK  497
            VEINVSYLD A+  EEVE+EAK LR+GK++   SVELRKKKTGKIIAQG HTKYLA+ASK
Sbjct  63   VEINVSYLDSAYPGEEVEVEAKALRVGKAVGVASVELRKKKTGKIIAQGHHTKYLALASK  122

Query  498  L  500
            L
Sbjct  123  L  123



>gb|KJB46873.1| hypothetical protein B456_008G001500 [Gossypium raimondii]
Length=144

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 112/155 (72%), Gaps = 13/155 (8%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVD--SMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            M++E +K++LE       A +D   +PLRF +  I HG++V+L E  R++C+FK      
Sbjct  1    MEVEKVKRYLESS-----ATIDGDKLPLRFFQRLIMHGLRVELIETNRVVCSFK------  49

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            N GN+LHGGA AT +D+V SAAIYT G   +G SVEIN+S++D A+ DE++EIEAK L +
Sbjct  50   NEGNYLHGGAVATFLDMVSSAAIYTAGGTLTGTSVEINISFMDAAYADEDIEIEAKALHV  109

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++A +SVE RKK TGKIIAQGRHTKYL + SK+
Sbjct  110  GKAVAVLSVEFRKKSTGKIIAQGRHTKYLPLPSKM  144



>ref|XP_003602708.1| Acyl-coenzyme A thioesterase [Medicago truncatula]
 gb|AES72959.1| acyl-coenzyme A thioesterase-like protein [Medicago truncatula]
Length=160

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 110/157 (70%), Gaps = 3/157 (2%)
 Frame = +3

Query  33   GKEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
            G   DLES+K++LEK   E   + D  P +FLEPFI  G+++DL E G ++ +  +P RL
Sbjct  6    GTITDLESVKRYLEKR--EASTVDDEFPPKFLEPFILRGLRLDLIEPGHVVFSMNIPPRL  63

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVP-TSGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            +N G  LH GA  TLVD+VG+ AI   G P  +GVS+EINVS  D A++ EE+EI+ KVL
Sbjct  64   LNSGKHLHVGAIVTLVDVVGAIAIPAAGFPMDTGVSLEINVSCFDAAYVHEEIEIDNKVL  123

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            R+G +IA VSVE RKKKTG+I AQGRHTKYL   SK+
Sbjct  124  RVGNAIAVVSVEFRKKKTGQIFAQGRHTKYLPFVSKM  160



>dbj|BAJ88253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=162

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = +3

Query  48   LESIKKFLEKEGGEY--EAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            LE  ++ LE+   E      VD++P  F + F+  GI+V   E GR++C F VP RL+N 
Sbjct  11   LEKARQLLEEAAAESLPAEQVDALPSGFYDAFVLCGIRVHAVEPGRLLCHFTVPARLLNS  70

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
            GNFLHGGATA+LVD+VG+A  YT G  T G  +E+N+SYLD AF DEE++IEAKVLR GK
Sbjct  71   GNFLHGGATASLVDLVGTAVFYTAGAQTRGSPLEMNISYLDAAFSDEEIDIEAKVLRAGK  130

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            ++   +VEL KKK+GKIIAQ R++KYL  +SKL
Sbjct  131  AVGVATVEL-KKKSGKIIAQARYSKYLGASSKL  162



>gb|AFK33840.1| unknown [Medicago truncatula]
Length=160

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 109/157 (69%), Gaps = 3/157 (2%)
 Frame = +3

Query  33   GKEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
            G   DLES+K++LEK   E   + D  P +FLEPFI  G++ DL E G ++ +  +P RL
Sbjct  6    GTITDLESVKRYLEKR--EASTVDDEFPPKFLEPFILRGLRSDLIEPGHVVFSMNIPPRL  63

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVP-TSGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            +N G  LH GA  TLVD+VG+ AI   G P  +GVS+EINVS  D A++ EE+EI+ KVL
Sbjct  64   LNSGKHLHVGAIVTLVDVVGAIAIPAAGFPMDTGVSLEINVSCFDAAYVHEEIEIDNKVL  123

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            R+G +IA VSVE RKKKTG+I AQGRHTKYL   SK+
Sbjct  124  RVGNAIAVVSVEFRKKKTGQIFAQGRHTKYLPFVSKM  160



>ref|XP_003602703.1| Acyl-coenzyme A thioesterase [Medicago truncatula]
 gb|AES72954.1| acyl-coenzyme A thioesterase-like protein [Medicago truncatula]
Length=196

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 115/163 (71%), Gaps = 6/163 (4%)
 Frame = +3

Query  12   KGGLGDMGKEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICT  191
            K  +G   +   L S+K +LEK G +  + +D++P +FLE  I HG+++DL + G I+ +
Sbjct  40   KNRMGKAEERTKLRSVKNYLEKRG-KTASTLDALPPKFLEHLICHGLRLDLLQPGCIVFS  98

Query  192  FKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVE  371
             K+P RL+N G +L GG  A+LVD+VG  AI     PT GVSVEINVS LD A++ EE+E
Sbjct  99   MKIPPRLLNSGKYLQGGVIASLVDMVGGVAI-----PTGGVSVEINVSCLDAAYVHEEIE  153

Query  372  IEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            IEA+VLR+GK IA VS+E RKKKTG++ A GRHT YL++ SK+
Sbjct  154  IEARVLRVGKVIAVVSMEFRKKKTGQVFAHGRHTTYLSITSKM  196



>gb|KFK42769.1| hypothetical protein AALP_AA1G037200 [Arabis alpina]
Length=148

 Score =   162 bits (410),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 117/158 (74%), Gaps = 15/158 (9%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDS-----MPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            MDLES+KK+LE E  E     DS     +P RF+E F++ G+KVDL E GRIIC+ K+P 
Sbjct  1    MDLESVKKYLEGEETENNEGADSSKVTKLPNRFIERFVTQGVKVDLIEPGRIICSMKIPP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKV  386
             L+N GNFLHGGATAT+VD++GSA +YT G+  +GVSVE          ++EE+EIEA+ 
Sbjct  61   HLLNAGNFLHGGATATIVDVIGSAVVYTSGLTQTGVSVE----------INEEIEIEART  110

Query  387  LRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            LR+GK++A VSVELRKKK GKIIAQGRHTKYLA  SKL
Sbjct  111  LRVGKAVAVVSVELRKKKNGKIIAQGRHTKYLAPRSKL  148



>ref|XP_003602707.1| Acyl-coenzyme A thioesterase [Medicago truncatula]
 gb|AES72958.1| acyl-coenzyme A thioesterase-like protein [Medicago truncatula]
Length=165

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = +3

Query  33   GKEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
            G   DLES+KK+LEK       + D  P +FL+  I   +++DL E GR++ +  +P RL
Sbjct  6    GTMPDLESVKKYLEKRLAS--TVDDEFPPKFLQHLILRALRLDLIEPGRVVFSMNIPPRL  63

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVPT-SGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            +N G +LHGGA  TLVDI G  AI   G P  SGVSVEIN+S LD A+++EE+EI+ +VL
Sbjct  64   LNSGKYLHGGAITTLVDIAGGTAIPAAGFPWKSGVSVEINISCLDAAYVNEEIEIDTRVL  123

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAV  488
            R+GK++A +SVELRKKKTG++ AQGRHTK+L +
Sbjct  124  RLGKAVAVLSVELRKKKTGQVFAQGRHTKFLPL  156



>ref|XP_003602709.1| Acyl-coenzyme A thioesterase [Medicago truncatula]
 gb|AES72960.1| acyl-coenzyme A thioesterase-like protein [Medicago truncatula]
Length=158

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = +3

Query  36   KEMDLESIKKFLEKEG-GEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
            ++ DLES K++LE++G    +   D  P +FLE  I  G++ D+ E GR+I T  +P RL
Sbjct  2    EKTDLESAKRYLEEKGEASLKVDDDEFPPKFLEHLILRGLRFDVIEPGRVIFTMNIPPRL  61

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVP-TSGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            +N G +LH GAT TLVD+VGS AI   G P  +G SVEINVS LD A+L EE+EI+A+VL
Sbjct  62   LNSGKYLHLGATVTLVDVVGSIAIPAAGFPLDTGTSVEINVSCLDAAYLHEEIEIDARVL  121

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            R+GK++A VSVELRKKKT ++ AQGR TKYL   SK+
Sbjct  122  RVGKAVAVVSVELRKKKTDQVFAQGRLTKYLPFRSKM  158



>ref|XP_004147338.1| PREDICTED: putative esterase F42H10.6 [Cucumis sativus]
 gb|KGN62226.1| hypothetical protein Csa_2G336730 [Cucumis sativus]
Length=150

 Score =   159 bits (402),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = +3

Query  102  VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAA  281
            +D +P RF + F+   +++DL + GRI+C+ KVP RL+N  N L  GA+  LVD +G AA
Sbjct  18   MDDLPFRFFQFFVMSTLRIDLLQPGRILCSLKVPARLINDNNSLRHGASVFLVDTLGHAA  77

Query  282  IYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQ  461
            + T+G P++GVS+E+NVS+ D A+LDEE+EI++ VLR+GK+IA V+VE+RKK  GKIIAQ
Sbjct  78   VKTLGPPSTGVSLEVNVSFFDAAYLDEEIEIDSNVLRLGKTIAVVNVEIRKKSNGKIIAQ  137

Query  462  GRHTKYLAVASKL  500
            GR T Y  V+SKL
Sbjct  138  GRLTNYTPVSSKL  150



>ref|XP_004975665.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Setaria 
italica]
Length=154

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLR--FLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            MD E++++ LE      E I  S P R  F +PF+  G+ ++ +E GR++C+F V  R  
Sbjct  1    MDPEAVRRSLEPTASA-EEITGSTPARLHFYDPFVLQGVSIESSEHGRLLCSFVVAPRHA  59

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            +   +L  G TATL D +GSA  Y  G+P SGVSVEI+VS++DVA + EE+E+E K+LR 
Sbjct  60   SPAGYLRSGVTATLADQLGSAVFYCSGLPRSGVSVEISVSFVDVATVGEEIEVEGKLLRA  119

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GKS+  VSV+ RKKKTGK++AQ RHTKYLAV+S+L
Sbjct  120  GKSVGVVSVDFRKKKTGKLMAQARHTKYLAVSSRL  154



>ref|NP_001152553.1| acyl-CoA thioesterase 13 [Zea mays]
 gb|ACG48186.1| thioesterase superfamily member 2 [Zea mays]
Length=154

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLR--FLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            MD E+++K LE      E I  S P R  F +PF+  G+ ++ AE GR++C+F V  RL 
Sbjct  1    MDPEAVRKSLEPTA-TVEKITGSTPARLHFYDPFVLSGVSIEAAEHGRLLCSFVVTPRLA  59

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            +   +L  G TATL D +GSA  +  G+P+SGVS+EI+VS++D A + EE+E+E K+LR 
Sbjct  60   SPAGYLRSGVTATLADQLGSAVFFCSGLPSSGVSLEISVSFVDAAAVGEEIEVEGKLLRA  119

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GKS+  VSV+ RKKKTGK++AQ RHTKYL  +S+L
Sbjct  120  GKSVGVVSVDFRKKKTGKLMAQARHTKYLVASSRL  154



>ref|XP_002447865.1| hypothetical protein SORBIDRAFT_06g017150 [Sorghum bicolor]
 gb|EES12193.1| hypothetical protein SORBIDRAFT_06g017150 [Sorghum bicolor]
Length=154

 Score =   154 bits (389),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLR--FLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            MD E+++K LE      E I  S P R  F +PF+  G+ ++ AE GR++C+F V  RL 
Sbjct  1    MDPEAVRKSLEPTA-TAEKITGSTPARLHFYDPFVLSGVSIEAAEHGRLLCSFVVTPRLA  59

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            +   +L  G TATL D +GSA  +  G+P+SGVS+EI+VS++D A + EE+E+E K+LR 
Sbjct  60   SPVGYLRSGVTATLADQLGSAVFFCSGLPSSGVSIEISVSFVDAAAVGEEIEVEGKLLRA  119

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GKS+  VSV+ RKKKTGK++AQ RHTKYL  +SKL
Sbjct  120  GKSVGVVSVDFRKKKTGKLMAQARHTKYLVASSKL  154



>ref|XP_008460848.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Cucumis melo]
Length=150

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +3

Query  102  VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAA  281
            +D +P +F + F+   +++DL + GR++C+ KVP RL+N  N +  GA+A LVD +G AA
Sbjct  18   MDDLPFKFFQFFVMTALRIDLLQPGRVLCSLKVPARLLNDNNSMRQGASALLVDCLGHAA  77

Query  282  IYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQ  461
            + T+   ++GVS+E+NVS+ D A+LDEE+EI++ VLRMGK+IA V+VE RKK  GKIIAQ
Sbjct  78   VKTLTPSSTGVSLEVNVSFFDAAYLDEEIEIDSNVLRMGKTIAVVNVEFRKKSNGKIIAQ  137

Query  462  GRHTKYLAVASKL  500
            GR T Y+ V+SKL
Sbjct  138  GRLTTYVPVSSKL  150



>ref|XP_008669391.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Zea mays]
 gb|ACG26522.1| thioesterase superfamily member 2 [Zea mays]
 tpg|DAA37714.1| TPA: thioesterase superfamily member 2 [Zea mays]
Length=154

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLR--FLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            M  E+++K LE      E I  S P R  F +PF+  G++++ AE GR++C+F V  RL 
Sbjct  1    MGPEAVRKSLEPTA-TAEEITGSTPARLHFYDPFVLSGVRIEAAEHGRLLCSFVVTPRLA  59

