BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7507

Length=788
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|E9L7A5.1|PAT_PETHY  RecName: Full=Bifunctional aspartate amino...    298   1e-94   Petunia x hybrida [garden petunia]
ref|XP_007048021.1|  Aspartate aminotransferase isoform 2               295   3e-94   
gb|KDO47027.1|  hypothetical protein CISIN_1g012095mg                   293   3e-94   Citrus sinensis [apfelsine]
ref|XP_007048020.1|  Aspartate aminotransferase isoform 1               297   4e-94   
gb|KJB44245.1|  hypothetical protein B456_007G241800                    297   4e-94   Gossypium raimondii
gb|KJB44246.1|  hypothetical protein B456_007G241800                    296   4e-94   Gossypium raimondii
gb|KJB79023.1|  hypothetical protein B456_013G030300                    295   7e-94   Gossypium raimondii
ref|NP_001234609.1|  prephenate aminotransferase                        296   8e-94   Solanum lycopersicum
gb|KJB79022.1|  hypothetical protein B456_013G030300                    296   1e-93   Gossypium raimondii
ref|XP_009776150.1|  PREDICTED: bifunctional aspartate aminotrans...    295   2e-93   Nicotiana sylvestris
gb|KDO47024.1|  hypothetical protein CISIN_1g012095mg                   295   3e-93   Citrus sinensis [apfelsine]
gb|KDO47025.1|  hypothetical protein CISIN_1g012095mg                   295   3e-93   Citrus sinensis [apfelsine]
ref|XP_009619635.1|  PREDICTED: bifunctional aspartate aminotrans...    293   1e-92   Nicotiana tomentosiformis
ref|XP_006464261.1|  PREDICTED: bifunctional aspartate aminotrans...    291   4e-92   Citrus sinensis [apfelsine]
ref|XP_006464262.1|  PREDICTED: bifunctional aspartate aminotrans...    291   4e-92   Citrus sinensis [apfelsine]
ref|XP_006366482.1|  PREDICTED: bifunctional aspartate aminotrans...    291   6e-92   Solanum tuberosum [potatoes]
ref|XP_006428144.1|  hypothetical protein CICLE_v10025279mg             291   7e-91   
ref|XP_006428145.1|  hypothetical protein CICLE_v10025279mg             291   9e-91   
ref|XP_004152277.1|  PREDICTED: bifunctional aspartate aminotrans...    287   2e-90   Cucumis sativus [cucumbers]
ref|XP_002528972.1|  aspartate aminotransferase, putative               284   4e-89   Ricinus communis
ref|XP_008454394.1|  PREDICTED: bifunctional aspartate aminotrans...    284   5e-89   Cucumis melo [Oriental melon]
emb|CDP01418.1|  unnamed protein product                                284   8e-89   Coffea canephora [robusta coffee]
ref|XP_011039537.1|  PREDICTED: bifunctional aspartate aminotrans...    283   8e-89   Populus euphratica
ref|XP_010269179.1|  PREDICTED: bifunctional aspartate aminotrans...    283   2e-88   Nelumbo nucifera [Indian lotus]
ref|XP_012093235.1|  PREDICTED: bifunctional aspartate aminotrans...    282   4e-88   Jatropha curcas
ref|XP_002307109.2|  hypothetical protein POPTR_0005s08100g             280   1e-87   Populus trichocarpa [western balsam poplar]
ref|XP_010027823.1|  PREDICTED: bifunctional aspartate aminotrans...    280   2e-87   Eucalyptus grandis [rose gum]
ref|XP_011008595.1|  PREDICTED: bifunctional aspartate aminotrans...    279   5e-87   Populus euphratica
ref|XP_009369901.1|  PREDICTED: bifunctional aspartate aminotrans...    278   8e-87   Pyrus x bretschneideri [bai li]
ref|XP_007207431.1|  hypothetical protein PRUPE_ppa005032mg             278   9e-87   Prunus persica
ref|XP_011090466.1|  PREDICTED: bifunctional aspartate aminotrans...    278   1e-86   Sesamum indicum [beniseed]
ref|XP_008233417.1|  PREDICTED: bifunctional aspartate aminotrans...    278   1e-86   Prunus mume [ume]
gb|EYU31038.1|  hypothetical protein MIMGU_mgv1a005497mg                278   1e-86   Erythranthe guttata [common monkey flower]
ref|XP_010652828.1|  PREDICTED: bifunctional aspartate aminotrans...    275   2e-86   Vitis vinifera
ref|XP_002310582.2|  hypothetical protein POPTR_0007s05880g             277   2e-86   Populus trichocarpa [western balsam poplar]
ref|XP_010027824.1|  PREDICTED: bifunctional aspartate aminotrans...    274   5e-86   Eucalyptus grandis [rose gum]
ref|XP_008346990.1|  PREDICTED: bifunctional aspartate aminotrans...    276   6e-86   
ref|XP_009378544.1|  PREDICTED: bifunctional aspartate aminotrans...    276   6e-86   Pyrus x bretschneideri [bai li]
ref|XP_008358516.1|  PREDICTED: bifunctional aspartate aminotrans...    276   6e-86   
ref|XP_010911890.1|  PREDICTED: bifunctional aspartate aminotrans...    274   7e-86   Elaeis guineensis
ref|XP_002277000.2|  PREDICTED: bifunctional aspartate aminotrans...    275   1e-85   Vitis vinifera
ref|XP_004302193.2|  PREDICTED: bifunctional aspartate aminotrans...    276   2e-85   Fragaria vesca subsp. vesca
ref|XP_008783401.1|  PREDICTED: bifunctional aspartate aminotrans...    275   2e-85   Phoenix dactylifera
ref|XP_009369904.1|  PREDICTED: bifunctional aspartate aminotrans...    275   2e-85   Pyrus x bretschneideri [bai li]
gb|KCW54449.1|  hypothetical protein EUGRSUZ_I00395                     275   2e-85   Eucalyptus grandis [rose gum]
ref|XP_010911889.1|  PREDICTED: bifunctional aspartate aminotrans...    273   8e-85   Elaeis guineensis
ref|XP_004504047.1|  PREDICTED: bifunctional aspartate aminotrans...    273   9e-85   Cicer arietinum [garbanzo]
ref|XP_010261209.1|  PREDICTED: bifunctional aspartate aminotrans...    273   1e-84   Nelumbo nucifera [Indian lotus]
gb|AII23743.1|  prephenate aminotransferase                             272   2e-84   Antirrhinum majus [garden snapdragon]
ref|XP_007159724.1|  hypothetical protein PHAVU_002G262100g             269   2e-83   Phaseolus vulgaris [French bean]
ref|XP_010090566.1|  Bifunctional aspartate aminotransferase and ...    269   2e-83   Morus notabilis
gb|KCW54448.1|  hypothetical protein EUGRSUZ_I00395                     269   4e-83   Eucalyptus grandis [rose gum]
ref|XP_008809315.1|  PREDICTED: bifunctional aspartate aminotrans...    267   1e-82   Phoenix dactylifera
ref|XP_008809314.1|  PREDICTED: bifunctional aspartate aminotrans...    267   2e-82   Phoenix dactylifera
ref|XP_003531365.1|  PREDICTED: bifunctional aspartate aminotrans...    266   3e-82   Glycine max [soybeans]
gb|KHN29088.1|  Bifunctional aspartate aminotransferase and gluta...    265   6e-82   Glycine soja [wild soybean]
ref|XP_010664298.1|  PREDICTED: bifunctional aspartate aminotrans...    265   9e-82   Vitis vinifera
ref|XP_006646517.1|  PREDICTED: bifunctional aspartate aminotrans...    265   1e-81   
tpg|DAA56613.1|  TPA: hypothetical protein ZEAMMB73_333099              258   2e-81   
ref|NP_001044936.1|  Os01g0871300                                       264   2e-81   
gb|AET04530.2|  aspartate aminotransferase                              264   2e-81   Medicago truncatula
ref|XP_003630054.1|  Aspartate aminotransferase                         264   3e-81   
ref|XP_006826992.1|  PREDICTED: bifunctional aspartate aminotrans...    263   7e-81   Amborella trichopoda
ref|XP_010555356.1|  PREDICTED: bifunctional aspartate aminotrans...    262   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_003525066.1|  PREDICTED: bifunctional aspartate aminotrans...    261   2e-80   Glycine max [soybeans]
gb|AET06146.1|  PLP-dependent aminotransferase                          261   2e-80   Papaver somniferum
gb|KHN38197.1|  Bifunctional aspartate aminotransferase and gluta...    261   2e-80   Glycine soja [wild soybean]
dbj|BAB86539.1|  putative aspartate aminotransferase                    263   2e-80   Oryza sativa Japonica Group [Japonica rice]
gb|ACN26294.1|  unknown                                                 258   4e-80   Zea mays [maize]
gb|ACG35175.1|  hypothetical protein                                    258   6e-80   Zea mays [maize]
gb|AFK38188.1|  unknown                                                 260   8e-80   Medicago truncatula
ref|NP_001143769.1|  hypothetical protein                               258   1e-79   Zea mays [maize]
gb|KHN44325.1|  Bifunctional aspartate aminotransferase and gluta...    258   1e-79   Glycine soja [wild soybean]
ref|XP_003564718.1|  PREDICTED: bifunctional aspartate aminotrans...    259   1e-79   Brachypodium distachyon [annual false brome]
ref|XP_010905916.1|  PREDICTED: bifunctional aspartate aminotrans...    259   1e-79   Elaeis guineensis
gb|EYU24011.1|  hypothetical protein MIMGU_mgv1a006790mg                258   1e-79   Erythranthe guttata [common monkey flower]
ref|XP_002441156.1|  hypothetical protein SORBIDRAFT_09g021360          258   5e-79   Sorghum bicolor [broomcorn]
ref|NP_001142303.1|  uncharacterized protein LOC100274472               258   5e-79   Zea mays [maize]
gb|ACG37512.1|  aspartate aminotransferase                              257   5e-79   Zea mays [maize]
ref|XP_002456709.1|  hypothetical protein SORBIDRAFT_03g041180          254   2e-78   
ref|XP_009402635.1|  PREDICTED: bifunctional aspartate aminotrans...    256   3e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004961976.1|  PREDICTED: bifunctional aspartate aminotrans...    255   3e-78   Setaria italica
gb|KEH24289.1|  aspartate aminotransferase                              256   4e-78   Medicago truncatula
ref|XP_002880438.1|  AAT/ATAAT/MEE17                                    253   4e-77   Arabidopsis lyrata subsp. lyrata
gb|EPS71875.1|  prephenate aminotransferase                             253   6e-77   Genlisea aurea
gb|KHN44324.1|  Bifunctional aspartate aminotransferase and gluta...    251   1e-76   Glycine soja [wild soybean]
ref|XP_007163632.1|  hypothetical protein PHAVU_001G250600g             251   1e-76   Phaseolus vulgaris [French bean]
ref|NP_850022.1|  aspartate aminotransferase                            250   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565529.1|  aspartate aminotransferase                            251   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112542.1|  PREDICTED: bifunctional aspartate aminotrans...    250   4e-76   Brassica rapa
ref|XP_009112541.1|  PREDICTED: bifunctional aspartate aminotrans...    250   5e-76   Brassica rapa
ref|XP_006294125.1|  hypothetical protein CARUB_v10023120mg             250   5e-76   
ref|XP_009140341.1|  PREDICTED: bifunctional aspartate aminotrans...    249   6e-76   Brassica rapa
ref|XP_010695651.1|  PREDICTED: bifunctional aspartate aminotrans...    249   1e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003568386.2|  PREDICTED: bifunctional aspartate aminotrans...    250   1e-75   Brachypodium distachyon [annual false brome]
ref|XP_010674468.1|  PREDICTED: bifunctional aspartate aminotrans...    247   2e-75   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM61164.1|  putative aspartate aminotransferase                     247   6e-75   Arabidopsis thaliana [mouse-ear cress]
gb|EMT16326.1|  Aspartate aminotransferase A                            246   6e-75   
ref|XP_006404683.1|  hypothetical protein EUTSA_v10000093mg             251   6e-75   
gb|KFK32831.1|  hypothetical protein AALP_AA6G292800                    246   1e-74   Arabis alpina [alpine rockcress]
gb|EMS62834.1|  Aspartate aminotransferase                              245   2e-74   Triticum urartu
ref|XP_010429140.1|  PREDICTED: bifunctional aspartate aminotrans...    244   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010472217.1|  PREDICTED: bifunctional aspartate aminotrans...    244   9e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010416982.1|  PREDICTED: bifunctional aspartate aminotrans...    243   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010416981.1|  PREDICTED: bifunctional aspartate aminotrans...    243   4e-73   Camelina sativa [gold-of-pleasure]
sp|Q5F4K8.1|PAT_PINPS  RecName: Full=Aspartate aminotransferase; ...    238   3e-71   Pinus pinaster [cluster pine]
ref|XP_007163631.1|  hypothetical protein PHAVU_001G250500g             237   3e-71   Phaseolus vulgaris [French bean]
gb|ABR17976.1|  unknown                                                 237   8e-71   Picea sitchensis
ref|XP_002965520.1|  hypothetical protein SELMODRAFT_143343             224   4e-67   
ref|XP_001763787.1|  predicted protein                                  224   2e-66   
ref|XP_002982998.1|  hypothetical protein SELMODRAFT_234146             223   3e-66   
gb|KCW54453.1|  hypothetical protein EUGRSUZ_I00398                     219   1e-64   Eucalyptus grandis [rose gum]
gb|KJB79026.1|  hypothetical protein B456_013G030300                    217   3e-63   Gossypium raimondii
gb|KDO47026.1|  hypothetical protein CISIN_1g012095mg                   214   1e-62   Citrus sinensis [apfelsine]
gb|KCW54514.1|  hypothetical protein EUGRSUZ_I004632                    206   9e-62   Eucalyptus grandis [rose gum]
ref|XP_010030428.1|  PREDICTED: bifunctional aspartate aminotrans...    210   7e-61   
gb|AGT17243.1|  hypothetical protein SHCRBa_067_E24_F_120               201   2e-60   Saccharum hybrid cultivar R570
ref|NP_001242772.1|  uncharacterized protein LOC100780254               208   4e-60   
ref|XP_006591408.1|  PREDICTED: bifunctional aspartate aminotrans...    201   7e-58   
ref|XP_003538514.1|  PREDICTED: bifunctional aspartate aminotrans...    201   1e-57   
gb|AFW81839.1|  hypothetical protein ZEAMMB73_129784                    199   1e-56   
ref|XP_001694895.1|  predicted protein                                  186   7e-52   Chlamydomonas reinhardtii
ref|XP_002502760.1|  aspartate aminotransferase                         186   2e-51   Micromonas commoda
ref|XP_005648179.1|  PLP-dependent transferase                          180   3e-50   Coccomyxa subellipsoidea C-169
ref|XP_002946497.1|  hypothetical protein VOLCADRAFT_103084             181   1e-49   Volvox carteri f. nagariensis
ref|XP_003060871.1|  aspartate aminotransferase                         179   3e-49   Micromonas pusilla CCMP1545
ref|XP_001421566.1|  predicted protein                                  172   1e-46   Ostreococcus lucimarinus CCE9901
ref|WP_014065957.1|  aspartate aminotransferase                         166   1e-44   Rhodothermus marinus
ref|WP_012842775.1|  aspartate aminotransferase                         164   6e-44   Rhodothermus marinus
emb|CAN61479.1|  hypothetical protein VITISV_013818                     161   1e-43   Vitis vinifera
ref|XP_005851526.1|  hypothetical protein CHLNCDRAFT_48481              163   3e-43   Chlorella variabilis
ref|WP_039745768.1|  aspartate aminotransferase                         160   1e-42   
ref|XP_007512171.1|  aspartate aminotransferase                         159   9e-42   Bathycoccus prasinos
ref|WP_009578666.1|  Aspartate aminotransferase                         154   3e-40   Fulvivirga imtechensis
gb|AGT17131.1|  hypothetical protein SHCRBa_170_F15_F_220               147   4e-40   Saccharum hybrid cultivar R570
ref|WP_042563747.1|  aspartate aminotransferase                         153   8e-40   Flavobacterium sp. MEB061
ref|WP_014083232.1|  aspartate aminotransferase                         151   4e-39   Flavobacterium branchiophilum
ref|WP_007096871.1|  aspartate aminotransferase                         151   4e-39   Kordia algicida
ref|WP_035135035.1|  aspartate aminotransferase                         151   4e-39   Flavobacterium beibuense
ref|XP_003083519.1|  putative aspartate aminotransferase (ISS)          152   5e-39   Ostreococcus tauri
ref|WP_023575472.1|  aspartate aminotransferase                         150   6e-39   Flavobacterium saliperosum
ref|WP_026991273.1|  aspartate aminotransferase                         150   8e-39   Flavobacterium subsaxonicum
ref|WP_022834450.1|  aspartate aminotransferase                         150   1e-38   Salisaeta longa
ref|XP_007048023.1|  Aspartate aminotransferase isoform 4               150   1e-38   
ref|WP_029273240.1|  aspartate aminotransferase                         149   1e-38   Flavobacterium sp. KJJ
ref|WP_009392912.1|  aspartate aminotransferase                         149   2e-38   Capnocytophaga sp. oral taxon 329
ref|WP_041517563.1|  aspartate aminotransferase                         149   3e-38   Flavobacterium hibernum
ref|WP_023578516.1|  aspartate/tyrosine/aromatic aminotransferase       149   3e-38   Flavobacterium limnosediminis
ref|WP_011962581.1|  aspartate aminotransferase                         149   3e-38   Flavobacterium psychrophilum
ref|WP_035670024.1|  aspartate aminotransferase                         149   3e-38   Flavobacterium sp. 83
ref|WP_034099044.1|  aspartate aminotransferase                         149   4e-38   Flavobacterium psychrophilum
ref|WP_038503298.1|  aspartate aminotransferase                         148   4e-38   Flavobacterium psychrophilum
ref|WP_008991255.1|  aspartate aminotransferase                         148   4e-38   Galbibacter marinus
ref|XP_011399542.1|  Bifunctional aspartate aminotransferase and ...    149   6e-38   Auxenochlorella protothecoides
ref|WP_016990821.1|  aspartate aminotransferase                         148   6e-38   Flavobacterium sp. ACAM 123
ref|WP_023570671.1|  aspartate aminotransferase                         148   6e-38   Flavobacterium cauense
ref|WP_024981404.1|  aspartate aminotransferase                         148   6e-38   Flavobacterium
ref|WP_022826688.1|  aspartate aminotransferase                         148   6e-38   Flavobacterium antarcticum
ref|WP_010418596.1|  aspartate aminotransferase                         148   7e-38   Anaerophaga thermohalophila
ref|WP_007137614.1|  aspartate aminotransferase                         147   9e-38   Flavobacterium frigoris
ref|WP_020212359.1|  aspartate aminotransferase                         147   1e-37   Flavobacterium rivuli
ref|WP_026712367.1|  aspartate aminotransferase                         147   1e-37   Flavobacterium daejeonense
ref|WP_026812169.1|  aspartate aminotransferase                         147   1e-37   Arenibacter certesii
ref|WP_035617997.1|  aspartate aminotransferase                         147   2e-37   Flavobacterium hydatis
ref|WP_035660695.1|  aspartate aminotransferase                         147   2e-37   Flavobacterium seoulense
ref|WP_027419920.1|  aspartate aminotransferase                         147   2e-37   Crocinitomix catalasitica
ref|WP_035685508.1|  aspartate aminotransferase                         146   2e-37   Flavobacterium reichenbachii
ref|WP_026979598.1|  aspartate aminotransferase                         146   2e-37   Flavobacterium suncheonense
ref|WP_039116426.1|  MULTISPECIES: aspartate aminotransferase           146   2e-37   Flavobacterium
ref|WP_031442683.1|  aspartate aminotransferase                         146   3e-37   Arenibacter
ref|WP_007803254.1|  aspartate aminotransferase                         146   3e-37   Flavobacterium sp. CF136
ref|WP_031454536.1|  aspartate aminotransferase                         146   3e-37   Flavobacterium chungangense
ref|WP_039108878.1|  aspartate aminotransferase                         146   3e-37   Flavobacterium sp. AED
ref|WP_042005698.1|  aspartate aminotransferase                         145   4e-37   Capnocytophaga
ref|WP_041985251.1|  aspartate aminotransferase                         145   5e-37   Capnocytophaga canimorsus
ref|WP_026703982.1|  aspartate aminotransferase                         145   5e-37   Flavobacterium soli
ref|WP_004351052.1|  aspartate aminotransferase                         145   5e-37   Prevotella buccalis
ref|WP_035275908.1|  aspartate aminotransferase                         145   5e-37   Desulfobulbus japonicus
ref|WP_026985617.1|  aspartate aminotransferase                         145   5e-37   Flavobacterium sp. URHB0058
ref|WP_012023823.1|  aspartate aminotransferase                         145   5e-37   Flavobacterium
ref|WP_026730628.1|  aspartate aminotransferase                         145   6e-37   Flavobacterium denitrificans
ref|WP_013551019.1|  aspartate aminotransferase                         145   6e-37   Cellulophaga algicola
ref|WP_008467231.1|  aspartate aminotransferase                         145   7e-37   Flavobacterium
emb|CBI21451.3|  unnamed protein product                                141   8e-37   Vitis vinifera
ref|WP_023573422.1|  aspartate/tyrosine/aromatic aminotransferase       145   8e-37   Flavobacterium enshiense
gb|KDD72845.1|  class I/II aminotransferase                             141   8e-37   Helicosporidium sp. ATCC 50920
ref|WP_011403699.1|  aspartate aminotransferase                         145   8e-37   Salinibacter ruber
ref|WP_042346104.1|  aspartate aminotransferase                         145   9e-37   Capnocytophaga canis
ref|WP_026976631.1|  aspartate aminotransferase                         145   9e-37   Flavobacterium tegetincola
ref|WP_026348612.1|  aspartate aminotransferase                         145   1e-36   Eudoraea adriatica
ref|WP_013869150.1|  aspartate aminotransferase                         144   1e-36   Lacinutrix sp. 5H-3-7-4
ref|WP_008122897.1|  aspartate aminotransferase                         144   1e-36   Prevotella timonensis
ref|WP_042345091.1|  aspartate aminotransferase                         144   1e-36   Capnocytophaga canis
ref|WP_034664548.1|  aspartate aminotransferase                         144   1e-36   Cellulophaga sp. E6(2014)
ref|WP_035651685.1|  aspartate aminotransferase                         144   2e-36   Flavobacterium sp. Fl
ref|WP_017497784.1|  aspartate aminotransferase                         144   2e-36   Flavobacterium
ref|WP_015362480.1|  aminotransferase class I /II                       144   2e-36   Nonlabens dokdonensis
ref|WP_024481675.1|  aspartate aminotransferase                         144   2e-36   Cellulophaga baltica
ref|WP_025615820.1|  aspartate aminotransferase                         144   2e-36   Cellulophaga baltica
ref|WP_029447030.1|  aspartate aminotransferase                         144   2e-36   Cellulophaga baltica
ref|WP_026724278.1|  aspartate aminotransferase                         144   2e-36   Flavobacterium sasangense
ref|WP_038266081.1|  aspartate aminotransferase                         144   2e-36   Zhouia amylolytica
ref|WP_026811714.1|  aspartate aminotransferase                         144   2e-36   Arenibacter latericius
ref|WP_016777057.1|  aspartate aminotransferase                         144   2e-36   Anaerophaga thermohalophila
ref|WP_033194606.1|  aspartate aminotransferase                         143   2e-36   Ochrovirga pacifica
dbj|GAE19495.1|  aspartate aminotransferase                             139   2e-36   Bacteroides pyogenes DSM 20611 = JCM 6294
ref|WP_025071956.1|  aspartate aminotransferase                         143   3e-36   Prevotella timonensis
ref|WP_020535732.1|  hypothetical protein                               143   3e-36   Lewinella cohaerens
ref|WP_040471430.1|  aspartate aminotransferase                         143   3e-36   Flavobacteria bacterium MS024-2A
gb|EEG41973.1|  aminotransferase class I and II                         143   3e-36   Flavobacteria bacterium MS024-2A
ref|WP_035123291.1|  aspartate aminotransferase                         143   3e-36   Flavobacterium aquatile
ref|WP_008631434.1|  Aspartate aminotransferase                         143   4e-36   Mariniradius saccharolyticus
ref|WP_008867926.1|  aspartate aminotransferase                         143   4e-36   Flavobacteria bacterium MS024-3C
ref|WP_009415879.1|  putative aspartate aminotransferase                143   4e-36   Capnocytophaga sp. oral taxon 332
ref|WP_045972938.1|  aspartate aminotransferase                         143   4e-36   Flavobacterium sp. 316
ref|WP_002989614.1|  MULTISPECIES: aspartate aminotransferase           143   4e-36   Myroides odoratus
ref|WP_044402523.1|  aspartate aminotransferase                         143   5e-36   Lacinutrix sp. Hel_I_90
ref|WP_044226184.1|  aspartate aminotransferase                         143   5e-36   Phaeodactylibacter xiamenensis
ref|WP_036928356.1|  aspartate aminotransferase                         142   6e-36   Prevotella timonensis
ref|WP_021855241.1|  aspartate aminotransferase                         142   6e-36   Prevotella sp. 109
ref|WP_022429991.1|  putative aspartate transaminase                    142   6e-36   
ref|WP_026707658.1|  aspartate aminotransferase                         142   6e-36   Flavobacterium frigidarium
ref|WP_021990972.1|  aspartate aminotransferase                         137   6e-36   
ref|WP_024283330.1|  aspartate aminotransferase                         142   6e-36   Algoriphagus marincola
ref|WP_013997944.1|  aspartate aminotransferase                         142   6e-36   Capnocytophaga canimorsus
