BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7526

Length=936
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011087158.1|  PREDICTED: nucleobase-ascorbate transporter 6      362   9e-118   Sesamum indicum [beniseed]
gb|AAL76261.1|AF466824_1  putative permease 1                           346   6e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004508844.1|  PREDICTED: nucleobase-ascorbate transporter ...    356   9e-116   Cicer arietinum [garbanzo]
gb|KEH31855.1|  nucleobase-ascorbate transporter-like protein           351   1e-115   Medicago truncatula
gb|KEH31856.1|  nucleobase-ascorbate transporter-like protein           352   8e-115   Medicago truncatula
emb|CDX84363.1|  BnaC03g51370D                                          353   1e-114   
gb|AAK59508.2|  putative permease 1                                     347   2e-114   Arabidopsis thaliana [mouse-ear cress]
gb|KJB19548.1|  hypothetical protein B456_003G109900                    348   3e-114   Gossypium raimondii
ref|XP_003608951.1|  Nucleobase ascorbate transporter                   352   3e-114   Medicago truncatula
ref|XP_009112041.1|  PREDICTED: nucleobase-ascorbate transporter 6      352   5e-114   Brassica rapa
gb|KJB53228.1|  hypothetical protein B456_008G297500                    347   6e-114   Gossypium raimondii
ref|XP_002511446.1|  purine permease, putative                          351   1e-113   Ricinus communis
ref|XP_009608483.1|  PREDICTED: nucleobase-ascorbate transporter ...    351   1e-113   Nicotiana tomentosiformis
ref|XP_010550666.1|  PREDICTED: nucleobase-ascorbate transporter 6      351   1e-113   Tarenaya hassleriana [spider flower]
emb|CDY30739.1|  BnaA02g33610D                                          350   1e-113   Brassica napus [oilseed rape]
ref|XP_010519558.1|  PREDICTED: nucleobase-ascorbate transporter ...    351   1e-113   Tarenaya hassleriana [spider flower]
gb|AIS71908.1|  nucleobase-ascorbate transporter 6-like isoform 1       351   2e-113   Nicotiana tabacum [American tobacco]
ref|XP_009151410.1|  PREDICTED: nucleobase-ascorbate transporter 6      350   2e-113   Brassica rapa
ref|XP_012092049.1|  PREDICTED: nucleobase-ascorbate transporter 7      350   2e-113   Jatropha curcas
emb|CDY56736.1|  BnaC09g50870D                                          350   3e-113   Brassica napus [oilseed rape]
gb|KHG14639.1|  Nucleobase-ascorbate transporter 6 -like protein        350   3e-113   Gossypium arboreum [tree cotton]
gb|KJB53223.1|  hypothetical protein B456_008G297500                    348   3e-113   Gossypium raimondii
ref|XP_006394340.1|  hypothetical protein EUTSA_v10003977mg             350   4e-113   Eutrema salsugineum [saltwater cress]
ref|XP_009803945.1|  PREDICTED: nucleobase-ascorbate transporter ...    350   4e-113   Nicotiana sylvestris
ref|XP_009608481.1|  PREDICTED: nucleobase-ascorbate transporter ...    351   4e-113   
emb|CDY45747.1|  BnaC02g42350D                                          349   4e-113   Brassica napus [oilseed rape]
gb|ABK93255.1|  unknown                                                 342   4e-113   Populus trichocarpa [western balsam poplar]
gb|KEH35060.1|  nucleobase-ascorbate transporter-like protein           349   5e-113   Medicago truncatula
ref|XP_009130240.1|  PREDICTED: nucleobase-ascorbate transporter ...    349   5e-113   Brassica rapa
ref|XP_010459419.1|  PREDICTED: nucleobase-ascorbate transporter ...    349   5e-113   Camelina sativa [gold-of-pleasure]
ref|XP_006280290.1|  hypothetical protein CARUB_v10026214mg             349   5e-113   
ref|NP_201094.1|  Xanthine/uracil permease family protein               349   6e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009782990.1|  PREDICTED: nucleobase-ascorbate transporter 6      349   6e-113   Nicotiana sylvestris
ref|XP_008393061.1|  PREDICTED: nucleobase-ascorbate transporter 6      349   7e-113   
ref|XP_009610581.1|  PREDICTED: nucleobase-ascorbate transporter ...    347   9e-113   Nicotiana tomentosiformis
gb|KJB19546.1|  hypothetical protein B456_003G109900                    348   9e-113   Gossypium raimondii
ref|XP_008453115.1|  PREDICTED: nucleobase-ascorbate transporter 6      348   1e-112   Cucumis melo [Oriental melon]
gb|KJB53217.1|  hypothetical protein B456_008G297500                    348   1e-112   Gossypium raimondii
gb|KHG22799.1|  Nucleobase-ascorbate transporter 6 -like protein        348   2e-112   Gossypium arboreum [tree cotton]
ref|XP_007036127.1|  Xanthine/uracil permease family protein isof...    348   2e-112   Theobroma cacao [chocolate]
ref|XP_002864824.1|  hypothetical protein ARALYDRAFT_496474             347   2e-112   
ref|XP_004501951.1|  PREDICTED: nucleobase-ascorbate transporter ...    347   3e-112   Cicer arietinum [garbanzo]
ref|XP_006438462.1|  hypothetical protein CICLE_v10031192mg             347   3e-112   Citrus clementina [clementine]
ref|XP_007155396.1|  hypothetical protein PHAVU_003G197800g             347   4e-112   Phaseolus vulgaris [French bean]
ref|XP_011028608.1|  PREDICTED: nucleobase-ascorbate transporter 6      347   4e-112   Populus euphratica
ref|XP_004241491.1|  PREDICTED: nucleobase-ascorbate transporter 6      347   4e-112   
ref|XP_009610578.1|  PREDICTED: nucleobase-ascorbate transporter ...    347   4e-112   Nicotiana tomentosiformis
ref|XP_009757662.1|  PREDICTED: nucleobase-ascorbate transporter ...    347   5e-112   Nicotiana sylvestris
ref|XP_006339989.1|  PREDICTED: nucleobase-ascorbate transporter ...    347   6e-112   Solanum tuberosum [potatoes]
ref|XP_004252190.1|  PREDICTED: nucleobase-ascorbate transporter 6      347   6e-112   Solanum lycopersicum
gb|AGV54390.1|  nucleobase-ascorbate transporter 6-like protein         347   6e-112   Phaseolus vulgaris [French bean]
ref|XP_007209884.1|  hypothetical protein PRUPE_ppa003999mg             347   6e-112   Prunus persica
ref|XP_012080118.1|  PREDICTED: nucleobase-ascorbate transporter 6      346   7e-112   Jatropha curcas
ref|XP_010546016.1|  PREDICTED: nucleobase-ascorbate transporter ...    346   9e-112   Tarenaya hassleriana [spider flower]
ref|XP_006439754.1|  hypothetical protein CICLE_v10019673mg             343   1e-111   
ref|XP_003549636.1|  PREDICTED: nucleobase-ascorbate transporter ...    346   1e-111   Glycine max [soybeans]
gb|KDO69759.1|  hypothetical protein CISIN_1g009582mg                   342   1e-111   Citrus sinensis [apfelsine]
gb|KDO69758.1|  hypothetical protein CISIN_1g009582mg                   342   2e-111   Citrus sinensis [apfelsine]
ref|XP_004138122.1|  PREDICTED: nucleobase-ascorbate transporter 6      345   2e-111   Cucumis sativus [cucumbers]
ref|XP_010678709.1|  PREDICTED: nucleobase-ascorbate transporter 6      345   2e-111   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO69757.1|  hypothetical protein CISIN_1g009582mg                   343   2e-111   Citrus sinensis [apfelsine]
gb|KHN48615.1|  Nucleobase-ascorbate transporter 6                      345   3e-111   Glycine soja [wild soybean]
ref|XP_006579556.1|  PREDICTED: nucleobase-ascorbate transporter ...    345   3e-111   Glycine max [soybeans]
ref|XP_008239723.1|  PREDICTED: nucleobase-ascorbate transporter 6      345   4e-111   
gb|KDO69752.1|  hypothetical protein CISIN_1g009582mg                   343   5e-111   Citrus sinensis [apfelsine]
ref|XP_002322154.1|  xanthine/uracil permease family protein            344   5e-111   Populus trichocarpa [western balsam poplar]
ref|XP_003527028.1|  PREDICTED: nucleobase-ascorbate transporter ...    344   7e-111   Glycine max [soybeans]
ref|XP_010444153.1|  PREDICTED: nucleobase-ascorbate transporter ...    344   7e-111   Camelina sativa [gold-of-pleasure]
ref|XP_002283469.1|  PREDICTED: nucleobase-ascorbate transporter 6      344   7e-111   Vitis vinifera
ref|XP_002311584.2|  hypothetical protein POPTR_0008s14580g             342   9e-111   
gb|KDO69748.1|  hypothetical protein CISIN_1g009582mg                   343   1e-110   Citrus sinensis [apfelsine]
ref|XP_006439755.1|  hypothetical protein CICLE_v10019673mg             343   1e-110   
ref|XP_006476733.1|  PREDICTED: nucleobase-ascorbate transporter ...    343   2e-110   Citrus sinensis [apfelsine]
ref|XP_009619816.1|  PREDICTED: nucleobase-ascorbate transporter ...    342   2e-110   Nicotiana tomentosiformis
ref|XP_006280300.1|  hypothetical protein CARUB_v10026223mg             342   3e-110   Capsella rubella
gb|KHG18287.1|  Nucleobase-ascorbate transporter 7 -like protein        342   3e-110   Gossypium arboreum [tree cotton]
gb|KJB77978.1|  hypothetical protein B456_012G170700                    342   3e-110   Gossypium raimondii
ref|XP_003523067.1|  PREDICTED: nucleobase-ascorbate transporter ...    342   4e-110   Glycine max [soybeans]
gb|KFK26633.1|  hypothetical protein AALP_AA8G273900                    342   4e-110   Arabis alpina [alpine rockcress]
gb|AET03140.2|  nucleobase-ascorbate transporter-like protein           342   5e-110   Medicago truncatula
ref|XP_010100509.1|  Nucleobase-ascorbate transporter 6                 342   6e-110   Morus notabilis
ref|XP_011025599.1|  PREDICTED: nucleobase-ascorbate transporter ...    341   7e-110   Populus euphratica
ref|XP_003628664.1|  Nucleobase ascorbate transporter                   342   8e-110   
dbj|BAB08803.1|  permease                                               340   8e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299577.1|  PREDICTED: nucleobase-ascorbate transporter 6      340   1e-109   Fragaria vesca subsp. vesca
ref|XP_004509863.1|  PREDICTED: nucleobase-ascorbate transporter ...    340   1e-109   Cicer arietinum [garbanzo]
ref|XP_007138109.1|  hypothetical protein PHAVU_009G181000g             340   2e-109   Phaseolus vulgaris [French bean]
ref|XP_002865770.1|  xanthine/uracil permease family protein            340   2e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_010028015.1|  PREDICTED: nucleobase-ascorbate transporter 6      340   2e-109   Eucalyptus grandis [rose gum]
ref|XP_011021644.1|  PREDICTED: nucleobase-ascorbate transporter 7      340   3e-109   Populus euphratica
ref|XP_011044342.1|  PREDICTED: nucleobase-ascorbate transporter ...    340   3e-109   Populus euphratica
ref|NP_199810.2|  xanthine/uracil permease family protein               339   4e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004236131.1|  PREDICTED: nucleobase-ascorbate transporter 6      339   4e-109   
ref|XP_002531406.1|  purine permease, putative                          339   4e-109   Ricinus communis
emb|CDP17001.1|  unnamed protein product                                339   5e-109   Coffea canephora [robusta coffee]
ref|XP_002315809.1|  xanthine/uracil permease family protein            339   6e-109   
ref|XP_007157491.1|  hypothetical protein PHAVU_002G074100g             338   7e-109   Phaseolus vulgaris [French bean]
ref|XP_006345027.1|  PREDICTED: nucleobase-ascorbate transporter ...    338   7e-109   Solanum tuberosum [potatoes]
ref|XP_006402200.1|  hypothetical protein EUTSA_v10013227mg             338   9e-109   Eutrema salsugineum [saltwater cress]
emb|CAN79848.1|  hypothetical protein VITISV_025959                     338   1e-108   Vitis vinifera
ref|XP_010442477.1|  PREDICTED: nucleobase-ascorbate transporter ...    338   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_010482302.1|  PREDICTED: nucleobase-ascorbate transporter ...    338   2e-108   
ref|XP_002268811.1|  PREDICTED: nucleobase-ascorbate transporter 6      338   2e-108   Vitis vinifera
ref|XP_010043812.1|  PREDICTED: nucleobase-ascorbate transporter 7      337   3e-108   
ref|XP_006355948.1|  PREDICTED: nucleobase-ascorbate transporter ...    336   3e-108   
ref|XP_004508843.1|  PREDICTED: nucleobase-ascorbate transporter ...    338   3e-108   
ref|XP_007044538.1|  Nucleobase-ascorbate transporter 7                 337   4e-108   
ref|XP_010418834.1|  PREDICTED: nucleobase-ascorbate transporter ...    335   6e-108   Camelina sativa [gold-of-pleasure]
gb|AAD14479.1|  Strong similarity to gi|3337350 F13P17.3 putative...    336   8e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355947.1|  PREDICTED: nucleobase-ascorbate transporter ...    336   1e-107   Solanum tuberosum [potatoes]
ref|NP_176211.2|  nucleobase-ascorbate transporter 7                    336   1e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KJB31307.1|  hypothetical protein B456_005G185400                    327   1e-107   Gossypium raimondii
gb|KHN10623.1|  Nucleobase-ascorbate transporter 6                      335   1e-107   Glycine soja [wild soybean]
ref|XP_003532028.1|  PREDICTED: nucleobase-ascorbate transporter ...    335   1e-107   Glycine max [soybeans]
gb|KHN44541.1|  Nucleobase-ascorbate transporter 6                      335   1e-107   Glycine soja [wild soybean]
ref|XP_010556259.1|  PREDICTED: nucleobase-ascorbate transporter 7      335   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_002886639.1|  xanthine/uracil permease family protein            335   2e-107   Arabidopsis lyrata subsp. lyrata
ref|XP_010532270.1|  PREDICTED: nucleobase-ascorbate transporter ...    333   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_004238704.1|  PREDICTED: nucleobase-ascorbate transporter 7      335   2e-107   Solanum lycopersicum
ref|XP_008374469.1|  PREDICTED: nucleobase-ascorbate transporter ...    334   3e-107   
dbj|BAF01000.1|  hypothetical protein                                   334   5e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010913510.1|  PREDICTED: LOW QUALITY PROTEIN: nucleobase-a...    334   6e-107   Elaeis guineensis
ref|XP_009595521.1|  PREDICTED: nucleobase-ascorbate transporter ...    334   6e-107   Nicotiana tomentosiformis
ref|XP_009799732.1|  PREDICTED: nucleobase-ascorbate transporter ...    333   9e-107   Nicotiana sylvestris
ref|XP_008446242.1|  PREDICTED: nucleobase-ascorbate transporter 7      333   1e-106   Cucumis melo [Oriental melon]
ref|XP_010532269.1|  PREDICTED: nucleobase-ascorbate transporter ...    333   1e-106   Tarenaya hassleriana [spider flower]
ref|XP_010470161.1|  PREDICTED: nucleobase-ascorbate transporter ...    333   1e-106   Camelina sativa [gold-of-pleasure]
ref|XP_003552008.1|  PREDICTED: nucleobase-ascorbate transporter ...    333   1e-106   
ref|XP_004135225.1|  PREDICTED: nucleobase-ascorbate transporter 7      333   2e-106   Cucumis sativus [cucumbers]
ref|XP_004297660.1|  PREDICTED: nucleobase-ascorbate transporter 6      333   2e-106   Fragaria vesca subsp. vesca
ref|XP_003519478.1|  PREDICTED: nucleobase-ascorbate transporter ...    332   2e-106   
ref|XP_007221801.1|  hypothetical protein PRUPE_ppa004044mg             332   2e-106   
ref|XP_009118902.1|  PREDICTED: nucleobase-ascorbate transporter 5      332   2e-106   Brassica rapa
gb|KHN45288.1|  Nucleobase-ascorbate transporter 6                      332   2e-106   Glycine soja [wild soybean]
ref|XP_010474016.1|  PREDICTED: nucleobase-ascorbate transporter ...    320   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_011071803.1|  PREDICTED: nucleobase-ascorbate transporter ...    332   2e-106   Sesamum indicum [beniseed]
ref|XP_008245218.1|  PREDICTED: nucleobase-ascorbate transporter ...    332   3e-106   Prunus mume [ume]
ref|XP_009360485.1|  PREDICTED: nucleobase-ascorbate transporter ...    332   3e-106   Pyrus x bretschneideri [bai li]
ref|XP_003517836.1|  PREDICTED: nucleobase-ascorbate transporter ...    332   3e-106   Glycine max [soybeans]
ref|XP_009103320.1|  PREDICTED: nucleobase-ascorbate transporter 7      332   3e-106   Brassica rapa
emb|CDY24508.1|  BnaA01g22120D                                          332   3e-106   Brassica napus [oilseed rape]
ref|XP_008389596.1|  PREDICTED: nucleobase-ascorbate transporter ...    332   4e-106   Malus domestica [apple tree]
ref|XP_010272020.1|  PREDICTED: nucleobase-ascorbate transporter 6      331   6e-106   Nelumbo nucifera [Indian lotus]
ref|XP_006573063.1|  PREDICTED: nucleobase-ascorbate transporter ...    332   8e-106   Glycine max [soybeans]
ref|XP_006300441.1|  hypothetical protein CARUB_v10020111mg             331   9e-106   Capsella rubella
ref|XP_006392193.1|  hypothetical protein EUTSA_v10023405mg             331   1e-105   Eutrema salsugineum [saltwater cress]
ref|XP_010472295.1|  PREDICTED: nucleobase-ascorbate transporter ...    329   1e-105   
ref|XP_008806500.1|  PREDICTED: nucleobase-ascorbate transporter ...    330   1e-105   
ref|XP_004953888.1|  PREDICTED: nucleobase-ascorbate transporter ...    330   1e-105   Setaria italica
ref|XP_006574587.1|  PREDICTED: nucleobase-ascorbate transporter ...    333   2e-105   
emb|CDX71592.1|  BnaC09g26330D                                          330   2e-105   
ref|XP_008339995.1|  PREDICTED: nucleobase-ascorbate transporter ...    329   3e-105   
emb|CDY33617.1|  BnaC01g28480D                                          329   4e-105   Brassica napus [oilseed rape]
gb|KFK40823.1|  hypothetical protein AALP_AA2G046200                    329   5e-105   Arabis alpina [alpine rockcress]
gb|AFW73351.1|  hypothetical protein ZEAMMB73_676690                    322   5e-105   
ref|XP_008806320.1|  PREDICTED: nucleobase-ascorbate transporter ...    327   7e-105   
ref|NP_001048084.1|  Os02g0741800                                       328   7e-105   
emb|CAJ84113.1|  root uracil permease 1                                 328   8e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010254659.1|  PREDICTED: nucleobase-ascorbate transporter ...    328   8e-105   Nelumbo nucifera [Indian lotus]
gb|ACR38061.1|  unknown                                                 318   8e-105   Zea mays [maize]
ref|XP_003613313.1|  Nucleobase ascorbate transporter                   328   1e-104   Medicago truncatula
ref|XP_002452570.1|  hypothetical protein SORBIDRAFT_04g028300          328   1e-104   Sorghum bicolor [broomcorn]
emb|CDY37762.1|  BnaA10g05590D                                          328   1e-104   Brassica napus [oilseed rape]
ref|XP_011086504.1|  PREDICTED: nucleobase-ascorbate transporter 7      328   1e-104   Sesamum indicum [beniseed]
ref|XP_007153664.1|  hypothetical protein PHAVU_003G054500g             328   2e-104   Phaseolus vulgaris [French bean]
ref|XP_003574490.1|  PREDICTED: nucleobase-ascorbate transporter ...    327   2e-104   Brachypodium distachyon [annual false brome]
ref|XP_008806323.1|  PREDICTED: nucleobase-ascorbate transporter ...    327   4e-104   Phoenix dactylifera
ref|XP_006647871.1|  PREDICTED: nucleobase-ascorbate transporter ...    327   4e-104   Oryza brachyantha
ref|XP_010510979.1|  PREDICTED: nucleobase-ascorbate transporter 7      326   9e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010037590.1|  PREDICTED: nucleobase-ascorbate transporter ...    325   1e-103   Eucalyptus grandis [rose gum]
ref|XP_009418014.1|  PREDICTED: nucleobase-ascorbate transporter ...    325   1e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929097.1|  PREDICTED: nucleobase-ascorbate transporter ...    325   1e-103   
gb|EYU42538.1|  hypothetical protein MIMGU_mgv1a004467mg                325   1e-103   Erythranthe guttata [common monkey flower]
ref|XP_008643648.1|  PREDICTED: LOC100282103 isoform X1                 323   1e-103   Zea mays [maize]
ref|NP_001061818.1|  Os08g0420600                                       325   2e-103   
ref|XP_010682619.1|  PREDICTED: nucleobase-ascorbate transporter ...    325   2e-103   
gb|EEC83594.1|  hypothetical protein OsI_29273                          325   2e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_006659402.1|  PREDICTED: nucleobase-ascorbate transporter ...    325   2e-103   Oryza brachyantha
gb|EEC84500.1|  hypothetical protein OsI_31190                          313   2e-103   Oryza sativa Indica Group [Indian rice]
dbj|BAJ85445.1|  predicted protein                                      324   3e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS61607.1|  Nucleobase-ascorbate transporter 6                      324   3e-103   Triticum urartu
ref|XP_010470160.1|  PREDICTED: nucleobase-ascorbate transporter ...    322   5e-103   
gb|ACN28348.1|  unknown                                                 323   9e-103   Zea mays [maize]
ref|XP_003573107.1|  PREDICTED: nucleobase-ascorbate transporter ...    323   9e-103   Brachypodium distachyon [annual false brome]
gb|ACN34480.1|  unknown                                                 323   9e-103   Zea mays [maize]
ref|NP_001148488.1|  LOC100282103                                       323   1e-102   Zea mays [maize]
ref|XP_010928566.1|  PREDICTED: nucleobase-ascorbate transporter ...    323   1e-102   Elaeis guineensis
gb|EMT04471.1|  Nucleobase-ascorbate transporter 6                      323   3e-102   
ref|XP_004973451.1|  PREDICTED: nucleobase-ascorbate transporter ...    321   4e-102   Setaria italica
ref|XP_009415380.1|  PREDICTED: nucleobase-ascorbate transporter ...    320   1e-101   
ref|XP_009385304.1|  PREDICTED: nucleobase-ascorbate transporter ...    320   1e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417550.1|  PREDICTED: nucleobase-ascorbate transporter ...    320   1e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391237.1|  PREDICTED: nucleobase-ascorbate transporter ...    320   2e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010238137.1|  PREDICTED: nucleobase-ascorbate transporter ...    318   3e-101   Brachypodium distachyon [annual false brome]
ref|NP_001140868.1|  uncharacterized protein LOC100272944               319   4e-101   Zea mays [maize]
gb|ACG35525.1|  permease I                                              319   4e-101   Zea mays [maize]
ref|XP_004981228.1|  PREDICTED: nucleobase-ascorbate transporter ...    318   5e-101   Setaria italica
ref|XP_003578065.1|  PREDICTED: nucleobase-ascorbate transporter ...    317   1e-100   Brachypodium distachyon [annual false brome]
ref|XP_002463615.1|  hypothetical protein SORBIDRAFT_01g002960          317   3e-100   
ref|NP_001063058.1|  Os09g0381100                                       316   4e-100   
ref|XP_009391740.1|  PREDICTED: nucleobase-ascorbate transporter ...    316   5e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001141421.1|  uncharacterized protein LOC100273531               315   1e-99    Zea mays [maize]
emb|CDP00202.1|  unnamed protein product                                315   1e-99    Coffea canephora [robusta coffee]
ref|XP_009391739.1|  PREDICTED: nucleobase-ascorbate transporter ...    315   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650817.1|  PREDICTED: nucleobase-ascorbate transporter ...    314   2e-99    Oryza brachyantha
ref|NP_001149779.1|  permease I                                         314   3e-99    
gb|EPS61022.1|  nucleobase ascorbate transporter                        304   3e-99    Genlisea aurea
ref|NP_001288584.1|  uncharacterized protein LOC103625746               314   3e-99    Zea mays [maize]
gb|EYU29705.1|  hypothetical protein MIMGU_mgv1a004288mg                314   3e-99    Erythranthe guttata [common monkey flower]
gb|EMT25940.1|  Nucleobase-ascorbate transporter 6                      314   3e-99    
ref|XP_010942184.1|  PREDICTED: nucleobase-ascorbate transporter ...    314   3e-99    Elaeis guineensis
ref|XP_008779515.1|  PREDICTED: nucleobase-ascorbate transporter ...    313   6e-99    Phoenix dactylifera
ref|XP_006660592.1|  PREDICTED: nucleobase-ascorbate transporter ...    312   1e-98    Oryza brachyantha
ref|NP_001150400.1|  permease I                                         312   1e-98    
tpg|DAA52241.1|  TPA: permease I                                        312   1e-98    
ref|XP_010475923.1|  PREDICTED: nucleobase-ascorbate transporter 8      311   3e-98    Camelina sativa [gold-of-pleasure]
ref|XP_009415384.1|  PREDICTED: nucleobase-ascorbate transporter ...    311   4e-98    
ref|NP_001051745.1|  Os03g0823800                                       310   1e-97    
ref|XP_002444345.1|  hypothetical protein SORBIDRAFT_07g020510          310   1e-97    
ref|XP_003563486.1|  PREDICTED: nucleobase-ascorbate transporter ...    308   3e-97    Brachypodium distachyon [annual false brome]
ref|XP_006417454.1|  hypothetical protein EUTSA_v10007311mg             308   8e-97    Eutrema salsugineum [saltwater cress]
ref|XP_010111541.1|  Nucleobase-ascorbate transporter 6                 308   9e-97    
ref|NP_172524.1|  nucleobase-ascorbate transporter 8                    306   3e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489879.1|  PREDICTED: nucleobase-ascorbate transporter ...    306   5e-96    Cicer arietinum [garbanzo]
ref|XP_006836697.1|  PREDICTED: nucleobase-ascorbate transporter 6      306   5e-96    Amborella trichopoda
ref|XP_009399656.1|  PREDICTED: nucleobase-ascorbate transporter ...    305   6e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT02255.1|  Nucleobase-ascorbate transporter 6                      305   6e-96    
ref|XP_006305877.1|  hypothetical protein CARUB_v10011003mg             304   2e-95    Capsella rubella
ref|XP_004956720.1|  PREDICTED: nucleobase-ascorbate transporter ...    304   2e-95    Setaria italica
ref|XP_009399654.1|  PREDICTED: nucleobase-ascorbate transporter ...    305   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386652.1|  PREDICTED: nucleobase-ascorbate transporter ...    303   4e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009760318.1|  PREDICTED: nucleobase-ascorbate transporter ...    293   6e-95    Nicotiana sylvestris
gb|EAZ29114.1|  hypothetical protein OsJ_13173                          303   3e-94    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ89101.1|  predicted protein                                      300   6e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY92392.1|  hypothetical protein OsI_14125                          300   8e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_002892576.1|  predicted protein                                  299   1e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_009604593.1|  PREDICTED: nucleobase-ascorbate transporter ...    298   2e-93    
ref|XP_006857136.1|  PREDICTED: nucleobase-ascorbate transporter 7      294   1e-91    Amborella trichopoda
gb|KFK43350.1|  hypothetical protein AALP_AA1G114400                    294   2e-91    Arabis alpina [alpine rockcress]
gb|EMS47148.1|  Nucleobase-ascorbate transporter 6                      293   7e-91    Triticum urartu
gb|AAD39576.1|AC007067_16  T10O24.16                                    289   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002265128.1|  PREDICTED: nucleobase-ascorbate transporter 4      285   5e-88    Vitis vinifera
ref|XP_007200240.1|  hypothetical protein PRUPE_ppa015287mg             284   7e-88    Prunus persica
gb|ADN33809.1|  nuclease ascorbate transporter                          272   2e-87    Cucumis melo subsp. melo
ref|XP_008236299.1|  PREDICTED: nucleobase-ascorbate transporter 4      282   4e-87    Prunus mume [ume]
ref|XP_008454409.1|  PREDICTED: nucleobase-ascorbate transporter 4      282   6e-87    Cucumis melo [Oriental melon]
ref|XP_011002186.1|  PREDICTED: nucleobase-ascorbate transporter ...    281   1e-86    Populus euphratica
ref|XP_007042667.1|  Xanthine/uracil permease family protein isof...    281   1e-86    Theobroma cacao [chocolate]
gb|AAX95758.2|  xanthine/uracil permease family protein                 285   2e-86    Solanum lycopersicum
ref|XP_004150259.1|  PREDICTED: nucleobase-ascorbate transporter 4      280   2e-86    Cucumis sativus [cucumbers]
ref|XP_003555298.1|  PREDICTED: nucleobase-ascorbate transporter ...    280   4e-86    Glycine max [soybeans]
ref|XP_008810107.1|  PREDICTED: nucleobase-ascorbate transporter ...    280   5e-86    Phoenix dactylifera
ref|XP_002313187.2|  hypothetical protein POPTR_0009s09000g             280   6e-86    
ref|XP_009411043.1|  PREDICTED: nucleobase-ascorbate transporter ...    278   2e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007143130.1|  hypothetical protein PHAVU_007G046400g             277   4e-85    Phaseolus vulgaris [French bean]
ref|XP_011459680.1|  PREDICTED: nucleobase-ascorbate transporter 4      277   4e-85    Fragaria vesca subsp. vesca
gb|KJB47303.1|  hypothetical protein B456_008G019900                    272   4e-83    Gossypium raimondii
gb|KHG02370.1|  Nucleobase-ascorbate transporter 4 -like protein        271   1e-82    Gossypium arboreum [tree cotton]
emb|CAN81484.1|  hypothetical protein VITISV_015553                     271   1e-82    Vitis vinifera
emb|CDO97291.1|  unnamed protein product                                271   1e-82    Coffea canephora [robusta coffee]
ref|XP_010939008.1|  PREDICTED: nucleobase-ascorbate transporter ...    269   6e-82    Elaeis guineensis
gb|KJB32223.1|  hypothetical protein B456_005G230600                    268   1e-81    Gossypium raimondii
ref|XP_010273039.1|  PREDICTED: nucleobase-ascorbate transporter ...    266   2e-81    Nelumbo nucifera [Indian lotus]
gb|AFW73350.1|  hypothetical protein ZEAMMB73_676690                    255   3e-81    
ref|XP_009614128.1|  PREDICTED: nucleobase-ascorbate transporter ...    266   8e-81    
gb|KEH44013.1|  nucleobase-ascorbate transporter-like protein           266   1e-80    Medicago truncatula
ref|XP_010273034.1|  PREDICTED: nucleobase-ascorbate transporter ...    265   1e-80    Nelumbo nucifera [Indian lotus]
ref|XP_010273019.1|  PREDICTED: nucleobase-ascorbate transporter ...    265   2e-80    
gb|ABO30011.1|  xanthine/uracil/vitamin C permease                      252   2e-80    Triticum dicoccon [cultivated emmer wheat]
gb|ABO30057.1|  xanthine/uracil/vitamin C permease                      252   3e-80    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009784935.1|  PREDICTED: nucleobase-ascorbate transporter ...    265   3e-80    Nicotiana sylvestris
ref|XP_010458403.1|  PREDICTED: nucleobase-ascorbate transporter ...    265   4e-80    Camelina sativa [gold-of-pleasure]
ref|XP_009784934.1|  PREDICTED: nucleobase-ascorbate transporter ...    264   6e-80    Nicotiana sylvestris
ref|XP_006422801.1|  hypothetical protein CICLE_v10028183mg             263   9e-80    Citrus clementina [clementine]
gb|KDP44514.1|  hypothetical protein JCGZ_16347                         263   9e-80    Jatropha curcas
ref|XP_006353973.1|  PREDICTED: nucleobase-ascorbate transporter ...    263   1e-79    Solanum tuberosum [potatoes]
gb|KCW55088.1|  hypothetical protein EUGRSUZ_I01049                     262   1e-79    Eucalyptus grandis [rose gum]
ref|XP_012093142.1|  PREDICTED: nucleobase-ascorbate transporter 4      263   1e-79    Jatropha curcas
ref|XP_006486910.1|  PREDICTED: nucleobase-ascorbate transporter ...    263   2e-79    
gb|ABO30069.1|  xanthine/uracil/vitamin C permease                      250   2e-79    
ref|XP_009606140.1|  PREDICTED: nucleobase-ascorbate transporter ...    262   3e-79    
gb|AAC19400.1|  permease 1                                              262   3e-79    
ref|XP_010028352.1|  PREDICTED: nucleobase-ascorbate transporter 4      261   6e-79    
ref|XP_009758825.1|  PREDICTED: nucleobase-ascorbate transporter ...    261   7e-79    
gb|EYU37564.1|  hypothetical protein MIMGU_mgv1a004336mg                260   1e-78    
ref|XP_004496870.1|  PREDICTED: nucleobase-ascorbate transporter ...    260   2e-78    
ref|XP_010691555.1|  PREDICTED: nucleobase-ascorbate transporter 4      259   2e-78    
gb|AAF76447.1|AC015445_14  Identical to permease homolog (At PER-...    259   4e-78    
ref|XP_011088159.1|  PREDICTED: nucleobase-ascorbate transporter ...    259   5e-78    
ref|NP_175418.1|  nucleobase-ascorbate transporter 4                    259   5e-78    
ref|XP_006346288.1|  PREDICTED: nucleobase-ascorbate transporter ...    258   1e-77    
ref|XP_011088158.1|  PREDICTED: nucleobase-ascorbate transporter ...    258   2e-77    
ref|XP_009107246.1|  PREDICTED: nucleobase-ascorbate transporter 4      256   5e-77    
ref|XP_006393199.1|  hypothetical protein EUTSA_v10011388mg             256   7e-77    
ref|XP_004230687.1|  PREDICTED: nucleobase-ascorbate transporter 4      256   7e-77    
ref|XP_010500549.1|  PREDICTED: nucleobase-ascorbate transporter ...    256   8e-77    
ref|XP_010479409.1|  PREDICTED: nucleobase-ascorbate transporter ...    256   8e-77    
gb|ABR17751.1|  unknown                                                 255   8e-77    
ref|XP_002891544.1|  xanthine/uracil permease family protein            255   8e-77    
gb|AFW67127.1|  hypothetical protein ZEAMMB73_289331                    246   1e-76    
ref|XP_002510081.1|  purine permease, putative                          255   2e-76    
ref|XP_004248777.1|  PREDICTED: nucleobase-ascorbate transporter ...    254   4e-76    
ref|XP_012068203.1|  PREDICTED: putative nucleobase-ascorbate tra...    254   4e-76    
ref|XP_009375676.1|  PREDICTED: nucleobase-ascorbate transporter ...    254   4e-76    
ref|XP_009343913.1|  PREDICTED: nucleobase-ascorbate transporter ...    253   5e-76    
gb|AAC19401.1|  permease 1                                              253   5e-76    
ref|XP_006306250.1|  hypothetical protein CARUB_v10012085mg             253   6e-76    
ref|XP_006356853.1|  PREDICTED: putative nucleobase-ascorbate tra...    253   6e-76    
ref|XP_010541828.1|  PREDICTED: nucleobase-ascorbate transporter 4      253   7e-76    
ref|XP_004238558.1|  PREDICTED: putative nucleobase-ascorbate tra...    253   8e-76    
ref|XP_006830254.1|  PREDICTED: nucleobase-ascorbate transporter 2      253   8e-76    
ref|XP_008368759.1|  PREDICTED: nucleobase-ascorbate transporter ...    253   8e-76    
ref|XP_008368760.1|  PREDICTED: nucleobase-ascorbate transporter ...    253   8e-76    
ref|XP_004141407.2|  PREDICTED: putative nucleobase-ascorbate tra...    253   1e-75    
ref|XP_010461847.1|  PREDICTED: nucleobase-ascorbate transporter ...    252   2e-75    
emb|CDY59368.1|  BnaA08g29610D                                          252   2e-75    
ref|XP_006487062.1|  PREDICTED: nucleobase-ascorbate transporter ...    252   2e-75    
gb|KDO57923.1|  hypothetical protein CISIN_1g037190mg                   252   2e-75    
gb|KEH35829.1|  nucleobase-ascorbate transporter-like protein           252   3e-75    
ref|XP_012093212.1|  PREDICTED: nucleobase-ascorbate transporter ...    247   4e-75    
ref|XP_003559230.1|  PREDICTED: nucleobase-ascorbate transporter ...    238   1e-74    
ref|XP_010108039.1|  Putative nucleobase-ascorbate transporter 10       254   1e-74    
ref|NP_001050969.1|  Os03g0694500                                       249   1e-74    
ref|XP_006660533.1|  PREDICTED: nucleobase-ascorbate transporter ...    249   1e-74    
ref|XP_006422800.1|  hypothetical protein CICLE_v10030392mg             249   2e-74    
gb|KHG30570.1|  Nucleobase-ascorbate transporter 4 -like protein        251   2e-74    
ref|XP_009613909.1|  PREDICTED: putative nucleobase-ascorbate tra...    249   2e-74    
gb|AAO38499.1|  putative permease                                       249   2e-74    
emb|CBI19388.3|  unnamed protein product                                249   2e-74    
ref|XP_010924597.1|  PREDICTED: nucleobase-ascorbate transporter ...    249   3e-74    
emb|CDY03581.1|  BnaC03g68400D                                          249   3e-74    
ref|XP_010664921.1|  PREDICTED: nucleobase-ascorbate transporter ...    249   3e-74    
ref|XP_003555666.1|  PREDICTED: nucleobase-ascorbate transporter ...    248   4e-74    
ref|XP_004502044.1|  PREDICTED: nucleobase-ascorbate transporter ...    247   1e-73    
dbj|BAJ89924.1|  predicted protein                                      240   2e-73    
ref|XP_008793044.1|  PREDICTED: nucleobase-ascorbate transporter ...    247   2e-73    
gb|KFK35967.1|  hypothetical protein AALP_AA4G061100                    247   2e-73    
gb|KHN08001.1|  Nucleobase-ascorbate transporter 1                      243   2e-73    
ref|XP_002525330.1|  purine permease, putative                          246   2e-73    
gb|AES71659.2|  nucleobase-ascorbate transporter-like protein           246   2e-73    
ref|XP_006650432.1|  PREDICTED: LOW QUALITY PROTEIN: nucleobase-a...    246   2e-73    
ref|XP_007146103.1|  hypothetical protein PHAVU_006G012700g             246   3e-73    
ref|XP_004982109.1|  PREDICTED: nucleobase-ascorbate transporter ...    246   3e-73    
emb|CDP11315.1|  unnamed protein product                                246   3e-73    
ref|XP_003601408.1|  Nucleobase ascorbate transporter                   246   4e-73    
ref|XP_010246467.1|  PREDICTED: nucleobase-ascorbate transporter 2      246   4e-73    
ref|XP_009797567.1|  PREDICTED: putative nucleobase-ascorbate tra...    245   6e-73    
gb|KHN41326.1|  Nucleobase-ascorbate transporter 1                      245   6e-73    
tpg|DAA50781.1|  TPA: hypothetical protein ZEAMMB73_786519              242   7e-73    
ref|XP_010274460.1|  PREDICTED: nucleobase-ascorbate transporter ...    245   8e-73    
ref|XP_004293963.1|  PREDICTED: nucleobase-ascorbate transporter 2      245   9e-73    
ref|XP_009604594.1|  PREDICTED: nucleobase-ascorbate transporter ...    244   1e-72    
gb|KCW46946.1|  hypothetical protein EUGRSUZ_K00759                     241   1e-72    
ref|XP_010920318.1|  PREDICTED: nucleobase-ascorbate transporter ...    243   1e-72    
gb|KDO77883.1|  hypothetical protein CISIN_1g0098371mg                  238   1e-72    
ref|XP_012080636.1|  PREDICTED: nucleobase-ascorbate transporter 1      244   2e-72    
gb|KHG19290.1|  Nucleobase-ascorbate transporter 1 -like protein        236   2e-72    
ref|XP_003542318.1|  PREDICTED: nucleobase-ascorbate transporter ...    244   2e-72    
gb|ACF84027.1|  unknown                                                 244   2e-72    
ref|XP_010252545.1|  PREDICTED: nucleobase-ascorbate transporter 1      244   2e-72    
ref|XP_004233030.1|  PREDICTED: nucleobase-ascorbate transporter 2      244   3e-72    
ref|XP_009592403.1|  PREDICTED: nucleobase-ascorbate transporter 1      244   3e-72    
ref|XP_010928524.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   3e-72    
ref|XP_010686222.1|  PREDICTED: nucleobase-ascorbate transporter 2      243   3e-72    
ref|XP_010920310.1|  PREDICTED: nucleobase-ascorbate transporter ...    243   3e-72    
ref|XP_002522228.1|  purine permease, putative                          238   4e-72    
ref|XP_011467773.1|  PREDICTED: nucleobase-ascorbate transporter ...    242   4e-72    
ref|XP_009771645.1|  PREDICTED: nucleobase-ascorbate transporter 1      243   5e-72    
ref|XP_009410926.1|  PREDICTED: nucleobase-ascorbate transporter ...    243   6e-72    
gb|EAZ08590.1|  hypothetical protein OsI_30859                          243   6e-72    
ref|XP_004292763.1|  PREDICTED: putative nucleobase-ascorbate tra...    244   6e-72    
gb|KEH20676.1|  nucleobase-ascorbate transporter-like protein           239   6e-72    
ref|XP_011086376.1|  PREDICTED: nucleobase-ascorbate transporter 1      243   7e-72    
ref|XP_002320481.1|  xanthine/uracil permease family protein            243   7e-72    
ref|XP_008799349.1|  PREDICTED: nucleobase-ascorbate transporter ...    242   8e-72    
ref|XP_006469619.1|  PREDICTED: nucleobase-ascorbate transporter ...    241   8e-72    
dbj|BAG95840.1|  unnamed protein product                                239   9e-72    
ref|XP_004485911.1|  PREDICTED: nucleobase-ascorbate transporter ...    242   9e-72    
tpg|DAA50782.1|  TPA: nucleobase-ascorbate transporter LPE1             242   9e-72    
ref|NP_001105384.1|  nucleobase-ascorbate transporter LPE1              242   1e-71    
ref|XP_004304090.1|  PREDICTED: nucleobase-ascorbate transporter ...    242   1e-71    
ref|XP_007143131.1|  hypothetical protein PHAVU_007G046500g             242   1e-71    
ref|XP_010035524.1|  PREDICTED: nucleobase-ascorbate transporter 1      242   1e-71    
ref|NP_001044313.1|  Os01g0759900                                       239   1e-71    
ref|XP_007141637.1|  hypothetical protein PHAVU_008G212800g             241   1e-71    
gb|AFK48579.1|  unknown                                                 234   2e-71    
gb|KDO54300.1|  hypothetical protein CISIN_1g009755mg                   242   2e-71    
ref|XP_006358126.1|  PREDICTED: nucleobase-ascorbate transporter ...    241   2e-71    
ref|XP_003569860.1|  PREDICTED: nucleobase-ascorbate transporter ...    241   2e-71    
dbj|BAJ95647.1|  predicted protein                                      241   2e-71    
ref|XP_010110631.1|  Nucleobase-ascorbate transporter 1                 242   2e-71    
ref|XP_008230014.1|  PREDICTED: nucleobase-ascorbate transporter 1      241   2e-71    
ref|XP_006447639.1|  hypothetical protein CICLE_v10014919mg             241   2e-71    
ref|XP_007025347.1|  Xanthine/uracil permease family protein            241   2e-71    
ref|XP_006828104.1|  PREDICTED: nucleobase-ascorbate transporter ...    241   3e-71    
ref|XP_009394827.1|  PREDICTED: nucleobase-ascorbate transporter ...    241   3e-71    
gb|KCW76101.1|  hypothetical protein EUGRSUZ_D00480                     238   3e-71    
gb|KHN38486.1|  Nucleobase-ascorbate transporter 1                      241   3e-71    
ref|XP_007141636.1|  hypothetical protein PHAVU_008G212800g             241   3e-71    
ref|XP_002456385.1|  hypothetical protein SORBIDRAFT_03g035190          241   3e-71    
gb|KJB57393.1|  hypothetical protein B456_009G161500                    239   3e-71    
ref|XP_008337251.1|  PREDICTED: putative nucleobase-ascorbate tra...    242   3e-71    
gb|EYU28101.1|  hypothetical protein MIMGU_mgv1a004500mg                241   3e-71    
ref|XP_011101410.1|  PREDICTED: nucleobase-ascorbate transporter 2      241   3e-71    
gb|EEC71519.1|  hypothetical protein OsI_03815                          240   3e-71    
gb|KEH36620.1|  nucleobase-ascorbate transporter-like protein           241   3e-71    
gb|ACG43417.1|  permease                                                241   4e-71    
ref|XP_003519453.2|  PREDICTED: nucleobase-ascorbate transporter ...    241   4e-71    
ref|XP_008667761.1|  PREDICTED: uncharacterized protein LOC100279...    241   4e-71    
ref|XP_002274603.1|  PREDICTED: nucleobase-ascorbate transporter ...    240   4e-71    
ref|XP_010089683.1|  Nucleobase-ascorbate transporter 2                 241   4e-71    
ref|XP_008456412.1|  PREDICTED: nucleobase-ascorbate transporter ...    240   5e-71    
ref|XP_011047203.1|  PREDICTED: nucleobase-ascorbate transporter 1      240   5e-71    
ref|XP_009799751.1|  PREDICTED: nucleobase-ascorbate transporter 2      240   5e-71    
ref|XP_010091023.1|  Nucleobase-ascorbate transporter 4                 248   6e-71    
gb|AFW85019.1|  hypothetical protein ZEAMMB73_943324                    236   6e-71    
ref|XP_004149274.1|  PREDICTED: nucleobase-ascorbate transporter 1      240   6e-71    
ref|XP_009604294.1|  PREDICTED: nucleobase-ascorbate transporter 2      240   7e-71    
ref|XP_003629785.1|  Nucleobase ascorbate transporter                   240   7e-71    
gb|KHM99089.1|  Nucleobase-ascorbate transporter 1                      239   7e-71    
ref|XP_003561025.1|  PREDICTED: nucleobase-ascorbate transporter ...    240   8e-71    
ref|XP_008789343.1|  PREDICTED: nucleobase-ascorbate transporter ...    240   8e-71    
ref|XP_009365106.1|  PREDICTED: nucleobase-ascorbate transporter 1      239   8e-71    
ref|NP_001061653.1|  Os08g0369000                                       234   1e-70    
ref|XP_008220535.1|  PREDICTED: putative nucleobase-ascorbate tra...    243   1e-70    
dbj|BAB61205.1|  putative permease 1                                    239   1e-70    
ref|XP_003577983.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   1e-70    
gb|EYU43133.1|  hypothetical protein MIMGU_mgv1a004837mg                239   1e-70    
gb|KJB57395.1|  hypothetical protein B456_009G161500                    239   1e-70    
ref|XP_010424560.1|  PREDICTED: nucleobase-ascorbate transporter ...    236   1e-70    
gb|KHG19625.1|  Nucleobase-ascorbate transporter 2 -like protein        239   1e-70    
ref|XP_006595825.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   1e-70    
ref|XP_010469386.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   1e-70    
ref|XP_006644739.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   1e-70    
ref|XP_006357961.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   1e-70    
ref|XP_010657232.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   2e-70    
ref|XP_010413769.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   2e-70    
ref|XP_004970033.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   2e-70    
ref|XP_006595824.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   2e-70    
ref|XP_002320684.2|  xanthine/uracil permease family protein            240   2e-70    
emb|CDY52234.1|  BnaC04g54110D                                          239   2e-70    
ref|XP_009143796.1|  PREDICTED: nucleobase-ascorbate transporter 2      239   2e-70    
ref|XP_010052181.1|  PREDICTED: nucleobase-ascorbate transporter 2      239   2e-70    
ref|XP_008225311.1|  PREDICTED: nucleobase-ascorbate transporter 2      238   2e-70    
ref|XP_004243518.1|  PREDICTED: nucleobase-ascorbate transporter 1      238   2e-70    
ref|XP_010999881.1|  PREDICTED: putative nucleobase-ascorbate tra...    239   2e-70    
ref|XP_006467632.1|  PREDICTED: nucleobase-ascorbate transporter ...    238   3e-70    
ref|XP_007159460.1|  hypothetical protein PHAVU_002G239500g             238   3e-70    
emb|CDM83756.1|  unnamed protein product                                238   3e-70    
ref|XP_008379668.1|  PREDICTED: nucleobase-ascorbate transporter 1      238   3e-70    
ref|XP_003526259.1|  PREDICTED: nucleobase-ascorbate transporter ...    238   3e-70    
dbj|BAJ96861.1|  predicted protein                                      238   3e-70    
gb|KHN48003.1|  Nucleobase-ascorbate transporter 2                      238   3e-70    
ref|XP_003545573.2|  PREDICTED: nucleobase-ascorbate transporter ...    239   3e-70    
ref|XP_011039417.1|  PREDICTED: nucleobase-ascorbate transporter ...    238   3e-70    
ref|XP_010655537.1|  PREDICTED: nucleobase-ascorbate transporter ...    238   3e-70    
emb|CDO96816.1|  unnamed protein product                                238   4e-70    
gb|KHN07045.1|  Nucleobase-ascorbate transporter 2                      238   4e-70    
ref|XP_012091799.1|  PREDICTED: nucleobase-ascorbate transporter 2      238   4e-70    
ref|XP_010509786.1|  PREDICTED: nucleobase-ascorbate transporter 2      238   5e-70    
gb|EMS56362.1|  Nucleobase-ascorbate transporter 2                      238   5e-70    
ref|XP_010490176.1|  PREDICTED: nucleobase-ascorbate transporter ...    237   5e-70    
ref|XP_006294014.1|  hypothetical protein CARUB_v10023002mg             238   5e-70    
ref|XP_009395859.1|  PREDICTED: nucleobase-ascorbate transporter ...    238   5e-70    
ref|XP_002265912.2|  PREDICTED: nucleobase-ascorbate transporter ...    238   5e-70    
ref|XP_007211779.1|  hypothetical protein PRUPE_ppa004190mg             238   6e-70    
emb|CAN66345.1|  hypothetical protein VITISV_040228                     238   6e-70    
emb|CDY18053.1|  BnaC07g04170D                                          237   6e-70    
gb|KHN29605.1|  Nucleobase-ascorbate transporter 2                      237   6e-70    
gb|AAT64019.1|  putative permease                                       237   7e-70    
ref|XP_010999757.1|  PREDICTED: nucleobase-ascorbate transporter 2      237   7e-70    
gb|KJB42851.1|  hypothetical protein B456_007G170500                    236   8e-70    
ref|XP_002305737.1|  xanthine/uracil permease family protein            237   8e-70    
ref|XP_006595823.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   8e-70    
ref|XP_006449522.1|  hypothetical protein CICLE_v10014896mg             237   8e-70    
ref|XP_010467086.1|  PREDICTED: nucleobase-ascorbate transporter 1      237   8e-70    
gb|ACD56652.1|  putative permease                                       237   9e-70    
ref|NP_001152037.1|  solute carrier family 23 member 2                  237   1e-69    
gb|ACD56666.1|  putative permease                                       236   1e-69    
ref|XP_002883707.1|  xanthine/uracil permease family protein            236   1e-69    
ref|NP_178636.1|  nucleobase-ascorbate transporter 1                    236   1e-69    
ref|XP_004956567.1|  PREDICTED: nucleobase-ascorbate transporter ...    236   1e-69    
ref|XP_008360971.1|  PREDICTED: putative nucleobase-ascorbate tra...    237   1e-69    
ref|XP_010533013.1|  PREDICTED: nucleobase-ascorbate transporter 1      236   2e-69    
ref|XP_007136977.1|  hypothetical protein PHAVU_009G089800g             236   2e-69    
gb|KJB69714.1|  hypothetical protein B456_011G038600                    236   2e-69    
gb|KJB42850.1|  hypothetical protein B456_007G170500                    236   2e-69    
gb|KFK39879.1|  hypothetical protein AALP_AA3G300500                    236   2e-69    
ref|XP_003527738.1|  PREDICTED: putative nucleobase-ascorbate tra...    236   2e-69    
gb|KJB08649.1|  hypothetical protein B456_001G095500                    236   2e-69    
gb|KHN45138.1|  Putative nucleobase-ascorbate transporter 10            237   2e-69    
ref|XP_010691485.1|  PREDICTED: nucleobase-ascorbate transporter ...    234   2e-69    
gb|KHN17163.1|  Putative nucleobase-ascorbate transporter 10            236   2e-69    
ref|XP_010943259.1|  PREDICTED: nucleobase-ascorbate transporter 1      236   2e-69    
ref|XP_006396141.1|  hypothetical protein EUTSA_v10002485mg             236   2e-69    
gb|KHG23953.1|  Nucleobase-ascorbate transporter 2 -like protein        236   2e-69    
gb|AAT64034.1|  putative permease                                       236   2e-69    
ref|XP_006469618.1|  PREDICTED: nucleobase-ascorbate transporter ...    236   2e-69    
gb|AAK59632.1|  putative membrane transporter protein                   236   2e-69    
ref|XP_008443418.1|  PREDICTED: nucleobase-ascorbate transporter 2      236   2e-69    