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            +   +L  G TATL D +GSA  +  G+P+SGVS+EI+VS++D A + EE+E+E K+LR 
Sbjct  60   SPVGYLRSGVTATLADQLGSAVFFCSGIPSSGVSIEISVSFVDSAAVGEEIEVEGKLLRA  119

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GKS+  VSV+ RKKKTGK++AQ RHTKYL  +SKL
Sbjct  120  GKSVGVVSVDFRKKKTGKLMAQARHTKYLVASSKL  154



>gb|EPS62880.1| hypothetical protein M569_11909 [Genlisea aurea]
Length=131

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 99/131 (76%), Gaps = 1/131 (1%)
 Frame = +3

Query  111  MPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGN-FLHGGATATLVDIVGSAAIY  287
            MP  F++P + +GI+VD  ERGRI+C++ VP RL+N GN  LHGGA  TLVD++G+AAI 
Sbjct  1    MPPEFIQPMVLYGIRVDEVERGRILCSYAVPPRLLNAGNSTLHGGAIVTLVDLIGAAAIS  60

Query  288  TMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGR  467
            + G   SGV+++I VSYLD A + EE+EIEAK L++G+ I  V+VE R+K+T K+IA GR
Sbjct  61   STGAVLSGVAIDIGVSYLDGASVGEEIEIEAKALKVGRGIGVVTVEFRRKRTRKVIALGR  120

Query  468  HTKYLAVASKL  500
            HT YL  +SKL
Sbjct  121  HTTYLFASSKL  131



>gb|KJB70245.1| hypothetical protein B456_011G121500 [Gossypium raimondii]
Length=157

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 105/151 (70%), Gaps = 10/151 (7%)
 Frame = +3

Query  42   MDLESIKKFLEK----EGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLR  209
            M+LE  KK+LEK         E + ++  ++ L      G+ +D  ERGR++C+ KVP+R
Sbjct  1    MELERAKKYLEKGVDGNADGNEGMFENFMMQGL------GLLLDSIERGRVLCSMKVPVR  54

Query  210  LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            L+N GN  HGGAT +LVD++GSA I T G+ ++GVSVEI +S LD AF +EE+EIE + L
Sbjct  55   LLNPGNTFHGGATTSLVDLIGSAVILTYGLTSTGVSVEITLSLLDAAFANEEIEIEGRAL  114

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            R+GK++A V+VE RKK T KI AQ RHTKYL
Sbjct  115  RIGKTVAVVNVEFRKKSTAKIFAQARHTKYL  145



>ref|NP_001159026.1| thioesterase superfamily member 2 [Zea mays]
 gb|ACF85790.1| unknown [Zea mays]
 gb|ACG39612.1| thioesterase superfamily member 2 [Zea mays]
 gb|AFW60035.1| putative Thioesterase superfamily member 2 [Zea mays]
Length=166

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 113/164 (69%), Gaps = 8/164 (5%)
 Frame = +3

Query  24   GDMGKE-MDLESIKKFLEK---EGGEYEAIVDSMPLRFLEPFISHGIKVDLA-ERGRIIC  188
            GD G E   LE+ ++ LE+      E EA+  S+P  F + F+  GI+V  A + G ++C
Sbjct  6    GDFGGENKSLETARRLLEETFTSEAEAEAL-PSLPSGFYDAFVLRGIRVVQALQPGTLLC  64

Query  189  TFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEV  368
             F VP RL+N G FLHGGATA+LVD+V SAA  T G+ T G  +E+N+SYLD AF DEE+
Sbjct  65   HFNVPSRLLNSGGFLHGGATASLVDLVASAAFATAGLRTRGSPLEMNISYLDAAFADEEI  124

Query  369  EIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            +IEAKVLR GK++    VEL KKK+GKIIAQ R++KYL V SKL
Sbjct  125  DIEAKVLRAGKAVGVAVVEL-KKKSGKIIAQARYSKYLGV-SKL  166



>ref|XP_004959913.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Setaria italica]
Length=161

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 107/157 (68%), Gaps = 8/157 (5%)
 Frame = +3

Query  36   KEMDLESIKKFLEKE---GGEYEAIVDSMPLRFLEPFISHGIKVDLA-ERGRIICTFKVP  203
            ++  LE+ +  LE+    G E EA    +P  F + F+  GI+V  A + G ++C F VP
Sbjct  6    QDKSLETARLLLEETSPAGAEAEA---DLPSGFYDAFVLRGIRVAQALQPGTLLCHFTVP  62

Query  204  LRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAK  383
             RL+N G FLHGGATA+LVD+V SAA  T G+ T G  +E+N+SYLD AF DEE++IEAK
Sbjct  63   SRLLNSGGFLHGGATASLVDLVASAAFTTAGLRTRGSPLEMNISYLDAAFADEEIDIEAK  122

Query  384  VLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVAS  494
            VLR GK++    VEL KKK+GKIIAQ R++KYL  AS
Sbjct  123  VLRAGKAVGVAVVEL-KKKSGKIIAQARYSKYLGAAS  158



>ref|NP_001052851.1| Os04g0436100 [Oryza sativa Japonica Group]
 emb|CAD40812.1| OSJNBa0006B20.3 [Oryza sativa Japonica Group]
 dbj|BAF14765.1| Os04g0436100 [Oryza sativa Japonica Group]
 gb|EAY94205.1| hypothetical protein OsI_15979 [Oryza sativa Indica Group]
 dbj|BAG93069.1| unnamed protein product [Oryza sativa Japonica Group]
Length=153

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAI-VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MD E++++ LE      E +   S  LR+ + F   G+++D AE GR++C+F V  R+ +
Sbjct  1    MDPEAVRRSLEPTALSKEVVGPASASLRY-DAFALTGVRIDAAEHGRLLCSFVVTPRIAS  59

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
               +L  G TATL D +GS    + G+ TSGVS+E+N+SY+DVA + EE+E+E K+LR G
Sbjct  60   PAGYLLSGVTATLADQLGSGVFLSSGIGTSGVSLELNLSYVDVASIGEEIEVEGKLLRAG  119

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            KS+  VSV+ RKKKTGK+IAQ RHTKYLAV+SKL
Sbjct  120  KSVGVVSVDFRKKKTGKLIAQARHTKYLAVSSKL  153



>ref|XP_004503022.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X2 [Cicer 
arietinum]
Length=165

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 118/161 (73%), Gaps = 6/161 (4%)
 Frame = +3

Query  33   GKEMDLESI-KKFLEKEG---GEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKV  200
            G+  +LESI KK+LE EG         VD +P  F+EP I +G+ +DL E GR++ + K+
Sbjct  6    GRIRELESIVKKYLENEGEGASTTTITVDGLPPLFIEPLIFYGLHLDLMEPGRVVFSMKI  65

Query  201  PLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPT-SGVSVEINVSYLDVAFLDEEVEIE  377
            P RL+N G +LHGGA  TLVD++G+AAI   G P  SGVS+EINVS+L  A++ EE+EI+
Sbjct  66   PPRLLN-GKYLHGGAIVTLVDVIGAAAIPAAGFPMDSGVSLEINVSHLGAAYVHEEIEID  124

Query  378  AKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            AKVLR+GK IA VSV+ RKK TG+I AQGRHTK+L ++SK+
Sbjct  125  AKVLRVGKVIAVVSVDFRKKMTGQIFAQGRHTKFLPISSKM  165



>gb|EAZ30818.1| hypothetical protein OsJ_14888 [Oryza sativa Japonica Group]
Length=153

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAI-VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MD E++++ LE      E +   S  LR+ + F   G+++D AE GR++C+F V  R+ +
Sbjct  1    MDPEAVRRSLEPTALSKEVVGPASASLRY-DAFALTGVRIDSAEHGRLLCSFVVTPRIAS  59

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
               +L  G TATL D +GS    + G+ TSGVS+E+N+SY+DVA + EE+E+E K+LR G
Sbjct  60   PAGYLLSGVTATLADQLGSGVFLSSGIGTSGVSLELNLSYVDVASIGEEIEVEGKLLRAG  119

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            KS+  VSV+ RKKKTGK+IAQ RHTKYLAV+SKL
Sbjct  120  KSVGVVSVDFRKKKTGKLIAQARHTKYLAVSSKL  153



>gb|AFW58300.1| hypothetical protein ZEAMMB73_040261 [Zea mays]
Length=155

 Score =   146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLR---FLEPFISHGIKVDLAERGRIICTFKVPLRL  212
            MD E+++K LE           + PLR      PF+  G+ ++ AE GR++C+F V  RL
Sbjct  1    MDPEAVRKSLEPTA-NCRKKSPAPPLRGSTSTTPFVLSGVSIEAAEHGRLLCSFVVTPRL  59

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLR  392
             +   +L  G TATL D +GSA  +  G+P+SGVS+EI+VS++D A + EE+E+E K+LR
Sbjct  60   ASPAGYLRSGVTATLADQLGSAVFFCSGLPSSGVSLEISVSFVDAAAVGEEIEVEGKLLR  119

Query  393  MGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
             GKS+  VSV+ RKKKTGK++AQ RHTKYL  +S+L
Sbjct  120  AGKSVGVVSVDFRKKKTGKLMAQARHTKYLVASSRL  155



>ref|XP_006652310.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Oryza brachyantha]
Length=151

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 105/153 (69%), Gaps = 2/153 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD E++++ LE      E  +     R  + F+  GI++D AE GR++C+F V  R+ + 
Sbjct  1    MDPEAVRRTLEPTALSKE--IAGSATRIYDTFVLTGIRIDAAEHGRLLCSFVVTPRIASP  58

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
              +L  G TATL D +GSA  +  G+  SGVS+E+++SY+DVA + EE+E+E K+LR GK
Sbjct  59   AGYLLSGVTATLGDQLGSAVFFCSGLRASGVSIELSLSYVDVASVGEEIEVEGKLLRAGK  118

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            S+  VSV+ RKKKTGK+IAQ RHTKYLAV+SKL
Sbjct  119  SVGVVSVDFRKKKTGKLIAQARHTKYLAVSSKL  151



>ref|XP_002306007.2| hypothetical protein POPTR_0004s14160g [Populus trichocarpa]
 gb|EEE86518.2| hypothetical protein POPTR_0004s14160g [Populus trichocarpa]
Length=110

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 86/109 (79%), Gaps = 3/109 (3%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYE---AIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
            MDLES+K++LE  G E +   + ++ MPLRF E FI  G+ +DL E GR++C+ KVP RL
Sbjct  1    MDLESVKRYLETGGYEEDKNASTIEKMPLRFFERFIMQGLHIDLIEPGRVVCSMKVPPRL  60

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLD  359
            +N GNFLHGGATATLVD+VGSAAI+T+G P +GVSVEINVSYLD AF D
Sbjct  61   LNGGNFLHGGATATLVDLVGSAAIFTVGAPATGVSVEINVSYLDAAFAD  109



>ref|XP_002440980.1| hypothetical protein SORBIDRAFT_09g018230 [Sorghum bicolor]
 gb|EES19410.1| hypothetical protein SORBIDRAFT_09g018230 [Sorghum bicolor]
Length=163

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 97/132 (73%), Gaps = 2/132 (2%)
 Frame = +3

Query  102  VDSMPLRFLEPFISHGIKVDLA-ERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSA  278
            + S+P  F + F+  GI+V  A + G ++C F VP RL+N G FLHGGATA+LVD+V SA
Sbjct  30   LPSLPSGFYDAFVLRGIRVVQALQPGTLLCHFTVPSRLLNSGGFLHGGATASLVDLVASA  89

Query  279  AIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIA  458
            A  T G+ T G  +E+N+SYLD AF DEE++IEAKVLR GK++    VEL KKK+GKIIA
Sbjct  90   AFATAGLRTRGSPLEMNISYLDAAFADEEIDIEAKVLRAGKAVGVAVVEL-KKKSGKIIA  148

Query  459  QGRHTKYLAVAS  494
            Q R++KYL VAS
Sbjct  149  QARYSKYLGVAS  160



>ref|XP_004503021.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Cicer 
arietinum]
Length=167

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 118/162 (73%), Gaps = 6/162 (4%)
 Frame = +3

Query  33   GKEMDLESI-KKFLEKEG---GEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKV  200
            G+  +LESI KK+LE EG         VD +P  F+EP I +G+ +DL E GR++ + K+
Sbjct  6    GRIRELESIVKKYLENEGEGASTTTITVDGLPPLFIEPLIFYGLHLDLMEPGRVVFSMKI  65

Query  201  PLRLVNM-GNFLHGGATATLVDIVGSAAIYTMGVPT-SGVSVEINVSYLDVAFLDEEVEI  374
            P RL++  G +LHGGA  TLVD++G+AAI   G P  SGVS+EINVS+L  A++ EE+EI
Sbjct  66   PPRLLSQNGKYLHGGAIVTLVDVIGAAAIPAAGFPMDSGVSLEINVSHLGAAYVHEEIEI  125

Query  375  EAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            +AKVLR+GK IA VSV+ RKK TG+I AQGRHTK+L ++SK+
Sbjct  126  DAKVLRVGKVIAVVSVDFRKKMTGQIFAQGRHTKFLPISSKM  167



>gb|KDO58741.1| hypothetical protein CISIN_1g031596mg [Citrus sinensis]
Length=115

 Score =   142 bits (358),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = +3

Query  42   MDLESIKKFLEKEGG----EYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLR  209
            M+LES+K++LEK GG    + ++ ++ MP +F E FI  G++VDL+E GR+IC+ KVP R
Sbjct  1    MELESVKRYLEKGGGGDDDKNKSTMEEMPTKFFERFIMQGLRVDLSEPGRVICSMKVPPR  60