ref|WP_027395725.1|  aspartate aminotransferase                         142   7e-36   Aquimarina latercula
ref|WP_004568839.1|  aspartate aminotransferase                         142   7e-36   Polaribacter irgensii
ref|WP_026946928.1|  aspartate aminotransferase                         142   8e-36   Algoriphagus marincola
ref|WP_036788341.1|  aspartate aminotransferase                         142   8e-36   Polaribacter
ref|WP_027886157.1|  aspartate aminotransferase                         142   8e-36   Mesonia mobilis
ref|WP_035635398.1|  aspartate aminotransferase                         142   9e-36   Flavobacterium gilvum
ref|WP_025572910.1|  aspartate aminotransferase                         142   9e-36   
gb|KGL61505.1|  aspartate aminotransferase                              142   9e-36   Polaribacter sp. Hel1_33_49
ref|WP_026450535.1|  aspartate aminotransferase                         142   1e-35   Aequorivita capsosiphonis
ref|WP_013620221.1|  MULTISPECIES: aspartate aminotransferase           142   1e-35   Cellulophaga
ref|WP_008256239.1|  aspartate aminotransferase                         142   1e-35   Flavobacteria bacterium BAL38
gb|EHJ36817.1|  putative aspartate transaminase                         141   1e-35   Prevotella stercorea DSM 18206
ref|WP_026718238.1|  aspartate aminotransferase                         141   2e-35   Flavobacterium gelidilacus
ref|WP_044164400.1|  aspartate aminotransferase                         141   2e-35   Bacteroides reticulotermitis
ref|WP_040596931.1|  aspartate aminotransferase                         141   2e-35   Prevotella stercorea
ref|WP_013453900.1|  aspartate aminotransferase                         141   2e-35   Marivirga tractuosa
dbj|BAO76230.1|  aspartate aminotransferase                             141   2e-35   Winogradskyella sp. PG-2
ref|WP_036872256.1|  aspartate aminotransferase                         141   2e-35   Prevotella buccalis
ref|WP_045471920.1|  aspartate aminotransferase                         141   2e-35   Winogradskyella sp. PG-2
ref|WP_035327609.1|  MULTISPECIES: aspartate aminotransferase           141   2e-35   Dokdonia
ref|WP_021965095.1|  aspartate aminotransferase                         141   2e-35   
ref|WP_008238499.1|  aspartate aminotransferase                         141   2e-35   Imtechella halotolerans
ref|WP_034261266.1|  aspartate aminotransferase                         141   2e-35   Altibacter lentus
ref|WP_009751122.1|  putative aspartate aminotransferase                141   2e-35   Capnocytophaga sp. oral taxon 326
ref|WP_009184199.1|  aspartate aminotransferase                         141   3e-35   Cecembia lonarensis
ref|WP_044150731.1|  aspartate aminotransferase                         141   3e-35   
ref|WP_022157246.1|  putative aspartate transaminase                    140   3e-35   
ref|WP_027310358.1|  aspartate aminotransferase                         140   3e-35   
ref|WP_022199592.1|  hypothetical protein                               139   3e-35   
ref|WP_025074894.1|  aspartate aminotransferase                         140   3e-35   Bacteroides faecichinchillae
ref|WP_008612163.1|  aspartate aminotransferase                         140   3e-35   Joostella marina
ref|WP_013751359.1|  aspartate aminotransferase                         140   4e-35   Dokdonia sp. 4H-3-7-5
ref|WP_035728588.1|  aspartate aminotransferase                         140   4e-35   
ref|WP_027324515.1|  aspartate aminotransferase                         140   5e-35   Bacteroides pyogenes
ref|WP_018278822.1|  aspartate aminotransferase                         140   5e-35   Capnocytophaga cynodegmi
ref|WP_037382554.1|  aspartate aminotransferase                         140   5e-35   
ref|WP_005926383.1|  MULTISPECIES: aspartate aminotransferase           140   6e-35   Bacteroides salyersiae
ref|WP_010255312.1|  aspartate aminotransferase                         140   6e-35   Myroides injenensis
ref|WP_009751465.1|  aspartate aminotransferase                         140   6e-35   Capnocytophaga
ref|WP_022208656.1|  hypothetical protein                               140   7e-35   
ref|WP_044468841.1|  aspartate aminotransferase                         140   7e-35   Bacteroides uniformis
ref|WP_004299090.1|  aspartate aminotransferase                         139   7e-35   
ref|WP_014033367.1|  aspartate aminotransferase                         139   7e-35   Muricauda ruestringensis
ref|WP_041585526.1|  aspartate aminotransferase                         139   7e-35   Syntrophus aciditrophicus
gb|ABC77478.1|  aspartate aminotransferase                              140   7e-35   Syntrophus aciditrophicus SB
ref|WP_035335958.1|  aspartate aminotransferase                         139   8e-35   Dokdonia sp. PRO95
ref|WP_005834870.1|  MULTISPECIES: aspartate aminotransferase           139   8e-35   Bacteroides
gb|EDO56201.1|  aminotransferase, class I/II                            139   8e-35   Bacteroides uniformis ATCC 8492
ref|WP_010535427.1|  aspartate aminotransferase                         139   8e-35   Bacteroides
ref|WP_004323563.1|  aspartate aminotransferase                         139   9e-35   Bacteroides
ref|WP_008649988.1|  MULTISPECIES: aspartate aminotransferase           139   9e-35   Bacteroides
emb|CBK66141.1|  Aspartate/tyrosine/aromatic aminotransferase           139   9e-35   Bacteroides xylanisolvens XB1A
ref|WP_013687118.1|  aspartate aminotransferase                         139   9e-35   Fluviicola taffensis
ref|WP_045080751.1|  aspartate aminotransferase                         139   1e-34   Aequorivita vladivostokensis
ref|WP_020895694.1|  Aspartate aminotransferase                         139   1e-34   
ref|WP_016479478.1|  aspartate aminotransferase                         139   1e-34   
ref|WP_023058160.1|  MULTISPECIES: aminotransferase, class I/II         139   1e-34   
ref|WP_009422163.1|  aspartate aminotransferase                         139   1e-34   
ref|WP_004306402.1|  MULTISPECIES: aspartate aminotransferase           139   1e-34   
ref|WP_037380526.1|  MULTISPECIES: aspartate aminotransferase           139   1e-34   
ref|WP_004309057.1|  aspartate aminotransferase                         139   1e-34   
ref|WP_038005632.1|  aspartate aminotransferase                         139   1e-34   
ref|WP_010801692.1|  MULTISPECIES: aspartate aminotransferase           139   1e-34   
ref|WP_019967996.1|  aspartate aminotransferase                         139   1e-34   
emb|CCG00596.1|  aspartate aminotransferase                             139   1e-34   
ref|WP_004326448.1|  aspartate aminotransferase                         139   1e-34   
ref|WP_015783025.1|  aspartate aminotransferase                         139   1e-34   
ref|WP_044229420.1|  aspartate aminotransferase                         139   1e-34   
ref|WP_027078932.1|  aspartate aminotransferase                         139   1e-34   
ref|WP_009411115.1|  putative aspartate transaminase                    139   1e-34   
gb|EEF90609.1|  aminotransferase, class I/II                            138   1e-34   
ref|WP_013992134.1|  aspartate aminotransferase                         139   1e-34   
ref|WP_008999056.1|  aspartate aminotransferase                         139   1e-34   
gb|ERI86748.1|  aspartate transaminase                                  138   2e-34   
ref|WP_038235069.1|  aspartate aminotransferase                         139   2e-34   
ref|WP_014790597.1|  aspartate aminotransferase                         139   2e-34   
ref|WP_036382940.1|  aspartate aminotransferase                         139   2e-34   
ref|WP_006988312.1|  aspartate aminotransferase                         139   2e-34   
ref|WP_026914354.1|  aspartate aminotransferase                         139   2e-34   
ref|WP_007655335.1|  aspartate aminotransferase                         139   2e-34   
ref|WP_014781289.1|  aspartate aminotransferase                         139   2e-34   
ref|WP_013258785.1|  aspartate aminotransferase                         139   2e-34   
ref|WP_034542905.1|  aspartate aminotransferase                         139   2e-34   
ref|WP_007217245.1|  MULTISPECIES: aspartate aminotransferase           138   2e-34   
ref|WP_009419963.1|  putative aspartate transaminase                    138   2e-34   
gb|KFB00372.1|  aspartate aminotransferase                              138   2e-34   
emb|CDA85287.1|  uncharacterized protein BN772_03534                    138   2e-34   
ref|WP_038533054.1|  aspartate aminotransferase                         138   2e-34   
ref|WP_044653813.1|  aspartate aminotransferase                         138   2e-34   
ref|WP_036123178.1|  aspartate aminotransferase                         138   2e-34   
ref|WP_040664760.1|  aspartate aminotransferase                         138   2e-34   
emb|CDF78197.1|  aspartate aminotransferase                             138   2e-34   
ref|WP_002679182.1|  aspartate aminotransferase                         138   3e-34   
ref|WP_008270593.1|  aspartate aminotransferase                         138   3e-34   
ref|WP_041383908.1|  aspartate aminotransferase                         137   3e-34   
ref|WP_015264518.1|  aspartate/tyrosine/aromatic aminotransferase       138   3e-34   
gb|EGF50903.1|  aspartate transaminase                                  137   3e-34   
ref|WP_015755729.1|  aspartate aminotransferase                         138   3e-34   
ref|WP_026955376.1|  aspartate aminotransferase                         138   3e-34   
gb|EAQ42330.1|  aminotransferase class I and II                         138   3e-34   
ref|WP_022219349.1|  MULTISPECIES: aminotransferase class I and II      137   4e-34   
ref|WP_035656070.1|  aspartate aminotransferase                         137   4e-34   
ref|WP_035075794.1|  aspartate aminotransferase                         137   4e-34   
ref|WP_008564903.1|  aspartate aminotransferase                         137   4e-34   
ref|WP_038031668.1|  aspartate aminotransferase                         137   5e-34   
ref|WP_005823072.1|  MULTISPECIES: aspartate aminotransferase           137   5e-34   
ref|WP_020404272.1|  hypothetical protein                               137   5e-34   
ref|WP_027067970.1|  aspartate aminotransferase                         137   5e-34   
ref|WP_044632604.1|  aspartate aminotransferase                         137   5e-34   
gb|EYA92707.1|  aminotransferase class-V family protein                 137   5e-34   
ref|WP_022110636.1|  aspartate transaminase                             137   6e-34   
gb|EFR53676.1|  aspartate transaminase                                  137   6e-34   
gb|EXY71744.1|  aminotransferase class-V family protein                 136   6e-34   
ref|WP_019599792.1|  aspartate aminotransferase                         137   6e-34   
gb|EDM20467.1|  aminotransferase, class I/II                            137   6e-34   
ref|WP_011708314.1|  aspartate aminotransferase                         137   6e-34   
ref|WP_013598315.1|  aspartate aminotransferase                         137   7e-34   
gb|AFW81840.1|  hypothetical protein ZEAMMB73_129784                    137   7e-34   
ref|WP_022041591.1|  hypothetical protein                               137   7e-34   
ref|WP_028898559.1|  aspartate aminotransferase                         137   7e-34   
ref|WP_040247740.1|  aspartate aminotransferase                         137   7e-34   
ref|WP_031428118.1|  aspartate aminotransferase                         137   7e-34   
ref|WP_042275880.1|  aspartate aminotransferase                         137   7e-34   
ref|WP_005682573.1|  aspartate aminotransferase                         137   7e-34   
gb|EXY14716.1|  aminotransferase class-V family protein                 137   7e-34   
ref|WP_011108289.1|  aspartate aminotransferase                         137   7e-34   
ref|WP_007767423.1|  aspartate aminotransferase                         137   7e-34   
ref|WP_010523182.1|  aspartate aminotransferase                         137   7e-34   
ref|WP_009779357.1|  aspartate aminotransferase                         137   8e-34   
gb|EXZ46313.1|  aminotransferase class-V family protein                 136   8e-34   
gb|EXZ20999.1|  aminotransferase class-V family protein                 136   8e-34   
ref|WP_041495942.1|  aspartate aminotransferase                         137   8e-34   
ref|WP_014389405.1|  aspartate aminotransferase                         137   8e-34   
gb|EEC52098.1|  aminotransferase, class I/II                            136   8e-34   
ref|WP_008763747.1|  MULTISPECIES: aspartate aminotransferase           137   8e-34   
gb|EDV06931.1|  aminotransferase, class I/II                            136   8e-34   
ref|WP_010178756.1|  aspartate aminotransferase                         137   8e-34   
ref|WP_036896314.1|  aspartate aminotransferase                         137   8e-34   
ref|WP_016420806.1|  hypothetical protein                               137   8e-34   
ref|WP_032569733.1|  aspartate aminotransferase                         137   8e-34   
ref|WP_044282120.1|  aminotransferase class I and II                    136   8e-34   
ref|WP_009640728.1|  aspartate aminotransferase                         137   9e-34   
ref|WP_036909670.1|  aspartate aminotransferase                         137   9e-34   
ref|WP_005784517.1|  aspartate aminotransferase                         137   9e-34   
ref|WP_005810662.1|  aspartate aminotransferase                         137   9e-34   
ref|WP_022394054.1|  MULTISPECIES: hypothetical protein                 137   9e-34   
ref|WP_005796424.1|  MULTISPECIES: aspartate aminotransferase           137   9e-34   
ref|WP_028911467.1|  aspartate aminotransferase                         137   9e-34   
ref|WP_004295091.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_027137138.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_036692207.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_034888939.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_022252350.1|  aspartate transaminase                             136   1e-33   
ref|WP_022275204.1|  hypothetical protein                               136   1e-33   
ref|WP_021967956.1|  hypothetical protein                               136   1e-33   
ref|WP_022328590.1|  aspartate transaminase                             136   1e-33   
ref|WP_025835327.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_021939732.1|  aminotransferase class I and II                    136   1e-33   
ref|WP_018127353.1|  hypothetical protein                               136   1e-33   
ref|WP_013762676.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_008202876.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_036827868.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_028981822.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_026935377.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_045456884.1|  aspartate aminotransferase                         136   1e-33   
ref|WP_018471982.1|  aspartate aminotransferase                         136   1e-33   
gb|EGF52682.1|  aspartate transaminase                                  136   1e-33   
ref|WP_039969506.1|  aspartate aminotransferase                         136   1e-33   
gb|KGL58538.1|  aspartate aminotransferase                              136   2e-33   
ref|WP_025742902.1|  aspartate aminotransferase                         136   2e-33   
ref|WP_044267353.1|  aspartate aminotransferase                         136   2e-33   
ref|WP_002698615.1|  aspartate aminotransferase                         136   2e-33   
ref|WP_027449940.1|  aspartate aminotransferase                         135   2e-33   
gb|EGD33374.1|  aspartate transaminase                                  135   2e-33   
ref|WP_034919088.1|  aspartate aminotransferase                         135   2e-33   
gb|EDM43791.1|  aspartate aminotransferase                              135   2e-33   
gb|EXZ02127.1|  aminotransferase class-V family protein                 135   2e-33   
ref|WP_040358106.1|  aspartate aminotransferase                         135   2e-33   
ref|WP_013545861.1|  aspartate aminotransferase                         135   2e-33   
ref|WP_027454975.1|  aspartate aminotransferase                         135   2e-33   
ref|WP_025068891.1|  aspartate aminotransferase                         135   2e-33   
ref|WP_033960146.1|  aspartate aminotransferase                         135   3e-33   
ref|WP_037440455.1|  aspartate aminotransferase                         135   3e-33   
ref|WP_044202297.1|  aspartate aminotransferase                         135   3e-33   
ref|WP_032601919.1|  aspartate aminotransferase                         135   3e-33   
ref|WP_036156148.1|  aspartate aminotransferase                         135   3e-33   
gb|KEQ30245.1|  aspartate aminotransferase                              135   3e-33   
ref|WP_021947712.1|  aspartate aminotransferase                         135   3e-33   
ref|WP_034062121.1|  aspartate aminotransferase                         135   3e-33   
ref|WP_022149134.1|  aspartate aminotransferase                         135   3e-33   
ref|WP_024995243.1|  aspartate aminotransferase                         135   3e-33   
ref|WP_009129316.1|  hypothetical protein                               135   4e-33   
ref|WP_038984872.1|  aspartate aminotransferase                         135   4e-33   
ref|WP_021852812.1|  hypothetical protein                               135   4e-33   
ref|XP_005777329.1|  putative aminotransferase                          139   4e-33   
ref|XP_005791078.1|  putative aminotransferase                          139   4e-33   
ref|WP_036878488.1|  aspartate aminotransferase                         135   4e-33   
ref|WP_007648362.1|  Aspartate aminotransferase                         135   4e-33   
ref|WP_041877232.1|  aspartate aminotransferase                         134   4e-33   
ref|WP_028374579.1|  aspartate aminotransferase                         135   4e-33   
ref|WP_044625842.1|  aspartate aminotransferase                         134   5e-33   
ref|WP_025125737.1|  aspartate aminotransferase                         134   5e-33   
gb|AJH13641.1|  aspartate aminotransferase                              134   5e-33   
ref|WP_028606556.1|  aspartate aminotransferase                         134   5e-33   
ref|WP_028289056.1|  aspartate aminotransferase                         134   5e-33   
ref|WP_041888746.1|  aspartate aminotransferase                         134   5e-33   
ref|WP_014164745.1|  aspartate aminotransferase                         134   6e-33   
ref|WP_006262731.1|  aspartate aminotransferase                         134   6e-33   
ref|WP_013061531.1|  aspartate aminotransferase                         134   6e-33   
ref|WP_006257475.1|  MULTISPECIES: aspartate aminotransferase           134   6e-33   
gb|ERI63262.1|  aminotransferase, class I/II                            134   6e-33   
ref|WP_036841708.1|  aspartate aminotransferase                         134   6e-33   
ref|WP_036610227.1|  aspartate aminotransferase                         134   6e-33   
ref|WP_013070438.1|  aspartate aminotransferase                         134   6e-33   
ref|WP_026755139.1|  aspartate aminotransferase                         134   6e-33   
ref|WP_034544275.1|  aspartate aminotransferase                         134   6e-33   
ref|WP_027881052.1|  aspartate aminotransferase                         134   6e-33   
ref|WP_005859478.1|  MULTISPECIES: aspartate aminotransferase           134   6e-33   
ref|WP_006849146.1|  aspartate aminotransferase                         134   7e-33   
ref|WP_022120096.1|  aspartate transaminase                             134   7e-33   
ref|WP_007134419.1|  aspartate aminotransferase                         134   8e-33   
ref|WP_010519176.1|  aspartate aminotransferase                         134   8e-33   
ref|WP_033148226.1|  aspartate aminotransferase                         134   8e-33   
ref|WP_039132368.1|  aspartate aminotransferase                         134   8e-33   
gb|EEX43900.1|  aminotransferase, class I/II                            134   9e-33   
ref|WP_021824695.1|  aminotransferase, class I/II                       134   9e-33   
gb|KDR52643.1|  putative aspartate transaminase                         134   9e-33   
ref|WP_024772570.1|  aspartate aminotransferase                         134   9e-33   
ref|WP_032839876.1|  aspartate aminotransferase                         134   9e-33   
ref|WP_002672330.1|  aspartate aminotransferase                         134   1e-32   
ref|WP_010854633.1|  Aspartate aminotransferase                         134   1e-32   
ref|WP_009016890.1|  aspartate aminotransferase                         134   1e-32   
ref|WP_018966968.1|  aspartate aminotransferase                         134   1e-32   
ref|WP_032131172.1|  aspartate aminotransferase                         134   1e-32   
ref|WP_042520134.1|  aspartate aminotransferase                         134   1e-32   
ref|WP_045802347.1|  aspartate aminotransferase                         134   1e-32   
ref|WP_031533269.1|  MULTISPECIES: aspartate aminotransferase           133   1e-32   
ref|WP_022316312.1|  MULTISPECIES: putative aspartate transaminase      133   1e-32   
ref|WP_009231765.1|  aspartate aminotransferase                         133   1e-32   
ref|WP_019187404.1|  aspartate aminotransferase                         133   1e-32   
ref|WP_008772804.1|  aspartate aminotransferase                         133   1e-32   
ref|WP_044072717.1|  aspartate aminotransferase                         133   1e-32   
ref|WP_005867539.1|  MULTISPECIES: aspartate aminotransferase           133   1e-32   
ref|WP_009236451.1|  aspartate aminotransferase                         133   2e-32   
gb|KHJ38438.1|  aspartate aminotransferase                              133   2e-32   
ref|WP_038025481.1|  aspartate aminotransferase                         133   2e-32   
ref|WP_039450776.1|  aspartate aminotransferase                         133   2e-32   
ref|WP_026952816.1|  aspartate aminotransferase                         133   2e-32   
ref|WP_020570746.1|  hypothetical protein                               133   2e-32   
ref|WP_023378769.1|  Aspartate aminotransferase                         133   2e-32   
ref|WP_012821438.1|  aspartate aminotransferase                         133   2e-32   
ref|WP_022309556.1|  aspartate aminotransferase                         133   2e-32   
ref|WP_021992205.1|  aspartate aminotransferase                         133   2e-32   
ref|WP_017843368.1|  hypothetical protein                               133   2e-32   
ref|WP_034241263.1|  aspartate aminotransferase                         133   2e-32   
ref|WP_028902170.1|  aspartate aminotransferase                         133   2e-32   
ref|WP_002670659.1|  aspartate aminotransferase                         133   2e-32   
ref|WP_015370726.1|  aspartate aminotransferase                         133   2e-32   
ref|WP_021589239.1|  aminotransferase, class I/II                       133   2e-32   
ref|WP_039866421.1|  aspartate aminotransferase                         132   2e-32   
gb|EDM36852.1|  putative aspartate aminotransferase                     132   3e-32   
ref|WP_025664987.1|  aspartate aminotransferase                         132   3e-32   
ref|WP_013187227.1|  aspartate aminotransferase                         132   3e-32   
gb|EHO43240.1|  aminotransferase class I and II                         135   3e-32   
ref|WP_026967727.1|  aspartate aminotransferase                         132   3e-32   
ref|WP_034041332.1|  aspartate aminotransferase                         132   3e-32   
ref|WP_029035217.1|  aspartate aminotransferase                         132   3e-32   
gb|EFB33029.1|  aminotransferase, class I/II                            132   3e-32   
ref|WP_014774275.1|  aspartate aminotransferase                         132   3e-32   
ref|WP_044638332.1|  aspartate aminotransferase                         132   3e-32   
gb|EDS16871.1|  aminotransferase, class I/II                            132   3e-32   
ref|WP_022103327.1|  aminotransferase class I and II                    132   3e-32   
ref|WP_018919649.1|  aspartate aminotransferase                         132   3e-32   
ref|WP_036890469.1|  aspartate aminotransferase                         132   3e-32   
ref|WP_013063435.1|  MULTISPECIES: aspartate aminotransferase           132   3e-32   