>ref|XP_011087158.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
 ref|XP_011087159.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
 ref|XP_011087161.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
 ref|XP_011087162.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
Length=531

 Score =   362 bits (928),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFM+FFS+LGKFGAVFASIPAPIVAALYCLF
Sbjct  342  GNGSSVSIENAGLLALTRVGSRRVVQISAGFMLFFSVLGKFGAVFASIPAPIVAALYCLF  401

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGA GVS LQFCNLNSFR KFILGFSIFLGLS+PQYFNEY AIN YGPVHT GRWFN
Sbjct  402  FAYVGAAGVSFLQFCNLNSFRTKFILGFSIFLGLSVPQYFNEYTAINGYGPVHTSGRWFN  461

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DI+NVPFSS+AFVAGI+AYFLD TMHKK++Q+RKDRGKHWWDKFRSFKTDTRSEEFYSLP
Sbjct  462  DIINVPFSSEAFVAGILAYFLDNTMHKKDSQIRKDRGKHWWDKFRSFKTDTRSEEFYSLP  521

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  522  FNLNKYFPSV  531



>gb|AAL76261.1|AF466824_1 putative permease 1 [Arabidopsis thaliana]
Length=216

 Score =   346 bits (887),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  27   GAGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  86

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  87   FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  146

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  147  DMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  206

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  207  FNLNKYFPSV  216



>ref|XP_004508844.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Cicer arietinum]
Length=531

 Score =   356 bits (914),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PIVAALYCLF
Sbjct  342  GIGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIVAALYCLF  401

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+GG+S LQFCNLNSFR KF+LGFSIFLGLSIPQYFNEY +IN +GPVHTG RWFN
Sbjct  402  FAYVGSGGLSFLQFCNLNSFRTKFVLGFSIFLGLSIPQYFNEYTSINGFGPVHTGARWFN  461

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNVPF SKAFVAG+VAYFLD T+HKKE+ +RKDRGKHWWDK+RSFKTDTRSEEFYSLP
Sbjct  462  DIVNVPFQSKAFVAGVVAYFLDNTLHKKESSIRKDRGKHWWDKYRSFKTDTRSEEFYSLP  521

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  522  FNLNKYFPSV  531



>gb|KEH31855.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=380

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLA TRVGSRRVVQIS GFMIFFS+LGKFGAVFASIP PIVAALYCLF
Sbjct  191  GIGSSVSVENAGLLAFTRVGSRRVVQISPGFMIFFSMLGKFGAVFASIPPPIVAALYCLF  250

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+GG+S LQFCNLNSFR KF+LGFSIFLGLSIPQYFNEY AIN +GPVHTG RWFN
Sbjct  251  FAYVGSGGLSFLQFCNLNSFRTKFVLGFSIFLGLSIPQYFNEYTAINGFGPVHTGARWFN  310

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNVPF SKAFVAG+VAYFLD T+HKKE+ +RKDRGKHWWDK+RSFKTDTRSEEFYSLP
Sbjct  311  DIVNVPFQSKAFVAGVVAYFLDNTLHKKESAIRKDRGKHWWDKYRSFKTDTRSEEFYSLP  370

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  371  FNLNKYFPSV  380



>gb|KEH31856.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=483

 Score =   352 bits (904),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLA TRVGSRRVVQIS GFMIFFS+LGKFGAVFASIP PIVAALYCLF
Sbjct  294  GIGSSVSVENAGLLAFTRVGSRRVVQISPGFMIFFSMLGKFGAVFASIPPPIVAALYCLF  353

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+GG+S LQFCNLNSFR KF+LGFSIFLGLSIPQYFNEY AIN +GPVHTG RWFN
Sbjct  354  FAYVGSGGLSFLQFCNLNSFRTKFVLGFSIFLGLSIPQYFNEYTAINGFGPVHTGARWFN  413

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNVPF SKAFVAG+VAYFLD T+HKKE+ +RKDRGKHWWDK+RSFKTDTRSEEFYSLP
Sbjct  414  DIVNVPFQSKAFVAGVVAYFLDNTLHKKESAIRKDRGKHWWDKYRSFKTDTRSEEFYSLP  473

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  474  FNLNKYFPSV  483



>emb|CDX84363.1| BnaC03g51370D [Brassica napus]
Length=532

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  343  GAGSSVSIENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTGGRWFN
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGGRWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG+VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGMVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>gb|AAK59508.2| putative permease 1 [Arabidopsis thaliana]
Length=360

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  171  GAGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  230

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  231  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  290

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  291  DMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  350

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  351  FNLNKYFPSV  360



>gb|KJB19548.1| hypothetical protein B456_003G109900 [Gossypium raimondii]
Length=399

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLFF 
Sbjct  212  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLFFA  271

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY AIN YGPVHTG RWFNDI
Sbjct  272  YVGAGGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTAINGYGPVHTGARWFNDI  331

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVP SS+AFVAG +AYFLD T+H+K++ +RKDRGKHWWDKFRSFK D+RSEEFYSLPFN
Sbjct  332  VNVPLSSEAFVAGCLAYFLDNTLHRKDSAIRKDRGKHWWDKFRSFKGDSRSEEFYSLPFN  391

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  392  LNKYFPSV  399



>ref|XP_003608951.1| Nucleobase ascorbate transporter [Medicago truncatula]
 gb|AES91148.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=532

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLA TRVGSRRVVQIS GFMIFFS+LGKFGAVFASIP PIVAALYCLF
Sbjct  343  GIGSSVSVENAGLLAFTRVGSRRVVQISPGFMIFFSMLGKFGAVFASIPPPIVAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+GG+S LQFCNLNSFR KF+LGFSIFLGLSIPQYFNEY AIN +GPVHTG RWFN
Sbjct  403  FAYVGSGGLSFLQFCNLNSFRTKFVLGFSIFLGLSIPQYFNEYTAINGFGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNVPF SKAFVAG+VAYFLD T+HKKE+ +RKDRGKHWWDK+RSFKTDTRSEEFYSLP
Sbjct  463  DIVNVPFQSKAFVAGVVAYFLDNTLHKKESAIRKDRGKHWWDKYRSFKTDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_009112041.1| PREDICTED: nucleobase-ascorbate transporter 6 [Brassica rapa]
 ref|XP_009112042.1| PREDICTED: nucleobase-ascorbate transporter 6 [Brassica rapa]
 emb|CDY16755.1| BnaA09g06270D [Brassica napus]
Length=532

 Score =   352 bits (903),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  343  GAGSSVSIENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG+VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGVVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>gb|KJB53228.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=399

 Score =   347 bits (891),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+A LYCLFF 
Sbjct  212  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAGLYCLFFA  271

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY AIN YGPVHTG RWFNDI
Sbjct  272  YVGAGGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTAINGYGPVHTGARWFNDI  331

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+AFVAG +AYFLD T+H+K++ +RKDRGKHWWDKFRSFK D+RSEEFYSLPFN
Sbjct  332  VNVPFSSEAFVAGCLAYFLDNTLHRKDSGIRKDRGKHWWDKFRSFKGDSRSEEFYSLPFN  391

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  392  LNKYFPSV  399



>ref|XP_002511446.1| purine permease, putative [Ricinus communis]
 gb|EEF52048.1| purine permease, putative [Ricinus communis]
Length=531

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
             SSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLFF 
Sbjct  344  ASSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG GG+S LQFCNLNSFR KFILGFSIFLGLSIPQYFNEY AIN YGPVHTGGRWFNDI
Sbjct  404  YVGVGGLSFLQFCNLNSFRTKFILGFSIFLGLSIPQYFNEYTAINGYGPVHTGGRWFNDI  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+AFVAG VAYFLD T+H+K++ +RKDRGKHWWDKFRSFK D RSEEFYSLPFN
Sbjct  464  VNVPFSSEAFVAGCVAYFLDNTLHRKDSSIRKDRGKHWWDKFRSFKGDIRSEEFYSLPFN  523

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  524  LNKYFPSV  531



>ref|XP_009608483.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009608484.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009608485.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009608486.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Nicotiana 
tomentosiformis]
Length=532

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIV ALYCLF
Sbjct  343  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVGALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+  LQFCNLNSFR KFILGFS+FLGLS+PQYFNEY A+  YGPVHT  RWFN
Sbjct  403  FAYVGAGGLGFLQFCNLNSFRTKFILGFSVFLGLSVPQYFNEYTAVAGYGPVHTHARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPF SKAFVAG+VAYFLD TMHKK+ Q RKDRGKHWWDKF+SFKTDTRSEEFYSLP
Sbjct  463  DMVNVPFQSKAFVAGVVAYFLDNTMHKKDGQTRKDRGKHWWDKFKSFKTDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_010550666.1| PREDICTED: nucleobase-ascorbate transporter 6 [Tarenaya hassleriana]
Length=532

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIP PI+AALYCLF
Sbjct  343  GAGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPGPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGGVS LQFCNLNSFR KFILGFSIFLGLSIPQYFNEY AIN YGPVHTG RWF+
Sbjct  403  FAYVGAGGVSFLQFCNLNSFRTKFILGFSIFLGLSIPQYFNEYTAINGYGPVHTGARWFD  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD+T+HKK+  VRKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGCVAFFLDSTLHKKDGSVRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>emb|CDY30739.1| BnaA02g33610D [Brassica napus]
Length=504

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  315  GAGSSVSIENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  374

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  375  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  434

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSF+ DTRSEEFYSLP
Sbjct  435  DMVNVPFSSEPFVAGAVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFRGDTRSEEFYSLP  494

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  495  FNLNKYFPSV  504



>ref|XP_010519558.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Tarenaya 
hassleriana]
 ref|XP_010519559.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Tarenaya 
hassleriana]
Length=532

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIP PI+AALYCLF
Sbjct  343  GAGASVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPGPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGGVS LQFCNLNSFR KFILGFSIFLGLSIPQYFNEY AIN YGPVHTG RWFN
Sbjct  403  FAYVGAGGVSFLQFCNLNSFRTKFILGFSIFLGLSIPQYFNEYTAINGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK+  +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGCVAFFLDNTLHKKDGSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>gb|AIS71908.1| nucleobase-ascorbate transporter 6-like isoform 1 [Nicotiana 
tabacum]
Length=532

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIV ALYC+F
Sbjct  343  GNGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVGALYCIF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S LQFCNLNSFR KFILGFSIFLGLS+PQYFNEY  I  YGPVHT GRWFN
Sbjct  403  FAYVGVGGLSFLQFCNLNSFRTKFILGFSIFLGLSVPQYFNEYTVIAGYGPVHTSGRWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGI+AYFLD TMHKK++QVRKDRGK WWDKF+SFKTDTRSEEFYSLP
Sbjct  463  DMVNVPFSSEAFVAGILAYFLDNTMHKKDSQVRKDRGKPWWDKFKSFKTDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_009151410.1| PREDICTED: nucleobase-ascorbate transporter 6 [Brassica rapa]
 emb|CDY00333.1| BnaA06g22340D [Brassica napus]
Length=532

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIP PI+AALYCLF
Sbjct  343  GAGSSVSIENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPGPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTGGRWF+
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGGRWFD  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG+VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGMVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_012092049.1| PREDICTED: nucleobase-ascorbate transporter 7 [Jatropha curcas]
 gb|KDP21309.1| hypothetical protein JCGZ_21780 [Jatropha curcas]
Length=536

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G+GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  347  GSGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  406