Query  210  LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAF  353
            L+N GNF+HGGATATLVD+VGSAAI+T+G P+ GVSVEINVSYLD AF
Sbjct  61   LLNAGNFMHGGATATLVDLVGSAAIFTVGAPSVGVSVEINVSYLDAAF  108



>gb|KDO58742.1| hypothetical protein CISIN_1g031596mg [Citrus sinensis]
Length=111

 Score =   142 bits (358),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = +3

Query  42   MDLESIKKFLEKEGG----EYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLR  209
            M+LES+K++LEK GG    + ++ ++ MP +F E FI  G++VDL+E GR+IC+ KVP R
Sbjct  1    MELESVKRYLEKGGGGDDDKNKSTMEEMPTKFFERFIMQGLRVDLSEPGRVICSMKVPPR  60

Query  210  LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAF  353
            L+N GNF+HGGATATLVD+VGSAAI+T+G P+ GVSVEINVSYLD AF
Sbjct  61   LLNAGNFMHGGATATLVDLVGSAAIFTVGAPSVGVSVEINVSYLDAAF  108



>gb|EPS58020.1| thioesterase family protein, partial [Genlisea aurea]
Length=105

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD++S KKF+EK GG+YE+IVDSMP RF++P ++HG+K+D  ERGR++C++ +P R++N 
Sbjct  1    MDIDSAKKFVEKNGGDYESIVDSMPARFIDPMVTHGLKIDEVERGRVLCSYAIPPRILNT  60

Query  222  GNFLHGGATATLVDIVGSAAIYTM--GVPTSGVSVEINVSYLDVA  350
            GN LHGGA ATLVD++GS AI TM  G   SGVSV+I+VSYLD A
Sbjct  61   GNTLHGGAIATLVDVIGSVAISTMIPGSEFSGVSVDISVSYLDSA  105



>ref|XP_006426408.1| hypothetical protein CICLE_v10026677mg [Citrus clementina]
 ref|XP_006426409.1| hypothetical protein CICLE_v10026677mg [Citrus clementina]
 gb|ESR39648.1| hypothetical protein CICLE_v10026677mg [Citrus clementina]
 gb|ESR39649.1| hypothetical protein CICLE_v10026677mg [Citrus clementina]
 gb|KDO58743.1| hypothetical protein CISIN_1g031596mg [Citrus sinensis]
Length=118

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = +3

Query  42   MDLESIKKFLEKEGG----EYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLR  209
            M+LES+K++LEK GG    + ++ ++ MP +F E FI  G++VDL+E GR+IC+ KVP R
Sbjct  1    MELESVKRYLEKGGGGDDDKNKSTMEEMPTKFFERFIMQGLRVDLSEPGRVICSMKVPPR  60

Query  210  LVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAF  353
            L+N GNF+HGGATATLVD+VGSAAI+T+G P+ GVSVEINVSYLD AF
Sbjct  61   LLNAGNFMHGGATATLVDLVGSAAIFTVGAPSVGVSVEINVSYLDAAF  108



>gb|EAY96177.1| hypothetical protein OsI_18061 [Oryza sativa Indica Group]
 gb|EEE61980.1| hypothetical protein OsJ_16758 [Oryza sativa Japonica Group]
Length=154

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 105/155 (68%), Gaps = 5/155 (3%)
 Frame = +3

Query  48   LESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGN  227
            +E+ ++ LE       +   ++P  F + F+  GI+V+ AE GR++C F VP RL+N G 
Sbjct  1    MEAARRVLEHPTPTDASSAAALPSGFYDAFVLRGIRVEAAEPGRLLCRFTVPSRLLNSGG  60

Query  228  FLHGGATATLVDIVGSAAIYTMG----VPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRM  395
            FLHGGATA+L+ +V SA  +T G      +S   +E+N+SYLD AF DEE+EIEAKVLR 
Sbjct  61   FLHGGATASLIHLVASAVFHTTGNSSSSSSSTSPLEMNISYLDAAFPDEEIEIEAKVLRA  120

Query  396  GKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            GK++    V+L KKK+GK+IAQ R++ YLA +SKL
Sbjct  121  GKAVGVALVDL-KKKSGKLIAQARYSNYLAPSSKL  154



>ref|XP_004970781.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Setaria italica]
Length=160

 Score =   141 bits (355),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 109/163 (67%), Gaps = 9/163 (6%)
 Frame = +3

Query  30   MGKEMDLESIKKFLEKEGG-----EYEAIVDSMPLRFLEPFISHGIKVDLAERGR-IICT  191
            MGK+ D  S    +  EGG     + E  V S   +  + F   G++VD  E GR +IC+
Sbjct  1    MGKQEDHRSKDGEVAVEGGPVMDWQLEPGVAS---KLYDVFTVAGLRVDAIEPGRALICS  57

Query  192  FKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVE  371
            F VP RL +    +HGGA A+LVD+VGSA  +  G PT+GVS+EI +SYL+ A  +EE+E
Sbjct  58   FTVPTRLTDGSKRMHGGALASLVDLVGSAVFFAGGSPTTGVSLEITISYLNAARANEEIE  117

Query  372  IEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            I+A+VL +G++   V+VE+RKK TG++IA GRHTKYLAV+SKL
Sbjct  118  IDARVLGIGETTGCVTVEVRKKGTGEVIAHGRHTKYLAVSSKL  160



>dbj|BAJ96777.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=149

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 107/153 (70%), Gaps = 4/153 (3%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD +++++ LE      + I  S P    + F+  G++++ AE GR++C+F V  R+ + 
Sbjct  1    MDPDAVRRTLEPTASPAD-ISGSTPY---DSFVISGVRLEAAEHGRVLCSFVVTPRIASP  56

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGK  401
              +L    TA+L D +GSA  ++ GV TSGVS+EI+VSY+D A + EE+E+EAK+LR GK
Sbjct  57   QGYLLSDVTASLADQLGSAVFFSSGVGTSGVSLEISVSYVDTAAIGEEIEVEAKLLRAGK  116

Query  402  SIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            S+  +SV+ RKK++GK++AQ RHTKYLAV+S+L
Sbjct  117  SVGVISVDFRKKRSGKLMAQARHTKYLAVSSRL  149



>gb|AES72956.2| acyl-coenzyme A thioesterase-like protein [Medicago truncatula]
Length=156

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 100/146 (68%), Gaps = 7/146 (5%)
 Frame = +3

Query  84   GEYEAIVDS-MPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLV  260
            GE  ++VD  +P  FLE     G+++D  E GR++ +  +P RL+N   +LHGGA  TLV
Sbjct  11   GEASSMVDDELPQEFLEHLTLRGLRLDRIEPGRVVFSMNIPPRLLNSSKYLHGGAITTLV  70

Query  261  D-----IVGSAAIYTMGVP-TSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSV  422
                   +G+AAI   G P  SGVS+EIN+S  D  +++EE+EI+A+VLR+GK++A VSV
Sbjct  71   RDGNGYPMGAAAIPAAGFPWNSGVSIEINISCFDATYVNEEIEIDARVLRIGKAVAVVSV  130

Query  423  ELRKKKTGKIIAQGRHTKYLAVASKL  500
            E +KKKTG++ AQGRHTKY+   SK+
Sbjct  131  EFKKKKTGQVFAQGRHTKYIPFVSKM  156



>gb|EAZ14386.1| hypothetical protein OsJ_04306 [Oryza sativa Japonica Group]
Length=153

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = +3

Query  120  RFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM-GNFLHGGATATLVDIVGSAAIYTMG  296
            +F + F   G++VD  + GR++C+F VP RL N     +HGGA A+LVD+VGSA  +  G
Sbjct  26   KFYDTFTVSGLRVDAIQPGRVLCSFTVPPRLTNARSKRMHGGAVASLVDLVGSAVFFAGG  85

Query  297  VPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTK  476
             P +GV+VEI VSYLD A  +EE+E+EA+VL +G++   V+VE+R+K  G+++A GR TK
Sbjct  86   SPKTGVTVEITVSYLDAARANEEIEMEARVLGIGETTGCVTVEVRRKGAGEVLAHGRITK  145

Query  477  YLAVASKL  500
            YLAV+SKL
Sbjct  146  YLAVSSKL  153



>gb|KJB39075.1| hypothetical protein B456_007G067900 [Gossypium raimondii]
Length=129

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 7/127 (6%)
 Frame = +3

Query  42   MDLESIKKFLEK----EGGEYEA-IVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            MDLE++KK+LEK    +G +  A  ++ MP RF E FI  G+ VD  E+GR++C+ KVP 
Sbjct  1    MDLETVKKYLEKGVGADGDDKNASTINGMPSRFFENFIMQGLHVDQIEKGRVLCSMKVPP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKV  386
            RL+N GNFLHGGATA+LVD+VGSA IY+ G  TSGVSVEI+++YLD A++   +    +V
Sbjct  61   RLLNAGNFLHGGATASLVDLVGSAVIYSYGASTSGVSVEISITYLDAAYVG--INACCQV  118

Query  387  LRMGKSI  407
            +R+  S+
Sbjct  119  VRISASL  125



>gb|EMT18579.1| hypothetical protein F775_01155 [Aegilops tauschii]
Length=151

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 88/126 (70%), Gaps = 0/126 (0%)
 Frame = +3

Query  117  LRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMG  296
            +R  + F   G++V+  E GR +C+F VP  L N    +HGGA A+LVD+VGSA  +  G
Sbjct  23   IRLYDAFTVAGLRVEAIEPGRTLCSFTVPPHLTNSSKRMHGGAVASLVDLVGSAVFFAGG  82

Query  297  VPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTK  476
             PT+GVS++I +SYLD A  +EE+EIEA+VL +      V+VE+R+K TG+++A GRHTK
Sbjct  83   SPTTGVSLDITISYLDAASANEEIEIEARVLGIRDKTGCVTVEVRRKGTGQVLAHGRHTK  142

Query  477  YLAVAS  494
            YLAV S
Sbjct  143  YLAVVS  148



>gb|KJB39074.1| hypothetical protein B456_007G067900 [Gossypium raimondii]
Length=123

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 84/110 (76%), Gaps = 5/110 (5%)
 Frame = +3

Query  42   MDLESIKKFLEK----EGGEYEA-IVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            MDLE++KK+LEK    +G +  A  ++ MP RF E FI  G+ VD  E+GR++C+ KVP 
Sbjct  1    MDLETVKKYLEKGVGADGDDKNASTINGMPSRFFENFIMQGLHVDQIEKGRVLCSMKVPP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFL  356
            RL+N GNFLHGGATA+LVD+VGSA IY+ G  TSGVSVEI+++YLD A++
Sbjct  61   RLLNAGNFLHGGATASLVDLVGSAVIYSYGASTSGVSVEISITYLDAAYV  110



>gb|KJB39073.1| hypothetical protein B456_007G067900 [Gossypium raimondii]
Length=118

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 84/110 (76%), Gaps = 5/110 (5%)
 Frame = +3

Query  42   MDLESIKKFLEK----EGGEYEA-IVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            MDLE++KK+LEK    +G +  A  ++ MP RF E FI  G+ VD  E+GR++C+ KVP 
Sbjct  1    MDLETVKKYLEKGVGADGDDKNASTINGMPSRFFENFIMQGLHVDQIEKGRVLCSMKVPP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFL  356
            RL+N GNFLHGGATA+LVD+VGSA IY+ G  TSGVSVEI+++YLD A++
Sbjct  61   RLLNAGNFLHGGATASLVDLVGSAVIYSYGASTSGVSVEISITYLDAAYV  110



>ref|XP_003579791.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Brachypodium 
distachyon]
Length=158

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 108/162 (67%), Gaps = 13/162 (8%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            MD E++++ +E     + A + +   R+ +  +  G+++D AE GR++ +F V  RL + 
Sbjct  1    MDPEAVRRTIEPTA--FPADI-TGSTRY-DALVVSGVRLDAAEHGRVLFSFVVTPRLASP  56

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPT---------SGVSVEINVSYLDVAFLDEEVEI  374
              +L  G TATL D +GSAA Y+ GV           SGVS+EINVSY+D A + EE+E+
Sbjct  57   QGYLLSGVTATLADQLGSAAFYSSGVGLIGVSSGVGLSGVSLEINVSYVDTATVGEEIEV  116

Query  375  EAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            EAK+LR GKS+  VSV+ RKK+TGK++AQ RHTKYLA++SKL
Sbjct  117  EAKLLRAGKSVGVVSVDFRKKRTGKLMAQARHTKYLALSSKL  158



>gb|KJB39072.1| hypothetical protein B456_007G067900 [Gossypium raimondii]
Length=138

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 5/113 (4%)
 Frame = +3

Query  42   MDLESIKKFLEK----EGGEYEA-IVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            MDLE++KK+LEK    +G +  A  ++ MP RF E FI  G+ VD  E+GR++C+ KVP 
Sbjct  1    MDLETVKKYLEKGVGADGDDKNASTINGMPSRFFENFIMQGLHVDQIEKGRVLCSMKVPP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEE  365
            RL+N GNFLHGGATA+LVD+VGSA IY+ G  TSGVSVEI+++YLD A++ ++
Sbjct  61   RLLNAGNFLHGGATASLVDLVGSAVIYSYGASTSGVSVEISITYLDAAYVGKK  113



>gb|KJB39076.1| hypothetical protein B456_007G067900 [Gossypium raimondii]
Length=130

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 84/110 (76%), Gaps = 5/110 (5%)
 Frame = +3

Query  42   MDLESIKKFLEK----EGGEYEA-IVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPL  206
            MDLE++KK+LEK    +G +  A  ++ MP RF E FI  G+ VD  E+GR++C+ KVP 
Sbjct  1    MDLETVKKYLEKGVGADGDDKNASTINGMPSRFFENFIMQGLHVDQIEKGRVLCSMKVPP  60