>sp|E9L7A5.1|PAT_PETHY RecName: Full=Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase; Short=PhPPA-AT; 
Flags: Precursor [Petunia x hybrida]
 gb|ADM67557.1| prephenate aminotransferase [Petunia x hybrida]
Length=479

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHF+AACNKIQSQ TSGASSISQKA
Sbjct  291  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFIAACNKIQSQFTSGASSISQKA  350

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGYAGGE VATMVK+FRERRD+LVKSFGE+EGVKISEP+GAFYLFID SSYYGV
Sbjct  351  AVAALGLGYAGGELVATMVKSFRERRDYLVKSFGEIEGVKISEPRGAFYLFIDLSSYYGV  410

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG++ +SESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERI+KAL
Sbjct  411  EVDGFGSINNSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIKKAL  470

Query  246  LTIRPVVPV  220
            +TI+P VPV
Sbjct  471  VTIKPPVPV  479



>ref|XP_007048021.1| Aspartate aminotransferase isoform 2 [Theobroma cacao]
 gb|EOX92178.1| Aspartate aminotransferase isoform 2 [Theobroma cacao]
Length=421

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  233  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQYTSGASSISQKA  292

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAFRERRDFLVKS GE+EGVKISEPQGAFYLFIDFSSYYG+
Sbjct  293  GVAALGLGYAGGEAVSTMVKAFRERRDFLVKSLGELEGVKISEPQGAFYLFIDFSSYYGI  352

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLD+AQVALVPGDAFGDDTC+RISYAASL+TLQAA ERI+KAL
Sbjct  353  EAEGFGKIENSESLCRYLLDRAQVALVPGDAFGDDTCVRISYAASLTTLQAAFERIKKAL  412

Query  246  LTIRPVVPV  220
            +++RP VPV
Sbjct  413  ISLRPAVPV  421



>gb|KDO47027.1| hypothetical protein CISIN_1g012095mg [Citrus sinensis]
Length=352

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  164  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKA  223

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+ MVKAFRERRDFLVKSFGE+EGVK+SEPQGAFYLFIDFS+YYG 
Sbjct  224  GVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSTYYGS  283

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASL+TLQAAVERI+K L
Sbjct  284  EAEGFGKIENSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKGL  343

Query  246  LTIRPVVPV  220
            LT+RP VPV
Sbjct  344  LTLRPGVPV  352



>ref|XP_007048020.1| Aspartate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007048022.1| Aspartate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOX92177.1| Aspartate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOX92179.1| Aspartate aminotransferase isoform 1 [Theobroma cacao]
Length=480

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  292  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQYTSGASSISQKA  351

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAFRERRDFLVKS GE+EGVKISEPQGAFYLFIDFSSYYG+
Sbjct  352  GVAALGLGYAGGEAVSTMVKAFRERRDFLVKSLGELEGVKISEPQGAFYLFIDFSSYYGI  411

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLD+AQVALVPGDAFGDDTC+RISYAASL+TLQAA ERI+KAL
Sbjct  412  EAEGFGKIENSESLCRYLLDRAQVALVPGDAFGDDTCVRISYAASLTTLQAAFERIKKAL  471

Query  246  LTIRPVVPV  220
            +++RP VPV
Sbjct  472  ISLRPAVPV  480



>gb|KJB44245.1| hypothetical protein B456_007G241800 [Gossypium raimondii]
Length=480

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQSTSGASSI+QKA
Sbjct  292  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQSTSGASSIAQKA  351

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEA++TMVKAFRERRDFLVKSFGE+EGVKISEPQGAFYLFIDFSSYYG+
Sbjct  352  GVAALGLGYAGGEAISTMVKAFRERRDFLVKSFGELEGVKISEPQGAFYLFIDFSSYYGI  411

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRY LDKAQVALVPGDAFGDD+CIRISYAASL+TLQAA ERI+KAL
Sbjct  412  EAEGFGKIENSESLCRYFLDKAQVALVPGDAFGDDSCIRISYAASLTTLQAAFERIKKAL  471

Query  246  LTIRPVVPV  220
             ++RP VPV
Sbjct  472  FSLRPAVPV  480



>gb|KJB44246.1| hypothetical protein B456_007G241800 [Gossypium raimondii]
Length=455

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQSTSGASSI+QKA
Sbjct  267  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQSTSGASSIAQKA  326

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEA++TMVKAFRERRDFLVKSFGE+EGVKISEPQGAFYLFIDFSSYYG+
Sbjct  327  GVAALGLGYAGGEAISTMVKAFRERRDFLVKSFGELEGVKISEPQGAFYLFIDFSSYYGI  386