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFS+F+GLSIPQYFNEY AIN YGPVHTG RWFN
Sbjct  407  FAYVGSAGLSFLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAINGYGPVHTGARWFN  466

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAG++A+FLDTT+H K+N  +KDRG HWWDKFRSFKTDTRSEEFYSLP
Sbjct  467  DMINVPFSSEAFVAGLLAFFLDTTLHHKDNTTKKDRGMHWWDKFRSFKTDTRSEEFYSLP  526

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  527  FNLNKFFPSV  536



>emb|CDY56736.1| BnaC09g50870D [Brassica napus]
Length=532

 Score =   350 bits (898),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  343  GAGSSVSIENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG+VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGVVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPS  370
            FNLNKYFPS
Sbjct  523  FNLNKYFPS  531



>gb|KHG14639.1| Nucleobase-ascorbate transporter 6 -like protein [Gossypium arboreum]
Length=525

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLFF 
Sbjct  338  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLFFA  397

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY AIN YGPVHTG RWFNDI
Sbjct  398  YVGAGGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTAINGYGPVHTGARWFNDI  457

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+AFVAG +AYFLD T+H+K++ +RKDRGKHWWDKFRSFK D+RSEEFYSLPFN
Sbjct  458  VNVPFSSEAFVAGCLAYFLDNTLHRKDSGIRKDRGKHWWDKFRSFKGDSRSEEFYSLPFN  517

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  518  LNKYFPSV  525



>gb|KJB53223.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=483

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+A LYCLFF 
Sbjct  296  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAGLYCLFFA  355

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY AIN YGPVHTG RWFNDI
Sbjct  356  YVGAGGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTAINGYGPVHTGARWFNDI  415

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+AFVAG +AYFLD T+H+K++ +RKDRGKHWWDKFRSFK D+RSEEFYSLPFN
Sbjct  416  VNVPFSSEAFVAGCLAYFLDNTLHRKDSGIRKDRGKHWWDKFRSFKGDSRSEEFYSLPFN  475

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  476  LNKYFPSV  483



>ref|XP_006394340.1| hypothetical protein EUTSA_v10003977mg [Eutrema salsugineum]
 gb|ESQ31626.1| hypothetical protein EUTSA_v10003977mg [Eutrema salsugineum]
Length=532

 Score =   350 bits (897),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  343  GAGSSVSIENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_009803945.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
sylvestris]
 ref|XP_009803946.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
sylvestris]
Length=532

 Score =   350 bits (897),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIV ALYCLF
Sbjct  343  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVGALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+  LQFCNLN FR KFILGFS+FLGLSIPQYFNEY A+  YGPVHT  RWFN
Sbjct  403  FAYVGAGGLGFLQFCNLNIFRTKFILGFSVFLGLSIPQYFNEYTAVAGYGPVHTHARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPF SKAFVAG+VAYFLD TMHKK+ Q RKDRGKHWWDKF+SFKTDTRSEEFYSLP
Sbjct  463  DMVNVPFQSKAFVAGVVAYFLDNTMHKKDGQTRKDRGKHWWDKFKSFKTDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_009608481.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X1 [Nicotiana 
tomentosiformis]
Length=590

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIV ALYCLF
Sbjct  401  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVGALYCLF  460

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+  LQFCNLNSFR KFILGFS+FLGLS+PQYFNEY A+  YGPVHT  RWFN
Sbjct  461  FAYVGAGGLGFLQFCNLNSFRTKFILGFSVFLGLSVPQYFNEYTAVAGYGPVHTHARWFN  520

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPF SKAFVAG+VAYFLD TMHKK+ Q RKDRGKHWWDKF+SFKTDTRSEEFYSLP
Sbjct  521  DMVNVPFQSKAFVAGVVAYFLDNTMHKKDGQTRKDRGKHWWDKFKSFKTDTRSEEFYSLP  580

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  581  FNLNKYFPSV  590



>emb|CDY45747.1| BnaC02g42350D [Brassica napus]
Length=515

 Score =   349 bits (895),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFAS+PAPI+AALYCLF
Sbjct  326  GAGSSVSIENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASVPAPIIAALYCLF  385

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  386  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  445

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSF+ DTRSEEFYSLP
Sbjct  446  DMVNVPFSSEPFVAGAVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFRGDTRSEEFYSLP  505

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  506  FNLNKYFPSV  515



>gb|ABK93255.1| unknown [Populus trichocarpa]
Length=324

 Score =   342 bits (878),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGA+FASIP PI A+LYCLFF
Sbjct  136  TGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAIFASIPGPIFASLYCLFF  195

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVGA G+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AI  YGPVHTGGRWFND
Sbjct  196  AYVGAAGLSFLQFCNLNSFRTKFILGFSIFMGLSVPQYFNEYTAIKGYGPVHTGGRWFND  255

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            IVNVPFSS+AFVAG +AYFLD T+H+ ++ +RKDRGKHWWDKFRS+K DTRSEEFYSLPF
Sbjct  256  IVNVPFSSEAFVAGCLAYFLDNTLHRNDSSIRKDRGKHWWDKFRSYKGDTRSEEFYSLPF  315

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  316  NLNKYFPSV  324



>gb|KEH35060.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=532

 Score =   349 bits (896),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            +GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP  I+AALYCLFF
Sbjct  344  SGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPAIIAALYCLFF  403

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVGAGG+S LQFCNLNSFR KFILGFSIFLGLS+PQYFNEY AIN YGPVHTGGRWFND
Sbjct  404  AYVGAGGLSFLQFCNLNSFRTKFILGFSIFLGLSVPQYFNEYTAINGYGPVHTGGRWFND  463

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            +VNVPF SKAFVAG+VAYFLD T+HK+++ +RKDRGKHWWDK++SFK DTRSEEFYSLPF
Sbjct  464  MVNVPFQSKAFVAGVVAYFLDNTLHKRDSSIRKDRGKHWWDKYKSFKGDTRSEEFYSLPF  523

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  524  NLNKYFPSV  532



>ref|XP_009130240.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brassica 
rapa]
Length=532

 Score =   349 bits (896),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  343  GAGSSVSIENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSF+ DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGAVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFRGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_010459419.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X1 [Camelina 
sativa]
 ref|XP_010459427.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Camelina 
sativa]
 ref|XP_010484002.1| PREDICTED: nucleobase-ascorbate transporter 6 [Camelina sativa]
Length=532

 Score =   349 bits (896),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  343  GAGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_006280290.1| hypothetical protein CARUB_v10026214mg [Capsella rubella]
 gb|EOA13188.1| hypothetical protein CARUB_v10026214mg [Capsella rubella]
Length=532

 Score =   349 bits (896),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  343  GAGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|NP_201094.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 ref|NP_851251.2| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 ref|NP_001032127.2| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 sp|Q27GI3.2|NAT6_ARATH RecName: Full=Nucleobase-ascorbate transporter 6; Short=AtNAT6 
[Arabidopsis thaliana]
 gb|AAM47573.1|AF466198_1 putative permease 1 [Arabidopsis thaliana]
 dbj|BAB10858.1| permease 1 [Arabidopsis thaliana]
 gb|AED97668.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 gb|AED97669.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 gb|AED97670.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
Length=532

 Score =   349 bits (896),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  343  GAGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_009782990.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nicotiana sylvestris]
 ref|XP_009782991.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nicotiana sylvestris]
 ref|XP_009782992.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nicotiana sylvestris]
Length=525

 Score =   349 bits (895),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIV ALYC+F
Sbjct  336  GNGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVGALYCIF  395

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S LQFCNLNSFR KFILGFSIFLGLS+PQYFNEY  I  YGPVHT GRWFN
Sbjct  396  FAYVGVGGLSFLQFCNLNSFRTKFILGFSIFLGLSVPQYFNEYTVIAGYGPVHTSGRWFN  455

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGI+AYFLD T+HKK++QVRKDRGK WWDKF+SFKTDTRSEEFYSLP
Sbjct  456  DMVNVPFSSEAFVAGILAYFLDNTLHKKDSQVRKDRGKPWWDKFKSFKTDTRSEEFYSLP  515

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  516  FNLNKYFPSV  525



>ref|XP_008393061.1| PREDICTED: nucleobase-ascorbate transporter 6 [Malus domestica]
 ref|XP_008393062.1| PREDICTED: nucleobase-ascorbate transporter 6 [Malus domestica]
Length=533

 Score =   349 bits (895),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLFF
Sbjct  345  TGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAALYCLFF  404

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVGAGG+S LQFCNLNSFR KFILGFSIFLGLSIPQYFNEY AIN YGPVHTGGRWFND
Sbjct  405  AYVGAGGLSFLQFCNLNSFRTKFILGFSIFLGLSIPQYFNEYTAINGYGPVHTGGRWFND  464

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            ++NVP  S+AFVAG VAYFLD T+H+K++ VRKDRGKHWWDKFR FK D+RSEEFYSLPF
Sbjct  465  MINVPLQSEAFVAGCVAYFLDNTLHRKDSSVRKDRGKHWWDKFRYFKGDSRSEEFYSLPF  524

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  525  NLNKYFPSV  533



>ref|XP_009610581.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Nicotiana tomentosiformis]
Length=482

 Score =   347 bits (890),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPA IV ALYC+F
Sbjct  293  GNGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPASIVGALYCIF  352

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S LQFCNLNSFR KFILGFSIFLGLS+PQYFNEY  I  YGPVHT GRWFN
Sbjct  353  FAYVGVGGLSFLQFCNLNSFRTKFILGFSIFLGLSVPQYFNEYTVIAGYGPVHTSGRWFN  412

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGI+AYFLD TMHKK++QVRKDRGK WWDKF+SFKTDTRSEEFYSLP
Sbjct  413  DMVNVPFSSEAFVAGILAYFLDNTMHKKDSQVRKDRGKPWWDKFKSFKTDTRSEEFYSLP  472

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  473  FNLNKYFPSV  482



>gb|KJB19546.1| hypothetical protein B456_003G109900 [Gossypium raimondii]
 gb|KJB19547.1| hypothetical protein B456_003G109900 [Gossypium raimondii]
 gb|KJB19552.1| hypothetical protein B456_003G109900 [Gossypium raimondii]
Length=531

 Score =   348 bits (894),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLFF 
Sbjct  344  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY AIN YGPVHTG RWFNDI
Sbjct  404  YVGAGGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTAINGYGPVHTGARWFNDI  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVP SS+AFVAG +AYFLD T+H+K++ +RKDRGKHWWDKFRSFK D+RSEEFYSLPFN
Sbjct  464  VNVPLSSEAFVAGCLAYFLDNTLHRKDSAIRKDRGKHWWDKFRSFKGDSRSEEFYSLPFN  523

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  524  LNKYFPSV  531



>ref|XP_008453115.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis melo]
 ref|XP_008453116.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis melo]
 ref|XP_008453117.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis melo]
 ref|XP_008453119.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis melo]
Length=530

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF 
Sbjct  343  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG GG+S LQFCNLNSFR KF+LGFSIFLGLSIPQYFNEY AIN +GPVHT  RWFND+
Sbjct  403  YVGMGGLSYLQFCNLNSFRTKFVLGFSIFLGLSIPQYFNEYTAINGFGPVHTRARWFNDM  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+ FVAGIVAYFLD TMHKK+  +RKDRGKHWWDKFRSFK DTRSEEFYSLPFN
Sbjct  463  VNVPFSSEPFVAGIVAYFLDNTMHKKDGAIRKDRGKHWWDKFRSFKGDTRSEEFYSLPFN  522

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  523  LNKYFPSV  530



>gb|KJB53217.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
 gb|KJB53218.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
 gb|KJB53219.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
 gb|KJB53221.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=525

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+A LYCLFF 
Sbjct  338  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAGLYCLFFA  397

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY AIN YGPVHTG RWFNDI
Sbjct  398  YVGAGGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTAINGYGPVHTGARWFNDI  457

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+AFVAG +AYFLD T+H+K++ +RKDRGKHWWDKFRSFK D+RSEEFYSLPFN
Sbjct  458  VNVPFSSEAFVAGCLAYFLDNTLHRKDSGIRKDRGKHWWDKFRSFKGDSRSEEFYSLPFN  517

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  518  LNKYFPSV  525



>gb|KHG22799.1| Nucleobase-ascorbate transporter 6 -like protein [Gossypium arboreum]
Length=535

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLFF 
Sbjct  348  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLFFA  407

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY AIN YGPVHTG RWFNDI
Sbjct  408  YVGAGGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTAINGYGPVHTGARWFNDI  467

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVP SS+AFVAG +AYFLD T+H+K++ +RKDRGKHWWDKFR+FK D+RSEEFYSLPFN
Sbjct  468  VNVPLSSEAFVAGCLAYFLDNTLHRKDSAIRKDRGKHWWDKFRTFKGDSRSEEFYSLPFN  527

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  528  LNKYFPSV  535



>ref|XP_007036127.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007036128.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007036129.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20628.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20629.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20630.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
Length=530

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLFF 
Sbjct  343  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY A+N YGPVHTG RWFNDI
Sbjct  403  YVGAGGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTALNGYGPVHTGARWFNDI  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVP SS+AFVAG +AYFLD T+H+K++ +RKDRGKHWWDKFRSFK D+RSEEFYSLPFN
Sbjct  463  VNVPLSSEAFVAGCLAYFLDNTLHRKDSSIRKDRGKHWWDKFRSFKGDSRSEEFYSLPFN  522

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  523  LNKYFPSV  530



>ref|XP_002864824.1| hypothetical protein ARALYDRAFT_496474 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41083.1| hypothetical protein ARALYDRAFT_496474 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  343  GAGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILG S+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFILGLSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_004501951.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Cicer arietinum]
 ref|XP_004501952.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Cicer arietinum]
Length=532

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            +GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP  IVAALYC+FF
Sbjct  344  SGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPAIVAALYCVFF  403

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVGAGG+S LQFCNLNSFR KFILGFSIFLGLSIPQYFNEY AIN +GPVHTGGRWFND
Sbjct  404  AYVGAGGLSFLQFCNLNSFRTKFILGFSIFLGLSIPQYFNEYTAINGFGPVHTGGRWFND  463

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            I+NVPF SKAFVAG+VA+FLD T+HKK++ +RKDRGKHWWDK++SFK DTRSEEFYSLPF
Sbjct  464  IINVPFQSKAFVAGVVAFFLDNTLHKKDSSIRKDRGKHWWDKYKSFKGDTRSEEFYSLPF  523

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  524  NLNKYFPSV  532



>ref|XP_006438462.1| hypothetical protein CICLE_v10031192mg [Citrus clementina]
 ref|XP_006483790.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Citrus sinensis]
 ref|XP_006483791.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Citrus sinensis]
 ref|XP_006483792.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X3 
[Citrus sinensis]
 gb|ESR51702.1| hypothetical protein CICLE_v10031192mg [Citrus clementina]
 gb|KDO82572.1| hypothetical protein CISIN_1g009393mg [Citrus sinensis]
Length=535

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  346  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  405

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFS F+GLSIPQYFNEY A+N YGPVHTG RWFN
Sbjct  406  FAYVGAGGLSFLQFCNLNSFRTKFILGFSFFMGLSIPQYFNEYTAVNGYGPVHTGARWFN  465

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG++AY LD T+HKK+N  RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  466  DMINVPFSSEPFVAGLLAYVLDVTLHKKDNATRKDRGMHWWDRFRSFKTDTRSEEFYSLP  525

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  526  FNLNKFFPSV  535



>ref|XP_007155396.1| hypothetical protein PHAVU_003G197800g [Phaseolus vulgaris]
 gb|ESW27390.1| hypothetical protein PHAVU_003G197800g [Phaseolus vulgaris]
Length=533

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PIVAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KF+LGFSIF+GLS+ QYFNEY AIN YGPVHT  RWFN
Sbjct  404  FAYVGAGGLSFLQFCNLNSFRTKFVLGFSIFIGLSVSQYFNEYTAINGYGPVHTKARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DI+NVPF SKAFVAG +AYFLD T+HKK+  +RKDRGKHWWDK+RSFKTDTRSEEFYSLP
Sbjct  464  DIINVPFQSKAFVAGCMAYFLDNTIHKKDGAIRKDRGKHWWDKYRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  524  FNLNKYFPSV  533



>ref|XP_011028608.1| PREDICTED: nucleobase-ascorbate transporter 6 [Populus euphratica]
 ref|XP_011028609.1| PREDICTED: nucleobase-ascorbate transporter 6 [Populus euphratica]
 ref|XP_011028611.1| PREDICTED: nucleobase-ascorbate transporter 6 [Populus euphratica]
 ref|XP_011028612.1| PREDICTED: nucleobase-ascorbate transporter 6 [Populus euphratica]
Length=528

 Score =   347 bits (890),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGA+FASIP PI A+LYCLFF 
Sbjct  341  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAIFASIPGPIFASLYCLFFA  400

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AI  YGPVHTGGRWFNDI
Sbjct  401  YVGAAGLSFLQFCNLNSFRTKFILGFSIFMGLSVPQYFNEYTAIKGYGPVHTGGRWFNDI  460

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+AFVAG +AYFLDTT+H+K++ +RKDRGKHWWDKFRSFK DTRSEEFYSLPFN
Sbjct  461  VNVPFSSEAFVAGFLAYFLDTTLHRKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLPFN  520

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  521  LNKYFPSV  528



>ref|XP_004241491.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
 ref|XP_010322558.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
 gb|AAX73299.1| putative permease I [Solanum lycopersicum]
Length=535

 Score =   347 bits (890),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGAVFASIPAPIV ALYCLF
Sbjct  346  GNGSSVSVENAGLLALTRVGSRRVVQISAAFMIFFSILGKFGAVFASIPAPIVGALYCLF  405

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+  LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY A+  YGPVHT  RWFN
Sbjct  406  FAYVGAGGLGFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAVAGYGPVHTHARWFN  465

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+ NVPF SKAFVAGIVA+FLD TMHKK+ Q RKDRGKHWWDKF+SFKTDTRSEEFYSLP
Sbjct  466  DMANVPFQSKAFVAGIVAFFLDNTMHKKDGQTRKDRGKHWWDKFKSFKTDTRSEEFYSLP  525

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  526  FNLNKYFPSV  535



>ref|XP_009610578.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009610579.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009610580.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Nicotiana tomentosiformis]
Length=525

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPA IV ALYC+F
Sbjct  336  GNGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPASIVGALYCIF  395

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S LQFCNLNSFR KFILGFSIFLGLS+PQYFNEY  I  YGPVHT GRWFN
Sbjct  396  FAYVGVGGLSFLQFCNLNSFRTKFILGFSIFLGLSVPQYFNEYTVIAGYGPVHTSGRWFN  455

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGI+AYFLD TMHKK++QVRKDRGK WWDKF+SFKTDTRSEEFYSLP
Sbjct  456  DMVNVPFSSEAFVAGILAYFLDNTMHKKDSQVRKDRGKPWWDKFKSFKTDTRSEEFYSLP  515

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  516  FNLNKYFPSV  525



>ref|XP_009757662.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
sylvestris]
 ref|XP_009757663.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
sylvestris]
Length=532

 Score =   347 bits (889),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIV ALYCLF
Sbjct  343  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVGALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S LQFCNLNSFRNKFILGFSIFLGLS+PQYFNEY  I  YGPVHT GRWFN
Sbjct  403  FAYVGVGGLSFLQFCNLNSFRNKFILGFSIFLGLSVPQYFNEYTVIAGYGPVHTHGRWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGI+AYFLD TMHKK+N ++KDRGK WW+KF+SFK+DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEAFVAGILAYFLDNTMHKKDNAIKKDRGKPWWNKFKSFKSDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_006339989.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Solanum tuberosum]
Length=532

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIV ALYCLF
Sbjct  343  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVGALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S LQFCNLNSFRNKFILGFSIFLGLS+PQYFNEY  I  YGPVHT GRWFN
Sbjct  403  FAYVGVGGLSFLQFCNLNSFRNKFILGFSIFLGLSVPQYFNEYTVIAGYGPVHTHGRWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGI+AYFLD TMHKKE+  +KDRGK WW+KFRSFK+DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEAFVAGILAYFLDNTMHKKESSTKKDRGKPWWNKFRSFKSDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_004252190.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
Length=532

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIV ALYCLF
Sbjct  343  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVGALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S LQFCNLNSFRNKFILGFSIFLGLS+PQYFNEY  I  YGPVHT GRWFN
Sbjct  403  FAYVGVGGLSFLQFCNLNSFRNKFILGFSIFLGLSVPQYFNEYTVIAGYGPVHTHGRWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGI+AYFLD TMHKKE+  +KDRGK WW+KFRSFK+DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEAFVAGILAYFLDNTMHKKESSTKKDRGKPWWNKFRSFKSDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>gb|AGV54390.1| nucleobase-ascorbate transporter 6-like protein [Phaseolus vulgaris]
Length=532

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PIVAALYCLF
Sbjct  343  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIVAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KF+LGFSIF+GLS+ QYFNEY AIN YGPVHT  RWFN
Sbjct  403  FAYVGAGGLSFLQFCNLNSFRTKFVLGFSIFIGLSVSQYFNEYTAINGYGPVHTKARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DI+NVPF SKAFVAG +AYFLD T+HKK+  +RKDRGKHWWDK+RSFKTDTRSEEFYSLP
Sbjct  463  DIINVPFQSKAFVAGCMAYFLDNTIHKKDGAIRKDRGKHWWDKYRSFKTDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_007209884.1| hypothetical protein PRUPE_ppa003999mg [Prunus persica]
 gb|EMJ11083.1| hypothetical protein PRUPE_ppa003999mg [Prunus persica]
Length=536

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLFF
Sbjct  348  TGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAALYCLFF  407

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AI  YGPVH+GGRWFND
Sbjct  408  AYVGAGGLSFLQFCNLNSFRTKFILGFSIFMGLSVPQYFNEYTAIKGYGPVHSGGRWFND  467

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            ++NVP  S+AFVAG VAYFLD T+H+K++ VRKDRGKHWWDKFRSFK D+RSEEFYSLPF
Sbjct  468  MINVPLQSEAFVAGCVAYFLDNTLHRKDSSVRKDRGKHWWDKFRSFKGDSRSEEFYSLPF  527

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  528  NLNKYFPSV  536



>ref|XP_012080118.1| PREDICTED: nucleobase-ascorbate transporter 6 [Jatropha curcas]
 ref|XP_012080119.1| PREDICTED: nucleobase-ascorbate transporter 6 [Jatropha curcas]
 ref|XP_012080120.1| PREDICTED: nucleobase-ascorbate transporter 6 [Jatropha curcas]
 ref|XP_012080121.1| PREDICTED: nucleobase-ascorbate transporter 6 [Jatropha curcas]
 gb|KDP31138.1| hypothetical protein JCGZ_11514 [Jatropha curcas]
Length=530

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFM+FFS+LGKFGAVFASIPAPI+AALYCLFF 
Sbjct  343  GSSVSVENAGLLALTRVGSRRVVQISAGFMLFFSVLGKFGAVFASIPAPIIAALYCLFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG GG+S LQFCNLNSFR KFILGFS FLGLS+PQYFNEY AIN YGPVHT GRWFNDI
Sbjct  403  YVGVGGLSFLQFCNLNSFRTKFILGFSFFLGLSVPQYFNEYTAINGYGPVHTSGRWFNDI  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+AFVAG VAYFLD T+ +K++ VRKDRGKHWWDKFRSFK DTRSEEFYSLPFN
Sbjct  463  VNVPFSSEAFVAGCVAYFLDNTLQRKDSSVRKDRGKHWWDKFRSFKGDTRSEEFYSLPFN  522

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  523  LNKYFPSV  530



>ref|XP_010546016.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Tarenaya 
hassleriana]
 ref|XP_010546018.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Tarenaya 
hassleriana]
Length=532

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GS+VS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIP PI+AALYCLF
Sbjct  343  GAGSAVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPGPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGGVS LQFCNLNSFR KFILGFSIFLGLSIPQYFNEY AIN YGPVHTG RWFN
Sbjct  403  FAYVGAGGVSFLQFCNLNSFRTKFILGFSIFLGLSIPQYFNEYTAINGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG +A+FLD T+ KK+  VRKDRGKHWWDKF+SFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGCIAFFLDNTLRKKDGSVRKDRGKHWWDKFKSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_006439754.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 gb|ESR52994.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
Length=434

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGAVFASIPAPIVAALYCLFF 
Sbjct  247  GTSVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAVFASIPAPIVAALYCLFFA  306

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN +GPVHT GRWFND+
Sbjct  307  YVGAGGLSFLQFCNLNSFRVKFILGFSIFIGLSVPQYFNEYTAINGFGPVHTSGRWFNDM  366

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+ FVAG VA+FLD T+HKK+ QVRKDRG+HWWDKF SFK DTRSEEFYSLPFN
Sbjct  367  VNVPFSSEPFVAGCVAFFLDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSEEFYSLPFN  426

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  427  LNKYFPSV  434



>ref|XP_003549636.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Glycine max]
 ref|XP_006600655.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Glycine max]
 gb|KHN18481.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=533

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PIVAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR  F+LG+SIF+GLS+ QYFNEY AIN YGPVHT  RWFN
Sbjct  404  FAYVGAGGLSFLQFCNLNSFRTIFVLGYSIFMGLSVSQYFNEYTAINGYGPVHTKARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DI+NVPF SKAFVAG VAYFLD T+HKKE  +RKDRGKHWWDK+RSFKTDTRSEEFYSLP
Sbjct  464  DIINVPFQSKAFVAGCVAYFLDNTLHKKEAAIRKDRGKHWWDKYRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  524  FNLNKYFPSV  533



>gb|KDO69759.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=434

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGAVFASIPAPIVAALYCLFF 
Sbjct  247  GTSVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAVFASIPAPIVAALYCLFFA  306

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN +GPVHT GRWFND+
Sbjct  307  YVGAGGLSFLQFCNLNSFRVKFILGFSIFIGLSVPQYFNEYTAINGFGPVHTSGRWFNDM  366

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+ FVAG VA+FLD T+HKK+ QVRKDRG+HWWDKF SFK DTRSEEFYSLPFN
Sbjct  367  VNVPFSSEPFVAGCVAFFLDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSEEFYSLPFN  426

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  427  LNKYFPSV  434



>gb|KDO69758.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=433

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGAVFASIPAPIVAALYCLFF 
Sbjct  246  GTSVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAVFASIPAPIVAALYCLFFA  305

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN +GPVHT GRWFND+
Sbjct  306  YVGAGGLSFLQFCNLNSFRVKFILGFSIFIGLSVPQYFNEYTAINGFGPVHTSGRWFNDM  365

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+ FVAG VA+FLD T+HKK+ QVRKDRG+HWWDKF SFK DTRSEEFYSLPFN
Sbjct  366  VNVPFSSEPFVAGCVAFFLDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSEEFYSLPFN  425

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  426  LNKYFPSV  433



>ref|XP_004138122.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis sativus]
 ref|XP_011658394.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis sativus]
 ref|XP_011658431.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis sativus]
 ref|XP_011658471.1| PREDICTED: nucleobase-ascorbate transporter 6 [Cucumis sativus]
 gb|KGN63603.1| hypothetical protein Csa_1G005640 [Cucumis sativus]
Length=530

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF 
Sbjct  343  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG GG+S LQFCNLNSFR KF+LGFSIFLGLSIPQYFNE+ AIN +GPVHT  RWFND+
Sbjct  403  YVGMGGLSYLQFCNLNSFRTKFVLGFSIFLGLSIPQYFNEFTAINGFGPVHTRARWFNDM  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+ FVAGIVAYFLD T+HKK+  +RKDRGKHWWDKFRSFK DTRSEEFYSLPFN
Sbjct  463  VNVPFSSEPFVAGIVAYFLDNTLHKKDGAIRKDRGKHWWDKFRSFKGDTRSEEFYSLPFN  522

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  523  LNKYFPSV  530



>ref|XP_010678709.1| PREDICTED: nucleobase-ascorbate transporter 6 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678710.1| PREDICTED: nucleobase-ascorbate transporter 6 [Beta vulgaris 
subsp. vulgaris]
Length=531

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLL LTRVGSRRVVQISAGFM+FFSILGKFGAVFASIP+PI+AALYCLF
Sbjct  342  GIGSSVSVENAGLLTLTRVGSRRVVQISAGFMLFFSILGKFGAVFASIPSPIIAALYCLF  401

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIFLGLSIPQYFNEY AI  +GPVHT  RWFN
Sbjct  402  FAYVGSIGLSFLQFCNLNSFRTKFILGFSIFLGLSIPQYFNEYEAIKGFGPVHTSARWFN  461

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGIVAYFLD T+H+KE+ VRKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  462  DMVNVPFSSEAFVAGIVAYFLDNTLHRKESSVRKDRGKHWWDKFRSFKGDTRSEEFYSLP  521

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  522  FNLNKYFPSV  531



>gb|KDO69757.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=484

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGAVFASIPAPIVAALYCLFF 
Sbjct  297  GTSVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAVFASIPAPIVAALYCLFFA  356

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN +GPVHT GRWFND+
Sbjct  357  YVGAGGLSFLQFCNLNSFRVKFILGFSIFIGLSVPQYFNEYTAINGFGPVHTSGRWFNDM  416

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+ FVAG VA+FLD T+HKK+ QVRKDRG+HWWDKF SFK DTRSEEFYSLPFN
Sbjct  417  VNVPFSSEPFVAGCVAFFLDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSEEFYSLPFN  476

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  477  LNKYFPSV  484



>gb|KHN48615.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=533

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIP PIVAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPPPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR  F+LG+SIF+GLS+ QYFNEY AIN YGPVHT  RWFN
Sbjct  404  FAYVGAGGLSFLQFCNLNSFRTIFVLGYSIFMGLSVSQYFNEYTAINGYGPVHTKARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DI+NVPF SKAFVAG VAYFLD T+HKKE  +RKDRGKHWWDK+RSFKTDTRSEEFYSLP
Sbjct  464  DIINVPFQSKAFVAGCVAYFLDNTLHKKEAAIRKDRGKHWWDKYRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  524  FNLNKYFPSV  533



>ref|XP_006579556.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Glycine max]
 ref|XP_006579557.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Glycine max]
Length=533

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIP PIVAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPPPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR  F+LG+SIF+GLS+ QYFNEY AIN YGPVHT  RWFN
Sbjct  404  FAYVGAGGLSFLQFCNLNSFRTIFVLGYSIFIGLSVSQYFNEYTAINGYGPVHTKARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DI+NVPF SKAFVAG VAYFLD T+HKKE  +RKDRGKHWWDK+RSFKTDTRSEEFYSLP
Sbjct  464  DIINVPFQSKAFVAGCVAYFLDNTLHKKEAAIRKDRGKHWWDKYRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  524  FNLNKYFPSV  533



>ref|XP_008239723.1| PREDICTED: nucleobase-ascorbate transporter 6 [Prunus mume]
 ref|XP_008239724.1| PREDICTED: nucleobase-ascorbate transporter 6 [Prunus mume]
 ref|XP_008239725.1| PREDICTED: nucleobase-ascorbate transporter 6 [Prunus mume]
Length=539

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLFF
Sbjct  351  TGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAALYCLFF  410

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AI  YGPVH+GGRWFND
Sbjct  411  AYVGAGGLSFLQFCNLNSFRTKFILGFSIFMGLSVPQYFNEYTAIKGYGPVHSGGRWFND  470

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            ++NVP  S+AFVAG VAYFLD T+H+K++ VRKDRGK+WWDKFRSFK+D+RSEEFYSLPF
Sbjct  471  MINVPLQSEAFVAGCVAYFLDNTLHRKDSSVRKDRGKNWWDKFRSFKSDSRSEEFYSLPF  530

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  531  NLNKYFPSV  539



>gb|KDO69752.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=501

 Score =   343 bits (880),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGAVFASIPAPIVAALYCLFF 
Sbjct  314  GTSVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAVFASIPAPIVAALYCLFFA  373

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN +GPVHT GRWFND+
Sbjct  374  YVGAGGLSFLQFCNLNSFRVKFILGFSIFIGLSVPQYFNEYTAINGFGPVHTSGRWFNDM  433

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+ FVAG VA+FLD T+HKK+ QVRKDRG+HWWDKF SFK DTRSEEFYSLPFN
Sbjct  434  VNVPFSSEPFVAGCVAFFLDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSEEFYSLPFN  493

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  494  LNKYFPSV  501



>ref|XP_002322154.1| xanthine/uracil permease family protein [Populus trichocarpa]
 ref|XP_006374513.1| hypothetical protein POPTR_0015s08380g [Populus trichocarpa]
 gb|EEF06281.1| xanthine/uracil permease family protein [Populus trichocarpa]
 gb|ERP52310.1| hypothetical protein POPTR_0015s08380g [Populus trichocarpa]
Length=528