Query  207  RLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFL  356
            RL+N GNFLHGGATA+LVD+VGSA IY+ G  TSGVSVEI+++YLD A++
Sbjct  61   RLLNAGNFLHGGATASLVDLVGSAVIYSYGASTSGVSVEISITYLDAAYV  110



>ref|XP_003522458.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Glycine 
max]
Length=140

 Score =   130 bits (328),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 101/156 (65%), Gaps = 19/156 (12%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRF--LEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            MDLESI K LE EG + E+   S+   +     F++H + +  ++ G             
Sbjct  1    MDLESINKLLE-EGAQSESPSHSLSTFYYIFIFFLTHDLSIFPSKNG-------------  46

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPT-SGVSVEINVSYLDVAFLDEEVEIEAKVLR  392
              GN LHGGATATLV +VG+AAI + G  + SGVSVEINVSY    +  EE+EI+A+VLR
Sbjct  47   --GNSLHGGATATLVALVGAAAILSAGHSSDSGVSVEINVSYFGAVYAHEEIEIDARVLR  104

Query  393  MGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            +GK++A VSVE RKKKTGK+ AQ RHTKYL + SK+
Sbjct  105  VGKAVAVVSVEFRKKKTGKVFAQWRHTKYLPITSKI  140



>ref|XP_003564778.2| PREDICTED: acyl-coenzyme A thioesterase 13-like [Brachypodium 
distachyon]
Length=156

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  120  RFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGV  299
            R    F   G++VD  + GR   +F VP RL N    +HGGA A+LVD+ GSAA +  G 
Sbjct  30   RLYNAFAVAGLRVDAIDPGRARFSFTVPPRLTNGRKHMHGGAVASLVDLAGSAAFFAGGS  89

Query  300  PTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKY  479
            P +GVS++I VS+L  A  +EE+EIEAKVL +G+    V+VE+R+K TG+++A GRHTKY
Sbjct  90   PATGVSLDITVSFLGAARANEEIEIEAKVLGIGERTGCVTVEVRRKSTGEVLAHGRHTKY  149

Query  480  LAVASKL  500
            LAV+SKL
Sbjct  150  LAVSSKL  156



>gb|EEC71905.1| hypothetical protein OsI_04677 [Oryza sativa Indica Group]
Length=153

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +3

Query  120  RFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM-GNFLHGGATATLVDIVGSAAIYTMG  296
            +F + F   G++VD  + GR++C+F VP RL N     +HGGA A+LVD+VGSA  +  G
Sbjct  26   KFYDTFTVSGLRVDAIQPGRVLCSFTVPPRLTNARSKRMHGGAVASLVDLVGSAVFFAGG  85

Query  297  VPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTK  476
             P +GV+VEI VSYLD A  +EE+E+EA+VL +G++   V+VE+R+K  G+++A GR TK
Sbjct  86   SPKTGVTVEITVSYLDAARANEEIEMEARVLGIGETTGCVTVEVRRKGAGEVLAHGRITK  145

Query  477  YLAVASKL  500
             LAV+SKL
Sbjct  146  NLAVSSKL  153



>ref|XP_008225768.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Prunus mume]
Length=132

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 89/156 (57%), Gaps = 34/156 (22%)
 Frame = +3

Query  33   GKEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
             +E  +ES+KKF E EG E    +D +P +F E FI   IKVDL E GRI+C+F+VP RL
Sbjct  11   NEETSIESVKKFFENEG-EMAMTMDGLPDKFFESFIMKNIKVDLLEPGRIVCSFRVPPRL  69

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLR  392
            +  GNF+HG A                                  A+  EEV IEAK LR
Sbjct  70   LKRGNFMHGAA---------------------------------YAYPGEEVGIEAKALR  96

Query  393  MGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            + K+I   SVELRKKKT KIIAQ RHTKYLA+A+K+
Sbjct  97   VWKAIGVASVELRKKKTCKIIAQARHTKYLALATKI  132



>ref|XP_007213313.1| hypothetical protein PRUPE_ppb019158mg, partial [Prunus persica]
 gb|EMJ14512.1| hypothetical protein PRUPE_ppb019158mg, partial [Prunus persica]
Length=177

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 90/156 (58%), Gaps = 34/156 (22%)
 Frame = +3

Query  33   GKEMDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRL  212
             +E  +ES+KKFLE E  E    +D +P +F E FI  GIKVDL E  RI+C+FKVP RL
Sbjct  56   NEETSIESVKKFLENEC-EMAMTMDGLPDKFFESFIMKGIKVDLLEPSRIVCSFKVPPRL  114

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLR  392
            +  GNF+HG A                                  A+  EEVEIEAK LR
Sbjct  115  LKGGNFMHGAA---------------------------------YAYPGEEVEIEAKALR  141

Query  393  MGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            + K+I   SVELRKKKT KI+AQGRHTKYLA+ +K+
Sbjct  142  VWKAIGVASVELRKKKTCKIMAQGRHTKYLALTTKI  177



>gb|EMT04341.1| hypothetical protein F775_12280 [Aegilops tauschii]
Length=130

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = +3

Query  201  PLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEA  380
            P+R  N GNFLHGGATA+LVD+VG+A  YT G  T G  +E+N+SYLD AF DEE++IEA
Sbjct  9    PVR--NSGNFLHGGATASLVDLVGTAVFYTAGAQTRGSPLEMNISYLDAAFSDEEIDIEA  66

Query  381  KVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            KVLR GK++   +VEL KKK+GKIIAQ R++KYL  ++ L
Sbjct  67   KVLRAGKAVGVATVEL-KKKSGKIIAQARYSKYLGASTIL  105



>gb|EMS53374.1| hypothetical protein TRIUR3_27835 [Triticum urartu]
Length=147

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 91/132 (69%), Gaps = 7/132 (5%)
 Frame = +3

Query  108  SMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIY  287
            S+  R  + F   G++V+  E GR++C+F VP RL +      GGA A+LVD+VGSA I+
Sbjct  22   SLSHRLYDVFTVAGLRVEAIEPGRLLCSFMVPARLTS------GGAVASLVDLVGSAVIF  75

Query  288  TMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGR  467
              G P +GVS++I VSYL  A  +EE+EI+A+VL +G     V+VE+R+K  G+++A GR
Sbjct  76   AGGSPVTGVSLDITVSYLGAARANEEIEIDARVLDIGDKTGCVTVEVRRKDNGQVLAHGR  135

Query  468  HTKYLA-VASKL  500
            HTKYLA V+SKL
Sbjct  136  HTKYLANVSSKL  147



>ref|XP_003602705.1| Acyl-coenzyme A thioesterase [Medicago truncatula]
Length=277

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 100/187 (53%), Gaps = 47/187 (25%)
 Frame = +3

Query  75   KEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGA---  245
            K+G     + D +P  FLE     G+++D  E GR++ +  +P RL+N   +LHGGA   
Sbjct  9    KKGEASSMVDDELPQEFLEHLTLRGLRLDRIEPGRVVFSMNIPPRLLNSSKYLHGGAITT  68

Query  246  -------------------------------------------TATLVDIVGSAAIYTMG  296
                                                       + TLVDIVG+AAI   G
Sbjct  69   LVRDGNGYPMGRVLQCPSPYPGVLPYPLWVFFAGIHWVWVQLPSLTLVDIVGAAAIPAAG  128

Query  297  VP-TSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHT  473
             P  SGVS+EIN+S  D  +++EE+EI+A+VLR+GK++A VSVE +KKKTG++ AQGRHT
Sbjct  129  FPWNSGVSIEINISCFDATYVNEEIEIDARVLRIGKAVAVVSVEFKKKKTGQVFAQGRHT  188

Query  474  KYLAVAS  494
            KY+   S
Sbjct  189  KYIPFVS  195


 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 10/94 (11%)
 Frame = +3

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
            +  +LHGGA  TLVD++G+AAI   G P      + N          EE+EI+AKVLR G
Sbjct  194  VSTYLHGGAITTLVDVIGAAAIPAAGFPWESGLCQPN----------EEIEIDAKVLRAG  243

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            K +A VSVE RKKKTG+I AQGRHTKY++  +K+
Sbjct  244  KGMAVVSVEFRKKKTGQIFAQGRHTKYISFITKM  277



>gb|KHN31228.1| Acyl-coenzyme A thioesterase 13 [Glycine soja]
Length=97

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +3

Query  213  VNMGNFLHGGATATLVDIVGSAAIYTMGVPT-SGVSVEINVSYLDVAFLDEEVEIEAKVL  389
            +N GN LHGGATATLV +VG+AAI + G  + SGVSVEINVSY    +  EE+EI+A+VL
Sbjct  1    MNGGNSLHGGATATLVALVGAAAILSAGHSSDSGVSVEINVSYFGAVYAHEEIEIDARVL  60

Query  390  RMGKSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
            R+GK++A VSVE RKKKTGK+ AQ RHTKYL + SK+
Sbjct  61   RVGKAVAVVSVEFRKKKTGKVFAQWRHTKYLPITSKI  97



>ref|XP_009505227.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Phalacrocorax 
carbo]
Length=147

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = +3

Query  78   EGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATL  257
            + G+Y+A+V    +RFL  F+   +K+  A  G+++C  KV     N G  LHGG TATL
Sbjct  12   DSGQYQALV-LWSIRFLLLFLVIQVKLLSATPGKVVCEMKVEEEHTNRGGTLHGGLTATL  70

Query  258  VDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKK  437
            VD+V + A+        GVSV++N++Y   A + EE+ I A++L+ G++IAF SV+L  K
Sbjct  71   VDVVSTTALLYTERAAPGVSVDMNITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNK  130

Query  438  KTGKIIAQGRHTKYL  482
             TGK+IAQGRHTKYL
Sbjct  131  ATGKLIAQGRHTKYL  145



>ref|XP_009469604.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Nipponia nippon]
Length=161

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 89/141 (63%), Gaps = 0/141 (0%)
 Frame = +3

Query  60   KKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHG  239
            K + + + G+Y+ +V    + FL  F+   +K+  A  G+I+C  KV     N G  LHG
Sbjct  19   KIYFQFDSGQYQVLVLLQSVSFLFLFLLIQMKLLSATPGKIVCEMKVEEEHTNRGGTLHG  78

Query  240  GATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVS  419
            G TATLVD+V + A+        GVSV++N++Y   A + EE+ I A++L+ G++IAF S
Sbjct  79   GLTATLVDVVSTTALLYTERAVPGVSVDMNITYTSAAKIGEEILITAEILKQGRNIAFAS  138

Query  420  VELRKKKTGKIIAQGRHTKYL  482
            V+L  K TGK+IAQGRHTKYL
Sbjct  139  VDLTNKATGKLIAQGRHTKYL  159



>ref|XP_010256522.1| PREDICTED: putative esterase C31F10.02 [Nelumbo nucifera]
Length=141

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNM  221
            M LES+K++LE+  G+ E     +P R ++  ++ GIK DL E GR++C+ KVP RLVN 
Sbjct  1    MGLESVKRWLERGDGDSENTPIPLPPRLIDSLVAQGIKFDLVEPGRVVCSMKVPPRLVNS  60

Query  222  GNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVA  350
             N LHGGATA+L+D VG+A I++ G   +GVS+EINVSYLD A
Sbjct  61   RNLLHGGATASLIDFVGAAVIFSAGAVNNGVSLEINVSYLDNA  103



>gb|KJB46872.1| hypothetical protein B456_008G001500 [Gossypium raimondii]
Length=106

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 76/108 (70%), Gaps = 7/108 (6%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVD--SMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            M++E +K++LE       A +D   +PLRF +  I HG++V+L E  R++C+FKV  RL+
Sbjct  1    MEVEKVKRYLESS-----ATIDGDKLPLRFFQRLIMHGLRVELIETNRVVCSFKVTPRLL  55

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLD  359
            N GN+LHGGA AT +D+V SAAIYT G   +G SVEIN+S++D A+ D
Sbjct  56   NEGNYLHGGAVATFLDMVSSAAIYTAGGTLTGTSVEINISFMDAAYAD  103



>ref|XP_010148546.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Eurypyga 
helias]
Length=123

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +3

Query  132  PFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSG  311
            PF+   +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        G
Sbjct  5    PFLVIQMKLHSASPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPG  64

Query  312  VSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            VSV++N++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  65   VSVDMNITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  121



>ref|XP_009575678.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Fulmarus glacialis]
Length=135

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 84/128 (66%), Gaps = 0/128 (0%)
 Frame = +3

Query  99   IVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSA  278
            +V ++  R   PF+   +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +A
Sbjct  6    VVGTVVSRLFIPFLVIQVKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTA  65

Query  279  AIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIA  458
            A+        GVSV++N++Y   A + EE+ I A++L+ G+++AF SV+L  K+TGK+IA
Sbjct  66   ALLYTERALPGVSVDMNITYTSAAKIGEEILITAQILKQGRNLAFASVDLTNKETGKLIA  125

Query  459  QGRHTKYL  482
            QGRHTKYL
Sbjct  126  QGRHTKYL  133



>gb|KJB46875.1| hypothetical protein B456_008G001500 [Gossypium raimondii]
Length=112

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 76/108 (70%), Gaps = 7/108 (6%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVD--SMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLV  215
            M++E +K++LE       A +D   +PLRF +  I HG++V+L E  R++C+FKV  RL+
Sbjct  1    MEVEKVKRYLESS-----ATIDGDKLPLRFFQRLIMHGLRVELIETNRVVCSFKVTPRLL  55

Query  216  NMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLD  359
            N GN+LHGGA AT +D+V SAAIYT G   +G SVEIN+S++D A+ D
Sbjct  56   NEGNYLHGGAVATFLDMVSSAAIYTAGGTLTGTSVEINISFMDAAYAD  103