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRY LDKAQVALVPGDAFGDD+CIRISYAASL+TLQAA ERI+KAL
Sbjct  387  EAEGFGKIENSESLCRYFLDKAQVALVPGDAFGDDSCIRISYAASLTTLQAAFERIKKAL  446

Query  246  LTIRPVVPV  220
             ++RP VPV
Sbjct  447  FSLRPAVPV  455



>gb|KJB79023.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
 gb|KJB79027.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
Length=421

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPK+F+AACNKIQSQSTSGASSI+QKA
Sbjct  233  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKNFIAACNKIQSQSTSGASSIAQKA  292

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+TMVKAFRERRDFLVKSFGE+EGVKISEPQGAFYLFIDFSSYYG+
Sbjct  293  GVAALGLGYAGGEVVSTMVKAFRERRDFLVKSFGELEGVKISEPQGAFYLFIDFSSYYGI  352

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +SESLCRYLLDK QVALVPGDAFGDD+CIRISYAASL+TLQA+ ERI+KAL
Sbjct  353  EVEGFGKIENSESLCRYLLDKGQVALVPGDAFGDDSCIRISYAASLTTLQASFERIKKAL  412

Query  246  LTIRPVVPV  220
            +++RP VPV
Sbjct  413  ISLRPAVPV  421



>ref|NP_001234609.1| prephenate aminotransferase [Solanum lycopersicum]
 gb|ADQ00383.1| prephenate aminotransferase [Solanum lycopersicum]
Length=480

 Score =   296 bits (758),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHFV+ACNK+QSQ TSGASSISQKA
Sbjct  292  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFVSACNKLQSQFTSGASSISQKA  351

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGYAGGEAVATMVKAFRERRDFLVKSFGE++GVKISEP+GAFYLFID SSYYGV
Sbjct  352  AVAALGLGYAGGEAVATMVKAFRERRDFLVKSFGEIDGVKISEPRGAFYLFIDLSSYYGV  411

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +SESLCRYLLDK+QVALVPGDAFGDDTCIRISYAASLSTLQAAVERI+KAL
Sbjct  412  EVDGFGTINNSESLCRYLLDKSQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIKKAL  471

Query  246  LTIRPVVPV  220
            +T+RP VPV
Sbjct  472  VTLRPPVPV  480



>gb|KJB79022.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
 gb|KJB79024.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
Length=479

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPK+F+AACNKIQSQSTSGASSI+QKA
Sbjct  291  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKNFIAACNKIQSQSTSGASSIAQKA  350

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+TMVKAFRERRDFLVKSFGE+EGVKISEPQGAFYLFIDFSSYYG+
Sbjct  351  GVAALGLGYAGGEVVSTMVKAFRERRDFLVKSFGELEGVKISEPQGAFYLFIDFSSYYGI  410

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +SESLCRYLLDK QVALVPGDAFGDD+CIRISYAASL+TLQA+ ERI+KAL
Sbjct  411  EVEGFGKIENSESLCRYLLDKGQVALVPGDAFGDDSCIRISYAASLTTLQASFERIKKAL  470

Query  246  LTIRPVVPV  220
            +++RP VPV
Sbjct  471  ISLRPAVPV  479



>ref|XP_009776150.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Nicotiana sylvestris]
Length=480

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLT+NGFSKAFAMTGWRLGYIAGPKHFV+ACNKIQSQ TSGASSISQKA
Sbjct  292  SFASLPGMWDRTLTINGFSKAFAMTGWRLGYIAGPKHFVSACNKIQSQFTSGASSISQKA  351

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGYAGGEAVATMVKAFRERRD+LVKSFGE++GVKISEP+GAFYLFID SSYYGV
Sbjct  352  AVAALGLGYAGGEAVATMVKAFRERRDYLVKSFGEIDGVKISEPRGAFYLFIDLSSYYGV  411

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG++ DSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERI+KAL
Sbjct  412  EVDGFGSINDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIKKAL  471

Query  246  LTIRPVVPV  220
            +T+R  VPV
Sbjct  472  VTLRSHVPV  480



>gb|KDO47024.1| hypothetical protein CISIN_1g012095mg [Citrus sinensis]
Length=471

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  283  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKA  342

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+ MVKAFRERRDFLVKSFGE+EGVK+SEPQGAFYLFIDFS+YYG 
Sbjct  343  GVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSTYYGS  402

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASL+TLQAAVERI+K L
Sbjct  403  EAEGFGKIENSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKGL  462

Query  246  LTIRPVVPV  220
            LT+RP VPV
Sbjct  463  LTLRPGVPV  471



>gb|KDO47025.1| hypothetical protein CISIN_1g012095mg [Citrus sinensis]
Length=470

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  282  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKA  341

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+ MVKAFRERRDFLVKSFGE+EGVK+SEPQGAFYLFIDFS+YYG 
Sbjct  342  GVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSTYYGS  401

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASL+TLQAAVERI+K L
Sbjct  402  EAEGFGKIENSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKGL  461

Query  246  LTIRPVVPV  220
            LT+RP VPV
Sbjct  462  LTLRPGVPV  470



>ref|XP_009619635.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Nicotiana tomentosiformis]
Length=478

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHFV+ACNKIQSQ TSGASSISQKA
Sbjct  290  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFVSACNKIQSQFTSGASSISQKA  349

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGYAGGEAVATMVKAFR+RRD+LVKSFGE++GVKISEP+GAFYLFID SSYYG 
Sbjct  350  AVAALGLGYAGGEAVATMVKAFRKRRDYLVKSFGEIDGVKISEPRGAFYLFIDLSSYYGA  409

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG++ +SESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERI KAL
Sbjct  410  EVDGFGSINNSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERINKAL  469

Query  246  LTIRPVVPV  220
            +T++P VPV
Sbjct  470  VTLKPTVPV  478



>ref|XP_006464261.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X1 [Citrus 
sinensis]
Length=471

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  283  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKA  342

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+ MVKAFRERRDFLVKSFGE+EGVK+SEPQGAFYLFIDFSSYYG 
Sbjct  343  GVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSSYYGS  402

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASL+TLQAAVERI+K L
Sbjct  403  EAEGFGKIENSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKGL  462

Query  246  LTIRPVV  226
            LT+RP V
Sbjct  463  LTLRPGV  469



>ref|XP_006464262.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X2 [Citrus 
sinensis]
Length=470

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  282  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKA  341

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+ MVKAFRERRDFLVKSFGE+EGVK+SEPQGAFYLFIDFSSYYG 
Sbjct  342  GVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSSYYGS  401

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASL+TLQAAVERI+K L
Sbjct  402  EAEGFGKIENSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKGL  461

Query  246  LTIRPVV  226
            LT+RP V
Sbjct  462  LTLRPGV  468



>ref|XP_006366482.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Solanum tuberosum]
Length=480

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHF++ACNK+QSQ TSGASSISQKA
Sbjct  292  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFISACNKLQSQFTSGASSISQKA  351

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAVATM+KAFRERRDFLVKSFGE++ VKISEP+GAFYLFID SSYYGV
Sbjct  352  GVAALGLGYAGGEAVATMLKAFRERRDFLVKSFGEIDSVKISEPRGAFYLFIDLSSYYGV  411

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG V +SESLCRYLLDK+QVALVPGDAFGDDTCIRISYAASLSTLQAAVERI+KAL
Sbjct  412  EVDGFGTVNNSESLCRYLLDKSQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIKKAL  471

Query  246  LTIRPVVPV  220
            +T++P VPV
Sbjct  472  ITLKPPVPV  480



>ref|XP_006428144.1| hypothetical protein CICLE_v10025279mg [Citrus clementina]
 gb|ESR41384.1| hypothetical protein CICLE_v10025279mg [Citrus clementina]
Length=567

 Score =   291 bits (745),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  379  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKA  438

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+ MVKAFRERRDFLVKSFGE+EGVK+SEPQGAFYLFIDFSSYYG 
Sbjct  439  GVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSSYYGS  498

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASL+TLQAAVERI+K L
Sbjct  499  EAEGFGKIENSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKGL  558

Query  246  LTIRPVVPV  220
            LT+RP V V
Sbjct  559  LTLRPGVLV  567



>ref|XP_006428145.1| hypothetical protein CICLE_v10025279mg [Citrus clementina]
 gb|ESR41385.1| hypothetical protein CICLE_v10025279mg [Citrus clementina]
Length=566

 Score =   291 bits (744),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  378  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKA  437

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+ MVKAFRERRDFLVKSFGE+EGVK+SEPQGAFYLFIDFSSYYG 
Sbjct  438  GVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSSYYGS  497

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASL+TLQAAVERI+K L
Sbjct  498  EAEGFGKIENSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKGL  557

Query  246  LTIRPVVPV  220
            LT+RP V V
Sbjct  558  LTLRPGVLV  566



>ref|XP_004152277.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Cucumis sativus]
 gb|KGN52768.1| hypothetical protein Csa_4G000870 [Cucumis sativus]
Length=475

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFV+AC KIQSQSTSGASSISQKA
Sbjct  287  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVSACGKIQSQSTSGASSISQKA  346

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALG+GYAGGEAVATMVKAFRERRD+LVKSFGE+ GVKISEPQGAFYLF+DFSSYYG 
Sbjct  347  AVAALGMGYAGGEAVATMVKAFRERRDYLVKSFGELAGVKISEPQGAFYLFLDFSSYYGA  406

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +SESLCRYLL+K QVALVPGDAFGDDTCIRISYA SLS LQAAVERI+KAL
Sbjct  407  EVEGFGVINNSESLCRYLLEKGQVALVPGDAFGDDTCIRISYAESLSVLQAAVERIKKAL  466

Query  246  LTIRPVVPV  220
               RPVVPV
Sbjct  467  EAARPVVPV  475



>ref|XP_002528972.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF33391.1| aspartate aminotransferase, putative [Ricinus communis]
Length=484

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A P+HF+AACNKIQSQ TSGASSI+QKA
Sbjct  296  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPRHFLAACNKIQSQFTSGASSIAQKA  355

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLG+AGGEAV+TMVKAF+ERRDFL+KSFGEMEGV++SEPQGAFYLFID SSYYGV
Sbjct  356  AVAALGLGFAGGEAVSTMVKAFKERRDFLIKSFGEMEGVRMSEPQGAFYLFIDVSSYYGV  415

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DS+SLCRYLLD AQVA+VPG AFGDD+CIRISYAASL+TLQAAVERI+KAL
Sbjct  416  EVEGFGKIDDSDSLCRYLLDNAQVAVVPGGAFGDDSCIRISYAASLTTLQAAVERIKKAL  475

Query  246  LTIRPVVPV  220
            + ++P VPV
Sbjct  476  IPLKPAVPV  484



>ref|XP_008454394.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Cucumis melo]
Length=477

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFV+AC KIQSQSTSGASSISQKA
Sbjct  289  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVSACGKIQSQSTSGASSISQKA  348

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALG+GYAGGEAVATMVKAFRERRD+LVKSFGE+ GVKISEPQGAFYLF+DFSSYYG 
Sbjct  349  AVAALGMGYAGGEAVATMVKAFRERRDYLVKSFGELAGVKISEPQGAFYLFLDFSSYYGA  408

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +SESLCRYLL+K QVALVPGDAFGDD+CIRISYA SLS LQAAVERI++AL
Sbjct  409  EVEGFGVINNSESLCRYLLEKGQVALVPGDAFGDDSCIRISYAESLSVLQAAVERIKEAL  468

Query  246  LTIRPVVPV  220
               RPVVPV
Sbjct  469  EAARPVVPV  477



>emb|CDP01418.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   284 bits (726),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+L GMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFV+ACNKIQSQ TSGASSISQKA
Sbjct  300  SFAALHGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVSACNKIQSQFTSGASSISQKA  359

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAAL +GYAGGEAVATMVKAFRERRDFLVK F E++GVKISEPQGAFYLF+DFSSYYG 
Sbjct  360  AVAALEMGYAGGEAVATMVKAFRERRDFLVKGFRELDGVKISEPQGAFYLFLDFSSYYGA  419

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E+ GFG +  SESLCRYLLDKAQVALVPG+AFGDDTCIRISYAASLSTLQAA ERI+KAL
Sbjct  420  EIDGFGKIDGSESLCRYLLDKAQVALVPGEAFGDDTCIRISYAASLSTLQAAFERIKKAL  479

Query  246  LTIRPVVPV  220
            +T+RP VPV
Sbjct  480  VTLRPPVPV  488



>ref|XP_011039537.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Populus euphratica]
Length=480

 Score =   283 bits (725),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  292  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACNKIQSQFTSGASSISQKA  351

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAFRERRDFL+KSFGEMEGV +SEP GAFYLFIDFSSYYG 
Sbjct  352  GVAALGLGYAGGEAVSTMVKAFRERRDFLIKSFGEMEGVGLSEPLGAFYLFIDFSSYYGA  411

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DS++LCRYLLD+AQVALVPG AFGDD+CIRISYAASL+TLQAAVERI+KAL
Sbjct  412  EVEGFGKIDDSDALCRYLLDQAQVALVPGVAFGDDSCIRISYAASLTTLQAAVERIKKAL  471

Query  246  LTIRPVVPV  220
            L ++  VPV
Sbjct  472  LPLKSAVPV  480



>ref|XP_010269179.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Nelumbo nucifera]
Length=482

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGP+HFVAAC KIQSQSTSGASSISQKA
Sbjct  294  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPRHFVAACGKIQSQSTSGASSISQKA  353

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAF+ERRDFLVKSF E+EGVKISEPQGAFYLF+DFSSYYGV
Sbjct  354  GVAALGLGYAGGEAVSTMVKAFQERRDFLVKSFKELEGVKISEPQGAFYLFLDFSSYYGV  413

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLCRYLLD+AQVALVPGDAFGDD CIRISYAASLSTLQAA ERI+ A+
Sbjct  414  EAEGFGVIKDSESLCRYLLDEAQVALVPGDAFGDDNCIRISYAASLSTLQAATERIKGAM  473

Query  246  LTIRPVVPV  220
             ++R V+PV
Sbjct  474  ASLRRVIPV  482



>ref|XP_012093235.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Jatropha curcas]
 gb|KDP46883.1| hypothetical protein JCGZ_24092 [Jatropha curcas]
Length=485

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW RTLTVNGFSKAFAMTGWRLGY+AGPKHFVAACNKIQSQ TSGASSI+QKA
Sbjct  297  SFASLPGMWGRTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACNKIQSQFTSGASSIAQKA  356

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGYAGGE V+TMVKAF+ERRDFL+ SFGEMEGVK+S+PQGAFYLFID SSYYGV
Sbjct  357  AVAALGLGYAGGEVVSTMVKAFKERRDFLITSFGEMEGVKMSKPQGAFYLFIDLSSYYGV  416

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DS+SLCRYLLDKAQVA+VPG AFGDD+CIRISYAASL+TLQAAVERI+KAL
Sbjct  417  EAEGFGKIEDSDSLCRYLLDKAQVAVVPGGAFGDDSCIRISYAASLTTLQAAVERIKKAL  476

Query  246  LTIRPVVPV  220
            + ++P +PV
Sbjct  477  ILLKPAIPV  485



>ref|XP_002307109.2| hypothetical protein POPTR_0005s08100g [Populus trichocarpa]
 gb|EEE94105.2| hypothetical protein POPTR_0005s08100g [Populus trichocarpa]
Length=480

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  292  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACNKIQSQFTSGASSISQKA  351

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMV AFRERRDFL+KSFGEMEGV +SEP GAFYLFIDFSSYYG 
Sbjct  352  GVAALGLGYAGGEAVSTMVIAFRERRDFLIKSFGEMEGVGLSEPLGAFYLFIDFSSYYGA  411

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DS++LCRYLLD+AQVALVPG AFGDD+CIRISYAASL+TLQAAVERI+KAL
Sbjct  412  EVEGFGKIDDSDALCRYLLDQAQVALVPGVAFGDDSCIRISYAASLTTLQAAVERIKKAL  471

Query  246  LTIRPVVPV  220
            L ++  VPV
Sbjct  472  LPLKSAVPV  480



>ref|XP_010027823.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
 gb|KCW54450.1| hypothetical protein EUGRSUZ_I00395 [Eucalyptus grandis]
Length=483

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERT TVNGFSKAFAMTGWRLGY+AGPKHF++AC KIQSQ TSGASSISQKA
Sbjct  295  SFASLPGMWERTFTVNGFSKAFAMTGWRLGYVAGPKHFISACAKIQSQFTSGASSISQKA  354

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAAL +GYAGGE V  MVKAFRERRD+LVK FGE+EGVKISEPQGAFYLFIDFS YYGV
Sbjct  355  GVAALSMGYAGGETVKNMVKAFRERRDYLVKGFGELEGVKISEPQGAFYLFIDFSCYYGV  414

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E+ GFGA+  SESLCRYLLDKAQVALVPG AFGDD+CIRISYAASL TL+ A ERI+KAL
Sbjct  415  EIEGFGAIDSSESLCRYLLDKAQVALVPGGAFGDDSCIRISYAASLPTLKEAFERIKKAL  474

Query  246  LTIRPVVPV  220
            +T+RP VPV
Sbjct  475  VTLRPAVPV  483



>ref|XP_011008595.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Populus euphratica]
Length=481

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  293  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKA  352

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAF ERRDFL++SFGEMEGV++SEPQGAFYLFID SSYYG 
Sbjct  353  GVAALGLGYAGGEAVSTMVKAFMERRDFLIRSFGEMEGVRMSEPQGAFYLFIDVSSYYGT  412

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DS+SLCRYLLD+AQVALVPG AF DD+CIRISYAASL+TLQ AVERI+KAL
Sbjct  413  EAEGFGKIEDSDSLCRYLLDQAQVALVPGVAFADDSCIRISYAASLTTLQEAVERIKKAL  472