 Score =   344 bits (882),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGA+FASIP PI A+LYCLFF
Sbjct  340  TGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAIFASIPGPIFASLYCLFF  399

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVGA G+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AI  YGPVHTGGRWFND
Sbjct  400  AYVGAAGLSFLQFCNLNSFRTKFILGFSIFMGLSVPQYFNEYTAIKGYGPVHTGGRWFND  459

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            IVNVPFSS+AFVAG +AYFLD T+H+ ++ +RKDRGKHWWDKFRS+K DTRSEEFYSLPF
Sbjct  460  IVNVPFSSEAFVAGCLAYFLDNTLHRNDSSIRKDRGKHWWDKFRSYKGDTRSEEFYSLPF  519

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  520  NLNKYFPSV  528



>ref|XP_003527028.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform 1 
[Glycine max]
 ref|XP_003527029.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform 2 
[Glycine max]
 gb|KHN19327.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=531

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLFF 
Sbjct  344  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIIAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN YGPVHTG RWFNDI
Sbjct  404  YVGAGGLSFLQFCNLNSFRTKFILGFSIFVGLSVPQYFNEYTAINGYGPVHTGARWFNDI  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPF SK FVAG+VAYFLD T+ K+E  +RKDRGKHWWDK++SFK DTRSEEFYSLPFN
Sbjct  464  INVPFQSKPFVAGVVAYFLDNTLFKREAAIRKDRGKHWWDKYKSFKGDTRSEEFYSLPFN  523

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  524  LNKYFPSV  531



>ref|XP_010444153.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Camelina 
sativa]
Length=532

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  343  GAGSSVSVENAGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F  VGAGG+S LQFC LNSFR KFILGFS+FLGLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  403  FACVGAGGLSFLQFCKLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGPVHTGARWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+ FVAG VA+FLD T+HKK++ +RKDRGKHWWDKFRSFK DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_002283469.1| PREDICTED: nucleobase-ascorbate transporter 6 [Vitis vinifera]
 ref|XP_010663208.1| PREDICTED: nucleobase-ascorbate transporter 6 [Vitis vinifera]
 emb|CBI15075.3| unnamed protein product [Vitis vinifera]
Length=531

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF 
Sbjct  344  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG+GG+S LQFCNLNSFR KFILGFSIF+G S+PQYFNE+ AI  YGPVHT GRWFND+
Sbjct  404  YVGSGGLSFLQFCNLNSFRTKFILGFSIFMGFSVPQYFNEFTAIRGYGPVHTSGRWFNDM  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSS+AFVAG +A+ LD T+H+K+  VRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN
Sbjct  464  INVPFSSEAFVAGCLAFLLDITLHRKDGSVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  523

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  524  LNKYFPSV  531



>ref|XP_002311584.2| hypothetical protein POPTR_0008s14580g [Populus trichocarpa]
 gb|EEE88951.2| hypothetical protein POPTR_0008s14580g [Populus trichocarpa]
Length=483

 Score =   342 bits (877),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G+GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  294  GSGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  353

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S+LQFCNLNSF+ KFILGFS+F+GLSIPQYFNEY AI+ YGPVHTG RWFN
Sbjct  354  FAYVGSAGLSILQFCNLNSFKTKFILGFSVFMGLSIPQYFNEYTAIHGYGPVHTGARWFN  413

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG +A FLD T+HKK+   RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  414  DMINVPFSSEPFVAGFLAMFLDVTLHKKDTTTRKDRGMHWWDRFRSFKTDTRSEEFYSLP  473

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  474  FNLNKFFPSV  483



>gb|KDO69748.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
 gb|KDO69749.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
 gb|KDO69750.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
 gb|KDO69751.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=531

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGAVFASIPAPIVAALYCLFF 
Sbjct  344  GTSVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAVFASIPAPIVAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN +GPVHT GRWFND+
Sbjct  404  YVGAGGLSFLQFCNLNSFRVKFILGFSIFIGLSVPQYFNEYTAINGFGPVHTSGRWFNDM  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+ FVAG VA+FLD T+HKK+ QVRKDRG+HWWDKF SFK DTRSEEFYSLPFN
Sbjct  464  VNVPFSSEPFVAGCVAFFLDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSEEFYSLPFN  523

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  524  LNKYFPSV  531



>ref|XP_006439755.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 ref|XP_006439756.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 ref|XP_006439757.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 gb|ESR52995.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 gb|ESR52996.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
 gb|ESR52997.1| hypothetical protein CICLE_v10019673mg [Citrus clementina]
Length=531

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGAVFASIPAPIVAALYCLFF 
Sbjct  344  GTSVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAVFASIPAPIVAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN +GPVHT GRWFND+
Sbjct  404  YVGAGGLSFLQFCNLNSFRVKFILGFSIFIGLSVPQYFNEYTAINGFGPVHTSGRWFNDM  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+ FVAG VA+FLD T+HKK+ QVRKDRG+HWWDKF SFK DTRSEEFYSLPFN
Sbjct  464  VNVPFSSEPFVAGCVAFFLDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSEEFYSLPFN  523

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  524  LNKYFPSV  531



>ref|XP_006476733.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Citrus sinensis]
 ref|XP_006476734.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Citrus sinensis]
Length=531

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGAVFASIPAPIVAALYCLFF 
Sbjct  344  GTSVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAVFASIPAPIVAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN +GPVHT GRWFND+
Sbjct  404  YVGAGGLSFLQFCNLNSFRVKFILGFSIFIGLSVPQYFNEYTAINGFGPVHTSGRWFNDM  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VN+PFSS+ FVAG VA+FLD T+HKK+ QVRKDRG+HWWDKF SFK DTRSEEFYSLPFN
Sbjct  464  VNIPFSSEPFVAGCVAFFLDNTLHKKDGQVRKDRGRHWWDKFWSFKGDTRSEEFYSLPFN  523

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  524  LNKYFPSV  531



>ref|XP_009619816.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009619817.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009619819.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana 
tomentosiformis]
Length=532

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIV ALYCLF
Sbjct  343  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVGALYCLF  402

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S LQFCNLNSFRNKFILGFSIFLGLS+PQYFNEY  I  YGPVHT GRWFN
Sbjct  403  FAYVGVGGLSFLQFCNLNSFRNKFILGFSIFLGLSVPQYFNEYTVIAGYGPVHTHGRWFN  462

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGI+AYFLD TM KK+N  +KDRGK WW+KF+SFK+DTRSEEFYSLP
Sbjct  463  DMVNVPFSSEAFVAGILAYFLDNTMTKKDNATKKDRGKPWWNKFKSFKSDTRSEEFYSLP  522

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  523  FNLNKYFPSV  532



>ref|XP_006280300.1| hypothetical protein CARUB_v10026223mg [Capsella rubella]
 gb|EOA13198.1| hypothetical protein CARUB_v10026223mg [Capsella rubella]
Length=528

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALT+VGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  339  GIGSSVSVENAGLLALTKVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  398

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR  FILGFSIFLGLSIPQYFNE+ AI  YGPVHTG RWFN
Sbjct  399  FAYVGAGGLSLLQFCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKGYGPVHTGARWFN  458

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSSKAFV G VAY LDTT+HKK+  +RKDRGKHWWDKF +FK D R+EEFY+LP
Sbjct  459  DMVNVPFSSKAFVGGCVAYLLDTTLHKKDGSIRKDRGKHWWDKFWTFKKDPRTEEFYALP  518

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  519  FNLNKYFPSV  528



>gb|KHG18287.1| Nucleobase-ascorbate transporter 7 -like protein [Gossypium arboreum]
Length=542

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  353  GNGSSVSAENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  412

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+ LLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY A+NSYGPVHT  RWFN
Sbjct  413  FAYVGSAGLGLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAVNSYGPVHTRARWFN  472

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG++A FLD T+H+K+N  RKDRG HWWDKFRSFKTDTRSEEFYSLP
Sbjct  473  DMINVPFSSEVFVAGLLAMFLDVTLHRKDNATRKDRGMHWWDKFRSFKTDTRSEEFYSLP  532

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  533  FNLNKFFPSV  542



>gb|KJB77978.1| hypothetical protein B456_012G170700 [Gossypium raimondii]
Length=540

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLF
Sbjct  351  GNGSSVSAENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIIAALYCLF  410

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+ LLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY A+NSYGPVHT  RWFN
Sbjct  411  FAYVGSAGLGLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAVNSYGPVHTRARWFN  470

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAG++A FLD T+H+K+N  RKDRG HWWDKFRSFKTDTRSEEFYSLP
Sbjct  471  DMINVPFSSEAFVAGLLAMFLDVTLHRKDNATRKDRGMHWWDKFRSFKTDTRSEEFYSLP  530

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  531  FNLNKFFPSV  540



>ref|XP_003523067.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Glycine max]
 ref|XP_006578614.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Glycine max]
 ref|XP_006578615.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X3 
[Glycine max]
 ref|XP_006578616.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X4 
[Glycine max]
 gb|KHN16309.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=531

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLFF 
Sbjct  344  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIIAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN YGPVHTG RWFNDI
Sbjct  404  YVGAGGLSFLQFCNLNSFRTKFILGFSIFIGLSVPQYFNEYTAINGYGPVHTGARWFNDI  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPF SK FVAG+VAYFLD T+ K+   +RKDRGKHWWDK++SFK DTRSEEFYSLPFN
Sbjct  464  INVPFQSKPFVAGVVAYFLDNTLFKRAADIRKDRGKHWWDKYKSFKGDTRSEEFYSLPFN  523

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  524  LNKYFPSV  531



>gb|KFK26633.1| hypothetical protein AALP_AA8G273900 [Arabis alpina]
Length=530

 Score =   342 bits (876),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALT+VGSRRVVQISAGFMIFFSILGKFGAVFASIP+PI+AALYCLF
Sbjct  341  GIGSSVSVENAGLLALTKVGSRRVVQISAGFMIFFSILGKFGAVFASIPSPIIAALYCLF  400

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR  FILGFSIFLGLS+PQYFNE+ AI  YGPVHTG RWFN
Sbjct  401  FAYVGAGGLSLLQFCNLNSFRTLFILGFSIFLGLSVPQYFNEHTAIKGYGPVHTGARWFN  460

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSSKAFV G VAYFLDTT+HKK+  +RKDRGKHWWD+F +FK D R+EEFY+LP
Sbjct  461  DMVNVPFSSKAFVGGCVAYFLDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTEEFYALP  520

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  521  FNLNKYFPSV  530



>gb|AET03140.2| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=533

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+G SIPQYFNEY A  SYGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGFSIPQYFNEYTAFKSYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF+S+AFVA ++A FLD T+HKK+NQ RKDRG HWWDKFRSFKTDTRSEEFYSLP
Sbjct  464  DMINVPFASEAFVASLLAMFLDVTLHKKDNQTRKDRGMHWWDKFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_010100509.1| Nucleobase-ascorbate transporter 6 [Morus notabilis]
 gb|EXB82643.1| Nucleobase-ascorbate transporter 6 [Morus notabilis]
Length=534

 Score =   342 bits (876),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYC F
Sbjct  345  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIIAALYCFF  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG  G+SLLQFCNLNSFR KF+LGFSIF+GLSIPQYFNEY  IN YGPVHTG RWFN
Sbjct  405  FAYVGLAGLSLLQFCNLNSFRTKFVLGFSIFMGLSIPQYFNEYTVINGYGPVHTGARWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF+S+AFVAG++A FLD T+HKK+N  RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  465  DMINVPFASEAFVAGLLALFLDVTLHKKDNATRKDRGMHWWDRFRSFKTDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  525  FNLNKFFPSV  534



>ref|XP_011025599.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011025607.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011025614.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
Length=534

 Score =   341 bits (875),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G+GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  345  GSGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFI+GFS+F+GLSIPQYFNEY AI+ YGPVHTG RWFN
Sbjct  405  FAYVGSAGLSFLQFCNLNSFRTKFIIGFSVFMGLSIPQYFNEYTAIHGYGPVHTGARWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG +A FLD T+HKK+   RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  465  DMINVPFSSEPFVAGFLAMFLDVTLHKKDTATRKDRGMHWWDRFRSFKTDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  525  FNLNKFFPSV  534



>ref|XP_003628664.1| Nucleobase ascorbate transporter [Medicago truncatula]
Length=549

 Score =   342 bits (876),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  360  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  419

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+G SIPQYFNEY A  SYGPVHT  RWFN
Sbjct  420  FAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGFSIPQYFNEYTAFKSYGPVHTRARWFN  479

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF+S+AFVA ++A FLD T+HKK+NQ RKDRG HWWDKFRSFKTDTRSEEFYSLP
Sbjct  480  DMINVPFASEAFVASLLAMFLDVTLHKKDNQTRKDRGMHWWDKFRSFKTDTRSEEFYSLP  539

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  540  FNLNKFFPSV  549



>dbj|BAB08803.1| permease [Arabidopsis thaliana]
Length=483

 Score =   340 bits (871),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALT++GSRRVVQISAGFMIFFSILGKFGAVFASIP+PI+AALYCLF
Sbjct  294  GIGSSVSVENAGLLALTKIGSRRVVQISAGFMIFFSILGKFGAVFASIPSPIIAALYCLF  353

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR  FILGFSIFLGLSIPQYFNE+ AI  YGPVHTG RWFN
Sbjct  354  FAYVGAGGLSLLQFCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKGYGPVHTGARWFN  413

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSSKAFV G VAY LDTT+HKK+  +RKDRGKHWWD+F +FK D R+EEFY+LP
Sbjct  414  DMVNVPFSSKAFVGGCVAYLLDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTEEFYALP  473

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  474  FNLNKYFPSV  483



>ref|XP_004299577.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
 ref|XP_011464518.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
 ref|XP_011464519.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
 ref|XP_011464520.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 1/189 (1%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGA+FASIP PI+AALYCLFF
Sbjct  342  TGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGALFASIPGPIIAALYCLFF  401

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVG+ G+S LQFCNLNSFR KFILGFSIF+GLSIPQYFNEY AIN YGPVHTGGRWFND
Sbjct  402  AYVGSCGLSFLQFCNLNSFRTKFILGFSIFMGLSIPQYFNEYTAINGYGPVHTGGRWFND  461

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            ++NVPF S+AFVAG++AYFLD T+H +++ +RKDRGKHWWDKFRSFK D+RSEEFYSLPF
Sbjct  462  MINVPFQSEAFVAGVIAYFLDNTLH-RDSTIRKDRGKHWWDKFRSFKGDSRSEEFYSLPF  520

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  521  NLNKYFPSV  529



>ref|XP_004509863.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Cicer arietinum]
Length=533

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+G SIPQYFNEY A   YGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGFSIPQYFNEYTAFKGYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF+S+AFVAG++A FLD T+ KKENQ RKDRG HWWDKFRSFKTDTRSEEFYSLP
Sbjct  464  DMINVPFASEAFVAGLLAMFLDVTLRKKENQTRKDRGMHWWDKFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_007138109.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
 ref|XP_007138110.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
 ref|XP_007138111.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
 gb|ESW10103.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
 gb|ESW10104.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
 gb|ESW10105.1| hypothetical protein PHAVU_009G181000g [Phaseolus vulgaris]
Length=531

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP  I+AALYCLFF
Sbjct  343  TGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPSIIAALYCLFF  402

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVGAGG+S LQFCNLNSFR KFILGFSIFLGLS+PQYFNEY AIN +GPV+TG RWFND
Sbjct  403  AYVGAGGLSFLQFCNLNSFRTKFILGFSIFLGLSVPQYFNEYTAINGFGPVNTGARWFND  462

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            I+NVPF SK FVAG+VAYFLD T+ K+E+ +RKDRGKHWWDK++SFK DTRSEEFYSLPF
Sbjct  463  IINVPFQSKPFVAGVVAYFLDNTLFKRESSIRKDRGKHWWDKYKSFKGDTRSEEFYSLPF  522

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  523  NLNKYFPSV  531



>ref|XP_002865770.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42029.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=528

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALT++GSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  339  GIGSSVSVENAGLLALTKIGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  398

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR  FILGFSIFLGLSIPQYFNE+ AI  YGPVHTG RWFN
Sbjct  399  FAYVGAGGLSLLQFCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKGYGPVHTGARWFN  458

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNVPFSS AFV G VAY LDTT+HKK+  +RKDRGKHWWD+F +FK D R+EEFY+LP
Sbjct  459  DIVNVPFSSNAFVGGCVAYLLDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTEEFYALP  518

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  519  FNLNKYFPSV  528



>ref|XP_010028015.1| PREDICTED: nucleobase-ascorbate transporter 6 [Eucalyptus grandis]
 ref|XP_010028021.1| PREDICTED: nucleobase-ascorbate transporter 6 [Eucalyptus grandis]
 ref|XP_010028028.1| PREDICTED: nucleobase-ascorbate transporter 6 [Eucalyptus grandis]
 ref|XP_010028035.1| PREDICTED: nucleobase-ascorbate transporter 6 [Eucalyptus grandis]
 ref|XP_010028045.1| PREDICTED: nucleobase-ascorbate transporter 6 [Eucalyptus grandis]
 gb|KCW83417.1| hypothetical protein EUGRSUZ_B00347 [Eucalyptus grandis]
Length=531

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGSSVS+ENAGLL LTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIPAPI AALYCLFF
Sbjct  343  TGSSVSVENAGLLGLTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPAPIFAALYCLFF  402

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVG+ G+S LQ+CNLNSFR KFILGFS+F+GLSIPQYFNEY AIN YGPVHTGGRWFND
Sbjct  403  AYVGSVGLSFLQYCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAINGYGPVHTGGRWFND  462

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            IVNVP SS+ FVAG +AYFLD T+H+K+  VRK+RGKHWWDKFRSFK DTRSEEFYSLPF
Sbjct  463  IVNVPLSSEPFVAGCIAYFLDNTLHRKDGTVRKERGKHWWDKFRSFKGDTRSEEFYSLPF  522

Query  393  NLNKYFPSV  367
            NLNKYFP V
Sbjct  523  NLNKYFPPV  531



>ref|XP_011021644.1| PREDICTED: nucleobase-ascorbate transporter 7 [Populus euphratica]
Length=534

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G+GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP+PI+AALYCLF
Sbjct  345  GSGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPSPIIAALYCLF  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFS+F+GLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  405  FAYVGSAGLSFLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAIKGYGPVHTGARWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG +A FLD T+HKK+   RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  465  DMINVPFSSEPFVAGFLAMFLDVTLHKKDTATRKDRGMHWWDRFRSFKTDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  525  FNLNKFFPSV  534



>ref|XP_011044342.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011044343.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011044344.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011044345.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
 ref|XP_011044346.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Populus euphratica]
Length=528

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGAVFASIP+PI+A LYCLF
Sbjct  339  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAVFASIPSPIIAGLYCLF  398

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AI  +GPV+T GRWFN
Sbjct  399  FAYVGAGGLSFLQFCNLNSFRTKFILGFSIFMGLSVPQYFNEYTAIKGFGPVNTSGRWFN  458

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DI+NVPFSS+AFVAG +AYFLD T+HKK++ +RKDRGKHWW KF+SFK DTRSEEFYSLP
Sbjct  459  DIINVPFSSEAFVAGCLAYFLDNTLHKKDSSIRKDRGKHWWAKFKSFKGDTRSEEFYSLP  518

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  519  FNLNKYFPSV  528



>ref|NP_199810.2| xanthine/uracil permease family protein [Arabidopsis thaliana]
 sp|Q8RWE9.1|NAT5_ARATH RecName: Full=Nucleobase-ascorbate transporter 5; Short=AtNAT5 
[Arabidopsis thaliana]
 gb|AAM13136.1| permease [Arabidopsis thaliana]
 gb|AAP68326.1| At5g49990 [Arabidopsis thaliana]
 dbj|BAF01588.1| permease [Arabidopsis thaliana]
 gb|AED95881.1| xanthine/uracil permease family protein [Arabidopsis thaliana]
Length=528

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALT++GSRRVVQISAGFMIFFSILGKFGAVFASIP+PI+AALYCLF
Sbjct  339  GIGSSVSVENAGLLALTKIGSRRVVQISAGFMIFFSILGKFGAVFASIPSPIIAALYCLF  398

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR  FILGFSIFLGLSIPQYFNE+ AI  YGPVHTG RWFN
Sbjct  399  FAYVGAGGLSLLQFCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKGYGPVHTGARWFN  458

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSSKAFV G VAY LDTT+HKK+  +RKDRGKHWWD+F +FK D R+EEFY+LP
Sbjct  459  DMVNVPFSSKAFVGGCVAYLLDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTEEFYALP  518

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  519  FNLNKYFPSV  528



>ref|XP_004236131.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
 ref|XP_004236132.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
 ref|XP_004236133.1| PREDICTED: nucleobase-ascorbate transporter 6 [Solanum lycopersicum]
Length=525

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+EN GLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIP  IV ALYC+ 
Sbjct  336  GNGSSVSVENVGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPTSIVGALYCIL  395

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S LQFCNLNSFR+KFILGFSIFLGLSIPQYFNE+  I  YGPVHT GRWFN
Sbjct  396  FAYVGVGGLSFLQFCNLNSFRSKFILGFSIFLGLSIPQYFNEHTVIEGYGPVHTSGRWFN  455

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGI+AYFLD TMHK++ QVRKDRGK WWDKF+SFKTDTRSEEFYSLP
Sbjct  456  DMVNVPFSSEAFVAGILAYFLDNTMHKRDGQVRKDRGKPWWDKFKSFKTDTRSEEFYSLP  515

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  516  FNLNKYFPSV  525



>ref|XP_002531406.1| purine permease, putative [Ricinus communis]
 gb|EEF30990.1| purine permease, putative [Ricinus communis]
Length=536

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  347  GNGASVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  406

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+GG+S LQFCNLNSFR KFILGFS F+GLSIPQYFNEY AIN YGPVHTG RWFN
Sbjct  407  FAYVGSGGLSFLQFCNLNSFRTKFILGFSFFMGLSIPQYFNEYTAINGYGPVHTGARWFN  466

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAGI+A+FLD T+H K+   RKDRG  WW KFRSFKTDTRSEEFYSLP
Sbjct  467  DMINVPFSSEAFVAGILAFFLDITLHHKDQATRKDRGVSWWAKFRSFKTDTRSEEFYSLP  526

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  527  FNLNKFFPSV  536



>emb|CDP17001.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   339 bits (869),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYC+F
Sbjct  342  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCIF  401

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLN+FR KFILGFSIFLGLSIPQYFNEY AI  YGPVH  GRWFN
Sbjct  402  FAYVGAGGLSFLQFCNLNTFRTKFILGFSIFLGLSIPQYFNEYTAIQGYGPVHVNGRWFN  461

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNVPFSS+AFVAG+VAYFLD T+HKK+ Q+RKDRGKH+WDKF+S+KTD R++EFY LP
Sbjct  462  DIVNVPFSSEAFVAGLVAYFLDNTLHKKDGQIRKDRGKHFWDKFKSYKTDQRTDEFYGLP  521

Query  396  FNLNKYFPSV  367
            F +NKYFPSV
Sbjct  522  FGINKYFPSV  531



>ref|XP_002315809.1| xanthine/uracil permease family protein [Populus trichocarpa]
 gb|EEF01980.1| xanthine/uracil permease family protein [Populus trichocarpa]
Length=534

 Score =   339 bits (869),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G+GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP+PI+AALYCLF
Sbjct  345  GSGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPSPIIAALYCLF  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSF+ KFILGFS+F+GLSIPQYFNEY AI  YGPVHTG RWFN
Sbjct  405  FAYVGSAGLSFLQFCNLNSFKTKFILGFSVFMGLSIPQYFNEYTAIKGYGPVHTGARWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG +A FLD T+HKK+   RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  465  DMINVPFSSEPFVAGFLAMFLDVTLHKKDTATRKDRGMHWWDRFRSFKTDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  525  FNLNKFFPSV  534



>ref|XP_007157491.1| hypothetical protein PHAVU_002G074100g [Phaseolus vulgaris]
 gb|ESW29485.1| hypothetical protein PHAVU_002G074100g [Phaseolus vulgaris]
Length=531

 Score =   338 bits (868),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  342  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  401

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSI++GLSIPQYFNEY A  +YGPVHT  RWFN
Sbjct  402  FAYVGSSGLSFLQFCNLNSFRTKFILGFSIYMGLSIPQYFNEYTAFKNYGPVHTHARWFN  461

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSKAFVAG +A FLD T+H K+NQ RKDRG HWWD+F SFKTDTRSEEFYSLP
Sbjct  462  DMINVPFSSKAFVAGSLALFLDATLHNKDNQTRKDRGMHWWDRFSSFKTDTRSEEFYSLP  521

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  522  FNLNKFFPSV  531



>ref|XP_006345027.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Solanum tuberosum]
 ref|XP_006345028.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Solanum tuberosum]
Length=525

 Score =   338 bits (868),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+EN GLLALTRVGSRRVVQI+AGFMIFFSILGKFGAVFASIP  IV ALYC+ 
Sbjct  336  GNGSSVSVENVGLLALTRVGSRRVVQIAAGFMIFFSILGKFGAVFASIPTSIVGALYCIL  395

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S LQFCNLNSFR+KFILGFSIFLGLSIPQYFNE+  I  YGPVHT GRWFN
Sbjct  396  FAYVGIGGLSYLQFCNLNSFRSKFILGFSIFLGLSIPQYFNEHTVIEGYGPVHTSGRWFN  455

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAGI+AYFLD TMHK++ QVRKDRGK WWDKF+SFKTDTRSEEFYSLP
Sbjct  456  DMVNVPFSSEAFVAGILAYFLDNTMHKRDGQVRKDRGKPWWDKFKSFKTDTRSEEFYSLP  515

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  516  FNLNKYFPSV  525



>ref|XP_006402200.1| hypothetical protein EUTSA_v10013227mg [Eutrema salsugineum]
 gb|ESQ43653.1| hypothetical protein EUTSA_v10013227mg [Eutrema salsugineum]
Length=530

 Score =   338 bits (867),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSS+SIENAGLLALT+VGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  341  GIGSSISIENAGLLALTKVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  400

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQ+CNLNSFR  FILGFSIFLGLSIPQYFNE+ AI SYGPVHTG RWFN
Sbjct  401  FAYVGAGGLSLLQYCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKSYGPVHTGARWFN  460

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSSKAFV G VAY LDTT+HKK+  +RKDRGKHWWD+F +FK D R+EEFY+LP
Sbjct  461  DMVNVPFSSKAFVGGCVAYLLDTTLHKKDGSIRKDRGKHWWDRFWTFKGDPRTEEFYALP  520

Query  396  FNLNKYFPS  370
            FNL+KYFPS
Sbjct  521  FNLHKYFPS  529



>emb|CAN79848.1| hypothetical protein VITISV_025959 [Vitis vinifera]
Length=524

 Score =   338 bits (867),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTGSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLF
Sbjct  335  GTGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIIAALYCLF  394

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGA G+S LQFCNLNSF+ KF+LGFSIF+GLSIPQYFNEY  +N YGPVHTG RWFN
Sbjct  395  FAYVGAAGLSFLQFCNLNSFKTKFVLGFSIFMGLSIPQYFNEYRVVNGYGPVHTGARWFN  454

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAG++A FLD+T+H+K+N  RKDRG  WW+KFRSFKTD+RSEEFYSLP
Sbjct  455  DMINVPFSSEAFVAGLLALFLDSTLHRKDNTTRKDRGMIWWEKFRSFKTDSRSEEFYSLP  514

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  515  FNLNKFFPSV  524



>ref|XP_010442477.1| PREDICTED: nucleobase-ascorbate transporter 5 isoform X1 [Camelina 
sativa]
 ref|XP_010442478.1| PREDICTED: nucleobase-ascorbate transporter 5 isoform X2 [Camelina 
sativa]
 ref|XP_010442479.1| PREDICTED: nucleobase-ascorbate transporter 5 isoform X2 [Camelina 
sativa]
Length=528

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALT+VGSRRVVQISAGFMIFFS+LGKFGAVFASIP+PI+AALYCLF
Sbjct  339  GIGSSVSVENAGLLALTKVGSRRVVQISAGFMIFFSVLGKFGAVFASIPSPIIAALYCLF  398

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR  FILGFSIFLGLSIPQYFNE+ AI  YGPVHTG RWFN
Sbjct  399  FAYVGAGGLSLLQFCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKGYGPVHTGARWFN  458

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSSKAFV G VAY LDTT+HKK+  +RKDRGKHWWD+F +FK D R+EEFY+LP
Sbjct  459  DMVNVPFSSKAFVGGCVAYLLDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTEEFYALP  518

Query  396  FNLNKYFPS  370
            FNLNKYFPS
Sbjct  519  FNLNKYFPS  527



>ref|XP_010482302.1| PREDICTED: nucleobase-ascorbate transporter 5-like [Camelina 
sativa]
Length=549

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALT+VGSRRVVQISAGFMIFFS+LGKFGAVFASIP+PIVAALYCLF
Sbjct  360  GIGSSVSVENAGLLALTKVGSRRVVQISAGFMIFFSVLGKFGAVFASIPSPIVAALYCLF  419

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR  FILGFSIFLGLSIPQYFNE+ AI  YGPVHTG RWFN
Sbjct  420  FAYVGAGGLSLLQFCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKGYGPVHTGARWFN  479

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSSKAFV G VAY LDTT+HKK+  +RKDRGKHWWD+F +FK D R+EEFY+LP
Sbjct  480  DMVNVPFSSKAFVGGCVAYLLDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTEEFYALP  539

Query  396  FNLNKYFPS  370
            FNLNKYFPS
Sbjct  540  FNLNKYFPS  548



>ref|XP_002268811.1| PREDICTED: nucleobase-ascorbate transporter 6 [Vitis vinifera]
 ref|XP_010653028.1| PREDICTED: nucleobase-ascorbate transporter 6 [Vitis vinifera]
 emb|CBI32088.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTGSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLF
Sbjct  352  GTGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIIAALYCLF  411

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGA G+S LQFCNLNSF+ KF+LGFSIF+GLSIPQYFNEY  +N YGPVHTG RWFN
Sbjct  412  FAYVGAAGLSFLQFCNLNSFKTKFVLGFSIFMGLSIPQYFNEYRVVNGYGPVHTGARWFN  471

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAG++A FLD+T+H+K+N  RKDRG  WW+KFRSFKTD+RSEEFYSLP
Sbjct  472  DMINVPFSSEAFVAGLLALFLDSTLHRKDNTTRKDRGMIWWEKFRSFKTDSRSEEFYSLP  531

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  532  FNLNKFFPSV  541



>ref|XP_010043812.1| PREDICTED: nucleobase-ascorbate transporter 7 [Eucalyptus grandis]
 gb|KCW85810.1| hypothetical protein EUGRSUZ_B02555 [Eucalyptus grandis]
Length=537

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 176/191 (92%), Gaps = 1/191 (1%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSV++ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  347  GIGSSVTVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  406

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+SLLQFCNLNSFR KF+LGFSIF+GLSIPQYFNEY  +N YGPVHTG RWFN
Sbjct  407  FAYVGSAGLSLLQFCNLNSFRIKFVLGFSIFMGLSIPQYFNEYTVVNGYGPVHTGARWFN  466

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHK-KENQVRKDRGKHWWDKFRSFKTDTRSEEFYSL  400
            D++NVPFSS AFVAG++AYFLD T+H+ K++  R+DRG HWWD+FRSFKTDTRSEEFY L
Sbjct  467  DMINVPFSSNAFVAGLLAYFLDITLHRSKDSTTRRDRGMHWWDRFRSFKTDTRSEEFYVL  526

Query  399  PFNLNKYFPSV  367
            PFNLNK+FPSV
Sbjct  527  PFNLNKFFPSV  537



>ref|XP_006355948.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Solanum tuberosum]
Length=483

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTGSSVS ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  294  GTGSSVSPENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  353

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+GLSIPQYFNEY AIN YGPVHT  RWFN
Sbjct  354  FAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGLSIPQYFNEYTAINGYGPVHTRARWFN  413

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG++A FLD ++H+K+   RKDRG  WWDKF+SFKTDTRSEEFYSLP
Sbjct  414  DMINVPFSSEPFVAGLLALFLDVSLHRKDAATRKDRGMPWWDKFKSFKTDTRSEEFYSLP  473

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  474  FNLNKFFPSV  483



>ref|XP_004508843.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Cicer arietinum]
Length=567