>ref|XP_005432083.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Falco cherrug]
Length=201

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 96/162 (59%), Gaps = 17/162 (10%)
 Frame = +3

Query  3    VAAKGGLGDMGKEMDL--ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERG  176
            VAA GG G MG  ++   E++K  +E +G  ++ ++  M L    P             G
Sbjct  53   VAAVGGAGKMGFTVESLKEAMKYMVESQG--FDRVLRKMKLLSATP-------------G  97

Query  177  RIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFL  356
            +I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y   A +
Sbjct  98   KIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMNITYTSAAKI  157

Query  357  DEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKY+
Sbjct  158  GEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYI  199



>ref|XP_006260599.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Alligator 
mississippiensis]
Length=141

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 89/146 (61%), Gaps = 19/146 (13%)
 Frame = +3

Query  51   ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNF  230
            E +K  L+  G  ++ ++D M L    P             G+++C  KV  +  N    
Sbjct  11   EMMKSLLDSSG--FDRVLDKMKLLSATP-------------GKVVCEMKVEEQHTNRAGT  55

Query  231  LHGGATATLVDIVGSAAI-YT-MGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKS  404
            LHGG TATLVD+V + A+ YT  G P  GVSV++N++Y+  A + EEV I A+VL+ G+S
Sbjct  56   LHGGLTATLVDVVSTTALLYTERGAP--GVSVDMNITYMSAAKIGEEVLITAQVLKQGRS  113

Query  405  IAFVSVELRKKKTGKIIAQGRHTKYL  482
            IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  114  IAFASVDLTNKATGKLIAQGRHTKYL  139



>ref|XP_005041905.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Ficedula 
albicollis]
Length=152

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 94/161 (58%), Gaps = 17/161 (11%)
 Frame = +3

Query  6    AAKGGLGDMGKEMDL--ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGR  179
            A  G  G MG  M+   E++K  LE +G  ++ ++  M L+   P             G+
Sbjct  5    AVSGAGGSMGLTMECLREAMKYMLESQG--FDRVLRKMKLQSAAP-------------GK  49

Query  180  IICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLD  359
            ++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y   A + 
Sbjct  50   VVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAMPGVSVDMNITYTSAAKIG  109

Query  360  EEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            EE+ I A++L+ GK++AF +V+L  K TGK+IAQGRHTK++
Sbjct  110  EEILITAQILKQGKNLAFATVDLTNKATGKLIAQGRHTKFI  150



>ref|XP_009937939.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Opisthocomus hoazin]
Length=125

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = +3

Query  120  RFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGV  299
            + L PF+   +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+     
Sbjct  3    KLLIPFLVVQVKLISATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLHTER  62

Query  300  PTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKY  479
               GVSV++N++Y   A + EE+ I A++L+ G++IAF +V+L  K TGK++AQGRHTK+
Sbjct  63   AVPGVSVDMNITYTSAAKIGEEILITAQILKQGRNIAFATVDLTNKATGKLVAQGRHTKF  122

Query  480  L  482
            L
Sbjct  123  L  123



>ref|XP_006034486.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Alligator sinensis]
Length=141

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 89/146 (61%), Gaps = 19/146 (13%)
 Frame = +3

Query  51   ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNF  230
            E +K  L+  G  ++ ++D M L    P             G+++C  KV  +  N    
Sbjct  11   EVMKSLLDSPG--FDRVLDKMKLLSATP-------------GKVVCEMKVEEQHTNRAGT  55

Query  231  LHGGATATLVDIVGSAAI-YT-MGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKS  404
            LHGG TATLVD+V + A+ YT  G P  GVSV++N++Y+  A + EEV I A+VL+ G+S
Sbjct  56   LHGGLTATLVDVVSTTALLYTERGAP--GVSVDMNITYMSAAKIGEEVLITAQVLKQGRS  113

Query  405  IAFVSVELRKKKTGKIIAQGRHTKYL  482
            IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  114  IAFASVDLTNKATGKLIAQGRHTKYL  139



>gb|KFV92668.1| Acyl-coenzyme A thioesterase 13, partial [Eurypyga helias]
Length=114

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    MKLHSASPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>gb|KFV88395.1| Acyl-coenzyme A thioesterase 13, partial [Struthio camelus australis]
Length=114

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSVEINVSY  338
            A  G+++C  KV     N G  LHGG TATLVD+V +AA+ YT  GVP  GVSV++N++Y
Sbjct  7    ATPGKVVCELKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERGVP--GVSVDMNITY  64

Query  339  LDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
               A + EEV I A++L+ GK+IAF SV+L  K TG++IAQGRHTKYL
Sbjct  65   TAAAKIGEEVLITAQILKQGKNIAFASVDLSNKATGRLIAQGRHTKYL  112



>gb|KFP54825.1| Acyl-coenzyme A thioesterase 13, partial [Cathartes aura]
Length=114

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+IIC  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    MKILSATPGKIICEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALMYTERAVPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_010179320.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Mesitornis 
unicolor]
Length=145

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = +3

Query  144  HGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVE  323
            H +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV+
Sbjct  31   HKMKLISATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERALPGVSVD  90

Query  324  INVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            +N++Y   A + EEV I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  91   MNITYTSAAKIGEEVLITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  143



>ref|XP_009687024.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Struthio camelus 
australis]
 ref|XP_009687025.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Struthio camelus 
australis]
Length=113

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSVEINVSY  338
            A  G+++C  KV     N G  LHGG TATLVD+V +AA+ YT  GVP  GVSV++N++Y
Sbjct  6    ATPGKVVCELKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERGVP--GVSVDMNITY  63

Query  339  LDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
               A + EEV I A++L+ GK+IAF SV+L  K TG++IAQGRHTKYL
Sbjct  64   TAAAKIGEEVLITAQILKQGKNIAFASVDLSNKATGRLIAQGRHTKYL  111



>gb|KFP59616.1| Acyl-coenzyme A thioesterase 13, partial [Cariama cristata]
Length=114

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y  
Sbjct  7    ATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLNTERAVPGVSVDMNITYTS  66

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  67   AAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_009702573.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Cariama 
cristata]
Length=113

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y  
Sbjct  6    ATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLNTERAVPGVSVDMNITYTS  65

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  66   AAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  111



>ref|XP_005483037.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Zonotrichia albicollis]
Length=129

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 81/125 (65%), Gaps = 0/125 (0%)
 Frame = +3

Query  108  SMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIY  287
            S  ++   PF+   +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+ 
Sbjct  3    SQGVQLFVPFLVIQMKLHSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALL  62

Query  288  TMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGR  467
                   GVSV++N++Y   A + E++ I A++L+ GK++AF +V+L  K TGK+IAQGR
Sbjct  63   YTERAAPGVSVDMNITYTSAAKIGEDILITAQILKQGKTLAFATVDLTNKATGKLIAQGR  122

Query  468  HTKYL  482
            HTK+L
Sbjct  123  HTKFL  127



>ref|XP_011015990.1| PREDICTED: putative esterase C31F10.02 [Populus euphratica]
Length=131

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = +3

Query  42   MDLESIKKFLEKEGGEYEAIVDSMP-LRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            MDLES+++++EK G E +     +  +RF E F+  G+ +DL E GR++C+ KVP RL+N
Sbjct  1    MDLESVRRYIEKGGHEDDKRASKIEEMRFFESFVMEGLHIDLIEPGRVVCSMKVPPRLLN  60

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLD  359
              + LH GA A LVD+VGSAA+   GV  +GVSVEINVSYLD A+ D
Sbjct  61   GSDCLHAGAIAMLVDVVGSAALVAAGVFLTGVSVEINVSYLDAAYAD  107



>ref|XP_011584257.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Aquila chrysaetos 
canadensis]
Length=140

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 86/144 (60%), Gaps = 15/144 (10%)
 Frame = +3

Query  51   ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNF  230
            E++K  +E +G  ++ ++  M L    P             G+I+C  KV     N G  
Sbjct  10   EAMKYMVESQG--FDRVLRKMKLLSATP-------------GKIVCEMKVEEEHTNRGGT  54

Query  231  LHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIA  410
            LHGG TATLVD+V +AA+        GVSV++N++Y   A + EE+ I A++L+ G++IA
Sbjct  55   LHGGLTATLVDVVSTAALLNTERAVPGVSVDMNITYTSAAKIGEEILITAQILKQGRNIA  114

Query  411  FVSVELRKKKTGKIIAQGRHTKYL  482
            F SV+L  K TGK+IAQGRHTKYL
Sbjct  115  FASVDLTNKATGKLIAQGRHTKYL  138



>gb|KFV60809.1| Acyl-coenzyme A thioesterase 13, partial [Tyto alba]
Length=114

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAAPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>gb|KFO14460.1| Acyl-coenzyme A thioesterase 13, partial [Balearica regulorum 
gibbericeps]
Length=125

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 82/119 (69%), Gaps = 5/119 (4%)
 Frame = +3

Query  132  PFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPT  305
            PF+   +K+  A  G+I+C  KV     N G  LHGG TATLVD+V + A+ YT  GVP 
Sbjct  8    PFVIQ-MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERGVP-  65

Query  306  SGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             GVSV++N++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  66   -GVSVDMNITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  123



>gb|KFU99230.1| Acyl-coenzyme A thioesterase 13, partial [Tauraco erythrolophus]
Length=113

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 80/113 (71%), Gaps = 4/113 (4%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSVE  323
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+ YT  GVP  GVSV+
Sbjct  2    MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALMYTERGVP--GVSVD  59

Query  324  INVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            +N++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKY+
Sbjct  60   MNITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYV  112



>ref|XP_009973036.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Tyto alba]
Length=118

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y  
Sbjct  6    ATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAAPGVSVDMNITYTS  65

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  66   AAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  111



>ref|XP_006260600.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X2 [Alligator 
mississippiensis]
Length=113

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSVE  323
            +K+  A  G+++C  KV  +  N    LHGG TATLVD+V + A+ YT  G P  GVSV+
Sbjct  1    MKLLSATPGKVVCEMKVEEQHTNRAGTLHGGLTATLVDVVSTTALLYTERGAP--GVSVD  58

Query  324  INVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            +N++Y+  A + EEV I A+VL+ G+SIAF SV+L  K TGK+IAQGRHTKYL
Sbjct  59   MNITYMSAAKIGEEVLITAQVLKQGRSIAFASVDLTNKATGKLIAQGRHTKYL  111



>ref|XP_010167417.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Caprimulgus carolinensis]
Length=144

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 85/132 (64%), Gaps = 3/132 (2%)
 Frame = +3

Query  87   EYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDI  266
            ++E  VD+   +   PF+   +K+  A  G+I+C  KV     N G  LHGG TATLVD+
Sbjct  14   DHEEDVDN---KLFIPFLVIQMKLLSAAPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDV  70

Query  267  VGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTG  446
            V +AA+        GVSV++N++Y   A + EE+ I A++L+ G+++AF SV+L  K +G
Sbjct  71   VSTAALLYTERAVPGVSVDMNITYTSAAKIGEEILITAQILKQGRNLAFASVDLTNKASG  130

Query  447  KIIAQGRHTKYL  482
            K+IAQGRHTKYL
Sbjct  131  KLIAQGRHTKYL  142



>gb|KFQ87216.1| Acyl-coenzyme A thioesterase 13, partial [Phoenicopterus ruber 
ruber]
Length=117

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y  
Sbjct  10   ATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAAPGVSVDMNITYTS  69

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  70   AAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  115



>gb|KFQ60450.1| Acyl-coenzyme A thioesterase 13, partial [Pelecanus crispus]
Length=114

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y  
Sbjct  7    ATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMNITYTS  66

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  67   AAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_010307995.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Balearica 
regulorum gibbericeps]
Length=113

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSVE  323
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V + A+ YT  GVP  GVSV+
Sbjct  1    MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERGVP--GVSVD  58

Query  324  INVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            +N++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  59   MNITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  111



>gb|KFW04556.1| Acyl-coenzyme A thioesterase 13, partial [Fulmarus glacialis]
Length=114

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    VKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERALPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF SV+L  K+TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEILITAQILKQGRNLAFASVDLTNKETGKLIAQGRHTKYL  112



>gb|EOA98726.1| Thioesterase superfamily member 2, partial [Anas platyrhynchos]
Length=114

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            IK+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    IKLLSATPGKVVCELKVEEEHTNRGGTLHGGLTATLVDVVSTAALLHTERAAPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EEV I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEVLITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_010292054.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Phaethon 
lepturus]
Length=113

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  1    MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERALPGVSVDMN  60

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  61   ITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  111



>ref|XP_009991401.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Tauraco 
erythrolophus]
Length=121

 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 82/118 (69%), Gaps = 4/118 (3%)
 Frame = +3

Query  135  FISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTS  308
            F+   +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+ YT  GVP  
Sbjct  4    FLVIQMKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALMYTERGVP--  61

Query  309  GVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            GVSV++N++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKY+
Sbjct  62   GVSVDMNITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYV  119



>gb|KFQ81540.1| Acyl-coenzyme A thioesterase 13, partial [Phaethon lepturus]
Length=114

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERALPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>gb|KFQ32411.1| Acyl-coenzyme A thioesterase 13, partial [Mesitornis unicolor]
Length=114

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    MKLISATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERALPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EEV I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEVLITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>gb|KFP18188.1| Acyl-coenzyme A thioesterase 13, partial [Egretta garzetta]
Length=114

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y  
Sbjct  7    ATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTEKAVPGVSVDMNITYTS  66

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  67   AAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_009479515.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Pelecanus crispus]
Length=295

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 92/142 (65%), Gaps = 3/142 (2%)
 Frame = +3