Query  246  LTIRPVVPV  220
            L ++  VPV
Sbjct  473  LPLKSAVPV  481



>ref|XP_009369901.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Pyrus x bretschneideri]
Length=488

 Score =   278 bits (712),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLT+NGFSKAFAMTGWRLGYIAGPKHFV AC K+QSQ TSGASSISQKA
Sbjct  300  SFASLPGMWERTLTINGFSKAFAMTGWRLGYIAGPKHFVTACGKLQSQFTSGASSISQKA  359

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEA ATMVKAFRERRDFLVKSFGE+ GV+ISEP+GAFYLFIDFS+YYG+
Sbjct  360  GVAALGLGYAGGEAGATMVKAFRERRDFLVKSFGELSGVRISEPRGAFYLFIDFSAYYGM  419

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDK QVALVPGDAFGDDTCIRISYAASL TLQAAVERI+KAL
Sbjct  420  EAKGFGKIENSESLCRYLLDKGQVALVPGDAFGDDTCIRISYAASLPTLQAAVERIKKAL  479

Query  246  LTIRPVVPV  220
            + ++P V V
Sbjct  480  VELKPSVGV  488



>ref|XP_007207431.1| hypothetical protein PRUPE_ppa005032mg [Prunus persica]
 gb|EMJ08630.1| hypothetical protein PRUPE_ppa005032mg [Prunus persica]
Length=480

 Score =   278 bits (711),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  297  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACGKIQSQFTSGASSISQKA  356

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+ MVKAFRERRDFLVKSFGE+ GVKISEP+GAFYLFID SSYYG 
Sbjct  357  GVAALGLGYAGGEAVSIMVKAFRERRDFLVKSFGELSGVKISEPKGAFYLFIDVSSYYGT  416

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDK QVALVPGDAFGDDTCIRISYAASL+TLQAAVERI+KAL
Sbjct  417  EAEGFGKIENSESLCRYLLDKGQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKAL  476

Query  246  LTIR  235
            +T++
Sbjct  477  VTLK  480



>ref|XP_011090466.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Sesamum indicum]
Length=481

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGY+AGPKHFVAAC KIQSQSTSGASSISQKA
Sbjct  293  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACGKIQSQSTSGASSISQKA  352

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGYAGGEAVATMVKAFRERRDFLV SFGE+ GVKISEPQGAFYLF+DFSSYYG 
Sbjct  353  AVAALGLGYAGGEAVATMVKAFRERRDFLVNSFGELPGVKISEPQGAFYLFLDFSSYYGS  412

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +V GFG ++ SESLCRYLLD AQVALVPGDAFGDDTCIRISYA SL+TLQAAVERI+ AL
Sbjct  413  KVDGFGVISGSESLCRYLLDMAQVALVPGDAFGDDTCIRISYAESLTTLQAAVERIKGAL  472

Query  246  LTIRPVVPV  220
            ++++P V V
Sbjct  473  VSLQPAVAV  481



>ref|XP_008233417.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Prunus mume]
Length=481

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  298  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACGKIQSQFTSGASSISQKA  357

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+ MVKAFRERRDFLVKSFGE+ GVKISEP+GAFYLFID SSYYG 
Sbjct  358  GVAALGLGYAGGEAVSIMVKAFRERRDFLVKSFGELSGVKISEPKGAFYLFIDVSSYYGT  417

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDK QVALVPGDAFGDDTCIRISYAASL+TLQAAVERI+KAL
Sbjct  418  EAEGFGKIENSESLCRYLLDKGQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKAL  477

Query  246  LTIR  235
            +T++
Sbjct  478  VTLK  481



>gb|EYU31038.1| hypothetical protein MIMGU_mgv1a005497mg [Erythranthe guttata]
Length=481

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHFVAAC KIQSQ+TSGASSISQK 
Sbjct  293  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACGKIQSQTTSGASSISQKG  352

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+ MVKAFRERRDFLVKSFGE++GVKISEPQGAFYLF+DFSSYYG 
Sbjct  353  GVAALGLGYAGGEAVSVMVKAFRERRDFLVKSFGELDGVKISEPQGAFYLFLDFSSYYGS  412

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            ++ GFG +  SESLCRYLLD+AQVALVPGDAFGDDTCIRISYAASL+TL+AAVE+I+ AL
Sbjct  413  KIDGFGVIDGSESLCRYLLDEAQVALVPGDAFGDDTCIRISYAASLATLKAAVEKIKGAL  472

Query  246  LTIRPVV  226
            L+++P V
Sbjct  473  LSLKPAV  479



>ref|XP_010652828.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X2 [Vitis 
vinifera]
Length=410

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+LPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  222  SFAALPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACGKIQSQFTSGASSISQKA  281

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALG+GYAGGEAV+TMVKAFRERRDFLVKSFGE+EGVKISEPQGAFYLF+DFSSYYG 
Sbjct  282  AVAALGMGYAGGEAVSTMVKAFRERRDFLVKSFGELEGVKISEPQGAFYLFLDFSSYYGA  341

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKA  250
            E  GFG + +SESLCRYLLD+AQVALVPGDAFGDD CIRISYAASLSTL AAVERI+KA
Sbjct  342  EAEGFGIIENSESLCRYLLDQAQVALVPGDAFGDDKCIRISYAASLSTLHAAVERIKKA  400



>ref|XP_002310582.2| hypothetical protein POPTR_0007s05880g [Populus trichocarpa]
 gb|EEE91032.2| hypothetical protein POPTR_0007s05880g [Populus trichocarpa]
Length=481

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  293  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKA  352

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAF ERRDFL++SFGEMEGV++SEPQGAFYLFID SSYYG 
Sbjct  353  GVAALGLGYAGGEAVSTMVKAFMERRDFLIRSFGEMEGVRMSEPQGAFYLFIDTSSYYGT  412

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DS+SLCRYLLD+AQVALVPG AFGDD+CIRISYAASL+TLQ AV RI+KAL
Sbjct  413  EAEGFGKIEDSDSLCRYLLDQAQVALVPGVAFGDDSCIRISYAASLTTLQEAVGRIKKAL  472

Query  246  LTIRPVVPV  220
            L ++  VPV
Sbjct  473  LPLKSAVPV  481



>ref|XP_010027824.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
 ref|XP_010027825.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
 ref|XP_010027826.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
 ref|XP_010027827.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
 gb|KCW54451.1| hypothetical protein EUGRSUZ_I00395 [Eucalyptus grandis]
Length=410

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHF++AC KIQSQ TS ASSI+QKA
Sbjct  222  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFISACAKIQSQFTSSASSIAQKA  281

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL +GYAGGE V TMVKAFRERRDFLVKSFGE+EGVK SEPQGAFYLFID S YYG 
Sbjct  282  ALAALSMGYAGGETVETMVKAFRERRDFLVKSFGELEGVKYSEPQGAFYLFIDLSCYYGA  341

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GF  +  SESLCRYLLD+AQVAL+PG A GDDTCIRISYA+SL+TLQ A  RI+KAL
Sbjct  342  EVEGFSVINGSESLCRYLLDRAQVALLPGGACGDDTCIRISYASSLATLQEAFRRIKKAL  401

Query  246  LTIRPVVPV  220
            LT+RP VPV
Sbjct  402  LTLRPSVPV  410



>ref|XP_008346990.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Malus domestica]
Length=484

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLT+NGFSKAFAMTGWRLGYIAGPKHFVAAC K+QSQ TSGA SISQKA
Sbjct  294  SFASLPGMWERTLTINGFSKAFAMTGWRLGYIAGPKHFVAACGKLQSQFTSGACSISQKA  353

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG+AGGEAV+ MVKAFRERRDFLVKSFGE+ GVKISEP+GAFYLF+DFS+YYG 
Sbjct  354  GVAALGLGFAGGEAVSVMVKAFRERRDFLVKSFGELSGVKISEPRGAFYLFVDFSAYYGT  413

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDK QVALVPGDAFGDDTCIRISYAASL T QAAVERI+KAL
Sbjct  414  EAEGFGKIENSESLCRYLLDKGQVALVPGDAFGDDTCIRISYAASLPTXQAAVERIKKAL  473

Query  246  LTIRPV  229
            + ++PV
Sbjct  474  VELKPV  479



>ref|XP_009378544.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Pyrus x bretschneideri]
Length=483

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLT+NGFSKAFAMTGWRLGYIAGPKHFVAAC K+QSQ TSGA SISQKA
Sbjct  293  SFASLPGMWERTLTINGFSKAFAMTGWRLGYIAGPKHFVAACGKLQSQFTSGACSISQKA  352

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG+AGGEAV+ MVKAFRERRDFLVKSFGE+ GV+ISEP+GAFYLFIDFS+YYG 
Sbjct  353  GVAALGLGFAGGEAVSVMVKAFRERRDFLVKSFGELSGVRISEPRGAFYLFIDFSAYYGT  412

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDK QVALVPGDAFGDDTCIRISYAASL TLQAAVERI+KAL
Sbjct  413  EAEGFGKIENSESLCRYLLDKGQVALVPGDAFGDDTCIRISYAASLPTLQAAVERIKKAL  472

Query  246  LTIRPVVPV  220
            + ++P   V
Sbjct  473  VELKPAASV  481



>ref|XP_008358516.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Malus domestica]
Length=484

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLT+NGFSKAFAMTGWRLGYIAGPKHFV AC K+QSQ TSGASSISQKA
Sbjct  296  SFASLPGMWERTLTINGFSKAFAMTGWRLGYIAGPKHFVTACGKLQSQFTSGASSISQKA  355

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV TMVKAFRERRDFLVKSFG++ GV+ISEP+GAFYLFIDFS+YYG 
Sbjct  356  GVAALGLGYAGGEAVXTMVKAFRERRDFLVKSFGKLSGVRISEPRGAFYLFIDFSAYYGT  415

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDK QVALVPGDAFGDDTCIRISYAASL TLQAAVERI+KAL
Sbjct  416  EAEGFGKIENSESLCRYLLDKGQVALVPGDAFGDDTCIRISYAASLPTLQAAVERIKKAL  475

Query  246  LTIRPVVPV  220
            + ++P V V
Sbjct  476  VELKPSVGV  484



>ref|XP_010911890.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X2 [Elaeis 
guineensis]
Length=412

 Score =   274 bits (700),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQSTSGASSISQKA
Sbjct  223  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLACPKHFVAACGKIQSQSTSGASSISQKA  282

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMV+AF+ERRDFLV+SF E+EGVKISEPQGAFYLFIDFSSYYG 
Sbjct  283  GVAALGLGYAGGEAVSTMVRAFQERRDFLVESFRELEGVKISEPQGAFYLFIDFSSYYGT  342

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSESLCR+LLD+AQVALVPGDAFGDD CIR+SYAASLSTLQAA+++I++A+
Sbjct  343  EVEGFGIIKDSESLCRFLLDEAQVALVPGDAFGDDNCIRMSYAASLSTLQAAMKKIKEAM  402

Query  246  LTIRPVVPV  220
            + ++P +PV
Sbjct  403  ILLKPPIPV  411



>ref|XP_002277000.2| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X1 [Vitis 
vinifera]
 emb|CBI21453.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+LPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  288  SFAALPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACGKIQSQFTSGASSISQKA  347

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALG+GYAGGEAV+TMVKAFRERRDFLVKSFGE+EGVKISEPQGAFYLF+DFSSYYG 
Sbjct  348  AVAALGMGYAGGEAVSTMVKAFRERRDFLVKSFGELEGVKISEPQGAFYLFLDFSSYYGA  407

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKA  250
            E  GFG + +SESLCRYLLD+AQVALVPGDAFGDD CIRISYAASLSTL AAVERI+KA
Sbjct  408  EAEGFGIIENSESLCRYLLDQAQVALVPGDAFGDDKCIRISYAASLSTLHAAVERIKKA  466



>ref|XP_004302193.2| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Fragaria vesca subsp. 
vesca]
Length=505

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHF++ACNKIQSQSTSGASSISQKA
Sbjct  317  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFISACNKIQSQSTSGASSISQKA  376

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+ MVKAFRERRDFLVKSFGE+ GVKISEP+GAFYLF+DFS YYG 
Sbjct  377  GVAALGLGYAGGEAVSIMVKAFRERRDFLVKSFGELAGVKISEPKGAFYLFLDFSCYYGT  436

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLC+YLLDK QVALVPGDAFGDDTCIRISYAASL TLQAA ERI+K+L
Sbjct  437  EADGFGKIENSESLCKYLLDKGQVALVPGDAFGDDTCIRISYAASLQTLQAAAERIKKSL  496

Query  246  LTIRP  232
            + ++P
Sbjct  497  IELKP  501



>ref|XP_008783401.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Phoenix dactylifera]
Length=491

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQSTSGASSISQKA
Sbjct  302  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLACPKHFVAACGKIQSQSTSGASSISQKA  361

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AALGLGYAGGEAV+TMV+AF+ERRDFLVKSF E+EG KISEPQGAFYLF+DFSSYYG 
Sbjct  362  GLAALGLGYAGGEAVSTMVRAFQERRDFLVKSFRELEGAKISEPQGAFYLFVDFSSYYGA  421

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSESLCR+LLDKAQVALVPGDAFGDD CIRISYAASLSTLQAAV +I++A+
Sbjct  422  EVEGFGIIKDSESLCRFLLDKAQVALVPGDAFGDDKCIRISYAASLSTLQAAVGKIKEAM  481

Query  246  LTIRPVVPV  220
            + ++P +PV
Sbjct  482  ILLKPPIPV  490



>ref|XP_009369904.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Pyrus x bretschneideri]
Length=485

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFV AC  +QSQ TSGASSISQKA
Sbjct  297  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVTACGTLQSQFTSGASSISQKA  356

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAVATMVKAFRERRDF+VKSFGE+ GV+ISEP+GAFYLFI+FS+YYG+
Sbjct  357  GVAALGLGYAGGEAVATMVKAFRERRDFMVKSFGELSGVRISEPRGAFYLFINFSAYYGM  416

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDK QVALVPGDAFGDDTCIRISYAASL TLQAAVERI+KAL
Sbjct  417  EAKGFGKIENSESLCRYLLDKGQVALVPGDAFGDDTCIRISYAASLPTLQAAVERIKKAL  476

Query  246  LTIRPVVPV  220
            + ++P V V
Sbjct  477  VELKPSVGV  485



>gb|KCW54449.1| hypothetical protein EUGRSUZ_I00395 [Eucalyptus grandis]
Length=483

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHF++AC KIQSQ TS ASSI+QKA
Sbjct  295  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFISACAKIQSQFTSSASSIAQKA  354

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL +GYAGGE V TMVKAFRERRDFLVKSFGE+EGVK SEPQGAFYLFID S YYG 
Sbjct  355  ALAALSMGYAGGETVETMVKAFRERRDFLVKSFGELEGVKYSEPQGAFYLFIDLSCYYGA  414

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GF  +  SESLCRYLLD+AQVAL+PG A GDDTCIRISYA+SL+TLQ A  RI+KAL
Sbjct  415  EVEGFSVINGSESLCRYLLDRAQVALLPGGACGDDTCIRISYASSLATLQEAFRRIKKAL  474

Query  246  LTIRPVVPV  220
            LT+RP VPV
Sbjct  475  LTLRPSVPV  483



>ref|XP_010911889.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X1 [Elaeis 
guineensis]
Length=493

 Score =   273 bits (699),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQSTSGASSISQKA
Sbjct  304  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLACPKHFVAACGKIQSQSTSGASSISQKA  363

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMV+AF+ERRDFLV+SF E+EGVKISEPQGAFYLFIDFSSYYG 
Sbjct  364  GVAALGLGYAGGEAVSTMVRAFQERRDFLVESFRELEGVKISEPQGAFYLFIDFSSYYGT  423

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSESLCR+LLD+AQVALVPGDAFGDD CIR+SYAASLSTLQAA+++I++A+
Sbjct  424  EVEGFGIIKDSESLCRFLLDEAQVALVPGDAFGDDNCIRMSYAASLSTLQAAMKKIKEAM  483

Query  246  LTIRPVVPV  220
            + ++P +PV
Sbjct  484  ILLKPPIPV  492



>ref|XP_004504047.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Cicer arietinum]
Length=482

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHF+AAC KIQSQ TSGASSISQKA
Sbjct  294  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFIAACGKIQSQFTSGASSISQKA  353

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGYAGGEAV+ MVKAFRERRD+LVKSFGE++GVKISEPQGAFYLFIDFS YYG 
Sbjct  354  AVAALGLGYAGGEAVSIMVKAFRERRDYLVKSFGEIDGVKISEPQGAFYLFIDFSFYYGR  413

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLCRYLLDK QVALVPG AFGDDTCIRISYAASL+TLQAAVERI+KAL
Sbjct  414  EAEGFGKIEDSESLCRYLLDKGQVALVPGSAFGDDTCIRISYAASLTTLQAAVERIKKAL  473

Query  246  LTI  238
            + +
Sbjct  474  IPL  476



>ref|XP_010261209.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Nelumbo nucifera]
Length=486

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  298  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACGKIQSQFTSGASSISQKA  357

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAF+ERRDFLVKSF E+EGVKISEPQGAFYLF+DFSSYYG 
Sbjct  358  GVAALGLGYAGGEAVSTMVKAFQERRDFLVKSFKELEGVKISEPQGAFYLFLDFSSYYGA  417

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG +  S+SLCRYLLDKAQVALVPGDAFGDD CIRISYAASLSTLQAA+ERI+ A+
Sbjct  418  EVEGFGLIKGSDSLCRYLLDKAQVALVPGDAFGDDNCIRISYAASLSTLQAAMERIKGAM  477