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 179/226 (79%), Gaps = 36/226 (16%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PIVAALYCLF
Sbjct  342  GIGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIVAALYCLF  401

Query  756  FGY------------------------------------VGAGGVSLLQFCNLNSFRNKF  685
            F Y                                    VG+GG+S LQFCNLNSFR KF
Sbjct  402  FAYVGMSDLRYNNHKTLRLLIYFDAYNKQHVTFHFELSFVGSGGLSFLQFCNLNSFRTKF  461

Query  684  ILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDIVNVPFSSKAFVAGIVAYFLDTT  505
            +LGFSIFLGLSIPQYFNEY +IN +GPVHTG RWFNDIVNVPF SKAFVAG+VAYFLD T
Sbjct  462  VLGFSIFLGLSIPQYFNEYTSINGFGPVHTGARWFNDIVNVPFQSKAFVAGVVAYFLDNT  521

Query  504  MHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNKYFPSV  367
            +HKKE+ +RKDRGKHWWDK+RSFKTDTRSEEFYSLPFNLNKYFPSV
Sbjct  522  LHKKESSIRKDRGKHWWDKYRSFKTDTRSEEFYSLPFNLNKYFPSV  567



>ref|XP_007044538.1| Nucleobase-ascorbate transporter 7 [Theobroma cacao]
 gb|EOY00370.1| Nucleobase-ascorbate transporter 7 [Theobroma cacao]
Length=536

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLF
Sbjct  347  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIIAALYCLF  406

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR KFILGFS+F+GLSIPQYFNEY A+N YGPVHTG RWFN
Sbjct  407  FAYVGSAGLGFLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAVNGYGPVHTGARWFN  466

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAG++A  LD T+H+K++  RKDRG HWWD+FRSFKTDTRSEEFY LP
Sbjct  467  DMINVPFSSEAFVAGLLAMILDVTLHRKDSTTRKDRGMHWWDRFRSFKTDTRSEEFYRLP  526

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  527  FNLNKFFPSV  536



>ref|XP_010418834.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Camelina 
sativa]
Length=487

 Score =   335 bits (858),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTG+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGA+FASIPAPIVAAL+CLF
Sbjct  298  GTGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAIFASIPAPIVAALHCLF  357

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY A+N YGPVHT  RWFN
Sbjct  358  FAYVGAGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAVNKYGPVHTHARWFN  417

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAGI+A+FLD T+  K++  RK+RG  WWD+F SFK+DTRSEEFYSLP
Sbjct  418  DMINVPFSSEAFVAGILAFFLDVTLSSKDSATRKNRGMFWWDRFMSFKSDTRSEEFYSLP  477

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  478  FNLNKYFPSV  487



>gb|AAD14479.1| Strong similarity to gi|3337350 F13P17.3 putative permease from 
Arabidopsis thaliana BAC gb|AC004481 [Arabidopsis thaliana]
Length=543

 Score =   336 bits (862),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGA+FASIPAP+VAAL+CLF
Sbjct  354  GNGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAIFASIPAPVVAALHCLF  413

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFS+F+GLSIPQYFN+Y A+N YGPVHT  RWFN
Sbjct  414  FAYVGAGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNQYTAVNKYGPVHTHARWFN  473

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSKAFVAGI+A+FLD TM  K++  RKDRG  WWD+F SFK+DTRSEEFYSLP
Sbjct  474  DMINVPFSSKAFVAGILAFFLDVTMSSKDSATRKDRGMFWWDRFMSFKSDTRSEEFYSLP  533

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  534  FNLNKYFPSV  543



>ref|XP_006355947.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Solanum tuberosum]
Length=533

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTGSSVS ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GTGSSVSPENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+GLSIPQYFNEY AIN YGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGLSIPQYFNEYTAINGYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG++A FLD ++H+K+   RKDRG  WWDKF+SFKTDTRSEEFYSLP
Sbjct  464  DMINVPFSSEPFVAGLLALFLDVSLHRKDAATRKDRGMPWWDKFKSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|NP_176211.2| nucleobase-ascorbate transporter 7 [Arabidopsis thaliana]
 sp|Q0WPE9.2|NAT7_ARATH RecName: Full=Nucleobase-ascorbate transporter 7; Short=AtNAT7 
[Arabidopsis thaliana]
 gb|AEE33651.1| nucleobase-ascorbate transporter 7 [Arabidopsis thaliana]
Length=538

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGA+FASIPAP+VAAL+CLF
Sbjct  349  GNGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAIFASIPAPVVAALHCLF  408

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFS+F+GLSIPQYFN+Y A+N YGPVHT  RWFN
Sbjct  409  FAYVGAGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNQYTAVNKYGPVHTHARWFN  468

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSKAFVAGI+A+FLD TM  K++  RKDRG  WWD+F SFK+DTRSEEFYSLP
Sbjct  469  DMINVPFSSKAFVAGILAFFLDVTMSSKDSATRKDRGMFWWDRFMSFKSDTRSEEFYSLP  528

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  529  FNLNKYFPSV  538



>gb|KJB31307.1| hypothetical protein B456_005G185400 [Gossypium raimondii]
Length=287

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+EN GLLA+TRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLF
Sbjct  98   GNGSSVSVENGGLLAMTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLF  157

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            FGYVG+GG+SLLQFCNLN+F+ KFILGFS+F+GLSIPQYFNEY AIN +GPVHTG RWFN
Sbjct  158  FGYVGSGGLSLLQFCNLNNFKIKFILGFSVFMGLSIPQYFNEYTAINGFGPVHTGARWFN  217

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAG +A FLD T+H KEN  +++RG H W+KF+SFK D RSEEFY+LP
Sbjct  218  DMINVPFSSEAFVAGSLAMFLDVTLHGKENATKRERGMHLWEKFKSFKKDARSEEFYALP  277

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  278  FNLNKFFPSV  287



>gb|KHN10623.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=533

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+G SIPQYFNEY A   YGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGFSIPQYFNEYTAFKGYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF S+AFVAG++A  LD T+ KK+NQ RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  464  DMINVPFQSEAFVAGMLALLLDVTLRKKDNQTRKDRGMHWWDRFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_003532028.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Glycine max]
Length=533

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+G SIPQYFNEY A   YGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGFSIPQYFNEYTAFKGYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF S+AFVAG++A  LD T+ KK+NQ RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  464  DMINVPFQSEAFVAGMLALLLDVTLRKKDNQTRKDRGMHWWDRFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>gb|KHN44541.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=533

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+G SIPQYFNEY A   YGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGFSIPQYFNEYTAFKGYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF S+AFVAG++A  LD T+ KK+NQ RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  464  DMINVPFQSEAFVAGMLALLLDVTLRKKDNQTRKDRGMHWWDRFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_010556259.1| PREDICTED: nucleobase-ascorbate transporter 7 [Tarenaya hassleriana]
Length=533

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GNGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSF+  FILGFSIF+GLSI QYFNEY A+N+YGPVHT  RWFN
Sbjct  404  FAYVGAGGLSLLQFCNLNSFKTMFILGFSIFMGLSITQYFNEYTALNNYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAGI+A+FLD  +HKK++ +R+DRG  WW++FRSFK+DTRSEEFYSLP
Sbjct  464  DMINVPFSSEAFVAGILAFFLDLMLHKKDSSMRRDRGLQWWERFRSFKSDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  524  FNLNKYFPSV  533



>ref|XP_002886639.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62898.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=537

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGA+FASIPAPIVAAL+CLF
Sbjct  348  GNGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAIFASIPAPIVAALHCLF  407

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY A+N YGPVHT  RWFN
Sbjct  408  FAYVGAGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAVNKYGPVHTHARWFN  467

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSKAFVAGI+A+FLD T+  K++  RKDRG  WWD+F SFK+DTRSEEFYSLP
Sbjct  468  DMINVPFSSKAFVAGILAFFLDVTLSSKDSATRKDRGMFWWDRFMSFKSDTRSEEFYSLP  527

Query  396  FNLNKYFPSV  367
            FNLNKYFPS+
Sbjct  528  FNLNKYFPSL  537



>ref|XP_010532270.1| PREDICTED: nucleobase-ascorbate transporter 5 isoform X2 [Tarenaya 
hassleriana]
Length=491

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTGSSV++ENAGLLALT+VGSRRVVQISA FMIFFSILGKFGAVFASIPAP+VAALYCLF
Sbjct  302  GTGSSVAVENAGLLALTKVGSRRVVQISAVFMIFFSILGKFGAVFASIPAPVVAALYCLF  361

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQ+CNLNSFR  FILGFSIFLGLS+PQYFNEY ++N YGPVHT  RWFN
Sbjct  362  FAYVGAGGLSLLQYCNLNSFRTVFILGFSIFLGLSVPQYFNEYTSVNGYGPVHTKARWFN  421

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFV G VAYFLDTT++KK+  +RKDRGKHWWD+F +FK D+R+EEFYSLP
Sbjct  422  DMVNVPFSSEAFVGGCVAYFLDTTVYKKDGSIRKDRGKHWWDRFWTFKGDSRTEEFYSLP  481

Query  396  FNLNKYFPSV  367
            FNL KYFPSV
Sbjct  482  FNLKKYFPSV  491



>ref|XP_004238704.1| PREDICTED: nucleobase-ascorbate transporter 7 [Solanum lycopersicum]
Length=533

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTGSSVS ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GTGSSVSPENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+GLSIPQYFNEY AIN YGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGLSIPQYFNEYTAINGYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG++A FLD ++H+K+   RKDRG  WWDKF+SFKTDTRSEEFYSLP
Sbjct  464  DMINVPFSSEPFVAGLLALFLDVSLHRKDVATRKDRGMPWWDKFKSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_008374469.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Malus domestica]
Length=533

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFS LGKFGA+FASIP PI AALYCLFF
Sbjct  345  TGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSXLGKFGALFASIPGPIFAALYCLFF  404

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YVGAGG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN YGPVHTGGRWFND
Sbjct  405  AYVGAGGLSFLQFCNLNSFRTKFILGFSIFIGLSVPQYFNEYTAINGYGPVHTGGRWFND  464

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            ++NVP  S+AFVAG VAYFLD T+ +K++ V+KDRGK WW+KFRSFK D+RSEEFYSLPF
Sbjct  465  MINVPLQSEAFVAGCVAYFLDNTLQRKDSSVKKDRGKTWWNKFRSFKGDSRSEEFYSLPF  524

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  525  NLNKYFPSV  533



>dbj|BAF01000.1| hypothetical protein [Arabidopsis thaliana]
Length=538

 Score =   334 bits (857),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQI AGFMIFFSILGKFGA+FASIPAP+VAAL+CLF
Sbjct  349  GNGASVSVENAGLLALTRVGSRRVVQIPAGFMIFFSILGKFGAIFASIPAPVVAALHCLF  408

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFS+F+GLSIPQYFN+Y A+N YGPVHT  RWFN
Sbjct  409  FAYVGAGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNQYTAVNKYGPVHTHARWFN  468

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSKAFVAGI+A+FLD TM  K++  RKDRG  WWD+F SFK+DTRSEEFYSLP
Sbjct  469  DMINVPFSSKAFVAGILAFFLDVTMSSKDSATRKDRGMFWWDRFMSFKSDTRSEEFYSLP  528

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  529  FNLNKYFPSV  538



>ref|XP_010913510.1| PREDICTED: LOW QUALITY PROTEIN: nucleobase-ascorbate transporter 
6 [Elaeis guineensis]
Length=533

 Score =   334 bits (856),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GS+VS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLFF 
Sbjct  346  GSTVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLFFA  405

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHT  RWFNDI
Sbjct  406  YVGAAGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTHARWFNDI  465

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSKAFVAG+VA+FLD T+H++++  RKDRG HWWD+FRSFKTDTRSEEFYSLPFN
Sbjct  466  INVIFSSKAFVAGLVAFFLDNTLHRRDSATRKDRGYHWWDRFRSFKTDTRSEEFYSLPFN  525

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  526  LNKFFPSV  533



>ref|XP_009595521.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   334 bits (856),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GNGSSVSPENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFS+F+GLSIPQYFNEY AIN YGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAINGYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG++A FLD ++HKK+   RKDRG  WWDKF+SFKTDTRSEEFYSLP
Sbjct  464  DMINVPFSSEPFVAGLLALFLDVSLHKKDAATRKDRGMPWWDKFKSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_009799732.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Nicotiana 
sylvestris]
Length=533

 Score =   333 bits (855),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS ENAGLLALTRVGSRRV+QISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GNGSSVSPENAGLLALTRVGSRRVIQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFS+F+GLSIPQYFNEY AIN YGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAINGYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG++A FLD ++HKK+   RKDRG  WWDKF+SFKTDTRSEEFYSLP
Sbjct  464  DMINVPFSSEPFVAGLLALFLDVSLHKKDAATRKDRGMPWWDKFKSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_008446242.1| PREDICTED: nucleobase-ascorbate transporter 7 [Cucumis melo]
Length=534

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISA FMIFFSILGKFGA+FASIPAPI+AALYC F
Sbjct  345  GNGSSVSIENAGLLALTRVGSRRVVQISASFMIFFSILGKFGAIFASIPAPIIAALYCFF  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+GLSIPQYFNEY A+N YGPVHT  RWFN
Sbjct  405  FAYVGSAGLSFLQFCNLNSFRIKFILGFSIFMGLSIPQYFNEYTAVNGYGPVHTRARWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF+S+ FVAG +A FLD T+H K+N ++KDRG HWWDKFRSFKTDTRSEEFYSLP
Sbjct  465  DMINVPFASEPFVAGFLALFLDVTLHSKDNAMKKDRGMHWWDKFRSFKTDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  525  FNLNKFFPSV  534



>ref|XP_010532269.1| PREDICTED: nucleobase-ascorbate transporter 5 isoform X1 [Tarenaya 
hassleriana]
Length=535

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTGSSV++ENAGLLALT+VGSRRVVQISA FMIFFSILGKFGAVFASIPAP+VAALYCLF
Sbjct  346  GTGSSVAVENAGLLALTKVGSRRVVQISAVFMIFFSILGKFGAVFASIPAPVVAALYCLF  405

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQ+CNLNSFR  FILGFSIFLGLS+PQYFNEY ++N YGPVHT  RWFN
Sbjct  406  FAYVGAGGLSLLQYCNLNSFRTVFILGFSIFLGLSVPQYFNEYTSVNGYGPVHTKARWFN  465

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFV G VAYFLDTT++KK+  +RKDRGKHWWD+F +FK D+R+EEFYSLP
Sbjct  466  DMVNVPFSSEAFVGGCVAYFLDTTVYKKDGSIRKDRGKHWWDRFWTFKGDSRTEEFYSLP  525

Query  396  FNLNKYFPSV  367
            FNL KYFPSV
Sbjct  526  FNLKKYFPSV  535



>ref|XP_010470161.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Camelina sativa]
Length=539

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTG+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGA+FASIPAPIVAAL+CLF
Sbjct  350  GTGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAIFASIPAPIVAALHCLF  409

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY A+N YGPVH   RWFN
Sbjct  410  FAYVGAGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAVNKYGPVHKHARWFN  469

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAGI+A+FLD T+  K++  RKDRG  WWD+F SFK+DTRSEEFYSLP
Sbjct  470  DMINVPFSSEAFVAGILAFFLDVTLSFKDSATRKDRGMFWWDRFMSFKSDTRSEEFYSLP  529

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  530  FNLNKYFPSV  539



>ref|XP_003552008.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Glycine max]
Length=533

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSF  KFILGFSIF+G SIPQYFNEY A   YGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFTTKFILGFSIFMGFSIPQYFNEYTAFKGYGPVHTRARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF S+AFVAG++A  LD T+ KK+NQ RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  464  DMINVPFQSEAFVAGMLALLLDVTLRKKDNQTRKDRGMHWWDRFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_004135225.1| PREDICTED: nucleobase-ascorbate transporter 7 [Cucumis sativus]
 ref|XP_011655642.1| PREDICTED: nucleobase-ascorbate transporter 7 [Cucumis sativus]
 ref|XP_011655643.1| PREDICTED: nucleobase-ascorbate transporter 7 [Cucumis sativus]
 gb|KGN51831.1| hypothetical protein Csa_5G603280 [Cucumis sativus]
Length=534

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISA FMIFFSILGKFGA+FASIPAPI+AALYC F
Sbjct  345  GNGSSVSIENAGLLALTRVGSRRVVQISASFMIFFSILGKFGAIFASIPAPIIAALYCFF  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+GLSIPQYFNEY A+N YGPVHT  RWFN
Sbjct  405  FAYVGSAGLSFLQFCNLNSFRIKFILGFSIFMGLSIPQYFNEYTAVNGYGPVHTRARWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF+S+ FVAG +A FLD T+H K+N  +KDRG HWWDKFRSFKTDTRSEEFYSLP
Sbjct  465  DMINVPFASEPFVAGFLALFLDVTLHSKDNATKKDRGMHWWDKFRSFKTDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  525  FNLNKFFPSV  534



>ref|XP_004297660.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
 ref|XP_011463385.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
 ref|XP_011463386.1| PREDICTED: nucleobase-ascorbate transporter 6 [Fragaria vesca 
subsp. vesca]
Length=533

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGAVFASIPAPIVAA+YC F
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQISASFMIFFSILGKFGAVFASIPAPIVAAMYCFF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+SLLQFCNLNSFR KFI+GFSIF+GLS+PQYFNEY  +  YGPVHTG RWFN
Sbjct  404  FAYVGSAGLSLLQFCNLNSFRTKFIIGFSIFMGLSVPQYFNEYTLVKGYGPVHTGARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG++A+ LDTT+H+K+N  RKDRG  WWD+FRS+KTDTRSEEFYSLP
Sbjct  464  DMINVPFSSEPFVAGLLAFVLDTTLHRKDNATRKDRGMPWWDRFRSYKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_003519478.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Glycine max]
 ref|XP_006574588.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X3 
[Glycine max]
 gb|KHN28662.1| Nucleobase-ascorbate transporter 7 [Glycine soja]
Length=531

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALT+VGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  342  GNGSSVSVENAGLLALTQVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  401

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR K ILGFSIF+G SIPQYFNEY A  +YGPVHT  RWFN
Sbjct  402  FAYVGSAGLGFLQFCNLNSFRTKLILGFSIFMGFSIPQYFNEYTAFKNYGPVHTHARWFN  461

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSKAFVAG +A FLDTT+H K++Q RKDRG HWWD+F SFKTDTRSEEFYSLP
Sbjct  462  DMINVPFSSKAFVAGSLALFLDTTLHNKDSQTRKDRGMHWWDRFSSFKTDTRSEEFYSLP  521

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  522  FNLNKFFPSV  531



>ref|XP_007221801.1| hypothetical protein PRUPE_ppa004044mg [Prunus persica]
 ref|XP_007221802.1| hypothetical protein PRUPE_ppa004044mg [Prunus persica]
 gb|EMJ23000.1| hypothetical protein PRUPE_ppa004044mg [Prunus persica]
 gb|EMJ23001.1| hypothetical protein PRUPE_ppa004044mg [Prunus persica]
Length=533

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G+GSSVS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGAVFASIPAPI+AALYC F
Sbjct  344  GSGSSVSVENAGLLALTRVGSRRVVQISASFMIFFSILGKFGAVFASIPAPIIAALYCFF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G++LLQ+CNLNSFR KFILGFSI++GLSIPQYFNEY  +  YGPVHTG RWFN
Sbjct  404  FAYVGSAGLTLLQYCNLNSFRTKFILGFSIYMGLSIPQYFNEYTLVKGYGPVHTGARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAG +  FLD T+H+ +N  RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  464  DMVNVPFSSEAFVAGFLGLFLDITLHRNDNATRKDRGMHWWDRFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_009118902.1| PREDICTED: nucleobase-ascorbate transporter 5 [Brassica rapa]
 ref|XP_009118903.1| PREDICTED: nucleobase-ascorbate transporter 5 [Brassica rapa]
Length=529

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGL+ALT+VGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAAL+CLF
Sbjct  340  GIGSSVSVENAGLIALTKVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALFCLF  399

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQ+CNLNSFR  FILGFSIFLGLSIPQYFNE+ AI  YGPVHTG RWFN
Sbjct  400  FAYVGAGGLSLLQYCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKGYGPVHTGARWFN  459

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSSKAFV G VAYFLDTT+HK +  +RKDRGKHWWD+F +FK D R+EEFY+LP
Sbjct  460  DMVNVPFSSKAFVGGCVAYFLDTTLHKNDGSIRKDRGKHWWDRFWTFKGDPRTEEFYALP  519

Query  396  FNLNKYFP  373
            FNL+KYFP
Sbjct  520  FNLHKYFP  527



>gb|KHN45288.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=511

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  322  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  381

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR K ILGFSIF+G S+PQYFNEY A  +YGPVHT  RWFN
Sbjct  382  FAYVGSAGLGFLQFCNLNSFRTKLILGFSIFMGFSVPQYFNEYTAFKNYGPVHTHARWFN  441

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSKAFVAG +A FLD T+H K++Q RKDRG HWWD+F SFKTDTRSEEFYSLP
Sbjct  442  DMINVPFSSKAFVAGSLALFLDATLHNKDSQTRKDRGMHWWDRFSSFKTDTRSEEFYSLP  501

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  502  FNLNKFFPSV  511



>ref|XP_010474016.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Camelina 
sativa]
Length=189

 Score =   320 bits (820),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  912  ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFGYVGAGG  733
            ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGA+FASIPAPIVAAL+CLFF YVGAGG
Sbjct  8    ENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAIFASIPAPIVAALHCLFFAYVGAGG  67

Query  732  VSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDIVNVPFS  553
            +SLLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY A+N YGPVH   RWFND++NVPFS
Sbjct  68   LSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAVNKYGPVHKHARWFNDMINVPFS  127

Query  552  SKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNKYFP  373
            S+AFVAGI+A+FLD T+  K++  RKDRG  WWD+F SFK+DTRSEEFYSLPFNLNKYFP
Sbjct  128  SEAFVAGILAFFLDVTLSFKDSATRKDRGMFWWDRFMSFKSDTRSEEFYSLPFNLNKYFP  187

Query  372  SV  367
            SV
Sbjct  188  SV  189



>ref|XP_011071803.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Sesamum indicum]
 ref|XP_011071804.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Sesamum indicum]
 ref|XP_011071805.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Sesamum indicum]
 ref|XP_011071806.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Sesamum indicum]
 ref|XP_011071807.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Sesamum indicum]
Length=530

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVSIENAGLL LTRVGSRRVVQISAGFM+FFS+LGKFGAVFASIP  I AALYC+FF 
Sbjct  343  GSSVSIENAGLLGLTRVGSRRVVQISAGFMLFFSVLGKFGAVFASIPPSITAALYCVFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG GG+S LQFC LNSFRNKFIL  SIFLGLS+PQYFNEY AIN YGP HT  RWFNDI
Sbjct  403  YVGVGGLSFLQFCQLNSFRNKFILAVSIFLGLSVPQYFNEYTAINGYGPAHTHARWFNDI  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+AFVAGI+A+F D T+ KK+ Q+RKDRGKHWWDKFRSFKTDTRSEEFYSLPFN
Sbjct  463  VNVPFSSEAFVAGILAFFFDNTLDKKDPQIRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  522

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  523  LNKYFPSV  530



>ref|XP_008245218.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Prunus mume]
Length=533

 Score =   332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G+GSSVS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGAVFASIPAPI+AALYC F
Sbjct  344  GSGSSVSVENAGLLALTRVGSRRVVQISASFMIFFSILGKFGAVFASIPAPIIAALYCFF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G++LLQFCNLNSFR KFILGFSI++GLSIPQYFNEY  +  YGPVHTG RWFN
Sbjct  404  FAYVGSAGLTLLQFCNLNSFRTKFILGFSIYMGLSIPQYFNEYTLVKGYGPVHTGARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSS+AFVAG +  FLD T+H+ ++  RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  464  DMVNVPFSSEAFVAGFLGLFLDITLHRNDSATRKDRGMHWWDRFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_009360485.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Pyrus x bretschneideri]
 ref|XP_009360486.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Pyrus x bretschneideri]
 ref|XP_009363509.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Pyrus x bretschneideri]
 ref|XP_009363510.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Pyrus x bretschneideri]
Length=533

 Score =   332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGAVFASIPAPI+AALYC F
Sbjct  344  GNGASVSVENAGLLALTRVGSRRVVQISACFMIFFSILGKFGAVFASIPAPIIAALYCFF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G++LLQFCNLNSFR KFILGFSI++GLSIPQYFNEY  I  YGPVHTG RWFN
Sbjct  404  FAYVGSAGLTLLQFCNLNSFRTKFILGFSIYMGLSIPQYFNEYTLIRGYGPVHTGARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG +A FLD T+H+K++  RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  464  DMINVPFSSEPFVAGFLAVFLDITLHRKDSATRKDRGMHWWDRFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_003517836.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Glycine max]
 ref|XP_006573064.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X3 
[Glycine max]
 ref|XP_006573065.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X4 
[Glycine max]
Length=531

 Score =   332 bits (850),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  342  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  401

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR K ILGFSIF+G S+PQYFNEY A  +YGPVHT  RWFN
Sbjct  402  FAYVGSAGLGFLQFCNLNSFRTKLILGFSIFMGFSVPQYFNEYTAFKNYGPVHTHARWFN  461

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSKAFVAG +A FLD T+H K++Q RKDRG HWWD+F SFKTDTRSEEFYSLP
Sbjct  462  DMINVPFSSKAFVAGSLALFLDATLHNKDSQTRKDRGMHWWDRFSSFKTDTRSEEFYSLP  521

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  522  FNLNKFFPSV  531



>ref|XP_009103320.1| PREDICTED: nucleobase-ascorbate transporter 7 [Brassica rapa]
Length=537

 Score =   332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYCLF
Sbjct  348  GNGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCLF  407

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY AIN YGPVHT  RWFN
Sbjct  408  FAYVGAGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAINKYGPVHTKARWFN  467

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++N PFSS+AFVAG++A+FLD T+  K++  RKDRG  WWD+F SFK+DTRSEEFYSLP
Sbjct  468  DMINAPFSSEAFVAGMLAFFLDVTLSSKDSATRKDRGVFWWDRFMSFKSDTRSEEFYSLP  527

Query  396  FNLNKYFPSV  367
            FNLNKYFPS+
Sbjct  528  FNLNKYFPSL  537



>emb|CDY24508.1| BnaA01g22120D [Brassica napus]
Length=537

 Score =   332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYCLF
Sbjct  348  GNGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCLF  407

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY AIN YGPVHT  RWFN
Sbjct  408  FAYVGAGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAINKYGPVHTKARWFN  467

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++N PFSS+AFVAG++A+FLD T+  K++  RKDRG  WWD+F SFK+DTRSEEFYSLP
Sbjct  468  DMINAPFSSEAFVAGMLAFFLDVTLSSKDSATRKDRGVFWWDRFMSFKSDTRSEEFYSLP  527

Query  396  FNLNKYFPSV  367
            FNLNKYFPS+
Sbjct  528  FNLNKYFPSL  537



>ref|XP_008389596.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Malus domestica]
 ref|XP_008389597.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Malus domestica]
Length=533

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGAVFASIPAPI+AALYC F
Sbjct  344  GNGASVSVENAGLLALTRVGSRRVVQISACFMIFFSILGKFGAVFASIPAPIIAALYCFF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G++LLQFCNLNSFR KFILGFSI++GLSIPQYFNEY  I  YGPVHTG RWFN
Sbjct  404  FAYVGSAGLTLLQFCNLNSFRTKFILGFSIYMGLSIPQYFNEYTLIRGYGPVHTGARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG +A FLD T+H+K++  RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  464  DMINVPFSSEPFVAGFLAVFLDITLHRKDSATRKDRGMHWWDRFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_010272020.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nelumbo nucifera]
 ref|XP_010272021.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nelumbo nucifera]
Length=535

 Score =   331 bits (849),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGAVFASIPAPI+AA YCLFF 
Sbjct  348  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAVFASIPAPIIAAFYCLFFA  407

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG+ G+S LQFCNLNSFR KFILGFS F+GLS+PQYFNEY A+N YGPVHT  RWFNDI
Sbjct  408  YVGSAGLSFLQFCNLNSFRTKFILGFSFFMGLSVPQYFNEYTAVNGYGPVHTRARWFNDI  467

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSS+AFVAGI+A FLD T+H+K++  RKD G HWW KFRSFKTDTRSEEFYSLPFN
Sbjct  468  INVPFSSEAFVAGILALFLDITLHRKDSATRKDSGMHWWVKFRSFKTDTRSEEFYSLPFN  527

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  528  LNKFFPSV  535



>ref|XP_006573063.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Glycine max]
Length=569

 Score =   332 bits (851),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  380  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  439

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR K ILGFSIF+G S+PQYFNEY A  +YGPVHT  RWFN
Sbjct  440  FAYVGSAGLGFLQFCNLNSFRTKLILGFSIFMGFSVPQYFNEYTAFKNYGPVHTHARWFN  499

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSKAFVAG +A FLD T+H K++Q RKDRG HWWD+F SFKTDTRSEEFYSLP
Sbjct  500  DMINVPFSSKAFVAGSLALFLDATLHNKDSQTRKDRGMHWWDRFSSFKTDTRSEEFYSLP  559

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  560  FNLNKFFPSV  569



>ref|XP_006300441.1| hypothetical protein CARUB_v10020111mg [Capsella rubella]
 gb|EOA33339.1| hypothetical protein CARUB_v10020111mg [Capsella rubella]
Length=537

 Score =   331 bits (848),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+S+S+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGA+FASIPAPIVAAL+CLF
Sbjct  348  GNGASISVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAIFASIPAPIVAALHCLF  407

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+GG+SLLQFCNLNSFR KFILGFS F+GLS+PQYFNEY A+N YGPVHT  RWFN
Sbjct  408  FAYVGSGGLSLLQFCNLNSFRTKFILGFSFFMGLSVPQYFNEYTAVNKYGPVHTHARWFN  467

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAGI+A+FLD T+  K++  RKDRG  WWD+F SFK+DTRSEEFYSLP
Sbjct  468  DMINVPFSSEAFVAGILAFFLDVTLSSKDSATRKDRGMVWWDRFMSFKSDTRSEEFYSLP  527

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  528  FNLNKYFPSV  537



>ref|XP_006392193.1| hypothetical protein EUTSA_v10023405mg [Eutrema salsugineum]
 gb|ESQ29479.1| hypothetical protein EUTSA_v10023405mg [Eutrema salsugineum]
Length=537

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AAL+CLF
Sbjct  348  GNGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALHCLF  407

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+GG+SLLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY A+N YGPVHT  RWFN
Sbjct  408  FAYVGSGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAVNKYGPVHTRARWFN  467

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAGI+A+FLD T+  K++  RKDRG  WWD+F SFK+D+RSEEFYSLP
Sbjct  468  DMINVPFSSEAFVAGILAFFLDVTLTSKDSATRKDRGMFWWDRFMSFKSDSRSEEFYSLP  527

Query  396  FNLNKYFPSV  367
            FNLNKYFPS+
Sbjct  528  FNLNKYFPSL  537



>ref|XP_010472295.1| PREDICTED: nucleobase-ascorbate transporter 5-like [Camelina 
sativa]
Length=496

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = -1

Query  921  VSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFGYVG  742
            +S+ENAGLLALT+VGSRRVVQISAGFMIFFS+LGKFGAVFASIP+PI+AALYCLFF YVG
Sbjct  312  ISMENAGLLALTKVGSRRVVQISAGFMIFFSVLGKFGAVFASIPSPIIAALYCLFFAYVG  371

Query  741  AGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDIVNV  562
            AGG+SLLQFCNLNSFR  FILGFSIFLGLSIPQYFNE+ AI  YGPVHTG RWFND+VNV
Sbjct  372  AGGLSLLQFCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKGYGPVHTGARWFNDMVNV  431

Query  561  PFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNK  382
            PFSSKAFV G VAY LDTT+HKK+  +RKDRGKHWWD+F +FK D R+EEFY+LPFNLNK
Sbjct  432  PFSSKAFVGGCVAYLLDTTLHKKDGSIRKDRGKHWWDRFWTFKNDPRTEEFYALPFNLNK  491

Query  381  YFPS  370
            YFPS
Sbjct  492  YFPS  495



>ref|XP_008806500.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Phoenix dactylifera]
Length=533

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLFF 
Sbjct  346  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLFFA  405

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  G+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHT  RWFNDI
Sbjct  406  YVGVAGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTHARWFNDI  465