Query  60   KKFLEKEGGEYEAI-VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLH  236
            K + + + G+Y+ + + S+ + FL  F+   +K+  A  G+I+C  KV     N G  LH
Sbjct  154  KIYFQFDSGQYQVLALLSVSVSFL--FLVIQMKLLSATPGKIVCEMKVEEEHTNRGGTLH  211

Query  237  GGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFV  416
            GG TATLVD+V +AA+        GVSV++N++Y   A + EE+ I A++L+ G++IAF 
Sbjct  212  GGLTATLVDVVSTAALLYTERAVPGVSVDMNITYTSAAKIGEEILITAQILKQGRNIAFA  271

Query  417  SVELRKKKTGKIIAQGRHTKYL  482
            SV+L  K TGK+IAQGRHTKYL
Sbjct  272  SVDLTNKATGKLIAQGRHTKYL  293



>ref|XP_005023122.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Anas platyrhynchos]
Length=120

 Score =   108 bits (270),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            IK+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  8    IKLLSATPGKVVCELKVEEEHTNRGGTLHGGLTATLVDVVSTAALLHTERAAPGVSVDMN  67

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EEV I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  68   ITYTSAAKIGEEVLITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  118



>ref|XP_010120347.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Chlamydotis 
macqueenii]
Length=113

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  1    MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMN  60

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF SV+L  K TGK+IAQGRHTKYL
Sbjct  61   ITYTSAAKIGEEILITAQILKQGRNLAFASVDLTNKATGKLIAQGRHTKYL  111



>gb|KFP36423.1| Acyl-coenzyme A thioesterase 13, partial [Chlamydotis macqueenii]
Length=114

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF SV+L  K TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEILITAQILKQGRNLAFASVDLTNKATGKLIAQGRHTKYL  112



>gb|KFQ00745.1| Acyl-coenzyme A thioesterase 13, partial [Haliaeetus albicilla]
Length=114

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V + A+        GVSV++N++Y  
Sbjct  7    ATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLNTERAVPGVSVDMNITYTS  66

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  67   AAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_009913010.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Haliaeetus albicilla]
 ref|XP_010576246.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X2 [Haliaeetus 
leucocephalus]
Length=113

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V + A+        GVSV++N++Y  
Sbjct  6    ATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLNTERAVPGVSVDMNITYTS  65

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  66   AAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  111



>ref|XP_009953803.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Leptosomus 
discolor]
Length=113

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y  
Sbjct  6    ATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMNITYTS  65

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + E+V I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  66   AAKIGEDVLITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  111



>gb|KFQ00125.1| Acyl-coenzyme A thioesterase 13, partial [Leptosomus discolor]
Length=114

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y  
Sbjct  7    ATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMNITYTS  66

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + E+V I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  67   AAKIGEDVLITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_009884205.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Charadrius vociferus]
Length=135

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 83/123 (67%), Gaps = 4/123 (3%)
 Frame = +3

Query  120  RFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-M  293
            +   PF+   +K+  A  G+I+C  KV     N G  LHGG TATLVD+V + A+ YT  
Sbjct  13   KLFIPFLVVQMKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTER  72

Query  294  GVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHT  473
            G+P  GVSV++N++Y   A + EE+ I A++L+ G++IAF +V+L  K TGK+IAQGRHT
Sbjct  73   GMP--GVSVDMNITYTSAAKIGEEILITAQILKQGRNIAFATVDLTDKATGKLIAQGRHT  130

Query  474  KYL  482
            KY+
Sbjct  131  KYI  133



>gb|KFV08952.1| Acyl-coenzyme A thioesterase 13, partial [Pterocles gutturalis]
Length=113

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+       SGVSV++N
Sbjct  2    MKLVSATPGKIVCEMKVEEEHANRGGTLHGGLTATLVDVVSTAALLYTERALSGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF SV+L  K TGK+IAQGRHTKY+
Sbjct  62   ITYTAAAKIGEEILITAEILKQGRNMAFASVDLTNKATGKLIAQGRHTKYI  112



>gb|KFW96776.1| Acyl-coenzyme A thioesterase 13, partial [Phalacrocorax carbo]
Length=114

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V + A+        GVSV++N
Sbjct  2    VKLLSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERAAPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_010576245.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X1 [Haliaeetus 
leucocephalus]
Length=140

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 85/144 (59%), Gaps = 15/144 (10%)
 Frame = +3

Query  51   ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNF  230
            E++K  +E +G  ++ ++  M L    P             G+++C  KV     N G  
Sbjct  10   EAMKYMVESQG--FDRVLRKMKLLSATP-------------GKVVCEMKVEEEHTNRGGT  54

Query  231  LHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIA  410
            LHGG TATLVD+V + A+        GVSV++N++Y   A + EE+ I A++L+ G++IA
Sbjct  55   LHGGLTATLVDVVSTTALLNTERAVPGVSVDMNITYTSAAKIGEEILITAQILKQGRNIA  114

Query  411  FVSVELRKKKTGKIIAQGRHTKYL  482
            F SV+L  K TGK+IAQGRHTKYL
Sbjct  115  FASVDLTNKATGKLIAQGRHTKYL  138



>gb|KFM05761.1| Acyl-coenzyme A thioesterase 13, partial [Aptenodytes forsteri]
 gb|KFV60784.1| Acyl-coenzyme A thioesterase 13, partial [Gavia stellata]
 gb|KFW67704.1| Acyl-coenzyme A thioesterase 13, partial [Pygoscelis adeliae]
Length=114

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+I+C  KV     N G  LHGG TATLVD+V + A+        GVSV++N++Y  
Sbjct  7    ATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERAVPGVSVDMNITYTS  66

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  67   AAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_005240365.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Falco peregrinus]
Length=129

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y  
Sbjct  22   ATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMNITYTS  81

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKY+
Sbjct  82   AAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYI  127



>ref|XP_009274940.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Aptenodytes forsteri]
 ref|XP_009323187.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Pygoscelis adeliae]
Length=118

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V + A+        GVSV++N
Sbjct  6    MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERAVPGVSVDMN  65

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  66   ITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  116



>ref|XP_005419442.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Geospiza fortis]
Length=194

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +3

Query  132  PFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSG  311
            PF+   +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        G
Sbjct  76   PFLVIQMKLHSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAAPG  135

Query  312  VSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            VSV++N++Y   A + E++ I A++L+ GK++AF +V+L  K TGK+IAQGRHTK+L
Sbjct  136  VSVDMNITYTSAAKIGEDILITAQILKQGKTLAFATVDLTNKATGKLIAQGRHTKFL  192



>ref|XP_010866002.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Esox lucius]
Length=141

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 89/139 (64%), Gaps = 16/139 (12%)
 Frame = +3

Query  108  SMPLRFLEPFISHGI----------KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATA  251
            SM L  L+    H +          KVD+  A  G+++C FKV     N G  LHGG TA
Sbjct  3    SMTLHSLKQIFRHMLDTRGFDRVLSKVDILTASPGKVVCEFKVEEEHTNRGGTLHGGLTA  62

Query  252  TLVDIVGSAAI-YT-MGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVE  425
            TLVD++ + A+ YT  G P  GVSV++N++Y++ A + E+V I A+VL+ G+S+AF +V+
Sbjct  63   TLVDVISTTALMYTERGAP--GVSVDMNITYMNAAKVGEDVLITAQVLKQGRSMAFATVD  120

Query  426  LRKKKTGKIIAQGRHTKYL  482
            L  K +GK+IAQGRHTK+L
Sbjct  121  LTSKSSGKLIAQGRHTKHL  139



>gb|KFQ49729.1| Acyl-coenzyme A thioesterase 13, partial [Nestor notabilis]
Length=114

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERALPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKMGEEILITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  112



>gb|KGL78544.1| Acyl-coenzyme A thioesterase 13, partial [Tinamus guttatus]
Length=140

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  30   VKLVSATPGKLVCELKVEEEHTNRGGTLHGGLTATLVDVVSTAALMNTERAVPGVSVDMN  89

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EEV I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  90   ITYTTAAKIGEEVLITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  140



>ref|XP_010214839.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Tinamus 
guttatus]
Length=143

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  32   VKLVSATPGKLVCELKVEEEHTNRGGTLHGGLTATLVDVVSTAALMNTERAVPGVSVDMN  91

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EEV I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  92   ITYTTAAKIGEEVLITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  142



>ref|XP_009074220.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Acanthisitta chloris]
 gb|KFP81273.1| Acyl-coenzyme A thioesterase 13 [Acanthisitta chloris]
Length=113

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  1    MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAAPGVSVDMN  60

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ GK++AF +V+L  K TGK+IAQGRHTK+L
Sbjct  61   ITYTSAAKIGEEILITAQILKQGKTLAFATVDLTNKATGKLIAQGRHTKFL  111



>ref|XP_008939949.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Merops nubicus]
Length=133

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = +3

Query  132  PFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSG  311
            PF+   +K+  A  G+++C  KV     N G  LHGG TATLVD+V + A+        G
Sbjct  15   PFLVIQMKLLSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERALPG  74

Query  312  VSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            VSV++N++Y   A + EE+ I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  75   VSVDMNITYTSAAKIGEEILITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  131



>ref|XP_010074245.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Pterocles 
gutturalis]
Length=129

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+       SGVSV++N
Sbjct  1    MKLVSATPGKIVCEMKVEEEHANRGGTLHGGLTATLVDVVSTAALLYTERALSGVSVDMN  60

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF SV+L  K TGK+IAQGRHTKY+
Sbjct  61   ITYTAAAKIGEEILITAEILKQGRNMAFASVDLTNKATGKLIAQGRHTKYI  111



>ref|XP_002978170.1| hypothetical protein SELMODRAFT_108421 [Selaginella moellendorffii]
 gb|EFJ20827.1| hypothetical protein SELMODRAFT_108421 [Selaginella moellendorffii]
Length=149

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +++  A+ GRI+C  +VP  L N    LHGGA ATL+D V + A+ T+G   +GVS++++
Sbjct  28   VEIKAADAGRILCAIRVPANLANGYGTLHGGAIATLIDCVSTMAVLTVGGTNTGVSIDLS  87

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKK-KTGKIIAQGRHTKYLA  485
            ++Y+  A +D+E+EIE+KVL+ GK++  +S E+R+  K G+I+A G HTKY +
Sbjct  88   ITYVSAARIDDELEIESKVLKKGKNVVMLSAEVRRAGKNGEIVASGHHTKYFS  140



>gb|KFZ50508.1| Acyl-coenzyme A thioesterase 13, partial [Caprimulgus carolinensis]
Length=114

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    MKLLSAAPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF SV+L  K +GK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEILITAQILKQGRNLAFASVDLTNKASGKLIAQGRHTKYL  112



>ref|XP_005728490.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X2 [Pundamilia 
nyererei]
Length=142

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEI  326
            KVD+  A  G+++C  +V     N G  LHGG TATLVDIV + AI        GVSV++
Sbjct  28   KVDILSASPGKVVCEMRVEEEHTNRGGTLHGGLTATLVDIVSTMAIMHSERGAPGVSVDM  87

Query  327  NVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            N++Y++ A + E+V I A+VL+ G+S+AF +V+L  K TGKIIAQGRHTK+L
Sbjct  88   NITYMNAAKMGEDVLITAQVLKQGRSLAFATVDLTNKVTGKIIAQGRHTKHL  139



>ref|XP_004074278.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Oryzias latipes]
Length=142

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEI  326
            KVD+  A +G+++C  +V     N G  LHGG TATLVD+V + AI        GVSV++
Sbjct  28   KVDILAASQGKVVCEMQVKEEHTNRGGTLHGGLTATLVDVVSTLAIMNSERGAPGVSVDM  87

Query  327  NVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            N++Y++ A + E+V I A+VL+ G+++AF +V+L  K TGK+IAQGRHTK+L
Sbjct  88   NITYMNAAKIGEDVLITAQVLKQGRTLAFATVDLTNKATGKLIAQGRHTKHL  139



>gb|KFR04080.1| Acyl-coenzyme A thioesterase 13, partial [Nipponia nippon]
Length=117

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+I+C  KV     N G  LHGG TATLVD+V + A+        GVSV++N++Y  
Sbjct  10   ATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERAVPGVSVDMNITYTS  69

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  70   AAKIGEEILITAEILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  115



>gb|KFO65912.1| Acyl-coenzyme A thioesterase 13, partial [Corvus brachyrhynchos]
Length=141

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 87/144 (60%), Gaps = 15/144 (10%)
 Frame = +3

Query  51   ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNF  230
            E++K  LE +G  ++ ++  M L+   P             G+++C  KV     N G  
Sbjct  11   EAMKYMLESQG--FDRVLRKMKLQSATP-------------GKVVCEMKVEEEHTNRGGT  55

Query  231  LHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIA  410
            LHGG TATLVD+V +AA+        GVSV++N++Y   A + EE+ I A++L+ G+++A
Sbjct  56   LHGGLTATLVDVVSTAALLYTERAVPGVSVDMNITYTSAAKIGEEILITAQILKQGRTLA  115

Query  411  FVSVELRKKKTGKIIAQGRHTKYL  482
            F +V+L  K TGK+IAQGRHTK++
Sbjct  116  FATVDLTNKATGKLIAQGRHTKFI  139



>ref|XP_009099776.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Serinus canaria]
Length=140

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  28   VKLQSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAAPGVSVDMN  87

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ GK++AF +V+L  K TGK+IAQGRHTK++
Sbjct  88   ITYTSAAKIGEEILITAQILKQGKTLAFATVDLTNKATGKLIAQGRHTKFI  138



>ref|XP_005153649.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Melopsittacus undulatus]
Length=123