Query  246  LTIRPVVP  223
              ++  VP
Sbjct  478  ALLKRPVP  485



>gb|AII23743.1| prephenate aminotransferase [Antirrhinum majus]
Length=487

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGY+AGPKHFV+AC KIQSQ+TSGASSISQKA
Sbjct  299  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYLAGPKHFVSACGKIQSQTTSGASSISQKA  358

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGYAGGEAV+ MVKAFRERRDFLVKSFGE+EGVKISEP GAFYLF+DFSSYYG 
Sbjct  359  AVAALGLGYAGGEAVSYMVKAFRERRDFLVKSFGELEGVKISEPLGAFYLFLDFSSYYGS  418

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E+ G+G +  SESLC YLLDKAQVALVPGDAFGDD+CIRISYA SL+TLQAAVERI+ AL
Sbjct  419  EIEGYGVIGGSESLCVYLLDKAQVALVPGDAFGDDSCIRISYAESLTTLQAAVERIKGAL  478

Query  246  LTIRPVVPV  220
             +++P  P+
Sbjct  479  ASLKPAAPL  487



>ref|XP_007159724.1| hypothetical protein PHAVU_002G262100g [Phaseolus vulgaris]
 gb|ESW31718.1| hypothetical protein PHAVU_002G262100g [Phaseolus vulgaris]
Length=463

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHFVAAC KIQSQ TSGASSI+QKA
Sbjct  275  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACGKIQSQFTSGASSIAQKA  334

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGYAGGEAV+TMVKAFRERRDFLVKSF E++GVKISEPQGAFYLFIDFS YYG 
Sbjct  335  AVAALGLGYAGGEAVSTMVKAFRERRDFLVKSFREIDGVKISEPQGAFYLFIDFSFYYGR  394

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLCRYLLD  QVALVPG AFGDDTCIRISYA SL+TLQAAVERI+KAL
Sbjct  395  EAEGFGKIEDSESLCRYLLDVGQVALVPGSAFGDDTCIRISYAESLTTLQAAVERIKKAL  454

Query  246  LTI  238
            + +
Sbjct  455  IPL  457



>ref|XP_010090566.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Morus notabilis]
 gb|EXB39772.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Morus notabilis]
Length=478

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFVAAC KIQSQSTSGASSISQKA
Sbjct  290  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACGKIQSQSTSGASSISQKA  349

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALG+GYAGGE VA MVKAF+ERRDFLV+SF E+EGVK+SEPQGAFYLFIDFSSYYG 
Sbjct  350  AVAALGMGYAGGEVVAFMVKAFQERRDFLVQSFLELEGVKVSEPQGAFYLFIDFSSYYGS  409

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDK+QVALVPGDAFGDD+CIRISYA SL+TLQAA ERI+KAL
Sbjct  410  EAEGFGMIENSESLCRYLLDKSQVALVPGDAFGDDSCIRISYATSLTTLQAAFERIKKAL  469

Query  246  LTIR  235
            + ++
Sbjct  470  IPLK  473



>gb|KCW54448.1| hypothetical protein EUGRSUZ_I00395 [Eucalyptus grandis]
Length=483

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERT TVNGFSKAFAMTGWRLGY+AGPKHF++AC KIQSQ TSGASSISQKA
Sbjct  295  SFASLPGMWERTFTVNGFSKAFAMTGWRLGYVAGPKHFISACAKIQSQFTSGASSISQKA  354

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAAL +GYAGGE V  MVKAFRERRD+LVK FGE+EGVKISEPQGAFYLFID S YYG 
Sbjct  355  GVAALSMGYAGGETVKNMVKAFRERRDYLVKGFGELEGVKISEPQGAFYLFIDLSCYYGA  414

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GF  +  SESLCRYLLD+AQVAL+PG A GDDTCIRISYA+SL+TLQ A  RI+KAL
Sbjct  415  EVEGFSVINGSESLCRYLLDRAQVALLPGGACGDDTCIRISYASSLATLQEAFRRIKKAL  474

Query  246  LTIRPVVPV  220
            LT+RP VPV
Sbjct  475  LTLRPSVPV  483



>ref|XP_008809315.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X2 [Phoenix 
dactylifera]
Length=469

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLT NGFSK FAMTGWRLGY+AGP HFVAAC KIQSQ+TSGASSISQKA
Sbjct  281  SFASLPGMWERTLTANGFSKTFAMTGWRLGYLAGPTHFVAACGKIQSQATSGASSISQKA  340

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AALG+G+AGGE V+TMVKAF+ERRDFLVK+F E++GVKI+EPQGAFYLF+D S+YYG 
Sbjct  341  GLAALGMGFAGGETVSTMVKAFQERRDFLVKAFRELKGVKIAEPQGAFYLFLDVSAYYGA  400

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E+ GFG +TDSESLCR+LL+KAQVALVPGDAFGDD CIRISYA SL T++ AVERI+KA+
Sbjct  401  EIEGFGTITDSESLCRFLLEKAQVALVPGDAFGDDNCIRISYAESLPTIKEAVERIKKAM  460

Query  246  LTIRPVVPV  220
            + IRP +P+
Sbjct  461  VLIRPKIPL  469



>ref|XP_008809314.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X1 [Phoenix 
dactylifera]
Length=474

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLT NGFSK FAMTGWRLGY+AGP HFVAAC KIQSQ+TSGASSISQKA
Sbjct  286  SFASLPGMWERTLTANGFSKTFAMTGWRLGYLAGPTHFVAACGKIQSQATSGASSISQKA  345

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AALG+G+AGGE V+TMVKAF+ERRDFLVK+F E++GVKI+EPQGAFYLF+D S+YYG 
Sbjct  346  GLAALGMGFAGGETVSTMVKAFQERRDFLVKAFRELKGVKIAEPQGAFYLFLDVSAYYGA  405

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E+ GFG +TDSESLCR+LL+KAQVALVPGDAFGDD CIRISYA SL T++ AVERI+KA+
Sbjct  406  EIEGFGTITDSESLCRFLLEKAQVALVPGDAFGDDNCIRISYAESLPTIKEAVERIKKAM  465

Query  246  LTIRPVVPV  220
            + IRP +P+
Sbjct  466  VLIRPKIPL  474



>ref|XP_003531365.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Glycine max]
Length=464

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHFVAAC KIQSQ TSGASSI+QKA
Sbjct  276  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACGKIQSQFTSGASSIAQKA  335

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLG+AGGEAV+TMVKAFRERRDFLVKSF E++GVKISEPQGAFYLF+DFS YYG 
Sbjct  336  AVAALGLGHAGGEAVSTMVKAFRERRDFLVKSFREIDGVKISEPQGAFYLFLDFSFYYGR  395

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLCRYLLD  QVALVPG AFGDDTCIRISYA SL+TLQAAVER+++AL
Sbjct  396  EAEGFGKIEDSESLCRYLLDVGQVALVPGSAFGDDTCIRISYAESLTTLQAAVERVKRAL  455

Query  246  LTI  238
            + +
Sbjct  456  IPL  458



>gb|KHN29088.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Glycine soja]
Length=470

 Score =   265 bits (678),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHFVAAC KIQSQ TSGASSI+QKA
Sbjct  282  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACGKIQSQFTSGASSIAQKA  341

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLG+AGGEAV+TMVKAFRERRDFLVKSF E++GVKISEPQGAFYLF+DFS YYG 
Sbjct  342  AVAALGLGHAGGEAVSTMVKAFRERRDFLVKSFREIDGVKISEPQGAFYLFLDFSFYYGR  401

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLCRYLLD  QVALVPG AFGDDTCIRISYA SL+TLQAAVER+++AL
Sbjct  402  EAEGFGKIEDSESLCRYLLDVGQVALVPGSAFGDDTCIRISYAESLTTLQAAVERVKRAL  461

Query  246  LTI  238
            + +
Sbjct  462  IPL  464



>ref|XP_010664298.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Vitis vinifera]
 emb|CBI19119.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   265 bits (677),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSK FAMTGWRLGY+AGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  290  SFASLPGMWERTLTVNGFSKTFAMTGWRLGYLAGPKHFVAACGKIQSQVTSGASSISQKA  349

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGY GGEAVA MVKAF ERRDFLV+SF E+ GVKISEPQGAFYLF+DFSSYYG 
Sbjct  350  GVAALGLGYRGGEAVAKMVKAFEERRDFLVESFRELGGVKISEPQGAFYLFLDFSSYYGA  409

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  G+G + DSESLC+YLLDKAQVALVPGDAFGDD CIRISYAAS+S LQAA+ERI+ A+
Sbjct  410  EAEGYGIIKDSESLCKYLLDKAQVALVPGDAFGDDKCIRISYAASMSNLQAAMERIKGAI  469

Query  246  LTIRPVVP  223
            + ++  VP
Sbjct  470  VHLKATVP  477



>ref|XP_006646517.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Oryza brachyantha]
Length=459

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  271  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQFTSGASSISQKA  330

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LVKSF E+ GVKISEPQGAFYLFIDFSSYYG 
Sbjct  331  GLAALNLGYAGGEAVSTMVKAFQERRDYLVKSFKELPGVKISEPQGAFYLFIDFSSYYGS  390

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSESLC +LL+KAQVALVPGDAFGDD CIRISYAA+LSTLQ A+++I++A+
Sbjct  391  EVEGFGTIKDSESLCMFLLEKAQVALVPGDAFGDDKCIRISYAAALSTLQTAMDKIKEAV  450

Query  246  LTIRPVV  226
              I+P V
Sbjct  451  ALIKPRV  457



>tpg|DAA56613.1| TPA: hypothetical protein ZEAMMB73_333099 [Zea mays]
Length=277

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  89   SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQFTSGASSISQKA  148

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAAL LGYAGGEAV+TMVKAF+ERRD+LVK+F E+ GVKISEPQGAFYLFIDFS+YYG 
Sbjct  149  GVAALNLGYAGGEAVSTMVKAFQERRDYLVKNFKELPGVKISEPQGAFYLFIDFSAYYGS  208

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +SESLC +LL+KAQVALVPGDAFGDD CIRISYAASL+TLQ A+ ++++A+
Sbjct  209  EVEGFGTIKNSESLCIFLLEKAQVALVPGDAFGDDKCIRISYAASLTTLQTAMSKLKEAV  268

Query  246  LTIRPVV  226
              ++P V
Sbjct  269  ALLKPCV  275



>ref|NP_001044936.1| Os01g0871300 [Oryza sativa Japonica Group]
 dbj|BAD81719.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF06850.1| Os01g0871300 [Oryza sativa Japonica Group]
 gb|EAY76646.1| hypothetical protein OsI_04601 [Oryza sativa Indica Group]
 gb|EAZ14314.1| hypothetical protein OsJ_04240 [Oryza sativa Japonica Group]
 dbj|BAG86884.1| unnamed protein product [Oryza sativa Japonica Group]
Length=458

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  269  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQFTSGASSISQKA  328

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LVKSF E+ GVKISEPQGAFYLFIDFSSYYG 
Sbjct  329  GLAALNLGYAGGEAVSTMVKAFQERRDYLVKSFKELPGVKISEPQGAFYLFIDFSSYYGS  388

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSESLC +LL+KAQVALVPGDAFGDD CIR+SYAA+LSTLQ A+E+I++A+
Sbjct  389  EVEGFGTIKDSESLCMFLLEKAQVALVPGDAFGDDKCIRMSYAAALSTLQTAMEKIKEAV  448

Query  246  LTIRPVV  226
              I+P V
Sbjct  449  ALIKPRV  455



>gb|AET04530.2| aspartate aminotransferase [Medicago truncatula]
Length=475

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP MW RTLTVNGFSKAFAMTGWRLGYIAGPKHF+AA  KIQSQ TSG SSISQKA
Sbjct  287  SFASLPRMWNRTLTVNGFSKAFAMTGWRLGYIAGPKHFIAAVGKIQSQFTSGPSSISQKA  346

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAFRERRD+LVKSF E++GVKISEPQGAFYLFIDFSSYYG 
Sbjct  347  GVAALGLGYAGGEAVSTMVKAFRERRDYLVKSFSEIDGVKISEPQGAFYLFIDFSSYYGK  406

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDK QVALVPG AFGDDTCIRISYAASL TLQAAVE I+KAL
Sbjct  407  EAEGFGKIENSESLCRYLLDKGQVALVPGSAFGDDTCIRISYAASLPTLQAAVENIKKAL  466

Query  246  LTI  238
            + +
Sbjct  467  IPL  469



>ref|XP_003630054.1| Aspartate aminotransferase [Medicago truncatula]
Length=486

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP MW RTLTVNGFSKAFAMTGWRLGYIAGPKHF+AA  KIQSQ TSG SSISQKA
Sbjct  298  SFASLPRMWNRTLTVNGFSKAFAMTGWRLGYIAGPKHFIAAVGKIQSQFTSGPSSISQKA  357

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAFRERRD+LVKSF E++GVKISEPQGAFYLFIDFSSYYG 
Sbjct  358  GVAALGLGYAGGEAVSTMVKAFRERRDYLVKSFSEIDGVKISEPQGAFYLFIDFSSYYGK  417

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLCRYLLDK QVALVPG AFGDDTCIRISYAASL TLQAAVE I+KAL
Sbjct  418  EAEGFGKIENSESLCRYLLDKGQVALVPGSAFGDDTCIRISYAASLPTLQAAVENIKKAL  477

Query  246  LTI  238
            + +
Sbjct  478  IPL  480



>ref|XP_006826992.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Amborella trichopoda]
 gb|ERM94229.1| hypothetical protein AMTR_s00010p00210410 [Amborella trichopoda]
Length=470

 Score =   263 bits (671),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHF+ ACNKIQSQ+TSGASSISQKA
Sbjct  282  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFITACNKIQSQATSGASSISQKA  341

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AALGLGYAGGEAV+TMV AF+ERRDFLV+ F  ++GVK+SEPQGAFYLF+DFSSYYG 
Sbjct  342  GLAALGLGYAGGEAVSTMVAAFKERRDFLVQRFKAIDGVKVSEPQGAFYLFLDFSSYYGS  401

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             V GFG + DS+SLCR+LLDKAQVALVPGDAFGDD+C+RISYAASL+TLQAA+++I KAL
Sbjct  402  YVEGFGLIKDSDSLCRFLLDKAQVALVPGDAFGDDSCVRISYAASLTTLQAAMDKIEKAL  461

Query  246  LTIRPVVPV  220
              I+P V V
Sbjct  462  PLIKPAVAV  470



>ref|XP_010555356.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Tarenaya hassleriana]
Length=484

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGM+ERTLT+NGFSKAFAMTGWRLGYIAGPKHFVAAC+K+Q Q TSGASSISQKA
Sbjct  294  SFASLPGMYERTLTINGFSKAFAMTGWRLGYIAGPKHFVAACSKLQGQLTSGASSISQKA  353

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AALG+G AGGE VA MV+A+RERRDFLVKS GE+EGVKI +P+GAFYLF+DFSSYYG 
Sbjct  354  GLAALGMGKAGGETVAKMVEAYRERRDFLVKSLGELEGVKICDPRGAFYLFVDFSSYYGA  413

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SESLC Y LDKAQVA+VPGDAFGDD+CIRISYA SL+ LQAAVERI+KAL
Sbjct  414  EAEGFGVINNSESLCLYFLDKAQVAMVPGDAFGDDSCIRISYATSLNNLQAAVERIKKAL  473

Query  246  LTIR  235
            L +R
Sbjct  474  LPLR  477



>ref|XP_003525066.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Glycine max]
Length=464

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHFVAAC KIQSQ TSGASSI+QKA
Sbjct  276  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACGKIQSQFTSGASSIAQKA  335

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLG+AGGEAV+TMVKAFRERRDFLV+SF E++G+KISEPQGAFYLF+D S YYG 
Sbjct  336  AVAALGLGHAGGEAVSTMVKAFRERRDFLVQSFREIDGIKISEPQGAFYLFLDLSFYYGR  395

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLC+YLL+  QVALVPG AFGDDTCIRISYA SL+TLQAAVERI+KAL
Sbjct  396  EAEGFGKIVDSESLCQYLLEVGQVALVPGSAFGDDTCIRISYAESLTTLQAAVERIKKAL  455

Query  246  LTI  238
            + +
Sbjct  456  VPL  458



>gb|AET06146.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=476

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGP+HF+AACNKIQSQ TSGASSISQK 
Sbjct  288  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPRHFIAACNKIQSQITSGASSISQKG  347

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALG+GYAGGE VA MVKAFRERRDFLVK+F E+ G KIS P+GAFYLF D SSYYG 
Sbjct  348  GVAALGMGYAGGETVANMVKAFRERRDFLVKNFRELPGAKISVPEGAFYLFFDCSSYYGS  407

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLCRYLLDK  VALVPGDAFGDD CIR+SYAASLSTLQAA+E I++A+
Sbjct  408  EAEGFGIIKDSESLCRYLLDKGMVALVPGDAFGDDKCIRMSYAASLSTLQAAMENIKEAI  467

Query  246  LTIRP  232
            L +RP
Sbjct  468  LALRP  472



>gb|KHN38197.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Glycine soja]
Length=464

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGYIAGPKHFVAAC KIQSQ TSGASSI+QKA
Sbjct  276  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACGKIQSQFTSGASSIAQKA  335

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLG+AGGEAV+TMVKAFRERRDFLV+SF E++G+KISEPQGAFYLF+D S YYG 
Sbjct  336  AVAALGLGHAGGEAVSTMVKAFRERRDFLVQSFREIDGIKISEPQGAFYLFLDLSFYYGR  395

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLC+YLL+  QVALVPG AFGDDTCIRISYA SL+TLQAAVERI+KAL
Sbjct  396  EAEGFGKIVDSESLCQYLLEVGQVALVPGSAFGDDTCIRISYAESLTTLQAAVERIKKAL  455