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSKAFVAG VA+FLD T+H++++  RKDRG HWWD+FRSFKTD+RSEEFYSLPFN
Sbjct  466  INVIFSSKAFVAGFVAFFLDNTLHRRDSATRKDRGYHWWDRFRSFKTDSRSEEFYSLPFN  525

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  526  LNKFFPSV  533



>ref|XP_004953888.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Setaria italica]
Length=536

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYC+F
Sbjct  347  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCIF  406

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F Y G+ G+  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHT  RWFN
Sbjct  407  FAYAGSAGLGFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTHSRWFN  466

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNV FSSKAFVAG VAY LD T+H+ EN VRKDRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  467  DIVNVLFSSKAFVAGFVAYLLDNTIHRHENSVRKDRGYHWWDKFRSYRTDTRSEEFYSLP  526

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  527  FNLNKFFPSV  536



>ref|XP_006574587.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Glycine max]
Length=617

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALT+VGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  428  GNGSSVSVENAGLLALTQVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  487

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR K ILGFSIF+G SIPQYFNEY A  +YGPVHT  RWFN
Sbjct  488  FAYVGSAGLGFLQFCNLNSFRTKLILGFSIFMGFSIPQYFNEYTAFKNYGPVHTHARWFN  547

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSKAFVAG +A FLDTT+H K++Q RKDRG HWWD+F SFKTDTRSEEFYSLP
Sbjct  548  DMINVPFSSKAFVAGSLALFLDTTLHNKDSQTRKDRGMHWWDRFSSFKTDTRSEEFYSLP  607

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  608  FNLNKFFPSV  617



>emb|CDX71592.1| BnaC09g26330D [Brassica napus]
Length=530

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGK-FGAVFASIPAPIVAALYCL  760
            G GSSVS+ENAGLLALT+VGSRRVVQISAGFMIFFSILGK FGAVFASIPAPIVAAL+CL
Sbjct  340  GIGSSVSVENAGLLALTKVGSRRVVQISAGFMIFFSILGKLFGAVFASIPAPIVAALFCL  399

Query  759  FFGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWF  580
            FF YVGAGG+SLLQ+CNLNSFR  FILGFSIFLGLSIPQYFNE+ AI  YGP+HTG RWF
Sbjct  400  FFAYVGAGGLSLLQYCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKGYGPIHTGARWF  459

Query  579  NDIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSL  400
            ND+VNVPFSSKAFV G VAYFLDTT+HKK+  +RKDRGKHWWD+F +FK D R+EEFY+L
Sbjct  460  NDMVNVPFSSKAFVGGCVAYFLDTTLHKKDGSIRKDRGKHWWDRFWTFKGDPRTEEFYAL  519

Query  399  PFNLNKYFP  373
            PFNL+KYFP
Sbjct  520  PFNLHKYFP  528



>ref|XP_008339995.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Malus domestica]
Length=533

 Score =   329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGAVFASIPAPI+AA YC F
Sbjct  344  GNGASVSVENAGLLALTRVGSRRVVQISACFMIFFSILGKFGAVFASIPAPIIAASYCFF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G++ LQFCNLNSFR KFILGFSI++GLSIPQYFNEY  I  YGPVHTG RWFN
Sbjct  404  FAYVGSAGLTFLQFCNLNSFRTKFILGFSIYMGLSIPQYFNEYTLIKXYGPVHTGARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG +A FLD T+H+K+N  RKDRG HWWD+FRSFKTDTRSEEFYSLP
Sbjct  464  DMINVPFSSEPFVAGFLAMFLDITLHRKDNATRKDRGMHWWDRFRSFKTDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>emb|CDY33617.1| BnaC01g28480D [Brassica napus]
Length=537

 Score =   329 bits (844),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYCLF
Sbjct  348  GNGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCLF  407

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY AIN YGPVHT  RWFN
Sbjct  408  FAYVGAGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAINKYGPVHTKARWFN  467

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFV+G++A+FLD T+  K+   RKDRG  WWD+F SF +DTRSEEFYSLP
Sbjct  468  DMINVPFSSEAFVSGMLAFFLDVTLSSKDIATRKDRGVFWWDRFMSFNSDTRSEEFYSLP  527

Query  396  FNLNKYFPSV  367
            FNLNKYFPS+
Sbjct  528  FNLNKYFPSL  537



>gb|KFK40823.1| hypothetical protein AALP_AA2G046200 [Arabis alpina]
Length=534

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G++VS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGA+FASIPAPIVAALYCLF
Sbjct  345  GNGAAVSVENAGLLALTRVGSRRVVQISAVFMIFFSILGKFGALFASIPAPIVAALYCLF  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFS+F+GLSIP YFN+Y AIN YGPVHT  RWFN
Sbjct  405  FAYVGAGGLSLLQFCNLNSFRTKFILGFSVFMGLSIPHYFNQYTAINKYGPVHTRARWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAGI+A+FLD T+  K+++ RKDRG  WWD+FRSFK DTRSEEFYSLP
Sbjct  465  DMINVPFSSEAFVAGILAFFLDVTLTSKDSETRKDRGMFWWDRFRSFKLDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
            F+LNKYFPS+
Sbjct  525  FHLNKYFPSM  534



>gb|AFW73351.1| hypothetical protein ZEAMMB73_676690 [Zea mays]
Length=326

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AA+YC+F
Sbjct  137  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAAMYCIF  196

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F Y G+ G+  LQFCNLN+FR KFILGFS+F+GLS+PQYFNEY +I  YGPVHT  RWFN
Sbjct  197  FAYAGSAGIGFLQFCNLNTFRTKFILGFSVFMGLSVPQYFNEYTSIAGYGPVHTHSRWFN  256

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNV FSSKAFVAG VAY LD T+ + E  VR+DRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  257  DIVNVIFSSKAFVAGFVAYLLDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSEEFYSLP  316

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  317  FNLNKFFPSV  326



>ref|XP_008806320.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008806321.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008806322.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Phoenix dactylifera]
Length=483

 Score =   327 bits (838),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GS+VS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYC+FF 
Sbjct  296  GSTVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAALYCIFFA  355

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++ SYGPVHTG RWFNDI
Sbjct  356  YVGAAGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVASYGPVHTGARWFNDI  415

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNV FSS+AFVAG+VAYFLD T+H+ ++  RKDRG+H+WD+FRSF  D+RSEEFYSLPFN
Sbjct  416  VNVIFSSEAFVAGLVAYFLDNTLHRHDSATRKDRGRHFWDRFRSFNADSRSEEFYSLPFN  475

Query  390  LNKYFPSV  367
            L+K+FPSV
Sbjct  476  LHKFFPSV  483



>ref|NP_001048084.1| Os02g0741800 [Oryza sativa Japonica Group]
 dbj|BAD15728.1| putative permease 1 [Oryza sativa Japonica Group]
 dbj|BAD15771.1| putative permease 1 [Oryza sativa Japonica Group]
 dbj|BAF09998.1| Os02g0741800 [Oryza sativa Japonica Group]
 dbj|BAG93519.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73980.1| hypothetical protein OsI_08888 [Oryza sativa Indica Group]
 gb|EEE57787.1| hypothetical protein OsJ_08338 [Oryza sativa Japonica Group]
Length=538

 Score =   328 bits (842),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI AALYC+F
Sbjct  349  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIFAALYCIF  408

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ GV  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHT  RWFN
Sbjct  409  FAYVGSAGVGFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTHSRWFN  468

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNV FSSKAFVAG VAY LD T+H+ ++ VRKDRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  469  DIVNVIFSSKAFVAGFVAYLLDNTIHRHDSSVRKDRGHHWWDKFRSYRTDTRSEEFYSLP  528

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  529  FNLNKFFPSV  538



>emb|CAJ84113.1| root uracil permease 1 [Oryza sativa Japonica Group]
Length=538

 Score =   328 bits (842),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI AALYC+F
Sbjct  349  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIFAALYCIF  408

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ GV  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHT  RWFN
Sbjct  409  FAYVGSAGVGFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTHSRWFN  468

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNV FSSKAFVAG VAY LD T+H+ ++ VRKDRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  469  DIVNVIFSSKAFVAGFVAYLLDNTIHRHDSSVRKDRGHHWWDKFRSYRTDTRSEEFYSLP  528

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  529  FNLNKFFPSV  538



>ref|XP_010254659.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nelumbo nucifera]
Length=534

 Score =   328 bits (842),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 1/188 (1%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS ENAGLLALTRVGSRRV+QISAGFM+FFS+LGKFGAVFASIPAPI+AA YC+FF 
Sbjct  348  GSSVSPENAGLLALTRVGSRRVIQISAGFMLFFSVLGKFGAVFASIPAPIIAAFYCVFFA  407

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            Y G+ G+S LQFCNLNSFR KFILGFS+FLGLS+PQYFNEY A+N YGPVHTG RWFND+
Sbjct  408  YAGSVGLSFLQFCNLNSFRTKFILGFSVFLGLSVPQYFNEYTAVNGYGPVHTGARWFNDM  467

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSS+AFVAG++A FLD TMH K++  RKDRG HWWDKFRSFKTDTRSEEFYSLPFN
Sbjct  468  INVPFSSEAFVAGLLALFLDITMH-KDSSTRKDRGLHWWDKFRSFKTDTRSEEFYSLPFN  526

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  527  LNKFFPSV  534



>gb|ACR38061.1| unknown [Zea mays]
Length=242

 Score =   318 bits (815),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+EN GLLALTR+GSRRVVQISAGFMIFFS+LGKFGA+FASIP P+ A +YCLFF 
Sbjct  55   GTSVSVENIGLLALTRIGSRRVVQISAGFMIFFSVLGKFGALFASIPLPVFAGMYCLFFA  114

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  G+SLLQFCNLNSFR KFI+GF+ F+GLS+PQYFNEY A+ SYGPVHTG RWFND+
Sbjct  115  YVGGVGLSLLQFCNLNSFRTKFIMGFAFFMGLSVPQYFNEYTAVASYGPVHTGARWFNDM  174

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPF+SK FVAG+VAY LD T+  KE+ VRKDRG HWW+KFRSFK D RS+EFYSLPFN
Sbjct  175  INVPFTSKPFVAGLVAYILDNTLQVKESAVRKDRGNHWWEKFRSFKKDARSQEFYSLPFN  234

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  235  LNKFFPSV  242



>ref|XP_003613313.1| Nucleobase ascorbate transporter [Medicago truncatula]
 gb|AES96271.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=538

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PIVAALYCL 
Sbjct  349  GNGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPMPIVAALYCLL  408

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F  VG+ G+S LQFCNLNSFR KFI+GFSIF+G S+PQYF EY AI  YGPVHT  RWFN
Sbjct  409  FSQVGSAGLSFLQFCNLNSFRTKFIIGFSIFMGFSVPQYFKEYTAIKQYGPVHTNARWFN  468

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS AFVAGI+A F D T+HK +NQ RKDRG HWWD+F SFKTDTRSEEFYSLP
Sbjct  469  DMINVPFSSGAFVAGILALFFDVTLHKSDNQTRKDRGMHWWDRFSSFKTDTRSEEFYSLP  528

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  529  FNLNKFFPSV  538



>ref|XP_002452570.1| hypothetical protein SORBIDRAFT_04g028300 [Sorghum bicolor]
 gb|EES05546.1| hypothetical protein SORBIDRAFT_04g028300 [Sorghum bicolor]
Length=537

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYC+F
Sbjct  348  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCIF  407

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F Y G+ G   LQFCNLNSFR KFILGFS+F+GLSIPQYFNEY ++  YGPVHT  RWFN
Sbjct  408  FAYAGSAGFGFLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTSVAGYGPVHTHSRWFN  467

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNV FSSKAFVAG VAY LD T+H+ E+ VRKDRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  468  DIVNVIFSSKAFVAGFVAYLLDNTIHRHESSVRKDRGYHWWDKFRSYRTDTRSEEFYSLP  527

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  528  FNLNKFFPSV  537



>emb|CDY37762.1| BnaA10g05590D [Brassica napus]
Length=530

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGK-FGAVFASIPAPIVAALYCL  760
            G GSSVS+ENAGL+ALT+VGSRRVVQISAGFMIFFSILGK FGAVFASIPAPIVAAL+CL
Sbjct  340  GIGSSVSVENAGLIALTKVGSRRVVQISAGFMIFFSILGKLFGAVFASIPAPIVAALFCL  399

Query  759  FFGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWF  580
            FF YVGAGG+SLLQ+CNLNSFR  FILGFSIFLGLSIPQYFNE+ AI  YGPVHTG RWF
Sbjct  400  FFAYVGAGGLSLLQYCNLNSFRTLFILGFSIFLGLSIPQYFNEHTAIKGYGPVHTGARWF  459

Query  579  NDIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSL  400
            ND+VNVPFSSKAFV G VAYFLDTT+HK +  +RKDRGKHWWD+F +FK D R+EEFY+L
Sbjct  460  NDMVNVPFSSKAFVGGCVAYFLDTTLHKNDGSIRKDRGKHWWDRFWTFKGDPRTEEFYAL  519

Query  399  PFNLNKYFP  373
            PFNL+KYFP
Sbjct  520  PFNLHKYFP  528



>ref|XP_011086504.1| PREDICTED: nucleobase-ascorbate transporter 7 [Sesamum indicum]
 ref|XP_011086505.1| PREDICTED: nucleobase-ascorbate transporter 7 [Sesamum indicum]
Length=534

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLL LTRVGSRRV+QISAGFMIFFSILGKFGAVFASIPAPI+AALYCL 
Sbjct  345  GNGSSVSVENAGLLGLTRVGSRRVIQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLL  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+  LQFCNLNSFR KFIL FSIF+GLSIPQYFNEY+++  YGPVHT  RWFN
Sbjct  405  FAYVGAGGLGFLQFCNLNSFRTKFILAFSIFMGLSIPQYFNEYLSVKGYGPVHTNARWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG++A  LD T+  K+N  RKDRG HWWDKFRS+KTDTRSEEFYSLP
Sbjct  465  DMINVPFSSEPFVAGVLALVLDVTLPPKDNTTRKDRGMHWWDKFRSYKTDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
             NLNK+FPSV
Sbjct  525  LNLNKFFPSV  534



>ref|XP_007153664.1| hypothetical protein PHAVU_003G054500g [Phaseolus vulgaris]
 gb|ESW25658.1| hypothetical protein PHAVU_003G054500g [Phaseolus vulgaris]
Length=534

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGAVFASIPAPIVAALYCLF
Sbjct  345  GNGSSVSVENAGLLALTRVGSRRVVQISAAFMIFFSILGKFGAVFASIPAPIVAALYCLF  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR KFILGFSIF+G SIPQYFNEY A   YGPVHT  RWFN
Sbjct  405  FAYVGSAGLGFLQFCNLNSFRTKFILGFSIFMGFSIPQYFNEYTAFKGYGPVHTRARWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPF+S+AFVAG +A  LD T+ KK+NQ RKDRG  WWDKFRSFKTDTRSEEFYSLP
Sbjct  465  DMMNVPFASEAFVAGTLALVLDVTLRKKDNQSRKDRGMQWWDKFRSFKTDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  525  FNLNKFFPSV  534



>ref|XP_003574490.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brachypodium 
distachyon]
Length=533

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G++VS+ENAGLLALT VGSRRVVQISAGFMIFFSILGKFGA+FASIP PI AALYC+FF 
Sbjct  346  GTAVSVENAGLLALTHVGSRRVVQISAGFMIFFSILGKFGAIFASIPLPIFAALYCIFFA  405

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            Y+GA G+S LQFCNLNSFR KFI+GFS F+GLS+PQYFNEY ++  +GPVHTG RWFND+
Sbjct  406  YIGACGLSFLQFCNLNSFRTKFIVGFSFFMGLSVPQYFNEYTSVAGHGPVHTGARWFNDM  465

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSSK FVAGIV YFLD TMH++++ VR+DRG HWWDKFRSFKTDTRSEEFYSLPFN
Sbjct  466  INVPFSSKPFVAGIVGYFLDNTMHRRDSAVRRDRGYHWWDKFRSFKTDTRSEEFYSLPFN  525

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  526  LNKFFPSV  533



>ref|XP_008806323.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Phoenix dactylifera]
Length=540

 Score =   327 bits (837),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GS+VS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYC+FF 
Sbjct  353  GSTVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAALYCIFFA  412

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++ SYGPVHTG RWFNDI
Sbjct  413  YVGAAGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVASYGPVHTGARWFNDI  472

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNV FSS+AFVAG+VAYFLD T+H+ ++  RKDRG+H+WD+FRSF  D+RSEEFYSLPFN
Sbjct  473  VNVIFSSEAFVAGLVAYFLDNTLHRHDSATRKDRGRHFWDRFRSFNADSRSEEFYSLPFN  532

Query  390  LNKYFPSV  367
            L+K+FPSV
Sbjct  533  LHKFFPSV  540



>ref|XP_006647871.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Oryza brachyantha]
Length=537

 Score =   327 bits (837),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI AALYC+F
Sbjct  348  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPPIFAALYCIF  407

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHT  RWFN
Sbjct  408  FAYVGSAGLGFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTHARWFN  467

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNV FSSKAFVAG VAY LD T+H+ +  VRKDRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  468  DIVNVIFSSKAFVAGFVAYLLDNTIHRHDGSVRKDRGYHWWDKFRSYRTDTRSEEFYSLP  527

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  528  FNLNKFFPSV  537



>ref|XP_010510979.1| PREDICTED: nucleobase-ascorbate transporter 7 [Camelina sativa]
Length=537

 Score =   326 bits (835),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTG+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGA+FASIPAPIV A +CLF
Sbjct  348  GTGASVSVENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAIFASIPAPIVVAFHCLF  407

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR  FILGFS+F+GLSIPQYFNEY A+N YGPVHT  RWFN
Sbjct  408  FAYVGAGGLSLLQFCNLNSFRTIFILGFSVFMGLSIPQYFNEYTAVNKYGPVHTHARWFN  467

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVA I+A+FLD T+  K++  RKDRG  WWD+F SFK+DTRSEEFYSLP
Sbjct  468  DMINVPFSSETFVASILAFFLDVTLSCKDSATRKDRGMFWWDRFMSFKSDTRSEEFYSLP  527

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  528  FNLNKYFPSV  537



>ref|XP_010037590.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Eucalyptus 
grandis]
 gb|KCW49319.1| hypothetical protein EUGRSUZ_K02873 [Eucalyptus grandis]
Length=526

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G SVS+ENAGLLA+TRVGSRRVVQI+AGFMIFFS+LGKFGA+FASIPAPIVAALYC+FF 
Sbjct  339  GCSVSVENAGLLAVTRVGSRRVVQIAAGFMIFFSVLGKFGAIFASIPAPIVAALYCVFFA  398

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG+ G++LLQFCNL SFR KF+LGFSIF+GLS+PQYFNEY AIN YGPVHTG RWFND+
Sbjct  399  YVGSVGLTLLQFCNLLSFRTKFVLGFSIFMGLSVPQYFNEYTAINGYGPVHTGARWFNDM  458

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVP SS+ F+AG +AYFLD T+ KK+ Q+RKDRGK WWDKF+SF  DTRS+EFYSLPFN
Sbjct  459  INVPLSSEPFIAGCLAYFLDNTLLKKDGQIRKDRGKEWWDKFKSFSGDTRSQEFYSLPFN  518

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  519  LNKYFPSV  526



>ref|XP_009418014.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=531

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYCLFF 
Sbjct  344  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA GVS LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHTG RWFNDI
Sbjct  404  YVGAAGVSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDI  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSK FVAG VA+FLD T+H+ ++ VRKDRG HWW KFRSFK D+RS+EFY LPFN
Sbjct  464  INVIFSSKPFVAGFVAFFLDNTLHRNDSTVRKDRGYHWWQKFRSFKGDSRSDEFYRLPFN  523

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  524  LNKFFPSV  531



>ref|XP_010929097.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010929098.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010929099.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010929100.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
Length=531

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GS+VS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYC+FF 
Sbjct  344  GSTVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAALYCIFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY A+  YGPVHTG RWFNDI
Sbjct  404  YVGAAGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTAVAGYGPVHTGARWFNDI  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNV FSS+A VAG+VAYFLD T+H+ ++ +RKDRG+H+WD+FRSF  D+RSEEFYSLPFN
Sbjct  464  VNVIFSSEALVAGLVAYFLDNTLHRHDSAIRKDRGRHFWDRFRSFNADSRSEEFYSLPFN  523

Query  390  LNKYFPSV  367
            L+K+FPSV
Sbjct  524  LHKFFPSV  531



>gb|EYU42538.1| hypothetical protein MIMGU_mgv1a004467mg [Erythranthe guttata]
Length=525

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVSIEN GL+ LTRVGSRRVVQISA FM+FFS+LGKFGAVFASIPAPIVAALYC+FF 
Sbjct  338  GSSVSIENVGLIGLTRVGSRRVVQISAVFMLFFSVLGKFGAVFASIPAPIVAALYCIFFA  397

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            Y GAGG S LQFC LNSFRNKFIL   IFLGLS+PQYFNEY AI  Y PVHT  RWFNDI
Sbjct  398  YAGAGGFSFLQFCQLNSFRNKFILAVPIFLGLSVPQYFNEYTAIKGYSPVHTSARWFNDI  457

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNVPFSS+AF+AG++A+  D T+ KK+ Q+RKDRGKHWWDKF++FKTDTRSEEFYSLPFN
Sbjct  458  VNVPFSSEAFIAGVLAFLFDNTLEKKDPQIRKDRGKHWWDKFKTFKTDTRSEEFYSLPFN  517

Query  390  LNKYFPSV  367
            LNKYFPSV
Sbjct  518  LNKYFPSV  525



>ref|XP_008643648.1| PREDICTED: LOC100282103 isoform X1 [Zea mays]
Length=483

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AA+YC+F
Sbjct  294  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAAMYCIF  353

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F Y G+ G+  LQFCNLN+FR KFILGFS+F+GLS+PQYFNEY +I  YGPVHT  RWFN
Sbjct  354  FAYAGSAGIGFLQFCNLNTFRTKFILGFSVFMGLSVPQYFNEYTSIAGYGPVHTHSRWFN  413

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNV FSSKAFVAG VAY LD T+ + E  VR+DRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  414  DIVNVIFSSKAFVAGFVAYLLDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSEEFYSLP  473

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  474  FNLNKFFPSV  483



>ref|NP_001061818.1| Os08g0420600 [Oryza sativa Japonica Group]
 dbj|BAC99450.1| putative permease [Oryza sativa Japonica Group]
 dbj|BAF23732.1| Os08g0420600 [Oryza sativa Japonica Group]
 gb|EAZ42764.1| hypothetical protein OsJ_27344 [Oryza sativa Japonica Group]
 dbj|BAG93520.1| unnamed protein product [Oryza sativa Japonica Group]
Length=533

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G++VS+ENAGLLALT VGSRRVVQISAGFMIFFSILGKFGA+FASIP PI AALYC+FF 
Sbjct  346  GTAVSVENAGLLALTHVGSRRVVQISAGFMIFFSILGKFGAIFASIPLPIFAALYCIFFA  405

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            Y+GA G+S LQFCNLNSFR KFI+GFS F+GLS+PQYFNEY ++  YGPVHTG RWFND+
Sbjct  406  YIGACGLSFLQFCNLNSFRTKFIVGFSFFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDM  465

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPF+SK FVAG++AYFLD T+ +++N VR+DRG HWWDKFRSFKTDTRSEEFYSLPFN
Sbjct  466  INVPFASKPFVAGLIAYFLDNTIQRRDNGVRRDRGYHWWDKFRSFKTDTRSEEFYSLPFN  525

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  526  LNKFFPSV  533



>ref|XP_010682619.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682620.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682621.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682622.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682623.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Beta vulgaris 
subsp. vulgaris]
Length=533

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQI+A FMIFFSILGKFGAVFASIPAP+VAALYCLF
Sbjct  344  GNGSSVSVENAGLLALTRVGSRRVVQIAAVFMIFFSILGKFGAVFASIPAPMVAALYCLF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFSIF+GLSIPQYFNEY  +  YGPVHT  RWFN
Sbjct  404  FAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGLSIPQYFNEYTVVKGYGPVHTHARWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+ FVAG++A+FLD T+ KK++ +RKDRG  WWD+FRSFK+DTRSEEFYSLP
Sbjct  464  DMINVPFSSEPFVAGLLAFFLDVTLRKKDSAIRKDRGVIWWDRFRSFKSDTRSEEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>gb|EEC83594.1| hypothetical protein OsI_29273 [Oryza sativa Indica Group]
Length=543

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G++VS+ENAGLLALT VGSRRVVQISAGFMIFFSILGKFGA+FASIP PI AALYC+FF 
Sbjct  356  GTAVSVENAGLLALTHVGSRRVVQISAGFMIFFSILGKFGAIFASIPLPIFAALYCIFFA  415

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            Y+GA G+S LQFCNLNSFR KFI+GFS F+GLS+PQYFNEY ++  YGPVHTG RWFND+
Sbjct  416  YIGACGLSFLQFCNLNSFRTKFIVGFSFFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDM  475

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPF+SK FVAG++AYFLD T+ +++N VR+DRG HWWDKFRSFKTDTRSEEFYSLPFN
Sbjct  476  INVPFASKPFVAGLIAYFLDNTIQRRDNGVRRDRGYHWWDKFRSFKTDTRSEEFYSLPFN  535

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  536  LNKFFPSV  543



>ref|XP_006659402.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Oryza brachyantha]
Length=533

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G++VS+ENAGLLALT VGSRRVVQISAGFMIFFSILGKFGA+FASIP PI AALYC+FF 
Sbjct  346  GTAVSVENAGLLALTHVGSRRVVQISAGFMIFFSILGKFGAIFASIPLPIFAALYCIFFA  405

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            Y+GA G+S LQFCNLNSFR KFI+GFS F+GLS+PQYFNEY ++  YGPVHTG RWFND+
Sbjct  406  YIGACGLSFLQFCNLNSFRTKFIVGFSFFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDM  465

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSSK FVAG+VAYFLD T+ +++N  R+DRG HWWDKFRSFKTDTRSEEFYSLPFN
Sbjct  466  INVPFSSKPFVAGLVAYFLDNTIQRRDNGARRDRGYHWWDKFRSFKTDTRSEEFYSLPFN  525

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  526  LNKFFPSV  533



>gb|EEC84500.1| hypothetical protein OsI_31190 [Oryza sativa Indica Group]
Length=216

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
              G+SVS+EN GLLALT VGSRRVVQISAGFMIFF+ILGKFGA+FASIP PI A +YC+F
Sbjct  27   ANGTSVSVENVGLLALTHVGSRRVVQISAGFMIFFAILGKFGALFASIPLPIFAGMYCIF  86

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGA G+S LQFCNLNSFR KFILGF+ F+G+S+PQYFNEY A+  YGPVHTG RWFN
Sbjct  87   FAYVGACGLSFLQFCNLNSFRTKFILGFAFFMGISVPQYFNEYTAVAGYGPVHTGARWFN  146

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSSK FVAG+VAYFLD T+    N VRKDRG HWWDKFRSFK D RSEEFYSLP
Sbjct  147  DMINVPFSSKPFVAGLVAYFLDNTIETHNNTVRKDRGYHWWDKFRSFKKDARSEEFYSLP  206

Query  396  FNLNKYFPSV  367
            FNLNK+FP+V
Sbjct  207  FNLNKFFPAV  216



>dbj|BAJ85445.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=536

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYC+F
Sbjct  347  GNGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCVF  406

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR KFILGFS+F+G S+PQYFNEY ++  +GPVHT  RWFN
Sbjct  407  FAYVGSAGLGFLQFCNLNSFRTKFILGFSVFMGFSVPQYFNEYTSVAGFGPVHTRARWFN  466

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNV FSSKAFV GIVAY LD T+H+ +  VRKDRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  467  DMVNVLFSSKAFVGGIVAYVLDNTLHRHDGAVRKDRGYHWWDKFRSYRTDTRSEEFYSLP  526

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  527  FNLNKFFPSV  536



>gb|EMS61607.1| Nucleobase-ascorbate transporter 6 [Triticum urartu]
Length=537

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYC+F
Sbjct  348  GNGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCVF  407

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR KFILGFS+F+G S+PQYFNEY ++  +GPVHT  RWFN
Sbjct  408  FAYVGSAGLGFLQFCNLNSFRTKFILGFSVFMGFSVPQYFNEYTSVAGFGPVHTRARWFN  467

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNV FSSKAFV GIVAY LD T+H+ +  VRKDRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  468  DMVNVLFSSKAFVGGIVAYVLDNTLHRHDGAVRKDRGYHWWDKFRSYRTDTRSEEFYSLP  527

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  528  FNLNKFFPSV  537



>ref|XP_010470160.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X1 
[Camelina sativa]
Length=464

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  912  ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFGYVGAGG  733
            ENAGLLALTRVGSRRVVQISAGFMIFFS+LGKFGA+FASIPAPIVAAL+CLFF YVGAGG
Sbjct  283  ENAGLLALTRVGSRRVVQISAGFMIFFSVLGKFGAIFASIPAPIVAALHCLFFAYVGAGG  342

Query  732  VSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDIVNVPFS  553
            +SLLQFCNLNSFR KFILGFS+F+GLSIPQYFNEY A+N YGPVH   RWFND++NVPFS
Sbjct  343  LSLLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAVNKYGPVHKHARWFNDMINVPFS  402

Query  552  SKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNKYFP  373
            S+AFVAGI+A+FLD T+  K++  RKDRG  WWD+F SFK+DTRSEEFYSLPFNLNKYFP
Sbjct  403  SEAFVAGILAFFLDVTLSFKDSATRKDRGMFWWDRFMSFKSDTRSEEFYSLPFNLNKYFP  462

Query  372  SV  367
            SV
Sbjct  463  SV  464



>gb|ACN28348.1| unknown [Zea mays]
Length=528

 Score =   323 bits (827),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AA+YC+F
Sbjct  339  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAAMYCIF  398

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F Y G+ G+  LQFCNLN+FR KFILGFS+F+GLS+PQYFNEY +I  YGPVHT  RWFN
Sbjct  399  FAYAGSAGIGFLQFCNLNTFRTKFILGFSVFMGLSVPQYFNEYTSIAGYGPVHTHSRWFN  458

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNV FSSKAFVAG VAY LD T+ + E  VR+DRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  459  DIVNVIFSSKAFVAGFVAYLLDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSEEFYSLP  518

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  519  FNLNKFFPSV  528



>ref|XP_003573107.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brachypodium 
distachyon]
Length=539

 Score =   323 bits (828),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYC+FF 
Sbjct  352  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCVFFA  411

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG+ G+  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  +GPVHT  RWFND+
Sbjct  412  YVGSAGLGFLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYTSVAGFGPVHTRARWFNDM  471

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNV FSSKAFV G+VAY LD T+H+ ++ VRKDRG HWWDKFRS++TDTRSEEFYSLPFN
Sbjct  472  VNVLFSSKAFVGGVVAYVLDNTLHRHDSVVRKDRGYHWWDKFRSYRTDTRSEEFYSLPFN  531

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  532  LNKFFPSV  539



>gb|ACN34480.1| unknown [Zea mays]
 gb|ACN34637.1| unknown [Zea mays]
 gb|ACR35941.1| unknown [Zea mays]
Length=534

 Score =   323 bits (828),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AA+YC+F
Sbjct  345  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAAMYCIF  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F Y G+ G+  LQFCNLN+FR KFILGFS+F+GLS+PQYFNEY +I  YGPVHT  RWFN
Sbjct  405  FAYAGSAGIGFLQFCNLNTFRTKFILGFSVFMGLSVPQYFNEYTSIAGYGPVHTHSRWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNV FSSKAFVAG VAY LD T+ + E  VR+DRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  465  DIVNVIFSSKAFVAGFVAYLLDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  525  FNLNKFFPSV  534



>ref|NP_001148488.1| LOC100282103 [Zea mays]
 gb|ACG31696.1| permease I [Zea mays]
Length=534

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AA+YC+F
Sbjct  345  GNGSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAAMYCIF  404

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F Y G+ G+  LQFCNLN+FR KFILGFS+F+GLS+PQYFNEY +I  YGPVHT  RWFN
Sbjct  405  FAYAGSAGIGFLQFCNLNTFRTKFILGFSVFMGLSVPQYFNEYTSIAGYGPVHTHSRWFN  464

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DIVNV FSSKAFVAG VAY LD T+ + E  VR+DRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  465  DIVNVIFSSKAFVAGFVAYLLDNTIDRHEASVRRDRGYHWWDKFRSYRTDTRSEEFYSLP  524