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  12   MKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAAPGVSVDMN  71

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  72   ITYTSAAKMGEEILITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  122



>gb|KFP24461.1| Acyl-coenzyme A thioesterase 13, partial [Colius striatus]
Length=116

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  4    VKLLSATPGKLVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMN  63

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  64   ITYTSAAKIGEEILITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  114



>ref|XP_010013017.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Nestor notabilis]
Length=134

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 82/128 (64%), Gaps = 3/128 (2%)
 Frame = +3

Query  99   IVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSA  278
            IV  + L F   F+   +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +A
Sbjct  8    IVSELLLFF---FLVVQMKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTA  64

Query  279  AIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIA  458
            A+        GVSV++N++Y   A + EE+ I A++L+ G+++AF +V+L  K TGK+IA
Sbjct  65   ALLYTERALPGVSVDMNITYTSAAKMGEEILITAQILKQGRNLAFATVDLTNKATGKLIA  124

Query  459  QGRHTKYL  482
            QGRHTKYL
Sbjct  125  QGRHTKYL  132



>ref|XP_008640918.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Corvus brachyrhynchos]
Length=140

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 87/144 (60%), Gaps = 15/144 (10%)
 Frame = +3

Query  51   ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNF  230
            E++K  LE +G  ++ ++  M L+   P             G+++C  KV     N G  
Sbjct  10   EAMKYMLESQG--FDRVLRKMKLQSATP-------------GKVVCEMKVEEEHTNRGGT  54

Query  231  LHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIA  410
            LHGG TATLVD+V +AA+        GVSV++N++Y   A + EE+ I A++L+ G+++A
Sbjct  55   LHGGLTATLVDVVSTAALLYTERAVPGVSVDMNITYTSAAKIGEEILITAQILKQGRTLA  114

Query  411  FVSVELRKKKTGKIIAQGRHTKYL  482
            F +V+L  K TGK+IAQGRHTK++
Sbjct  115  FATVDLTNKATGKLIAQGRHTKFI  138



>ref|XP_010194714.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Colius striatus]
Length=113

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  1    VKLLSATPGKLVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMN  60

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  61   ITYTSAAKIGEEILITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  111



>emb|CDQ94367.1| unnamed protein product [Oncorhynchus mykiss]
Length=141

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 81/114 (71%), Gaps = 6/114 (5%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSV  320
            KVD+  A  G+++C FKV     N G  LHGG TATLVD++ + AI YT  G P  GVSV
Sbjct  28   KVDIVTASPGKVVCEFKVEEEHTNRGGTLHGGLTATLVDVISTTAIMYTERGAP--GVSV  85

Query  321  EINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++N++Y++ A + E+V I A VL+ G+++AF +V+L  K +GK+IAQGRHTK+L
Sbjct  86   DMNITYMNAAKMGEDVLITATVLKQGRTLAFATVDLTSKASGKLIAQGRHTKHL  139



>ref|XP_004549285.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Maylandia zebra]
 ref|XP_005917540.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X2 [Haplochromis 
burtoni]
Length=142

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEI  326
            KVD+  A  G+++C  +V     N G  LHGG TATLVDIV + AI        GVSV++
Sbjct  28   KVDILSASPGKVVCEMRVEEEHTNRGGTLHGGLTATLVDIVSTIAIMHSERGAPGVSVDM  87

Query  327  NVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            N++Y++ A + E+V I A+VL+ G+S+AF +V+L  K TGKIIAQGRHTK+L
Sbjct  88   NITYMNAAKMGEDVLITAQVLKQGRSLAFATVDLTNKVTGKIIAQGRHTKHL  139



>ref|XP_006787914.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Neolamprologus 
brichardi]
Length=142

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEI  326
            KVD+  A  G+++C  +V     N G  LHGG TATLVDIV + AI        GVSV++
Sbjct  28   KVDILSASPGKVVCEMRVEEEHTNRGGTLHGGLTATLVDIVSTMAIMYSERGAPGVSVDM  87

Query  327  NVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            N++Y++ A + E+V I A+VL+ G+S+AF +V+L  K TGKIIAQGRHTK+L
Sbjct  88   NITYMNAAKMGEDVLITAQVLKQGRSLAFATVDLTNKVTGKIIAQGRHTKHL  139



>ref|NP_001045006.1| Os01g0882100 [Oryza sativa Japonica Group]
 dbj|BAB90363.1| thioesterase -like protein [Oryza sativa Japonica Group]
 dbj|BAF06920.1| Os01g0882100 [Oryza sativa Japonica Group]
Length=90

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +3

Query  231  LHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIA  410
            +HGGA A+LVD+VGSA  +  G P +GV+VEI VSYLD A  +EE+E+EA+VL +G++  
Sbjct  1    MHGGAVASLVDLVGSAVFFAGGSPKTGVTVEITVSYLDAARANEEIEMEARVLGIGETTG  60

Query  411  FVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
             V+VE+R+K  G+++A GR TKYLAV+SKL
Sbjct  61   CVTVEVRRKGAGEVLAHGRITKYLAVSSKL  90



>ref|XP_009818645.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Gavia stellata]
Length=133

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = +3

Query  135  FISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGV  314
            F+   +K+  A  G+I+C  KV     N G  LHGG TATLVD+V + A+        GV
Sbjct  16   FLVIQMKLLSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERAVPGV  75

Query  315  SVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            SV++N++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  76   SVDMNITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  131



>gb|KFR14708.1| Acyl-coenzyme A thioesterase 13, partial [Opisthocomus hoazin]
Length=114

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  2    VKLISATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLHTERAVPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G++IAF +V+L  K TGK++AQGRHTK+L
Sbjct  62   ITYTSAAKIGEEILITAQILKQGRNIAFATVDLTNKATGKLVAQGRHTKFL  112



>ref|XP_008420246.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Poecilia reticulata]
Length=142

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 82/114 (72%), Gaps = 6/114 (5%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSV  320
            KVD+  A  G+++C  +V     N G  LHGG TATLVD++ + AI YT  GVP  GVSV
Sbjct  28   KVDIVSASPGKVVCEMRVEEEHTNRGGTLHGGLTATLVDVISTMAIMYTERGVP--GVSV  85

Query  321  EINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++N++Y++ A + E+V I A+VL+ GK++AF +V+L  K +GK+IAQGRHTK+L
Sbjct  86   DMNITYMNAAKIGEDVLITAQVLKQGKTLAFATVDLSSKASGKLIAQGRHTKHL  139



>gb|KFO78633.1| Acyl-coenzyme A thioesterase 13, partial [Cuculus canorus]
Length=114

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N++Y  
Sbjct  7    ATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERALPGVSVDMNITYTS  66

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + E+V I A++L+ G++IAF SV+L  K TGK+IAQGRHTKY+
Sbjct  67   AAKIGEDVLITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYI  112



>ref|XP_005517377.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Pseudopodoces humilis]
Length=140

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  28   MKLQSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAAPGVSVDMN  87

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ GK++AF +V+L  K TGK+IAQGRHTK++
Sbjct  88   ITYTSAAKIGEEILITAQILKQGKTLAFATVDLTNKATGKLIAQGRHTKFI  138



>gb|KFU90118.1| Acyl-coenzyme A thioesterase 13, partial [Chaetura pelagica]
Length=158

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  46   MKLVSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERALPGVSVDMN  105

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + E+V I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  106  ITYTSAAKIGEDVLITAEILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  156



>ref|XP_002966393.1| hypothetical protein SELMODRAFT_69277, partial [Selaginella moellendorffii]
 gb|EFJ32420.1| hypothetical protein SELMODRAFT_69277, partial [Selaginella moellendorffii]
Length=113

 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +++  A+ GRI+C  +VP  L N    LHGGA ATL+D V + A+ T+G   +GVS++++
Sbjct  1    VEIKAADAGRIVCGIRVPANLANGYGTLHGGAIATLIDCVSTMAVLTVGGTNTGVSIDLS  60

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKK-KTGKIIAQGRHTKYLA  485
            ++Y+  A +D+E+EIE+KVL+ GK++  +S E+R+  K G+I+A G HTK+ +
Sbjct  61   ITYVSAARIDDELEIESKVLKKGKNVVMLSAEVRRAGKNGEIVASGHHTKFFS  113



>ref|XP_009905315.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Picoides pubescens]
Length=141

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  29   VKLLSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERAVPGVSVDMN  88

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EEV I A+VL+ G+++AF +V+L  K +GK+IAQGRHTKYL
Sbjct  89   ITYTSAAKIGEEVLITAQVLKQGRNLAFATVDLTNKASGKLIAQGRHTKYL  139



>gb|KFO83643.1| Acyl-coenzyme A thioesterase 13, partial [Buceros rhinoceros 
silvestris]
Length=114

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V + A+        GVSV++N++Y  
Sbjct  7    ATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERAVPGVSVDMNITYTS  66

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF +V+L  K TGK+IAQGRHTKYL
Sbjct  67   AAKIGEEILITAQILKQGRNIAFATVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_009996592.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Chaetura pelagica]
Length=171

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+I+C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  59   MKLVSATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERALPGVSVDMN  118

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + E+V I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  119  ITYTSAAKIGEDVLITAEILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  169



>ref|XP_010135910.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Buceros 
rhinoceros silvestris]
Length=113

 Score =   105 bits (262),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V + A+        GVSV++N++Y  
Sbjct  6    ATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERAVPGVSVDMNITYTS  65

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF +V+L  K TGK+IAQGRHTKYL
Sbjct  66   AAKIGEEILITAQILKQGRNIAFATVDLTNKATGKLIAQGRHTKYL  111



>ref|XP_009639750.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Egretta garzetta]
Length=253

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  141  MKLLSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTEKAVPGVSVDMN  200

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G++IAF SV+L  K TGK+IAQGRHTKYL
Sbjct  201  ITYTSAAKIGEEILITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYL  251



>gb|KFZ64967.1| Acyl-coenzyme A thioesterase 13, partial [Podiceps cristatus]
Length=117

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V + A+        GVSV++N++Y  
Sbjct  10   ATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERAMPGVSVDMNITYTS  69

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G++IAF +V+L  K TGK+IAQGRHTKYL
Sbjct  70   AAKIGEEILITAQILKQGRNIAFATVDLTNKATGKLIAQGRHTKYL  115



>gb|KGL94020.1| Acyl-coenzyme A thioesterase 13, partial [Charadrius vociferus]
Length=114

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSVEINVSY  338
            A  G+I+C  KV     N G  LHGG TATLVD+V + A+ YT  G+P  GVSV++N++Y
Sbjct  7    ATPGKIVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERGMP--GVSVDMNITY  64

Query  339  LDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
               A + EE+ I A++L+ G++IAF +V+L  K TGK+IAQGRHTKY+
Sbjct  65   TSAAKIGEEILITAQILKQGRNIAFATVDLTDKATGKLIAQGRHTKYI  112



>gb|EMS66235.1| hypothetical protein TRIUR3_31840 [Triticum urartu]
Length=91

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +3

Query  231  LHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIA  410
            +HGGA A+LVD+VGSA I+  G P +GVS++I VSYL  A  +EE+EIEA+VL +G    
Sbjct  1    MHGGAVASLVDLVGSAVIFAGGSPLTGVSLDITVSYLGAARANEEIEIEARVLGLGDKTG  60

Query  411  FVSVELRKKKTGKIIAQGRHTKYLA-VASKL  500
             V+VE+R+K  G+++A GRHTKYLA V+SKL
Sbjct  61   CVTVEVRRKDNGQVLAHGRHTKYLANVSSKL  91



>ref|XP_003444129.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Oreochromis 
niloticus]
Length=142

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEI  326
            KVD+  A  G+++C  +V     N G  LHGG TATLVD++ + AI        GVSV++
Sbjct  28   KVDILSASPGKVVCEMRVDEEHTNRGGTLHGGLTATLVDVISTMAIMYSERGAPGVSVDM  87

Query  327  NVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            N++Y++ A + E+V I A+VL+ G+S+AF +V+L  K TGKIIAQGRHTK+L
Sbjct  88   NITYMNAAKMGEDVLITAQVLKQGRSLAFATVDLTNKVTGKIIAQGRHTKHL  139



>ref|XP_009346893.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
 ref|XP_009346894.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
Length=162

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 95/154 (62%), Gaps = 4/154 (3%)
 Frame = +3

Query  48   LESIKKFLEKEGGEYEAI---VDSMPLRFLEPFISHGIKVDLAERGRIICTFKVPLRLVN  218
            LE  KK+LE    E EA+   V     R  + F+  GI+VD  + G ++CTFKVP RL +
Sbjct  10   LEDAKKYLEVTQDESEAVSRLVFPSDRRIYDHFVESGIRVDRVQPGFVVCTFKVPPRLTD  69

Query  219  MGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIEAKVLRMG  398
                L  GA ATLVD+VG++ ++   +P + VSV++++SY+  A L++E+EI +K L   
Sbjct  70   RAGNLANGAIATLVDMVGASTVFVPHIPMN-VSVDMSISYMANAKLNDELEITSKRLGQR  128

Query  399  KSIAFVSVELRKKKTGKIIAQGRHTKYLAVASKL  500
               +   V LR K +G+IIA+GRH+ + + +SKL
Sbjct  129  GRYSGTYVLLRNKASGEIIAEGRHSLFRSSSSKL  162



>ref|XP_009562520.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A thioesterase 
13, partial [Cuculus canorus]
Length=151

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V +AA+        GVSV++N
Sbjct  39   MKLLSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERALPGVSVDMN  98

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + E+V I A++L+ G++IAF SV+L  K TGK+IAQGRHTKY+
Sbjct  99   ITYTSAAKIGEDVLITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYI  149