Query  246  LTI  238
            + +
Sbjct  456  VPL  458



>dbj|BAB86539.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
Length=536

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  347  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQFTSGASSISQKA  406

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LVKSF E+ GVKISEPQGAFYLFIDFSSYYG 
Sbjct  407  GLAALNLGYAGGEAVSTMVKAFQERRDYLVKSFKELPGVKISEPQGAFYLFIDFSSYYGS  466

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSESLC +LL+KAQVALVPGDAFGDD CIR+SYAA+LSTLQ A+E+I++A+
Sbjct  467  EVEGFGTIKDSESLCMFLLEKAQVALVPGDAFGDDKCIRMSYAAALSTLQTAMEKIKEAV  526

Query  246  LTIRPVV  226
              I+P V
Sbjct  527  ALIKPRV  533



>gb|ACN26294.1| unknown [Zea mays]
 tpg|DAA56615.1| TPA: hypothetical protein ZEAMMB73_333099 [Zea mays]
Length=372

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  184  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQFTSGASSISQKA  243

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAAL LGYAGGEAV+TMVKAF+ERRD+LVK+F E+ GVKISEPQGAFYLFIDFS+YYG 
Sbjct  244  GVAALNLGYAGGEAVSTMVKAFQERRDYLVKNFKELPGVKISEPQGAFYLFIDFSAYYGS  303

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +SESLC +LL+KAQVALVPGDAFGDD CIRISYAASL+TLQ A+ ++++A+
Sbjct  304  EVEGFGTIKNSESLCIFLLEKAQVALVPGDAFGDDKCIRISYAASLTTLQTAMSKLKEAV  363

Query  246  LTIRPVV  226
              ++P V
Sbjct  364  ALLKPCV  370



>gb|ACG35175.1| hypothetical protein [Zea mays]
Length=384

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  196  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQFTSGASSISQKA  255

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAAL LGYAGGEAV+TMVKAF+ERRD+LVK+F E+ GVKISEPQGAFYLFIDFS+YYG 
Sbjct  256  GVAALNLGYAGGEAVSTMVKAFQERRDYLVKNFKELPGVKISEPQGAFYLFIDFSAYYGS  315

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +SESLC +LL+KAQVALVPGDAFGDD CIRISYAASL+TLQ A+ ++++A+
Sbjct  316  EVEGFGTIKNSESLCIFLLEKAQVALVPGDAFGDDKCIRISYAASLTTLQTAMSKLKEAV  375

Query  246  LTIRPVV  226
              ++P V
Sbjct  376  ALLKPCV  382



>gb|AFK38188.1| unknown [Medicago truncatula]
Length=475

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP MW RTLTVNGFSKAFAMTGWRLGYIAGPKHF+AA  KIQSQ TSG SSISQKA
Sbjct  287  SFASLPRMWNRTLTVNGFSKAFAMTGWRLGYIAGPKHFIAAVGKIQSQFTSGPSSISQKA  346

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKA RERRD+LVKSF E++GVKISEPQGAFYLFIDFSSYYG 
Sbjct  347  GVAALGLGYAGGEAVSTMVKALRERRDYLVKSFSEIDGVKISEPQGAFYLFIDFSSYYGK  406

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +SES CRYLLDK QVALVPG AFGDDTCIRISYAASL TLQAAVE I+KAL
Sbjct  407  EAEGFGKIENSESFCRYLLDKGQVALVPGSAFGDDTCIRISYAASLPTLQAAVENIKKAL  466

Query  246  LTI  238
            + +
Sbjct  467  IPL  469



>ref|NP_001143769.1| hypothetical protein [Zea mays]
 gb|ACF87080.1| unknown [Zea mays]
 tpg|DAA56614.1| TPA: hypothetical protein ZEAMMB73_333099 [Zea mays]
Length=416

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  228  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQFTSGASSISQKA  287

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAAL LGYAGGEAV+TMVKAF+ERRD+LVK+F E+ GVKISEPQGAFYLFIDFS+YYG 
Sbjct  288  GVAALNLGYAGGEAVSTMVKAFQERRDYLVKNFKELPGVKISEPQGAFYLFIDFSAYYGS  347

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +SESLC +LL+KAQVALVPGDAFGDD CIRISYAASL+TLQ A+ ++++A+
Sbjct  348  EVEGFGTIKNSESLCIFLLEKAQVALVPGDAFGDDKCIRISYAASLTTLQTAMSKLKEAV  407

Query  246  LTIRPVV  226
              ++P V
Sbjct  408  ALLKPCV  414



>gb|KHN44325.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Glycine soja]
Length=420

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSK FAMTGWRLGYIAG KHFVAAC KIQSQ TSGASSISQKA
Sbjct  231  SFASLPGMWDRTLTVNGFSKTFAMTGWRLGYIAGTKHFVAACGKIQSQFTSGASSISQKA  290

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAFRERRDFLV+SF EM+GVKISEPQGAFYLFIDFSSYYG 
Sbjct  291  GVAALGLGYAGGEAVSTMVKAFRERRDFLVESFREMDGVKISEPQGAFYLFIDFSSYYGR  350

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +S+SLCRYLLDK  VALVPG AFGDD+CIRISYA SL+ L+ AVERI+KAL
Sbjct  351  EVEGFGIIENSDSLCRYLLDKGLVALVPGSAFGDDSCIRISYAESLTNLKTAVERIKKAL  410

Query  246  LTI  238
            + +
Sbjct  411  IPL  413



>ref|XP_003564718.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Brachypodium 
distachyon]
Length=459

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  271  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQFTSGASSISQKA  330

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LV  F E+ GVKISEP+GAFYLFIDFSSYYG 
Sbjct  331  GLAALNLGYAGGEAVSTMVKAFQERRDYLVNGFKEIPGVKISEPKGAFYLFIDFSSYYGS  390

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG ++DSESLC +LL+KAQVALVPGDAFGDDTC+RISYAA+LSTLQ A+ +I++A+
Sbjct  391  EVEGFGTISDSESLCIFLLEKAQVALVPGDAFGDDTCVRISYAAALSTLQTAMVKIKEAV  450

Query  246  LTIRPVV  226
              I+P V
Sbjct  451  ALIKPRV  457



>ref|XP_010905916.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Elaeis guineensis]
Length=474

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGP HFVAAC KIQSQ+TSGASSISQ A
Sbjct  286  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPTHFVAACGKIQSQATSGASSISQNA  345

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AALG+G+AGGE V+TMVKAF+ERRDFLVK+F E++GVKI+EPQGAFYLF+D S+YYG 
Sbjct  346  GLAALGMGFAGGETVSTMVKAFQERRDFLVKAFRELKGVKIAEPQGAFYLFLDVSAYYGA  405

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG +  SES CR+LL+KAQVALVPGDAFGDD CIRIS+A SL T++ AVERI+KAL
Sbjct  406  EVEGFGTIKHSESFCRFLLEKAQVALVPGDAFGDDNCIRISFAESLPTIKEAVERIKKAL  465

Query  246  LTIRPVVP  223
              IRP +P
Sbjct  466  ALIRPKIP  473



>gb|EYU24011.1| hypothetical protein MIMGU_mgv1a006790mg [Erythranthe guttata]
Length=431

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGM++RTLTVNGFSKAFAMTGWRLGY+AGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  223  SFASLPGMFDRTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACAKIQSQFTSGASSISQKA  282

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+TMVKA+ ERRDF+VKSF E+EGV++SEPQGAFYLF+DFS YYG 
Sbjct  283  GVAALGLGYAGGEVVSTMVKAYSERRDFVVKSFKEIEGVQLSEPQGAFYLFLDFSYYYGS  342

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + GFG +  SESLCRYLLDKAQVALVPGDAFGDD+CIRISYA SL+TLQ AVERI+ A 
Sbjct  343  RIDGFGVIDGSESLCRYLLDKAQVALVPGDAFGDDSCIRISYAESLATLQTAVERIKTAF  402

Query  246  LTIRPV  229
            ++++P+
Sbjct  403  VSLKPI  408



>ref|XP_002441156.1| hypothetical protein SORBIDRAFT_09g021360 [Sorghum bicolor]
 gb|EES19586.1| hypothetical protein SORBIDRAFT_09g021360 [Sorghum bicolor]
Length=462

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  274  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQYTSGASSISQKA  333

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LV+SF E+ GVKISEPQGAFYLFIDFSSYYG 
Sbjct  334  GLAALNLGYAGGEAVSTMVKAFQERRDYLVRSFRELPGVKISEPQGAFYLFIDFSSYYGS  393

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSESLC +LL+KAQVALVPGDAFGDD  +RISYAA++STLQAA+ +I++A+
Sbjct  394  EVEGFGTIKDSESLCLFLLEKAQVALVPGDAFGDDKGVRISYAAAMSTLQAAMGKIKEAM  453

Query  246  LTIRPVVPV  220
              ++P V V
Sbjct  454  ALLKPPVAV  462



>ref|NP_001142303.1| uncharacterized protein LOC100274472 [Zea mays]
 gb|ACF88138.1| unknown [Zea mays]
 gb|ACR38533.1| unknown [Zea mays]
 gb|AFW81838.1| aspartate aminotransferase [Zea mays]
Length=461

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  273  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQYTSGASSISQKA  332

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LV+SF E+ GVKISEPQGAFYLFIDFSSYYG 
Sbjct  333  GLAALNLGYAGGEAVSTMVKAFQERRDYLVRSFRELPGVKISEPQGAFYLFIDFSSYYGS  392

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSESLC +LL+KAQVALVPGDAFGDD  +RISYAA++STLQ A+ +I++A+
Sbjct  393  EVEGFGTIKDSESLCLFLLEKAQVALVPGDAFGDDKGVRISYAAAMSTLQTAMGKIKEAM  452

Query  246  LTIRPVVPV  220
              +RP V V
Sbjct  453  ALLRPPVAV  461



>gb|ACG37512.1| aspartate aminotransferase [Zea mays]
Length=461

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  273  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQYTSGASSISQKA  332

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LV+SF E+ GVKISEPQGAFYLFIDFSSYYG 
Sbjct  333  GLAALNLGYAGGEAVSTMVKAFQERRDYLVRSFRELPGVKISEPQGAFYLFIDFSSYYGS  392

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSESLC +LL+KAQVALVPGDAFGDD  +RISYAA++STLQ A+ +I++A+
Sbjct  393  EVEGFGTIKDSESLCLFLLEKAQVALVPGDAFGDDKGVRISYAAAMSTLQTAMGKIKEAM  452

Query  246  LTIRPVVPV  220
              +RP V V
Sbjct  453  ALLRPPVAV  461



>ref|XP_002456709.1| hypothetical protein SORBIDRAFT_03g041180 [Sorghum bicolor]
 gb|EES01829.1| hypothetical protein SORBIDRAFT_03g041180 [Sorghum bicolor]
Length=416

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQ A
Sbjct  228  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQFTSGASSISQMA  287

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+ MVKAF+ERRD+LVK+F E+ GVKISEPQGAFYLFIDFS+YYG 
Sbjct  288  GLAALNLGYAGGEAVSNMVKAFQERRDYLVKNFKELPGVKISEPQGAFYLFIDFSAYYGS  347

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + +SESLC +LL+KAQVALVPGDAFGDD CIRISYAASL+TLQ A+ +I++A+
Sbjct  348  EVQGFGTIKNSESLCIFLLEKAQVALVPGDAFGDDKCIRISYAASLTTLQTAMAKIKEAV  407

Query  246  LTIRPVV  226
              ++P V
Sbjct  408  ALLKPCV  414



>ref|XP_009402635.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Musa acuminata subsp. 
malaccensis]
Length=475

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERT TVNGFSKAFAMTGWRLGY+A PKHF+ AC KIQSQSTSGASSISQKA
Sbjct  287  SFASLPGMWERTFTVNGFSKAFAMTGWRLGYLACPKHFLTACGKIQSQSTSGASSISQKA  346

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AALGLGYAGGEAV+ MVKAF+ERRDFL++SF E+EGVKISEPQGAFYLFIDFSSYYG 
Sbjct  347  GLAALGLGYAGGEAVSVMVKAFQERRDFLIESFKELEGVKISEPQGAFYLFIDFSSYYGS  406

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSESLCR+ LDK QVALVPGDAFGDD CIRISYAASLSTLQ A+++I++A+
Sbjct  407  EVEGFGTIKDSESLCRFFLDKGQVALVPGDAFGDDKCIRISYAASLSTLQEAMKKIKEAI  466

Query  246  LTIR  235
              +R
Sbjct  467  GLLR  470



>ref|XP_004961976.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Setaria italica]
Length=460

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFV+AC KIQSQ TSGASSISQKA
Sbjct  272  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVSACGKIQSQYTSGASSISQKA  331

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LV SF E+ GVKISEP+GAFYLFIDFSSYYG 
Sbjct  332  GLAALNLGYAGGEAVSTMVKAFQERRDYLVSSFRELPGVKISEPKGAFYLFIDFSSYYGS  391

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSE+LC +LL+KAQVALVPGDAFGDD  +RISYAA++STLQ A+E+I++A+
Sbjct  392  EVEGFGTIRDSEALCMFLLEKAQVALVPGDAFGDDKGVRISYAAAMSTLQTAMEKIKEAM  451

Query  246  LTIRPVVPV  220
              +RP V V
Sbjct  452  ALLRPPVAV  460



>gb|KEH24289.1| aspartate aminotransferase [Medicago truncatula]
Length=473

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW +TLTVNGFSK FAMTGWRLGYIAGPKHF++AC KIQSQ TSGASSISQKA
Sbjct  285  SFASLPGMWGKTLTVNGFSKPFAMTGWRLGYIAGPKHFISACGKIQSQFTSGASSISQKA  344

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGYAGGE V+TMVKAFRERR++LVKSF E++GV+ISEPQGAFYLFID SSYYG 
Sbjct  345  AVAALGLGYAGGEVVSTMVKAFRERRNYLVKSFREIDGVEISEPQGAFYLFIDISSYYGR  404

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLC+YLL K QVALVPG A GDDTCIRISYAASL TLQAAVERI++AL
Sbjct  405  EAEGFGKIEDSESLCQYLLHKGQVALVPGSASGDDTCIRISYAASLPTLQAAVERIKQAL  464

Query  246  LTI  238
            + +
Sbjct  465  INL  467



>ref|XP_002880438.1| AAT/ATAAT/MEE17 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56697.1| AAT/ATAAT/MEE17 [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERTLTVNGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q +SGASSI+QKA
Sbjct  290  SFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKA  349

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS GE+EGVKISEPQGAFYLFIDFS+YYG 
Sbjct  350  GVAALGLGKAGGETVAEMVKAYRERRDFLVKSLGEIEGVKISEPQGAFYLFIDFSAYYGS  409

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DS SL  Y LDK QVA+VPGDAFGDD+CIRISYA SL  LQAAVE+IRKAL
Sbjct  410  EAEGFGLINDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLQAAVEKIRKAL  469

Query  246  LTIRPVVPV  220
              +R  V V
Sbjct  470  EPLRATVSV  478



>gb|EPS71875.1| prephenate aminotransferase, partial [Genlisea aurea]
Length=495

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSKAFAMTGWRLGY+AGPKHFV+AC KIQSQ TSGASSISQKA
Sbjct  310  SFASLPGMWDRTLTVNGFSKAFAMTGWRLGYLAGPKHFVSACGKIQSQLTSGASSISQKA  369

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MV+AFRERRD+LVKSFGE+EGVKIS P+G+FY+F+DFSS+Y  
Sbjct  370  GVAALGLGRAGGETVAAMVEAFRERRDYLVKSFGEIEGVKISVPRGSFYMFLDFSSFYNR  429

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               GFG ++ SESLCRY LDKAQVALVPGDAFGDDTCIRISYAASL TLQ AV+RI+++L
Sbjct  430  RAHGFGEISGSESLCRYFLDKAQVALVPGDAFGDDTCIRISYAASLPTLQEAVKRIKESL  489

Query  246  LTIR  235
             +++
Sbjct  490  ASLK  493



>gb|KHN44324.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Glycine soja]
Length=472

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTL VNG SK FAMTGWRLGYIAGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  284  SFASLPGMWDRTLIVNGLSKTFAMTGWRLGYIAGPKHFVAACEKIQSQFTSGASSISQKA  343

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+TMVKAFRERRDFLV+SF EM+GVKI EPQG FY+F+DFSSYYG 
Sbjct  344  GVAALGLGYAGGEVVSTMVKAFRERRDFLVESFREMDGVKICEPQGGFYVFLDFSSYYGR  403

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +S+SLCRYLLDK  VALVPG AFGDDTCIRIS+A SL+TL+ AVERI+KAL
Sbjct  404  EAEGFGVIENSDSLCRYLLDKGLVALVPGSAFGDDTCIRISFAESLTTLKTAVERIKKAL  463

Query  246  LTI  238
            + +
Sbjct  464  IPL  466



>ref|XP_007163632.1| hypothetical protein PHAVU_001G250600g [Phaseolus vulgaris]
 gb|ESW35626.1| hypothetical protein PHAVU_001G250600g [Phaseolus vulgaris]
Length=469

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASL GMW+RTLTVNGFSK FAMTGWRLGYIAGP+HFVAAC KIQSQ TSGASSISQKA
Sbjct  284  SFASLTGMWDRTLTVNGFSKTFAMTGWRLGYIAGPRHFVAACGKIQSQFTSGASSISQKA  343

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAF+ERRDFLV+SF +M+GVKISEPQGAFYLFIDFSSYYG 
Sbjct  344  GVAALGLGYAGGEAVSTMVKAFKERRDFLVESFSKMDGVKISEPQGAFYLFIDFSSYYGR  403

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +S+SLCRYLLDK  VA+VPG AFGDD+CIRISYA SL+ L+ AVERI+KAL
Sbjct  404  EAEGFGLIENSDSLCRYLLDKGLVAVVPGSAFGDDSCIRISYAESLTVLKTAVERIKKAL  463