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  525  FNLNKFFPSV  534



>ref|XP_010928566.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
Length=531

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLA+T +GSR+VVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLFF 
Sbjct  344  GSSVSVENAGLLAVTTIGSRQVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHT  RWFNDI
Sbjct  404  YVGAAGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTQARWFNDI  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSK FVAG VA+FLD T+H+ ++ V+KDRG HWWDKFRSFKTD RS+EFYSLPFN
Sbjct  464  INVIFSSKPFVAGFVAFFLDNTLHRHDSAVKKDRGYHWWDKFRSFKTDNRSDEFYSLPFN  523

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  524  LNKFFPSV  531



>gb|EMT04471.1| Nucleobase-ascorbate transporter 6 [Aegilops tauschii]
Length=561

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYC+F
Sbjct  347  GNGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCVF  406

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+  LQFCNLNSFR KFILGFS+F+G S+PQYFNEY ++  +GPVHT  RWFN
Sbjct  407  FAYVGSAGLGFLQFCNLNSFRTKFILGFSVFMGFSVPQYFNEYTSVAGFGPVHTRARWFN  466

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNV FSSKAFV GIVAY LD T+H+ +  VRKDRG HWWDKFRS++TDTRSEEFYSLP
Sbjct  467  DMVNVLFSSKAFVGGIVAYVLDNTLHRHDGAVRKDRGYHWWDKFRSYRTDTRSEEFYSLP  526

Query  396  FNLNKYFPS  370
            FNLNK+FPS
Sbjct  527  FNLNKFFPS  535



>ref|XP_004973451.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Setaria italica]
Length=533

 Score =   321 bits (823),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G++VS+ENAGLLALT VGSRRVVQISAGFMIFFSILGKFGA+FASIP PI AALYC+FF 
Sbjct  346  GTAVSVENAGLLALTHVGSRRVVQISAGFMIFFSILGKFGAIFASIPLPIFAALYCIFFA  405

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            Y+GA G+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHTG RWFND+
Sbjct  406  YIGACGLSFLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDM  465

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSSK FVA +VA+FLD T+ +++  VR+DRG HWWDKFRSFKTD+RSEEFYSLPFN
Sbjct  466  INVPFSSKPFVAVLVAFFLDNTIQRRDTAVRRDRGYHWWDKFRSFKTDSRSEEFYSLPFN  525

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  526  LNKFFPSV  533



>ref|XP_009415380.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415381.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415382.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415383.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=531

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQ+SAGFMIFFSILGKFGAVFASIPAPI AALYCLFF 
Sbjct  344  GSSVSVENAGLLALTRVGSRRVVQLSAGFMIFFSILGKFGAVFASIPAPIFAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHTG RWFNDI
Sbjct  404  YVGAAGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDI  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSK FVAG VA+ LD T+H+ ++ VRKDRG HWW KFRSF  DTRSEEFYSLP N
Sbjct  464  INVIFSSKPFVAGFVAFLLDNTLHRHDSAVRKDRGFHWWHKFRSFMGDTRSEEFYSLPCN  523

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  524  LNKFFPSV  531



>ref|XP_009385304.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=533

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GS+VS+ENAGL+ALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLFF 
Sbjct  346  GSTVSVENAGLIALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAALYCLFFA  405

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  G+SLLQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGP HTG RWFND+
Sbjct  406  YVGVAGLSLLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPAHTGARWFNDM  465

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNV FSS+A VAG VAYFLD T+H+ +   RKDRG H+WDKFRS+KTD RSEEFYSLPFN
Sbjct  466  VNVAFSSEALVAGFVAYFLDNTLHRNDTTARKDRGYHFWDKFRSYKTDPRSEEFYSLPFN  525

Query  390  LNKYFPS  370
            LNK+FP+
Sbjct  526  LNKFFPA  532



>ref|XP_009417550.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=534

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYCLFF 
Sbjct  347  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCLFFA  406

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILG S+F+GLS+PQYFNEY ++  YGPVHT  RWFNDI
Sbjct  407  YVGAAGLSFLQFCNLNSFRTKFILGLSVFMGLSVPQYFNEYTSVAGYGPVHTKARWFNDI  466

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSK FVAG+VA+FLD T+H+     RKDRG HWW KFR+FK D RSEEFYSLPFN
Sbjct  467  INVIFSSKPFVAGLVAFFLDNTLHRHNEATRKDRGYHWWKKFRNFKADMRSEEFYSLPFN  526

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  527  LNKFFPSV  534



>ref|XP_009391237.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391238.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=535

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTR+GSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYCLFF 
Sbjct  348  GSSVSVENAGLLALTRIGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCLFFA  407

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILG S+F+GLS+PQYFNEY ++  YGPVHT  RWFNDI
Sbjct  408  YVGAAGLSFLQFCNLNSFRTKFILGLSVFMGLSVPQYFNEYTSVAGYGPVHTKARWFNDI  467

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSK FVAG+VA+FLD T+H+  +  ++DRG HWW +FRSFK DTRSEEFY+LPFN
Sbjct  468  INVIFSSKPFVAGLVAFFLDNTLHRHHDATKRDRGYHWWKRFRSFKADTRSEEFYALPFN  527

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  528  LNKFFPSV  535



>ref|XP_010238137.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Brachypodium distachyon]
Length=483

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+EN GLLA+T VGSRRVVQISAGFMIFF++LGKFGA+FASIP PI A +YC+FF 
Sbjct  296  GTSVSVENVGLLAVTHVGSRRVVQISAGFMIFFAVLGKFGALFASIPLPIFAGMYCVFFA  355

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA GVSLLQFCNLNSFR KFILGF+ F+G+S+PQYFNEY A++ +GPVHTG RWFND+
Sbjct  356  YVGACGVSLLQFCNLNSFRTKFILGFAFFMGISVPQYFNEYAAVSGHGPVHTGARWFNDM  415

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFS+K FVAG+VAYFLD TMH  ++ VRKDRG HWWDKFRSFK D RS+EFYSLPFN
Sbjct  416  INVPFSNKPFVAGLVAYFLDNTMHLHQSAVRKDRGYHWWDKFRSFKKDARSQEFYSLPFN  475

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  476  LNKFFPSV  483



>ref|NP_001140868.1| uncharacterized protein LOC100272944 [Zea mays]
 gb|ACF78516.1| unknown [Zea mays]
 gb|ACF84845.1| unknown [Zea mays]
 tpg|DAA61282.1| TPA: permease I [Zea mays]
Length=530

 Score =   319 bits (817),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+EN GLLALTR+GSRRVVQISAGFMIFFS+LGKFGA+FASIP P+ A +YCLFF 
Sbjct  343  GTSVSVENIGLLALTRIGSRRVVQISAGFMIFFSVLGKFGALFASIPLPVFAGMYCLFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  G+SLLQFCNLNSFR KFI+GF+ F+GLS+PQYFNEY A+ SYGPVHTG RWFND+
Sbjct  403  YVGGVGLSLLQFCNLNSFRTKFIMGFAFFMGLSVPQYFNEYTAVASYGPVHTGARWFNDM  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPF+SK FVAG+VAY LD T+  KE+ VRKDRG HWW+KFRSFK D RS+EFYSLPFN
Sbjct  463  INVPFTSKPFVAGLVAYILDNTLQVKESAVRKDRGNHWWEKFRSFKKDARSQEFYSLPFN  522

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  523  LNKFFPSV  530



>gb|ACG35525.1| permease I [Zea mays]
Length=530

 Score =   319 bits (817),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+EN GLLALTR+GSRRVVQISAGFMIFFS+LGKFGA+FASIP P+ A +YCLFF 
Sbjct  343  GTSVSVENIGLLALTRIGSRRVVQISAGFMIFFSVLGKFGALFASIPLPVFAGMYCLFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  G+SLLQFCNLNSFR KFI+GF+ F+GLS+PQYFNEY A+ SYGPVHTG RWFND+
Sbjct  403  YVGGVGLSLLQFCNLNSFRTKFIMGFAFFMGLSVPQYFNEYTAVASYGPVHTGARWFNDM  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPF+SK FVAG+VAY LD T+  KE+ VRKDRG HWW+KFRSFK D RS+EFYSLPFN
Sbjct  463  INVPFTSKPFVAGLVAYILDNTLQVKESAVRKDRGNHWWEKFRSFKKDARSQEFYSLPFN  522

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  523  LNKFFPSV  530



>ref|XP_004981228.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Setaria italica]
Length=529

 Score =   318 bits (816),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AA+YCL F 
Sbjct  342  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAAIYCLLFA  401

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  GV  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  +GPVHT  RWFND+
Sbjct  402  YVGMAGVGFLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYTSVAGFGPVHTHARWFNDM  461

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSKAFV G VAYFLD T+H+++  VRKDRG H+WD+FRSFKTD RSEEFYSLPFN
Sbjct  462  INVVFSSKAFVGGAVAYFLDNTLHRRDGTVRKDRGHHFWDRFRSFKTDPRSEEFYSLPFN  521

Query  390  LNKYFPS  370
            LNK+FPS
Sbjct  522  LNKFFPS  528



>ref|XP_003578065.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Brachypodium distachyon]
Length=530

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+EN GLLA+T VGSRRVVQISAGFMIFF++LGKFGA+FASIP PI A +YC+FF 
Sbjct  343  GTSVSVENVGLLAVTHVGSRRVVQISAGFMIFFAVLGKFGALFASIPLPIFAGMYCVFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA GVSLLQFCNLNSFR KFILGF+ F+G+S+PQYFNEY A++ +GPVHTG RWFND+
Sbjct  403  YVGACGVSLLQFCNLNSFRTKFILGFAFFMGISVPQYFNEYAAVSGHGPVHTGARWFNDM  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFS+K FVAG+VAYFLD TMH  ++ VRKDRG HWWDKFRSFK D RS+EFYSLPFN
Sbjct  463  INVPFSNKPFVAGLVAYFLDNTMHLHQSAVRKDRGYHWWDKFRSFKKDARSQEFYSLPFN  522

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  523  LNKFFPSV  530



>ref|XP_002463615.1| hypothetical protein SORBIDRAFT_01g002960 [Sorghum bicolor]
 gb|EER90613.1| hypothetical protein SORBIDRAFT_01g002960 [Sorghum bicolor]
Length=528

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLL L+RVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AA+YCL F 
Sbjct  341  GTSVSVENAGLLGLSRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAAIYCLLFA  400

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  GV  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  +GPVHT  RWFND+
Sbjct  401  YVGMAGVGFLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYTSVAGFGPVHTHARWFNDM  460

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSKAFVAG VAYFLD T+H+++  VRKDRG H+WD+FRSFKTD RSEEFYSLPFN
Sbjct  461  INVVFSSKAFVAGAVAYFLDNTLHRRDGTVRKDRGHHFWDRFRSFKTDPRSEEFYSLPFN  520

Query  390  LNKYFPS  370
            LNK+FPS
Sbjct  521  LNKFFPS  527



>ref|NP_001063058.1| Os09g0381100 [Oryza sativa Japonica Group]
 dbj|BAD26097.1| putative permease 1 [Oryza sativa Japonica Group]
 dbj|BAF24972.1| Os09g0381100 [Oryza sativa Japonica Group]
 gb|EAZ08924.1| hypothetical protein OsI_31191 [Oryza sativa Indica Group]
 gb|EAZ44570.1| hypothetical protein OsJ_29191 [Oryza sativa Japonica Group]
 dbj|BAG89273.1| unnamed protein product [Oryza sativa Japonica Group]
Length=530

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+EN GLLALT VGSRRVVQISAGFMIFF+ILGKFGA+FASIP PI A +YC+FF 
Sbjct  343  GTSVSVENVGLLALTHVGSRRVVQISAGFMIFFAILGKFGALFASIPLPIFAGMYCIFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGF+ F+G+S+PQYFNEY A+  YGPVHTG RWFND+
Sbjct  403  YVGACGLSFLQFCNLNSFRTKFILGFAFFMGISVPQYFNEYTAVAGYGPVHTGARWFNDM  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSSK FVAG+VAYFLD T+    N VRKDRG HWWDKFRSFK D RSEEFYSLPFN
Sbjct  463  INVPFSSKPFVAGLVAYFLDNTIETHNNTVRKDRGYHWWDKFRSFKKDARSEEFYSLPFN  522

Query  390  LNKYFPSV  367
            LNK+FP+V
Sbjct  523  LNKFFPAV  530



>ref|XP_009391740.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=531

 Score =   316 bits (809),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYCL F 
Sbjct  344  GTSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCLLFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFS F+GLS+PQYFNEY ++  YGPVHTG RWFNDI
Sbjct  404  YVGAGGLSFLQFCNLNSFRTKFILGFSFFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDI  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSK FVAG VA+FLD ++H+ ++ VRKDRG HWW KFRS+K D RSEEFY LP N
Sbjct  464  INVIFSSKPFVAGFVAFFLDNSLHRHDSAVRKDRGLHWWHKFRSYKGDPRSEEFYRLPLN  523

Query  390  LNKYFPS  370
            LNK+FP+
Sbjct  524  LNKFFPA  530



>ref|NP_001141421.1| uncharacterized protein LOC100273531 [Zea mays]
 gb|ACF86349.1| unknown [Zea mays]
 gb|ACG30077.1| permease [Zea mays]
 tpg|DAA49132.1| TPA: permease [Zea mays]
Length=533

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G++VS+ENAGLLALT VGSRRVVQISAGFMIFFS+LGKFGA+FASIP PI AALYC+ F 
Sbjct  346  GTAVSVENAGLLALTHVGSRRVVQISAGFMIFFSVLGKFGAIFASIPLPIFAALYCILFA  405

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            Y+GA G+S LQFCNLNSFR KFI+GFS+F+GLS+PQYFNEY ++  YGPVHTG RWFND+
Sbjct  406  YIGACGLSFLQFCNLNSFRTKFIMGFSLFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDM  465

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSSK FVA +VA+ LD T+  +++ VR+DRG HWWDKFRSFKTD+RSEEFYSLPFN
Sbjct  466  INVPFSSKPFVAVLVAFLLDNTIQVRDSGVRRDRGYHWWDKFRSFKTDSRSEEFYSLPFN  525

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  526  LNKFFPSV  533



>emb|CDP00202.1| unnamed protein product [Coffea canephora]
Length=535

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLA+TRVGSRRVVQISAGFMIFFSILGKFGA+FASIPAPIVAALYCLF
Sbjct  346  GNGSSVSVENAGLLAVTRVGSRRVVQISAGFMIFFSILGKFGAIFASIPAPIVAALYCLF  405

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG+ G+S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY A+N  GPVHT  RWFN
Sbjct  406  FAYVGSAGLSYLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTAVNGMGPVHTRARWFN  465

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVPFSS+AFVAG++A  LD T+HKK +   +DRG  WWD+FRS+K+DTRSEEFYSLP
Sbjct  466  DMINVPFSSEAFVAGLLALLLDVTLHKKGSATSRDRGLPWWDRFRSYKSDTRSEEFYSLP  525

Query  396  FNLNKYFPSV  367
             NLNK+FPSV
Sbjct  526  CNLNKFFPSV  535



>ref|XP_009391739.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=557

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI AALYCL F 
Sbjct  370  GTSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIFAALYCLLFA  429

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG+S LQFCNLNSFR KFILGFS F+GLS+PQYFNEY ++  YGPVHTG RWFNDI
Sbjct  430  YVGAGGLSFLQFCNLNSFRTKFILGFSFFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDI  489

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSK FVAG VA+FLD ++H+ ++ VRKDRG HWW KFRS+K D RSEEFY LP N
Sbjct  490  INVIFSSKPFVAGFVAFFLDNSLHRHDSAVRKDRGLHWWHKFRSYKGDPRSEEFYRLPLN  549

Query  390  LNKYFPS  370
            LNK+FP+
Sbjct  550  LNKFFPA  556



>ref|XP_006650817.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Oryza brachyantha]
Length=529

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLL LTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PIVAA+YCL F 
Sbjct  342  GSSVSVENAGLLGLTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIVAAIYCLLFA  401

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  GV  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHT  RWFND+
Sbjct  402  YVGMAGVGFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTHARWFNDM  461

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSKAFV G VAY LD T+H+ ++  RKDRG H+WD+FRSF+TD RSEEFYSLPFN
Sbjct  462  INVVFSSKAFVGGAVAYLLDNTLHRHDSTARKDRGHHFWDRFRSFRTDPRSEEFYSLPFN  521

Query  390  LNKYFPS  370
            LNK+FPS
Sbjct  522  LNKFFPS  528



>ref|NP_001149779.1| permease I [Zea mays]
 gb|ACG36768.1| permease I [Zea mays]
Length=531

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLL LTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AA+YCL F 
Sbjct  344  GTSVSVENAGLLGLTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAAIYCLLFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  GV  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  +GPVHT  RWFND+
Sbjct  404  YVGTAGVGFLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYTSVAGFGPVHTRARWFNDM  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNV FSSKAFV G VAYFLD T+ +++  VRKDRG H+WD+FRSFKTD RSEEFYSLPFN
Sbjct  464  VNVVFSSKAFVGGAVAYFLDNTLQRRDGAVRKDRGHHFWDRFRSFKTDPRSEEFYSLPFN  523

Query  390  LNKYFPS  370
            LNK+FPS
Sbjct  524  LNKFFPS  530



>gb|EPS61022.1| nucleobase ascorbate transporter, partial [Genlisea aurea]
Length=231

 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLL LT+VGSRRVVQISAGFM+FFS+LGKFGAVFAS+P+PI+AALYC+ 
Sbjct  42   GIGSSVSVENAGLLGLTKVGSRRVVQISAGFMLFFSVLGKFGAVFASVPSPIIAALYCVL  101

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+S +QFCN+NSFR KFIL FSIF+G S+PQYFNE++AI  YGPVHT  RWFN
Sbjct  102  FAYVGVGGLSFMQFCNVNSFRCKFILAFSIFMGFSVPQYFNEHLAIKGYGPVHTDARWFN  161

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VN  FSSK FV G+VA  LDTT+  K+   RKDRG H+WDK++S+KTD+RSEEFYSLP
Sbjct  162  DMVNAAFSSKGFVGGVVAMILDTTLPPKDTATRKDRGLHFWDKYKSYKTDSRSEEFYSLP  221

Query  396  FNLNKYFPSV  367
             NLNK+FPSV
Sbjct  222  LNLNKFFPSV  231



>ref|NP_001288584.1| uncharacterized protein LOC103625746 [Zea mays]
 ref|XP_008644369.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Zea mays]
 gb|ACF82086.1| unknown [Zea mays]
Length=531

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+ENAGLL LTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AA+YCL F 
Sbjct  344  GTSVSVENAGLLGLTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAAIYCLLFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  GV  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  +GPVHT  RWFND+
Sbjct  404  YVGTAGVGFLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYTSVAGFGPVHTRARWFNDM  463

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNV FSSKAFV G VAYFLD T+ +++  VRKDRG H+WD+FRSFKTD RSEEFYSLPFN
Sbjct  464  VNVVFSSKAFVGGAVAYFLDNTLQRRDGAVRKDRGHHFWDRFRSFKTDPRSEEFYSLPFN  523

Query  390  LNKYFPS  370
            LNK+FPS
Sbjct  524  LNKFFPS  530



>gb|EYU29705.1| hypothetical protein MIMGU_mgv1a004288mg [Erythranthe guttata]
Length=535

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTGSSVSIENAGLL LTRVGSRRV+QISA FMIFFSILGKFGAVFASIP+PIVAALYCL 
Sbjct  346  GTGSSVSIENAGLLGLTRVGSRRVIQISAAFMIFFSILGKFGAVFASIPSPIVAALYCLL  405

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG GG+  LQFCNLNSFR  FI+ FSIF+GLS+PQYFNEY+++N + PVHT  RWFN
Sbjct  406  FAYVGVGGLGFLQFCNLNSFRTTFIIAFSIFMGLSVPQYFNEYLSVNKFSPVHTNARWFN  465

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NVP SSK FVAGI+A  LD T+  K+   RKDRG  WWDKFRS+KTDTRSEE YSLP
Sbjct  466  DMINVPLSSKPFVAGILALILDVTLPPKDGGTRKDRGMQWWDKFRSYKTDTRSEELYSLP  525

Query  396  FNLNKYFPSV  367
             NLNK+FPSV
Sbjct  526  LNLNKFFPSV  535



>gb|EMT25940.1| Nucleobase-ascorbate transporter 6 [Aegilops tauschii]
Length=538

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SV++EN GLLA+T VGSRRVVQISAGFMIFF++LGKFGA+FASIP PI A +YC+FF 
Sbjct  351  GTSVAVENVGLLAVTHVGSRRVVQISAGFMIFFAVLGKFGALFASIPLPIFAGMYCVFFA  410

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS F+G+S+PQYFNEY +++ +GPVHTG RWFND+
Sbjct  411  YVGACGLSFLQFCNLNSFRTKFILGFSFFIGISVPQYFNEYASVSGHGPVHTGARWFNDM  470

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFS+K FVAG+VAYFLD TMH  ++ VRKDRG HWWDKFRSFK D RSEEFYSLPFN
Sbjct  471  INVPFSNKPFVAGLVAYFLDNTMHLHQSAVRKDRGYHWWDKFRSFKKDARSEEFYSLPFN  530

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  531  LNKFFPSV  538



>ref|XP_010942184.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010942185.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
Length=546

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GS+VS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AALYCLFF 
Sbjct  359  GSTVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAALYCLFFA  418

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS+F+GLS+PQYF EY  +  YGPVHTG RWFNDI
Sbjct  419  YVGAVGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFKEYTLVAGYGPVHTGARWFNDI  478

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSS+AFVAG+VAYFLD T+ + E+  RKD G+H+W ++RSF TD RSEEFYSLPFN
Sbjct  479  INVIFSSEAFVAGLVAYFLDNTLQRHESATRKDSGRHFWQRYRSFGTDPRSEEFYSLPFN  538

Query  390  LNKYFPSV  367
            L+K+FPSV
Sbjct  539  LHKFFPSV  546



>ref|XP_008779515.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Phoenix dactylifera]
 ref|XP_008779520.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Phoenix dactylifera]
Length=544

 Score =   313 bits (803),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GS+VS+ENAGLLALTR+GSRRVVQISAG+MIFFSILGKFGAVFASIPAPIVAALYCLFF 
Sbjct  357  GSTVSVENAGLLALTRIGSRRVVQISAGYMIFFSILGKFGAVFASIPAPIVAALYCLFFA  416

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS+F+GLS+PQYF EY A+  YGPVHTG RWFNDI
Sbjct  417  YVGAAGLSFLQFCNLNSFRVKFILGFSVFMGLSVPQYFKEYTAVAGYGPVHTGARWFNDI  476

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNV FSS+AFVAG+VAYFLD T+ ++++  +KD G+H+W K++SF +D RSEEFYSLPFN
Sbjct  477  VNVIFSSEAFVAGLVAYFLDNTLQRRDSATKKDSGRHFWRKYKSFGSDPRSEEFYSLPFN  536

Query  390  LNKYFPSV  367
            L+K+FPSV
Sbjct  537  LHKFFPSV  544



>ref|XP_006660592.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Oryza brachyantha]
Length=530

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+EN GLLALT VGSRRVVQISAGFMIFF+ILGKFGA+FASIP PI A +YC+FF 
Sbjct  343  GTSVSVENVGLLALTHVGSRRVVQISAGFMIFFAILGKFGALFASIPLPIFAGMYCIFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGF+ F+G+S+PQYFNEY A+  YGPVHTG RWFND+
Sbjct  403  YVGACGLSFLQFCNLNSFRTKFILGFAFFMGISVPQYFNEYTAVAGYGPVHTGARWFNDM  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSSK FVAG+VAYFLD T+    + VRKDRG HWWDKFRSFK D RSEEFYSLP N
Sbjct  463  INVPFSSKPFVAGLVAYFLDNTIETHNSTVRKDRGYHWWDKFRSFKKDARSEEFYSLPLN  522

Query  390  LNKYFPSV  367
            LNK+FP+V
Sbjct  523  LNKFFPAV  530



>ref|NP_001150400.1| permease I [Zea mays]
 gb|ACG38946.1| permease I [Zea mays]
Length=529

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G++VS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP P++AA+YCL F 
Sbjct  342  GTTVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPVIAAVYCLLFA  401

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  GV  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  +GPVHT  RWFND+
Sbjct  402  YVGMAGVGFLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYTSVAGFGPVHTRARWFNDM  461

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSKA V G VAYFLD T+H+++   RKDRG H+WD+FRSFKTD RSEEFYSLPFN
Sbjct  462  INVVFSSKALVGGAVAYFLDNTLHRRDGVARKDRGHHFWDRFRSFKTDPRSEEFYSLPFN  521

Query  390  LNKYFPS  370
            LNK+FPS
Sbjct  522  LNKFFPS  528



>tpg|DAA52241.1| TPA: permease I [Zea mays]
Length=529

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G++VS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP P++AA+YCL F 
Sbjct  342  GTTVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPVIAAVYCLLFA  401

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  GV  LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  +GPVHT  RWFND+
Sbjct  402  YVGMAGVGFLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYTSVAGFGPVHTRARWFNDM  461

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSKA V G VAYFLD T+H+++   RKDRG H+WD+FRSFKTD RSEEFYSLPFN
Sbjct  462  INVVFSSKALVGGAVAYFLDNTLHRRDGVARKDRGHHFWDRFRSFKTDPRSEEFYSLPFN  521

Query  390  LNKYFPS  370
            LNK+FPS
Sbjct  522  LNKFFPS  528



>ref|XP_010475923.1| PREDICTED: nucleobase-ascorbate transporter 8 [Camelina sativa]
Length=535

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G  ++VS+ENAGLLALTRVGSRRV+Q+SAGFMIFFSILGKFGA+FASIPAPI+AALYCLF
Sbjct  346  GNATAVSVENAGLLALTRVGSRRVIQVSAGFMIFFSILGKFGAIFASIPAPIIAALYCLF  405

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILGFSIF+GLSIPQYF +Y  ++ YGPVHT   WFN
Sbjct  406  FSYVGAGGLSLLQFCNLNSFRTKFILGFSIFMGLSIPQYFYQYTIVHHYGPVHTSATWFN  465

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
             I+NVPFSSKAFV+GI+A+FLD T+  K+   +KDRG  WW +FRSFKTD RS EFYSLP
Sbjct  466  IIINVPFSSKAFVSGILAFFLDMTLPPKDKTTKKDRGSQWWKRFRSFKTDNRSAEFYSLP  525

Query  396  FNLNKYFPS  370
             NL+KYFPS
Sbjct  526  LNLSKYFPS  534



>ref|XP_009415384.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=528

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 165/188 (88%), Gaps = 3/188 (2%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQ+SAGFMIFFSILGKFGAVFASIPAPI AALYCLFF 
Sbjct  344  GSSVSVENAGLLALTRVGSRRVVQLSAGFMIFFSILGKFGAVFASIPAPIFAALYCLFFA  403

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG   +S LQFCNLNSFR KFILGFS+F+GLS+PQYFNEY ++  YGPVHTG RWFNDI
Sbjct  404  YVG---LSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDI  460

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSK FVAG VA+ LD T+H+ ++ VRKDRG HWW KFRSF  DTRSEEFYSLP N
Sbjct  461  INVIFSSKPFVAGFVAFLLDNTLHRHDSAVRKDRGFHWWHKFRSFMGDTRSEEFYSLPCN  520

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  521  LNKFFPSV  528



>ref|NP_001051745.1| Os03g0823800 [Oryza sativa Japonica Group]
 gb|AAO18455.1| putative permease [Oryza sativa Japonica Group]
 gb|ABF99619.1| Permease I, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13659.1| Os03g0823800 [Oryza sativa Japonica Group]
Length=529

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLL LTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AA+YCL F 
Sbjct  342  GSSVSVENAGLLGLTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAAIYCLLFA  401

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  GV  LQFCNLNSFR KFI+GFS+F+GLS+PQYFNEY ++  YGPVHT  RWFND+
Sbjct  402  YVGMAGVGFLQFCNLNSFRTKFIVGFSVFMGLSVPQYFNEYTSVAGYGPVHTHARWFNDM  461

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSKAFV G VAY LD T+ + ++  RKDRG H+WD+FRSF+TD RSEEFYSLPFN
Sbjct  462  INVVFSSKAFVGGAVAYLLDNTLQRHDSTARKDRGHHFWDRFRSFRTDPRSEEFYSLPFN  521

Query  390  LNKYFPS  370
            LNK+FPS
Sbjct  522  LNKFFPS  528



>ref|XP_002444345.1| hypothetical protein SORBIDRAFT_07g020510 [Sorghum bicolor]
 gb|EES13840.1| hypothetical protein SORBIDRAFT_07g020510 [Sorghum bicolor]
Length=533

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -1

Query  912  ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFGYVGAGG  733
            ENAGLLALT VGSRRVVQISAGFMIFFSILGKFGA+FASIP PI AALYC+FF Y+GA G
Sbjct  352  ENAGLLALTHVGSRRVVQISAGFMIFFSILGKFGAIFASIPLPIFAALYCIFFAYIGACG  411

Query  732  VSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDIVNVPFS  553
            +S LQFCNLNSFR KFI+GFS+F+GLS+PQYFNEY ++  YGPVHTG RWFND++NVPFS
Sbjct  412  LSFLQFCNLNSFRTKFIMGFSLFMGLSVPQYFNEYTSVAGYGPVHTGARWFNDMINVPFS  471

Query  552  SKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNKYFP  373
            SK FVA +VA+ LD T+  +++ VR+DRG HWWDKFRSFKTD+RSEEFYSLPFNLNK+FP
Sbjct  472  SKPFVAVLVAFLLDNTIQVRDSGVRRDRGYHWWDKFRSFKTDSRSEEFYSLPFNLNKFFP  531

Query  372  SV  367
            SV
Sbjct  532  SV  533



>ref|XP_003563486.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brachypodium 
distachyon]
Length=529

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
             +GSSVS+ENAGLL LTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AA+YCL 
Sbjct  340  ASGSSVSVENAGLLGLTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAAIYCLL  399

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVG  G+  LQFCNLNSFR KFILGFS+F+G S+PQYFNEY ++  +GPVHT  RWFN
Sbjct  400  FAYVGMAGIGFLQFCNLNSFRTKFILGFSLFMGFSVPQYFNEYTSVAGFGPVHTHARWFN  459

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D++NV FSSKAFV G VA  LD+T+H+ ++  RKDRG H+WD+FRSFKTD RSEEFYSLP
Sbjct  460  DMINVVFSSKAFVGGAVALLLDSTLHRHDSTARKDRGHHFWDRFRSFKTDPRSEEFYSLP  519

Query  396  FNLNKYFPS  370
            FNLNK+FPS
Sbjct  520  FNLNKFFPS  528



>ref|XP_006417454.1| hypothetical protein EUTSA_v10007311mg [Eutrema salsugineum]
 gb|ESQ35807.1| hypothetical protein EUTSA_v10007311mg [Eutrema salsugineum]
Length=538

 Score =   308 bits (788),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G  +SVS+ENAGLLA+TRVG+RRVVQISAGFMIFFSILGKFGA+FASIPAPI+AAL+CLF
Sbjct  349  GNATSVSVENAGLLAVTRVGNRRVVQISAGFMIFFSILGKFGAIFASIPAPIIAALHCLF  408

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SLLQFCNLNSFR KFILG SIF+GLSIPQYF +Y  +  YGPVHT   WFN
Sbjct  409  FAYVGAGGLSLLQFCNLNSFRTKFILGISIFMGLSIPQYFYQYTTLEHYGPVHTNATWFN  468

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            DI+NVPFSSKAFV+GI+A+FLD T+  K+   +KDRG  WW +FRSFK+D RSEEFYSLP
Sbjct  469  DIINVPFSSKAFVSGILAFFLDMTLPPKDKTTKKDRGVIWWKRFRSFKSDNRSEEFYSLP  528

Query  396  FNLNKYFPS  370
            FNL+ YFPS
Sbjct  529  FNLSYYFPS  537



>ref|XP_010111541.1| Nucleobase-ascorbate transporter 6 [Morus notabilis]
 gb|EXC31174.1| Nucleobase-ascorbate transporter 6 [Morus notabilis]
Length=566

 Score =   308 bits (790),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPI+AALYCLFF 
Sbjct  377  GSSVSVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIIAALYCLFFA  436

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG+GG+S LQFCNLNSFR KFILGFSIF+GLS+PQYFNEY AIN YGPVHTG RWFNDI
Sbjct  437  YVGSGGLSFLQFCNLNSFRTKFILGFSIFIGLSVPQYFNEYTAINGYGPVHTGERWFNDI  496