>gb|EMP35193.1| Acyl-coenzyme A thioesterase 13, partial [Chelonia mydas]
Length=114

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSVEINVSY  338
            A  G+++C  K+     N G  LHGG TATLVD+V +AA+ YT  G+P  GVSV++N++Y
Sbjct  7    ATPGKVVCEMKIEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERGLP--GVSVDMNITY  64

Query  339  LDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            +  A + EE+ I A++L+ G+S+AF SV++  K TGK +AQGRHTK+L
Sbjct  65   MSAAKIGEEILITAQILKQGRSLAFASVDVTNKATGKFVAQGRHTKHL  112



>ref|XP_005728489.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Pundamilia 
nyererei]
Length=151

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  +V     N G  LHGG TATLVDIV + AI        GVSV++N++Y++
Sbjct  43   ASPGKVVCEMRVEEEHTNRGGTLHGGLTATLVDIVSTMAIMHSERGAPGVSVDMNITYMN  102

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + E+V I A+VL+ G+S+AF +V+L  K TGKIIAQGRHTK+L
Sbjct  103  AAKMGEDVLITAQVLKQGRSLAFATVDLTNKVTGKIIAQGRHTKHL  148



>ref|NP_001139872.1| Thioesterase superfamily member 2 [Salmo salar]
 gb|ACM08428.1| Thioesterase superfamily member 2 [Salmo salar]
Length=141

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSV  320
            KVD+  A  G+++C FKV     N G  LHGG TATLVD++ + AI YT  G P  GVSV
Sbjct  28   KVDIVTASPGKVVCEFKVEEEHTNRGGTLHGGLTATLVDVISTTAIMYTERGAP--GVSV  85

Query  321  EINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++N++Y++ A + E+V I A VL+ G++ AF +V+L  K +GK+IAQGRHTK+L
Sbjct  86   DMNITYMNAAKMGEDVLITATVLKQGRTPAFATVDLTSKASGKLIAQGRHTKHL  139



>ref|XP_008304638.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Stegastes partitus]
Length=142

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEI  326
            KVD+  A  G+++C  +V     N G  LHGG TATLVD++ + AI        GVSV++
Sbjct  28   KVDVLSASPGKVVCEMQVEEEHTNRGGTLHGGLTATLVDVISTLAIMNSERGAPGVSVDM  87

Query  327  NVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            N++Y+  A L E+V I A+VL+ G+++AF +V+L  K TGK+IAQGRHTK+L
Sbjct  88   NITYMSAAKLGEDVLITAQVLKQGRTLAFATVDLTSKATGKVIAQGRHTKHL  139



>ref|XP_005917539.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Haplochromis 
burtoni]
Length=151

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  +V     N G  LHGG TATLVDIV + AI        GVSV++N++Y++
Sbjct  43   ASPGKVVCEMRVEEEHTNRGGTLHGGLTATLVDIVSTIAIMHSERGAPGVSVDMNITYMN  102

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + E+V I A+VL+ G+S+AF +V+L  K TGKIIAQGRHTK+L
Sbjct  103  AAKMGEDVLITAQVLKQGRSLAFATVDLTNKVTGKIIAQGRHTKHL  148



>gb|KFP85437.1| Acyl-coenzyme A thioesterase 13, partial [Apaloderma vittatum]
Length=114

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V + A+        GVSV++N++Y  
Sbjct  7    ATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERAVPGVSVDMNITYTS  66

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EE+ I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  67   AAKIGEEILITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_009864157.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Apaloderma 
vittatum]
Length=113

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V + A+        GVSV++N
Sbjct  1    MKLLSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERAVPGVSVDMN  60

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  61   ITYTSAAKIGEEILITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  111



>ref|XP_003204950.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X1 [Meleagris 
gallopavo]
Length=143

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  KV     N G  LHGG TATLVD+V + A+        GVSV++N++Y  
Sbjct  36   ANPGKVVCELKVEEEHTNRGGTLHGGLTATLVDVVSTIALLYTERALPGVSVDMNITYTS  95

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + EEV I A++L+ G++IAF SV+L  K TGK+IAQGRHTKY+
Sbjct  96   AAKIGEEVLITAQILKQGRNIAFASVDLTNKATGKLIAQGRHTKYI  141



>ref|XP_005281460.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X2 [Chrysemys 
picta bellii]
Length=113

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSVEINVSY  338
            A  G+++C  K+     N G  LHGG TATLVD+V +AA+ YT  G+P  GVSV++N++Y
Sbjct  6    ATPGKVVCEMKIEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERGMP--GVSVDMNITY  63

Query  339  LDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            +  A + EE+ I A++L+ G+ +AF SV++  K TGK +AQGRHTKYL
Sbjct  64   MSAAKIGEEILITAQILKQGRRLAFASVDVTNKATGKFVAQGRHTKYL  111



>gb|KFQ18918.1| Acyl-coenzyme A thioesterase 13, partial [Merops nubicus]
Length=114

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +K+  A  G+++C  KV     N G  LHGG TATLVD+V + A+        GVSV++N
Sbjct  2    MKLLSATPGKVVCEMKVEEEHTNRGGTLHGGLTATLVDVVSTTALLYTERALPGVSVDMN  61

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y   A + EE+ I A++L+ G+++AF +V+L  K TGK+IAQGRHTKYL
Sbjct  62   ITYTSAAKIGEEILITAQILKQGRNLAFATVDLTNKATGKLIAQGRHTKYL  112



>ref|XP_007547806.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Poecilia formosa]
Length=142

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 81/114 (71%), Gaps = 6/114 (5%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSV  320
            KVD+  A  G+++C  +V     N G  LHGG TATLVD++ + AI YT  G P  GVSV
Sbjct  28   KVDVVSASPGKVVCEMRVEEEHTNRGGTLHGGLTATLVDVISTMAIMYTERGAP--GVSV  85

Query  321  EINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++N++Y++ A + E+V I A+VL+ GK++AF +V+L  K +GK+IAQGRHTK+L
Sbjct  86   DMNITYMNAAKIGEDVLITAQVLKQGKTLAFATVDLSSKASGKLIAQGRHTKHL  139



>ref|XP_006635775.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Lepisosteus 
oculatus]
Length=141

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  174  GRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAF  353
            G+++C  KV     N G  LHGG TATLVDIV + A+        GVSV++N++Y++ A 
Sbjct  37   GKVVCEMKVEEEHTNRGGTLHGGLTATLVDIVSTTALLYTERAEPGVSVDMNITYMNTAK  96

Query  354  LDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            L E+V I A+VL+ G+++AF +V++  K+TGK+IAQGRHTK+L
Sbjct  97   LGEDVLITAQVLKQGRTLAFATVDITNKETGKLIAQGRHTKHL  139



>ref|XP_007421999.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Python bivittatus]
Length=141

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  150  IKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEIN  329
            +KV  A  G+++C  KV  +  N G  LHGG TATLVDIV +AA+        GVSV++N
Sbjct  29   LKVISASPGKVVCEMKVEEQHTNRGGTLHGGLTATLVDIVSTAALLHTERGAPGVSVDMN  88

Query  330  VSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            ++Y+  A + EE+ I A+VL+ GK++ F +V L  K TG++IAQGRHTK+L
Sbjct  89   ITYMSSAKIGEEILITAEVLKQGKTLGFANVNLTSKATGRLIAQGRHTKHL  139



>ref|XP_004294282.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=159

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 2/127 (2%)
 Frame = +3

Query  123  FLEPFISHGIKVDLAERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVP  302
            F E F   GI+VD AE G ++CTFKVP RL +    L  GA A LVDIVGS   YT G+ 
Sbjct  34   FYENFAIRGIRVDQAEPGLVVCTFKVPPRLTDRAGNLSNGAIANLVDIVGSYVTYTGGL-  92

Query  303  TSGVSVEINVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKY-  479
               VS +I++SY+  A LD+EVEI +K L        + V LR K TG +IA+GRH+ + 
Sbjct  93   IRNVSADISISYMSTAKLDDEVEITSKRLGQKGGYTGILVLLRNKATGDVIAEGRHSMFC  152

Query  480  LAVASKL  500
            L  ASKL
Sbjct  153  LDSASKL  159



>ref|XP_005797423.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Xiphophorus 
maculatus]
Length=142

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEI  326
            KVD+  A  G+++C  +V     N G  LHGG TATLVD++ + AI        GVSV++
Sbjct  28   KVDVVSASPGKVVCEMRVEEEHTNRGGTLHGGLTATLVDVISTMAIMHSERGAPGVSVDM  87

Query  327  NVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            N++Y++ A + E+V I A+VL+ GK++AF +V+L  K +GK+IAQGRHTK+L
Sbjct  88   NITYMNAANIGEDVLITAQVLKQGKTLAFATVDLSSKTSGKLIAQGRHTKHL  139



>gb|KFW77463.1| Acyl-coenzyme A thioesterase 13, partial [Manacus vitellinus]
Length=148

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 90/155 (58%), Gaps = 17/155 (11%)
 Frame = +3

Query  24   GDMGKEMDL--ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFK  197
            G+MG  ++   E++K  LE +G  ++ ++  M L    P             G I+C  K
Sbjct  9    GNMGFTVETLREAMKFMLESQG--FDRVLRKMKLVSATP-------------GNIVCEMK  53

Query  198  VPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIE  377
            V     N    LHGG TATLVD+V +AA+        GVSV++N+SY   A + EE+ I 
Sbjct  54   VEEEHTNRYGTLHGGLTATLVDVVSTAALLYTERAAPGVSVDMNISYTSAAKIGEEILIT  113

Query  378  AKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            A++L+ G+S+AF +V+L  K TGK+IAQGRHTK+L
Sbjct  114  AQILKQGRSLAFATVDLTNKATGKLIAQGRHTKFL  148



>ref|XP_007060448.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Chelonia mydas]
Length=141

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSVEINVSY  338
            A  G+++C  K+     N G  LHGG TATLVD+V +AA+ YT  G+P  GVSV++N++Y
Sbjct  34   ATPGKVVCEMKIEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERGLP--GVSVDMNITY  91

Query  339  LDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            +  A + EE+ I A++L+ G+S+AF SV++  K TGK +AQGRHTK+L
Sbjct  92   MSAAKIGEEILITAQILKQGRSLAFASVDVTNKATGKFVAQGRHTKHL  139



>ref|XP_005281459.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X1 [Chrysemys 
picta bellii]
Length=141

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAI-YT-MGVPTSGVSVEINVSY  338
            A  G+++C  K+     N G  LHGG TATLVD+V +AA+ YT  G+P  GVSV++N++Y
Sbjct  34   ATPGKVVCEMKIEEEHTNRGGTLHGGLTATLVDVVSTAALLYTERGMP--GVSVDMNITY  91

Query  339  LDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            +  A + EE+ I A++L+ G+ +AF SV++  K TGK +AQGRHTKYL
Sbjct  92   MSAAKIGEEILITAQILKQGRRLAFASVDVTNKATGKFVAQGRHTKYL  139



>ref|XP_008917907.1| PREDICTED: acyl-coenzyme A thioesterase 13, partial [Manacus 
vitellinus]
Length=155

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 90/155 (58%), Gaps = 17/155 (11%)
 Frame = +3

Query  24   GDMGKEMDL--ESIKKFLEKEGGEYEAIVDSMPLRFLEPFISHGIKVDLAERGRIICTFK  197
            G+MG  ++   E++K  LE +G  ++ ++  M L    P             G I+C  K
Sbjct  14   GNMGFTVETLREAMKFMLESQG--FDRVLRKMKLVSATP-------------GNIVCEMK  58

Query  198  VPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLDVAFLDEEVEIE  377
            V     N    LHGG TATLVD+V +AA+        GVSV++N+SY   A + EE+ I 
Sbjct  59   VEEEHTNRYGTLHGGLTATLVDVVSTAALLYTERAAPGVSVDMNISYTSAAKIGEEILIT  118

Query  378  AKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            A++L+ G+S+AF +V+L  K TGK+IAQGRHTK+L
Sbjct  119  AQILKQGRSLAFATVDLTNKATGKLIAQGRHTKFL  153



>ref|XP_005478564.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X2 [Oreochromis 
niloticus]
Length=151

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = +3

Query  165  AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEINVSYLD  344
            A  G+++C  +V     N G  LHGG TATLVD++ + AI        GVSV++N++Y++
Sbjct  43   ASPGKVVCEMRVDEEHTNRGGTLHGGLTATLVDVISTMAIMYSERGAPGVSVDMNITYMN  102

Query  345  VAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
             A + E+V I A+VL+ G+S+AF +V+L  K TGKIIAQGRHTK+L
Sbjct  103  AAKMGEDVLITAQVLKQGRSLAFATVDLTNKVTGKIIAQGRHTKHL  148



>ref|XP_010736256.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Larimichthys crocea]
Length=142

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +3

Query  153  KVDL--AERGRIICTFKVPLRLVNMGNFLHGGATATLVDIVGSAAIYTMGVPTSGVSVEI  326
            KVDL  A  G+++C  +V     N G  LHGG TATLVD++ + AI        GVSV++
Sbjct  28   KVDLLSASPGKVVCEMRVEEEHTNRGGTLHGGLTATLVDVISTMAIMYSERGAPGVSVDM  87

Query  327  NVSYLDVAFLDEEVEIEAKVLRMGKSIAFVSVELRKKKTGKIIAQGRHTKYL  482
            N++Y++ A   E+V I A+VL+ G+++AF +V+L  K TGK+IAQGRHTK+L
Sbjct  88   NITYMNAAKTGEDVLITAQVLKQGRTLAFATVDLTSKATGKLIAQGRHTKHL  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1358489737150