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRS  418
            +NVP  S+AFVAG VAYFLD T+H+++  +RKDRGKHWWDKFRS+K DTR+
Sbjct  497  INVPLQSEAFVAGCVAYFLDNTLHRRDGAIRKDRGKHWWDKFRSYKGDTRN  547



>ref|NP_172524.1| nucleobase-ascorbate transporter 8 [Arabidopsis thaliana]
 sp|Q8VZQ5.1|NAT8_ARATH RecName: Full=Nucleobase-ascorbate transporter 8; Short=AtNAT8 
[Arabidopsis thaliana]
 gb|AAL36291.1| putative permease [Arabidopsis thaliana]
 gb|AAM20104.1| putative permease [Arabidopsis thaliana]
 gb|AEE28592.1| nucleobase-ascorbate transporter 8 [Arabidopsis thaliana]
Length=539

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G  +SVS+ENAGLLA+TRVGSRRV+Q++AGFMIFFSILGKFGA+FASIPAPIVAALYCLF
Sbjct  350  GNATSVSVENAGLLAVTRVGSRRVIQVAAGFMIFFSILGKFGAIFASIPAPIVAALYCLF  409

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SL+QFCNLNSFR KFILGFSIF+GLSIPQYF +Y  + +YGPV T   WFN
Sbjct  410  FSYVGAGGLSLIQFCNLNSFRTKFILGFSIFMGLSIPQYFYQYTTLETYGPVRTSATWFN  469

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            +I+NVPFSSKAFV+GI+A+FLDTT+  K+   +KDRG  WW +F+SF++D RSEEFYSLP
Sbjct  470  NIINVPFSSKAFVSGILAFFLDTTLPPKDKTTKKDRGLVWWKRFKSFQSDNRSEEFYSLP  529

Query  396  FNLNKYFPS  370
             NL+KYFPS
Sbjct  530  LNLSKYFPS  538



>ref|XP_004489879.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Cicer arietinum]
Length=533

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVSIENAGLLALT+VGSRRVVQISA FMIFFSILGKFGAVFASIP PI AA+YC+F
Sbjct  344  GNGSSVSIENAGLLALTKVGSRRVVQISALFMIFFSILGKFGAVFASIPIPIFAAIYCVF  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F  VG+ G+S +QFCNLNSFR KFI+GFSIF+G SIPQYF EY AI  +GPVHT   WFN
Sbjct  404  FACVGSAGLSFVQFCNLNSFRTKFIIGFSIFMGFSIPQYFKEYTAIKHHGPVHTHATWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            +++NVPFSS+AFVAGI+A  LD ++H  ++++RKDRG HWWDKF SFKTDTRS EFYSLP
Sbjct  464  NMINVPFSSEAFVAGILAMLLDASLHNSDSKIRKDRGMHWWDKFSSFKTDTRSGEFYSLP  523

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  524  FNLNKFFPSV  533



>ref|XP_006836697.1| PREDICTED: nucleobase-ascorbate transporter 6 [Amborella trichopoda]
 gb|ERM99550.1| hypothetical protein AMTR_s00088p00102240 [Amborella trichopoda]
Length=536

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GS+VS+ENAGL+ +T +GSR VVQISAGFMIFFSILGKFGA+FASIP PIVAALYCLFFG
Sbjct  349  GSTVSVENAGLIGVTCIGSRTVVQISAGFMIFFSILGKFGALFASIPLPIVAALYCLFFG  408

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGAGG++ LQFCNLNSFR KFILGFS+FLG S+PQYF EY     YGPVHT  RWFNDI
Sbjct  409  YVGAGGLTFLQFCNLNSFRVKFILGFSLFLGFSVPQYFKEYTVSARYGPVHTPARWFNDI  468

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSS+AFV  IVA FLD T+  ++   RKDRG HWWDKFRSFK DTRSEEFY+LPF 
Sbjct  469  INVPFSSEAFVGSIVAMFLDITLPPRDTATRKDRGLHWWDKFRSFKGDTRSEEFYALPFR  528

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  529  LNKFFPSV  536



>ref|XP_009399656.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009399657.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=536

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGA+FASIPAPI AALYCLFF 
Sbjct  349  GSSVSVENAGLLALTRVGSRRVVQISALFMIFFSILGKFGAIFASIPAPIFAALYCLFFA  408

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS+F+GLSIPQYFNEY ++  YGPVHT  RWFNDI
Sbjct  409  YVGAAGLSFLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTSVAGYGPVHTKARWFNDI  468

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSK FVAG+VA+FLD T+++ ++  ++DRG HWW +F++F+ D+RS EFYSLPF+
Sbjct  469  INVTFSSKPFVAGLVAFFLDNTLNRHDDATKRDRGYHWWKRFQNFEGDSRSGEFYSLPFD  528

Query  390  LNKYFPSV  367
            LN++FPSV
Sbjct  529  LNRFFPSV  536



>gb|EMT02255.1| Nucleobase-ascorbate transporter 6 [Aegilops tauschii]
Length=529

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G SVS+ENAGLL LTRVGSRRVVQISAGFM+FFSILGKFGAVFASIP PI+AA+YCL F 
Sbjct  342  GCSVSVENAGLLGLTRVGSRRVVQISAGFMLFFSILGKFGAVFASIPGPIIAAIYCLLFA  401

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  GV  LQFCNLNSFR KFILGFS+F+G+S+PQYFNEY ++  +GPVHT  RWFND+
Sbjct  402  YVGMAGVGFLQFCNLNSFRTKFILGFSLFMGISVPQYFNEYTSVAGFGPVHTHARWFNDM  461

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSKAFV G  A  LD+T+H+ ++  RKDRG H+WD+FRSFKTD RSEEFYSLPFN
Sbjct  462  INVVFSSKAFVGGATALLLDSTLHRHDSTARKDRGHHFWDRFRSFKTDPRSEEFYSLPFN  521

Query  390  LNKYFPS  370
            LNK+FPS
Sbjct  522  LNKFFPS  528



>ref|XP_006305877.1| hypothetical protein CARUB_v10011003mg [Capsella rubella]
 gb|EOA38775.1| hypothetical protein CARUB_v10011003mg [Capsella rubella]
Length=538

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G  +SVS+ENAGLLALTRVGSRRV+Q+SA FMI FSILGKFGA+FASIPAPIVAALYCLF
Sbjct  349  GNATSVSVENAGLLALTRVGSRRVIQVSAVFMILFSILGKFGAIFASIPAPIVAALYCLF  408

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SL+QFCN+NSFR KFILGFSIF+GLSIPQYF EY     YGPVHT   WFN
Sbjct  409  FSYVGAGGLSLIQFCNMNSFRTKFILGFSIFMGLSIPQYFYEYTITKDYGPVHTPATWFN  468

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            +I+NVPFSS+AFV+GI+A+FLD T+  K+   +KDRG  WW +FRSFK+D RSEEFYSLP
Sbjct  469  NIINVPFSSRAFVSGILAFFLDMTLPPKDKTTKKDRGLVWWKRFRSFKSDNRSEEFYSLP  528

Query  396  FNLNKYFPS  370
             NL+KYFPS
Sbjct  529  LNLSKYFPS  537



>ref|XP_004956720.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Setaria italica]
Length=528

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 161/188 (86%), Gaps = 2/188 (1%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G+SVS+EN GLL LTRVGSRRVVQISAGFMIFFS+LGKFGA+FASIP PI A +YCLFF 
Sbjct  343  GTSVSVENIGLLGLTRVGSRRVVQISAGFMIFFSVLGKFGALFASIPLPIFAGMYCLFFA  402

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  G+S LQFCNLNSFR KFI+GF+ F+GLS+PQYFNEY A+  YGPVHTG RWFND+
Sbjct  403  YVGGVGLSFLQFCNLNSFRTKFIMGFAFFMGLSVPQYFNEYTAVAGYGPVHTGARWFNDM  462

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NVPFSSK FVAG+VAY LD T+  K+   RKDRG HWWDKFRS+K D RS EFYSLPFN
Sbjct  463  INVPFSSKPFVAGLVAYVLDNTLQVKD--ARKDRGYHWWDKFRSYKKDGRSTEFYSLPFN  520

Query  390  LNKYFPSV  367
            LNK+FPSV
Sbjct  521  LNKFFPSV  528



>ref|XP_009399654.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=572

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GSSVS+ENAGLLALTRVGSRRVVQISA FMIFFSILGKFGA+FASIPAPI AALYCLFF 
Sbjct  385  GSSVSVENAGLLALTRVGSRRVVQISALFMIFFSILGKFGAIFASIPAPIFAALYCLFFA  444

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+S LQFCNLNSFR KFILGFS+F+GLSIPQYFNEY ++  YGPVHT  RWFNDI
Sbjct  445  YVGAAGLSFLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTSVAGYGPVHTKARWFNDI  504

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSK FVAG+VA+FLD T+++ ++  ++DRG HWW +F++F+ D+RS EFYSLPF+
Sbjct  505  INVTFSSKPFVAGLVAFFLDNTLNRHDDATKRDRGYHWWKRFQNFEGDSRSGEFYSLPFD  564

Query  390  LNKYFPSV  367
            LN++FPSV
Sbjct  565  LNRFFPSV  572



>ref|XP_009386652.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386653.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=537

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            GS+ S+ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP  I+AALYCLFF 
Sbjct  350  GSTASVENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGSIIAALYCLFFA  409

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVGA G+ LLQF NLNSFR KFILGFS+FLGLSIPQYF EY ++  YGPVHTG RWFNDI
Sbjct  410  YVGAAGLGLLQFSNLNSFRTKFILGFSVFLGLSIPQYFKEYTSVAGYGPVHTGARWFNDI  469

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            VNV FSS+A VAG VAYFLD TM   E+  RKDRG H+WDKFR+FK D RSEEFYSLPF 
Sbjct  470  VNVIFSSEALVAGFVAYFLDNTMQLHESSTRKDRGYHFWDKFRTFKKDPRSEEFYSLPFK  529

Query  390  LNKYF  376
            LN++F
Sbjct  530  LNRFF  534



>ref|XP_009760318.1| PREDICTED: nucleobase-ascorbate transporter 6-like, partial [Nicotiana 
sylvestris]
Length=232

 Score =   293 bits (749),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGL+A TRVGSRRVVQ SAGFMIFFSILGKFGA FASIP PIV ALYCL 
Sbjct  47   GIGSSVSVENAGLIAHTRVGSRRVVQTSAGFMIFFSILGKFGAFFASIPTPIVGALYCLL  106

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F Y+GAGG+S LQFCNLNSFR KFILGFSIFLGLS+PQYFNEY AI  YGPVHT  RW N
Sbjct  107  FPYLGAGGLSFLQFCNLNSFRTKFILGFSIFLGLSVPQYFNEYTAIAGYGPVHTHRRWLN  166

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSSKAFVAGIVAYFLD T+ ++ NQ   DRG HWW  F S+K D+RSEEFYSLP
Sbjct  167  DMVNVPFSSKAFVAGIVAYFLDNTLQRRYNQTWNDRGNHWWYIFTSYKADSRSEEFYSLP  226

Query  396  FNLNKY  379
              L+ +
Sbjct  227  CILHHW  232



>gb|EAZ29114.1| hypothetical protein OsJ_13173 [Oryza sativa Japonica Group]
Length=596

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  921  VSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFGYVG  742
            VS ENAGLL LTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AA+YCL F YVG
Sbjct  412  VSFENAGLLGLTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAAIYCLLFAYVG  471

Query  741  AGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDIVNV  562
              GV  LQFCNLNSFR KFI+GFS+F+GLS+PQYFNEY ++  YGPVHT  RWFND++NV
Sbjct  472  MAGVGFLQFCNLNSFRTKFIVGFSVFMGLSVPQYFNEYTSVAGYGPVHTHARWFNDMINV  531

Query  561  PFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNK  382
             FSSKAFV G VAY LD T+ + ++  RKDRG H+WD+FRSF+TD RSEEFYSLPFNLNK
Sbjct  532  VFSSKAFVGGAVAYLLDNTLQRHDSTARKDRGHHFWDRFRSFRTDPRSEEFYSLPFNLNK  591

Query  381  YFPS  370
            +FPS
Sbjct  592  FFPS  595



>dbj|BAJ89101.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G SVS+ENAGLL LTRVGSRRVVQISAGFM+FFSILGKFGAVFASIP PI+AA+YCL F 
Sbjct  342  GCSVSVENAGLLGLTRVGSRRVVQISAGFMLFFSILGKFGAVFASIPGPIIAAIYCLLFA  401

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDI  571
            YVG  GV  LQFCNLNSFR KFILGFS F+G+S+PQYFNEY ++  +GPVHT  RWFND+
Sbjct  402  YVGMAGVGFLQFCNLNSFRTKFILGFS-FMGISVPQYFNEYTSVAGFGPVHTHARWFNDM  460

Query  570  VNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFN  391
            +NV FSSKAFV G  A  LD+T+H+ ++  RKDRG H+WD+FRSFKTD RSEEFYSLPFN
Sbjct  461  INVVFSSKAFVGGATALLLDSTLHRHDSTARKDRGHHFWDRFRSFKTDPRSEEFYSLPFN  520

Query  390  LNKYFPS  370
            LNK+FPS
Sbjct  521  LNKFFPS  527



>gb|EAY92392.1| hypothetical protein OsI_14125 [Oryza sativa Indica Group]
Length=549

 Score =   300 bits (769),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  912  ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFGYVGAGG  733
            ENAGLL LTRVGSRRVVQISAGFMIFFSILGKFGAVFASIP PI+AA+YCL F YVG  G
Sbjct  368  ENAGLLGLTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPGPIIAAIYCLLFAYVGMAG  427

Query  732  VSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDIVNVPFS  553
            V  LQFCNLNSFR KFI+GFS+F+GLS+PQYFNEY ++  YGPVHT  RWFND++NV FS
Sbjct  428  VGFLQFCNLNSFRTKFIVGFSVFMGLSVPQYFNEYTSVAGYGPVHTHARWFNDMINVVFS  487

Query  552  SKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNKYFP  373
            SKAFV G VAY LD T+ + ++  RKDRG H+WD+FRSF+TD RSEEFYSLPFNLNK+FP
Sbjct  488  SKAFVGGAVAYLLDNTLQRHDSTARKDRGHHFWDRFRSFRTDPRSEEFYSLPFNLNKFFP  547

Query  372  S  370
            S
Sbjct  548  S  548



>ref|XP_002892576.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68835.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=539

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G  +SVS+ENAGLLA+TRVGSRRV+Q+SAGFMIFFSILGKFGA+FASIPAPI+AALYCLF
Sbjct  350  GNATSVSVENAGLLAVTRVGSRRVIQVSAGFMIFFSILGKFGAIFASIPAPIIAALYCLF  409

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+SL+QFCNLNSFR KFILGFSIF+GLSIPQYF +Y    +YGPV T    FN
Sbjct  410  FSYVGAGGLSLIQFCNLNSFRTKFILGFSIFMGLSIPQYFYQYTTFENYGPVRTSATSFN  469

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            +I+NVPFSSKAFV+GI+A+FLD T+  K+   +KDRG  WW +F+SFK+D RSEEFYSLP
Sbjct  470  NIINVPFSSKAFVSGILAFFLDMTLPPKDKATKKDRGLVWWKRFKSFKSDNRSEEFYSLP  529

Query  396  FNLNKYFPS  370
             NL+KYFPS
Sbjct  530  LNLSKYFPS  538



>ref|XP_009604593.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Nicotiana tomentosiformis]
Length=517

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGL+A TRVGSRRVVQISAGFMIFFSILGK+GA FASIP PIV ALYCL 
Sbjct  332  GIGSSVSVENAGLIAQTRVGSRRVVQISAGFMIFFSILGKYGAFFASIPTPIVGALYCLL  391

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YVGAGG+S LQFCNLNSFR KFILGFSIFLGLS+PQYFNEY AI  YGPVHT  RW N
Sbjct  392  FPYVGAGGLSFLQFCNLNSFRTKFILGFSIFLGLSVPQYFNEYTAIAGYGPVHTHRRWLN  451

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+VNVPFSSKAFVAGIVAYFLD T+ ++ NQ   DRG HWW  F S+K D RSEEFYSLP
Sbjct  452  DMVNVPFSSKAFVAGIVAYFLDNTLQRRYNQTWNDRGNHWWYAFTSYKGDCRSEEFYSLP  511

Query  396  FNLNKY  379
            + L  +
Sbjct  512  YILRHW  517



>ref|XP_006857136.1| PREDICTED: nucleobase-ascorbate transporter 7 [Amborella trichopoda]
 gb|ERN18603.1| hypothetical protein AMTR_s00065p00152120 [Amborella trichopoda]
Length=535

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GS+ S+EN G LALTRVGSRRV+QISA FMIFFSILGKFGA+FASIPAPIVAALYC+F
Sbjct  346  GNGSTASVENTGFLALTRVGSRRVIQISALFMIFFSILGKFGALFASIPAPIVAALYCVF  405

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YV + G+  LQFCNLNSFR KFILGFS+FLGLS+PQYFNE++ ++ +GPV+T  RWFN
Sbjct  406  FAYVASAGLGFLQFCNLNSFRTKFILGFSLFLGLSVPQYFNEFVLVSGHGPVNTKARWFN  465

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D +NV FSS A VA IVA FLD TM   E+ +R+DRG HWW+KF SFKTD+RSEEFYSLP
Sbjct  466  DSMNVIFSSPATVAAIVAVFLDCTMRFGESSLRRDRGWHWWEKFHSFKTDSRSEEFYSLP  525

Query  396  FNLNKYFPSV  367
            FNLNK+FPSV
Sbjct  526  FNLNKHFPSV  535



>gb|KFK43350.1| hypothetical protein AALP_AA1G114400 [Arabis alpina]
Length=536

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G  +++S+ENAGLL +TRVG+RRVVQISAGFMIFFSILGKFGA+FASIPAPI AALYCLF
Sbjct  346  GNATTISVENAGLLPVTRVGNRRVVQISAGFMIFFSILGKFGAIFASIPAPIFAALYCLF  405

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSY-GPVHTGGRWF  580
            F YVGAGG+SLLQFCNLNSFR KFILGFSIF+GLSIPQYF +Y  +++Y GPV T   W+
Sbjct  406  FAYVGAGGLSLLQFCNLNSFRTKFILGFSIFMGLSIPQYFYQYTLLDNYGGPVRTNATWW  465

Query  579  NDIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSL  400
            N++VNVPFSSKAFV+GI A+FLD T+  K+   +KDRG  WW  FRSFK+DTRS+EFYSL
Sbjct  466  NNMVNVPFSSKAFVSGIFAFFLDMTLPPKDKTTKKDRGMVWWKPFRSFKSDTRSQEFYSL  525

Query  399  PFNLNKYFPS  370
            PFNL+ YFPS
Sbjct  526  PFNLSYYFPS  535



>gb|EMS47148.1| Nucleobase-ascorbate transporter 6 [Triticum urartu]
Length=551

 Score =   293 bits (749),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 161/209 (77%), Gaps = 22/209 (11%)
 Frame = -1

Query  930  GSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFG  751
            G SVS+ENAGLL LTRVGSRRVVQISAGFM+FFSILGKFGAVFASIP PI+AA+YCL F 
Sbjct  342  GCSVSVENAGLLGLTRVGSRRVVQISAGFMLFFSILGKFGAVFASIPGPIIAAIYCLLFA  401

Query  750  YVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRW----  583
            YVG  GV  LQFCNLNSFR KFILGFS+F+G+S+PQYFNEY ++  +GPVHT  RW    
Sbjct  402  YVGMAGVGFLQFCNLNSFRTKFILGFSLFMGISVPQYFNEYTSVAGFGPVHTHARWTCCY  461

Query  582  ------------------FNDIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHW  457
                              FND++NV FSSKAFV G  A  LD+T+H+ ++  RKDRG H+
Sbjct  462  VLYHDLGGDTESTGSLYLFNDMINVVFSSKAFVGGATALLLDSTLHRHDSTARKDRGHHF  521

Query  456  WDKFRSFKTDTRSEEFYSLPFNLNKYFPS  370
            WD+FRSFKTD RSEEFYSLPFNLNK+FPS
Sbjct  522  WDRFRSFKTDPRSEEFYSLPFNLNKFFPS  550



>gb|AAD39576.1|AC007067_16 T10O24.16 [Arabidopsis thaliana]
Length=600

 Score =   289 bits (740),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 167/222 (75%), Gaps = 33/222 (15%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G G++ S+ENAGLLA+TRVGSRRV+Q++AGFMIFFSILGKFGA+FASIPAPIVAALYCLF
Sbjct  378  GAGNATSVENAGLLAVTRVGSRRVIQVAAGFMIFFSILGKFGAIFASIPAPIVAALYCLF  437

Query  756  FGYVG---------------------------------AGGVSLLQFCNLNSFRNKFILG  676
            F YVG                                 AGG+SL+QFCNLNSFR KFILG
Sbjct  438  FSYVGTILETTETELFCFLFLEPQGTHLFAQKTENIAGAGGLSLIQFCNLNSFRTKFILG  497

Query  675  FSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDIVNVPFSSKAFVAGIVAYFLDTTMHK  496
            FSIF+GLSIPQYF +Y  + +YGPV T   WFN+I+NVPFSSKAFV+GI+A+FLDTT+  
Sbjct  498  FSIFMGLSIPQYFYQYTTLETYGPVRTSATWFNNIINVPFSSKAFVSGILAFFLDTTLPP  557

Query  495  KENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNKYFPS  370
            K+   +KDRG  WW +F+SF++D RSEEFYSLP NL+KYFPS
Sbjct  558  KDKTTKKDRGLVWWKRFKSFQSDNRSEEFYSLPLNLSKYFPS  599



>ref|XP_002265128.1| PREDICTED: nucleobase-ascorbate transporter 4 [Vitis vinifera]
 emb|CBI22436.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            +GS+ S+EN GLL LTRVGSRR +QISAGFM+FFS+LGKFGA+FASIP PIVAA+YC+FF
Sbjct  341  SGSTASVENTGLLGLTRVGSRRAIQISAGFMLFFSVLGKFGAIFASIPLPIVAAIYCIFF  400

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YV + G+SLLQFCNLNSFR+KFILGFS+F+GLS+PQYF EY+ +  +GPVHT    FN+
Sbjct  401  AYVASAGLSLLQFCNLNSFRSKFILGFSLFMGLSVPQYFKEYVFVTGHGPVHTSTISFNN  460

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            IV V F S A VA IVA+FLD T+ +  +  R D G+HWW KFRSF TDTRSEEFYSLP 
Sbjct  461  IVQVIFQSPATVAAIVAFFLDCTLDRAHSSTRADSGRHWWGKFRSFHTDTRSEEFYSLPC  520

Query  393  NLNKYFPSV  367
            NLNKYFPSV
Sbjct  521  NLNKYFPSV  529



>ref|XP_007200240.1| hypothetical protein PRUPE_ppa015287mg [Prunus persica]
 gb|EMJ01439.1| hypothetical protein PRUPE_ppa015287mg [Prunus persica]
Length=528

 Score =   284 bits (727),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGS+ S+ENAGLL LT +GSRRV+QISAGFM+FFS+LGKFGAV ASIP PIVAAL+C+ +
Sbjct  340  TGSTASVENAGLLGLTHIGSRRVIQISAGFMLFFSVLGKFGAVLASIPLPIVAALFCVLY  399

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YV + G+ LLQFCNLNS+R+KFI+GF++F+GLS+PQYFNEY+A + +GPVHTG  WFN+
Sbjct  400  AYVASAGLGLLQFCNLNSYRSKFIVGFALFMGLSVPQYFNEYLATSGHGPVHTGSTWFNN  459

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            IV V FSS A VA I+A+FLD T+ ++ +  R+D G+HWW KFR+F +DTRSEEFYSLP+
Sbjct  460  IVQVIFSSPATVAIIIAFFLDLTVSRQHSATRRDSGRHWWAKFRNFDSDTRSEEFYSLPY  519

Query  393  NLNKYFPSV  367
            NLN++FPSV
Sbjct  520  NLNRHFPSV  528



>gb|ADN33809.1| nuclease ascorbate transporter [Cucumis melo subsp. melo]
Length=182

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  912  ENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFFGYVGAGG  733
            ENAGLL LTRVGSRR VQ+SAGFM+FFS+LGKFGAV AS+P P++AALYC+ F Y+ + G
Sbjct  1    ENAGLLGLTRVGSRRAVQVSAGFMLFFSVLGKFGAVLASVPLPLMAALYCVLFAYIASAG  60

Query  732  VSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFNDIVNVPFS  553
            +  LQFCNLNSFR+KF+LGFS+FLGLS+PQYFNEY+ I+ +GPVHT  RWFN+IV V FS
Sbjct  61   LGFLQFCNLNSFRSKFVLGFSLFLGLSVPQYFNEYLFISGHGPVHTKARWFNNIVQVIFS  120

Query  552  SKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPFNLNKYFP  373
            S A VA +VA+FLD T+ +     R+D G+HWW KF SF  DTRSEEFYSLP+NLN++FP
Sbjct  121  SPATVAAVVAFFLDITLMRNHTATRRDSGRHWWGKFYSFNLDTRSEEFYSLPWNLNRFFP  180

Query  372  S  370
            S
Sbjct  181  S  181



>ref|XP_008236299.1| PREDICTED: nucleobase-ascorbate transporter 4 [Prunus mume]
Length=528

 Score =   282 bits (722),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  933  TGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLFF  754
            TGS+ S+ENAGLL LT +GSRRV+QISAGFM+FFS+LGKFGAV ASIP PIVAALYC+ +
Sbjct  340  TGSTASVENAGLLGLTHIGSRRVIQISAGFMLFFSVLGKFGAVLASIPLPIVAALYCVLY  399

Query  753  GYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFND  574
             YV + G+ LLQFCNLNS+R+KFI+GF++F+GLS+PQYFNEY+A + +GPVHTG  WFN+
Sbjct  400  AYVASAGLGLLQFCNLNSYRSKFIVGFALFMGLSVPQYFNEYLATSGHGPVHTGSTWFNN  459

Query  573  IVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLPF  394
            IV V FSS A VA I+A+FLD T+ +     R+D G+HWW KF++F +DTRSEEFYSLP+
Sbjct  460  IVQVIFSSPATVAIIIAFFLDLTVSRGHGSTRRDSGRHWWGKFKNFGSDTRSEEFYSLPY  519

Query  393  NLNKYFPSV  367
            NLN++FPSV
Sbjct  520  NLNRHFPSV  528



>ref|XP_008454409.1| PREDICTED: nucleobase-ascorbate transporter 4 [Cucumis melo]
Length=530

 Score =   282 bits (721),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GS+ S+ENAGLL LTRVGSRR VQ+SAGFM+FFS+LGKFGAV AS+P P++AALYC+ 
Sbjct  341  GVGSTASVENAGLLGLTRVGSRRAVQVSAGFMLFFSVLGKFGAVLASVPLPLMAALYCVL  400

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F Y+ + G+  LQFCNLNSFR+KF+LGFS+FLGLS+PQYFNEY+ I+ +GPVHT  RWFN
Sbjct  401  FAYIASAGLGFLQFCNLNSFRSKFVLGFSLFLGLSVPQYFNEYLFISGHGPVHTKARWFN  460

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            +IV V FSS A VA +VA+FLD T+ +     R+D G+HWW KF SF  DTRSEEFYSLP
Sbjct  461  NIVQVIFSSPATVAAVVAFFLDITLMRNHTATRRDSGRHWWGKFYSFNLDTRSEEFYSLP  520

Query  396  FNLNKYFPS  370
            +NLN++FPS
Sbjct  521  WNLNRFFPS  529



>ref|XP_011002186.1| PREDICTED: nucleobase-ascorbate transporter 4-like [Populus euphratica]
Length=533

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            GTGS+ S+ENAGL+ LTRVGSRRVVQI+AGFM+ FS+LGKFGAV ASIP PI+AALYC+ 
Sbjct  344  GTGSTASVENAGLVGLTRVGSRRVVQIAAGFMLLFSVLGKFGAVLASIPLPIMAALYCVL  403

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YV + G+ LLQFCNLNSFR KFILGFS+FLGLS+PQYFNEY+ ++  GPVHTG  WFN
Sbjct  404  FAYVASAGLGLLQFCNLNSFRTKFILGFSLFLGLSVPQYFNEYLLVSGRGPVHTGATWFN  463

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D + V FSS A VA IVA+FLD T  +  +  R+D G+HWW KFR F  DTR+EEFY+LP
Sbjct  464  DAIQVIFSSPATVAIIVAFFLDCTHSRGHSATRRDSGRHWWAKFRYFNQDTRTEEFYALP  523

Query  396  FNLNKYFPS  370
            +NLN++FPS
Sbjct  524  WNLNRFFPS  532



>ref|XP_007042667.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX98498.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
Length=530

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G+GS+ S+ENAGLL LTRVGSRRVVQISA FM+FFS+LGKFGAV ASIP PIVAALYC+ 
Sbjct  341  GSGSTASVENAGLLGLTRVGSRRVVQISAIFMLFFSVLGKFGAVLASIPLPIVAALYCVL  400

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F YV A G+ LLQFCNLNSFR KFILGFS+F+GLS+PQYFNEY+ ++  GPVHT   WFN
Sbjct  401  FAYVAAAGLGLLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYLLVSGRGPVHTKSTWFN  460

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            +++ V FSS A VA I+A+FLD T     + VR+D G+HWW+KFR+F TD+RSEEFYSLP
Sbjct  461  NVMQVIFSSPATVAIIIAFFLDCTHSYGHSSVRRDSGRHWWEKFRNFNTDSRSEEFYSLP  520

Query  396  FNLNKYFPSV  367
             NLN++FPS+
Sbjct  521  GNLNRFFPSI  530



>gb|AAX95758.2| xanthine/uracil permease family protein [Solanum lycopersicum]
Length=695

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 149/190 (78%), Gaps = 26/190 (14%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GSSVS+ENAGLLALTRVGSRRVVQISA FMIFFSILG                     
Sbjct  532  GNGSSVSVENAGLLALTRVGSRRVVQISAAFMIFFSILG---------------------  570

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
                 AGG+  LQFCNLNSFR KFILGFS+FLGLSIPQYFNEY A+  YGPVHT  RWFN
Sbjct  571  -----AGGLGFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAVAGYGPVHTHARWFN  625

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            D+ NVPF SKAFVAGIVA+FLD TMHKK+ Q RKDRGKHWWDKF+SFKTDTRSEEFYSLP
Sbjct  626  DMANVPFQSKAFVAGIVAFFLDNTMHKKDGQTRKDRGKHWWDKFKSFKTDTRSEEFYSLP  685

Query  396  FNLNKYFPSV  367
            FNLNKYFPSV
Sbjct  686  FNLNKYFPSV  695



>ref|XP_004150259.1| PREDICTED: nucleobase-ascorbate transporter 4 [Cucumis sativus]
 gb|KGN52746.1| hypothetical protein Csa_4G000670 [Cucumis sativus]
Length=530

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  936  GTGSSVSIENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPAPIVAALYCLF  757
            G GS+ S ENAGLL LTRVGSRR VQ+SAGFM+FFS+LGKFGAV AS+P P++AALYC+ 
Sbjct  341  GVGSTASFENAGLLGLTRVGSRRAVQVSAGFMLFFSVLGKFGAVLASVPLPLMAALYCVL  400

Query  756  FGYVGAGGVSLLQFCNLNSFRNKFILGFSIFLGLSIPQYFNEYIAINSYGPVHTGGRWFN  577
            F Y+ + G+  LQFCNLNSFR+KF+LGFS+FLGLS+PQYFNEY+ I+ +GPVHT  RWFN
Sbjct  401  FAYIASAGLGFLQFCNLNSFRSKFVLGFSLFLGLSVPQYFNEYLFISGHGPVHTKARWFN  460

Query  576  DIVNVPFSSKAFVAGIVAYFLDTTMHKKENQVRKDRGKHWWDKFRSFKTDTRSEEFYSLP  397
            +IV V FSS A VA +VA+FLD T+ +  +  R+D G+HWW KF SF  DTRSEEFYSLP
Sbjct  461  NIVQVIFSSPATVAAVVAFFLDITLMRNHSATRRDSGRHWWGKFYSFNLDTRSEEFYSLP  520

Query  396  FNLNKYFPS  370
            +NLN++FPS
Sbjct  521  WNLNRFFPS  529



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2227596869306