Query  246  LTI  238
            + +
Sbjct  464  IPL  466



>ref|NP_850022.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEC07283.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=428

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERTLTVNGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q +SGASSI+QKA
Sbjct  240  SFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKA  299

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS G+++GVKISEPQGAFYLFIDFS+YYG 
Sbjct  300  GVAALGLGKAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYGS  359

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DS SL  Y LDK QVA+VPGDAFGDD+CIRISYA SL  LQAAVE+IRKAL
Sbjct  360  EAEGFGLINDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLQAAVEKIRKAL  419

Query  246  LTIRPVVPV  220
              +R  V V
Sbjct  420  EPLRATVSV  428



>ref|NP_565529.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_001031394.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|Q9SIE1.2|PAT_ARATH RecName: Full=Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase; Short=AtAAT; Short=AtPPA-AT; 
AltName: Full=Protein MATERNAL EFFECT EMBRYO 
ARREST 17; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL36058.1| At2g22250/T26C19.9 [Arabidopsis thaliana]
 gb|AAD23617.2| putative aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM70520.1| At2g22250/T26C19.9 [Arabidopsis thaliana]
 gb|ADM67558.1| prephenate aminotransferase [Arabidopsis thaliana]
 gb|AEC07284.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEC07285.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=475

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERTLTVNGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q +SGASSI+QKA
Sbjct  287  SFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKA  346

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS G+++GVKISEPQGAFYLFIDFS+YYG 
Sbjct  347  GVAALGLGKAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYGS  406

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DS SL  Y LDK QVA+VPGDAFGDD+CIRISYA SL  LQAAVE+IRKAL
Sbjct  407  EAEGFGLINDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLQAAVEKIRKAL  466

Query  246  LTIRPVVPV  220
              +R  V V
Sbjct  467  EPLRATVSV  475



>ref|XP_009112542.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X2 [Brassica 
rapa]
Length=473

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERTLTVNGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q +SGASSISQKA
Sbjct  285  SFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSISQKA  344

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKSF EMEGVKISEPQGAFYLFIDFS+YYG 
Sbjct  345  GVAALGLGKAGGEIVAEMVKAYRERRDFLVKSFREMEGVKISEPQGAFYLFIDFSAYYGS  404

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG ++DS SL  Y LDK QVA+VPGDAFGDDTCIRISYA SL  L+ AV++IRKAL
Sbjct  405  EAEGFGLISDSSSLALYFLDKFQVAMVPGDAFGDDTCIRISYATSLDVLRVAVDKIRKAL  464

Query  246  LTIRPVVPV  220
              +R  V V
Sbjct  465  EPLRATVSV  473



>ref|XP_009112541.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X1 [Brassica 
rapa]
Length=476

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERTLTVNGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q +SGASSISQKA
Sbjct  288  SFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSISQKA  347

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKSF EMEGVKISEPQGAFYLFIDFS+YYG 
Sbjct  348  GVAALGLGKAGGEIVAEMVKAYRERRDFLVKSFREMEGVKISEPQGAFYLFIDFSAYYGS  407

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG ++DS SL  Y LDK QVA+VPGDAFGDDTCIRISYA SL  L+ AV++IRKAL
Sbjct  408  EAEGFGLISDSSSLALYFLDKFQVAMVPGDAFGDDTCIRISYATSLDVLRVAVDKIRKAL  467

Query  246  LTIRPVVPV  220
              +R  V V
Sbjct  468  EPLRATVSV  476



>ref|XP_006294125.1| hypothetical protein CARUB_v10023120mg [Capsella rubella]
 gb|EOA27023.1| hypothetical protein CARUB_v10023120mg [Capsella rubella]
Length=476

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERT+T+NGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q +SGASSISQKA
Sbjct  288  SFASLPDMYERTMTINGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSISQKA  347

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS  E+EGVKISEPQGAFYLFIDFSSYYG 
Sbjct  348  GVAALGLGKAGGETVAEMVKAYRERRDFLVKSLSEIEGVKISEPQGAFYLFIDFSSYYGS  407

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DS SL  Y LDK QVA+VPGDAFGDD+CIRISYA SL  LQAAVE+I+KAL
Sbjct  408  EAEGFGLINDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLQAAVEKIKKAL  467

Query  246  LTIRPVVPV  220
              +R  V V
Sbjct  468  EPLRATVSV  476



>ref|XP_009140341.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Brassica rapa]
Length=466

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERTLTVNGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q +SGASSI+QKA
Sbjct  278  SFASLPNMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKA  337

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVK+F EM+GVKISEPQGAFYLFIDFS+YYG 
Sbjct  338  GVAALGLGKAGGETVAEMVKAYRERRDFLVKNFREMDGVKISEPQGAFYLFIDFSAYYGS  397

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG ++DS SL  Y LDK QVA+VPGDAFGDDTCIRISYA SL  L+AAV +IRKAL
Sbjct  398  EVEGFGLISDSSSLALYFLDKFQVAMVPGDAFGDDTCIRISYATSLDVLRAAVVKIRKAL  457

Query  246  LTIRPVVPV  220
              +R  V V
Sbjct  458  EPLRATVSV  466



>ref|XP_010695651.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFVAAC KIQSQSTSGASSISQKA
Sbjct  286  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVAACGKIQSQSTSGASSISQKA  345

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALG+G AGGE VATMVKAFRERRDFL++SF E++GVKIS+PQGAFYLF+DFSSYYG 
Sbjct  346  GVAALGMGKAGGEVVATMVKAFRERRDFLIQSFSELKGVKISDPQGAFYLFLDFSSYYGS  405

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +  GFG +  SESL RYLL+KAQVALVPGDAFGDD CIRISYA SL  L+ A++ I+ A+
Sbjct  406  KAEGFGVIDGSESLSRYLLEKAQVALVPGDAFGDDNCIRISYAESLPILRNAMDNIKNAI  465



>ref|XP_003568386.2| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Brachypodium 
distachyon]
Length=514

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+LPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFV+AC K+QSQ TSGAS+ISQKA
Sbjct  276  SFAALPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVSACGKVQSQFTSGASNISQKA  335

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LV+SF E+ GVKISEP+GAFYLFIDFSSYYG 
Sbjct  336  GLAALNLGYAGGEAVSTMVKAFQERRDYLVRSFRELPGVKISEPKGAFYLFIDFSSYYGS  395

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSE+LC +LL+KAQVALVPGDAFGD+  +RISYAA+LSTLQAA+E+I++A+
Sbjct  396  EVEGFGTIKDSETLCMFLLEKAQVALVPGDAFGDNKGVRISYAAALSTLQAAMEKIKEAM  455

Query  246  LTIRP  232
              + P
Sbjct  456  ALLSP  460



>ref|XP_010674468.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=410

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA LP MWERTLT+NGFSK FAMTGWRLGY+AGP+HFVAAC KIQSQSTS ASSISQ A
Sbjct  222  SFAVLPNMWERTLTINGFSKTFAMTGWRLGYLAGPRHFVAACAKIQSQSTSCASSISQAA  281

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG  GG+ V+ MV A++ERRDFL+KSF +++GVK S PQGAFYLF+DFSSYYG+
Sbjct  282  GVAALGLGKGGGKEVSDMVNAYKERRDFLIKSFKQLQGVKNSVPQGAFYLFLDFSSYYGL  341

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG +  SESLC YLL KAQVALVPGDAFGDD C+RISY ASLSTLQ A+++I+KAL
Sbjct  342  EAEGFGMIDGSESLCCYLLSKAQVALVPGDAFGDDKCVRISYTASLSTLQKAIQQIQKAL  401

Query  246  LTIRPVVPV  220
            L ++P V V
Sbjct  402  LHLKPAVCV  410



>gb|AAM61164.1| putative aspartate aminotransferase [Arabidopsis thaliana]
Length=475

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERTLTVNGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q +SGASSI+QKA
Sbjct  287  SFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKA  346

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS G+++GVKISEPQGAFYLFIDFS+YYG 
Sbjct  347  GVAALGLGKAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYGS  406

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DS SL  Y LDK QVA+VPGDAFGD +CIRISYA SL  LQAAVE+IRKAL
Sbjct  407  EAEGFGLINDSSSLALYFLDKFQVAMVPGDAFGDXSCIRISYATSLDVLQAAVEKIRKAL  466

Query  246  LTIRPVVPV  220
              +R  V V
Sbjct  467  EPLRATVSV  475



>gb|EMT16326.1| Aspartate aminotransferase A [Aegilops tauschii]
Length=421

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+LPGM++RTLTVNGFSKAFAMTGWRLGY+A PKHFV+AC KIQSQ TSGASSISQKA
Sbjct  232  SFAALPGMYDRTLTVNGFSKAFAMTGWRLGYLAAPKHFVSACGKIQSQYTSGASSISQKA  291

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LV+SF E+ GVKISEPQGAFYLF+DFSSYYG 
Sbjct  292  GLAALNLGYAGGEAVSTMVKAFQERRDYLVRSFRELPGVKISEPQGAFYLFLDFSSYYGS  351

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSE+LC +LL+KAQVALVPGDAFGDD  +RISYAA+LSTLQ+A+E+I+ A+
Sbjct  352  EVEGFGTIKDSETLCMFLLEKAQVALVPGDAFGDDKGVRISYAAALSTLQSAMEKIKDAM  411

Query  246  LTIR  235
              ++
Sbjct  412  SLLK  415



>ref|XP_006404683.1| hypothetical protein EUTSA_v10000093mg [Eutrema salsugineum]
 gb|ESQ46136.1| hypothetical protein EUTSA_v10000093mg [Eutrema salsugineum]
Length=616

 Score =   251 bits (640),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERTLTVNGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q TSGASSI+QKA
Sbjct  428  SFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVTSGASSIAQKA  487

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS  E+EGVKISEPQGAFYLFIDFS+YYG+
Sbjct  488  GVAALGLGKAGGETVAQMVKAYRERRDFLVKSLSEIEGVKISEPQGAFYLFIDFSAYYGL  547

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DS SL  Y LDK QVA+VPGDAFGDD+CIRISYA SL  LQ AVE+IRKAL
Sbjct  548  EVEGFGLINDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLQVAVEKIRKAL  607

Query  246  LTIRPVVPV  220
              +R  V V
Sbjct  608  EPLRATVSV  616



>gb|KFK32831.1| hypothetical protein AALP_AA6G292800 [Arabis alpina]
Length=480

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERTLT+NGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q +SGASSISQKA
Sbjct  292  SFASLPDMYERTLTINGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSISQKA  351

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS G++EGVKISEPQGAFYLFIDFS+YYG 
Sbjct  352  GVAALGLGKAGGETVAAMVKAYRERRDFLVKSLGDIEGVKISEPQGAFYLFIDFSAYYGS  411

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DS SL  Y LDK QVA+VPGDAFGDD+CIRISYA SL  L+AAVE+I+KAL
Sbjct  412  EAEGFGLINDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLRAAVEKIKKAL  471

Query  246  LTIR  235
              +R
Sbjct  472  EPLR  475



>gb|EMS62834.1| Aspartate aminotransferase [Triticum urartu]
Length=428

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+LPGM++RTLTVNGFSKAFAMTGWRLGY+A PKHFV+AC KIQSQ TSGASSISQKA
Sbjct  239  SFAALPGMYDRTLTVNGFSKAFAMTGWRLGYLAAPKHFVSACGKIQSQYTSGASSISQKA  298

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+ MVKAF+ERRD+LV+SF E+ GVKISEPQGAFYLF+DFSSYYG 
Sbjct  299  GLAALNLGYAGGEAVSAMVKAFQERRDYLVRSFRELPGVKISEPQGAFYLFLDFSSYYGS  358

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG + DSE+LC +LL+KAQVALVPGDAFGDD  IRISYAA+LSTLQ+A+E+I+ A+
Sbjct  359  EVEGFGTIKDSETLCMFLLEKAQVALVPGDAFGDDKGIRISYAAALSTLQSAMEKIKDAM  418

Query  246  LTIR  235
              ++
Sbjct  419  ALLK  422



>ref|XP_010429140.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Camelina sativa]
 ref|XP_010429141.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Camelina sativa]
Length=438

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERT+T+NGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q TSGASSISQKA
Sbjct  250  SFASLPDMYERTMTINGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVTSGASSISQKA  309

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS G +EGVKISEPQGAFYLFIDFS+YYG 
Sbjct  310  GVAALGLGKAGGETVAEMVKAYRERRDFLVKSLGAIEGVKISEPQGAFYLFIDFSAYYGS  369

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG ++DS SL  Y LDK QVA+VPGDAFGDD+CIRISYA SL  L+AAVE+I KAL
Sbjct  370  EAEGFGLISDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLRAAVEKITKAL  429

Query  246  LTIRPVVPV  220
              +R  + V
Sbjct  430  KPLRATISV  438



>ref|XP_010472217.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Camelina sativa]
Length=482

 Score =   244 bits (624),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERT+T+NGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q TSGASSISQKA
Sbjct  294  SFASLPDMYERTMTINGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVTSGASSISQKA  353

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS G +EGVKISEPQGAFYLFIDFS+YYG 
Sbjct  354  GVAALGLGKAGGETVAEMVKAYRERRDFLVKSLGAIEGVKISEPQGAFYLFIDFSAYYGS  413

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG ++DS SL  Y LDK QVA+VPGDAFGDD+CIRISYA SL  L+AAVE+I KAL
Sbjct  414  EAEGFGLISDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDILRAAVEKITKAL  473

Query  246  LTIRPVVPV  220
              +R  + V
Sbjct  474  KPLRATISV  482



>ref|XP_010416982.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X2 [Camelina 
sativa]
Length=466

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERT+T+NGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q TSGASSISQKA
Sbjct  278  SFASLPDMYERTMTINGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVTSGASSISQKA  337

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS G +EGVKISEPQGAFYLFIDFS+YYG 
Sbjct  338  GVAALGLGKAGGETVAEMVKAYRERRDFLVKSLGAIEGVKISEPQGAFYLFIDFSAYYGS  397

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +  GFG ++DS SL  Y LDK QVA+VPGDAFGDD+CIRISYA SL  L+AAVE+I KAL
Sbjct  398  KAEGFGLISDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLRAAVEKITKAL  457

Query  246  LTIRPVVPV  220
              +R  + V
Sbjct  458  KPLRATISV  466



>ref|XP_010416981.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase isoform X1 [Camelina 
sativa]
Length=479

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLP M+ERT+T+NGFSKAFAMTGWRLGY+AGPKH VAAC+K+Q Q TSGASSISQKA
Sbjct  291  SFASLPDMYERTMTINGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVTSGASSISQKA  350

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLG AGGE VA MVKA+RERRDFLVKS G +EGVKISEPQGAFYLFIDFS+YYG 
Sbjct  351  GVAALGLGKAGGETVAEMVKAYRERRDFLVKSLGAIEGVKISEPQGAFYLFIDFSAYYGS  410

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +  GFG ++DS SL  Y LDK QVA+VPGDAFGDD+CIRISYA SL  L+AAVE+I KAL
Sbjct  411  KAEGFGLISDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLRAAVEKITKAL  470

Query  246  LTIRPVVPV  220
              +R  + V
Sbjct  471  KPLRATISV  479



>sp|Q5F4K8.1|PAT_PINPS RecName: Full=Aspartate aminotransferase; Short=PpAAT; Flags: 
Precursor [Pinus pinaster]
 emb|CAF31327.1| aspartate aminotransferase [Pinus pinaster]
Length=492

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFV AC +IQSQSTSGASSISQKA
Sbjct  300  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVTACGRIQSQSTSGASSISQKA  359

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAAL LGYAG EAV+TMVKA+RERRDFLV+    MEGVK+  PQGAFYLF DFSSYYG 
Sbjct  360  GVAALALGYAGSEAVSTMVKAYRERRDFLVQRLQAMEGVKLPVPQGAFYLFPDFSSYYGT  419

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKA  250
            EV  FG +  SE+LCR+ L+KAQVALVPGDAFG+D CIRISYAASL TL+ A+  I K+
Sbjct  420  EVEDFGVINGSEALCRFFLEKAQVALVPGDAFGNDDCIRISYAASLDTLRTAINNIEKS  478



>ref|XP_007163631.1| hypothetical protein PHAVU_001G250500g [Phaseolus vulgaris]
 gb|ESW35625.1| hypothetical protein PHAVU_001G250500g [Phaseolus vulgaris]
Length=452

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGM +RTLTVNG SK FAMTGWRLGYIAGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  270  SFASLPGMQDRTLTVNGLSKTFAMTGWRLGYIAGPKHFVAACGKIQSQFTSGASSISQKA  329

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             VAALGLGY GGEAV+ MVKAFRERRDFLV+SF +++G +I EPQG FY+FID SSYYG 
Sbjct  330  AVAALGLGYGGGEAVSNMVKAFRERRDFLVESFRDVDGARICEPQGGFYVFIDLSSYYGR  389

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + +S+SLC YLL+K QVALVPG AFGDD+CIRIS+A SLSTL  AVERI+KAL
Sbjct  390  EAEGFGLIENSDSLCGYLLEKGQVALVPGSAFGDDSCIRISFAESLSTLNTAVERIKKAL  449



>gb|ABR17976.1| unknown [Picea sitchensis]
Length=491

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+AGPKHFV AC +IQSQ+TSGASSISQKA
Sbjct  299  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAGPKHFVTACARIQSQTTSGASSISQKA  358

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GV A+GLGYAG E V+TMVKA++ERRDFLV+    +EGVK+S PQGAFYLF DFSSYYG 
Sbjct  359  GVGAMGLGYAGSEVVSTMVKAYKERRDFLVQRLQALEGVKLSVPQGAFYLFPDFSSYYGT  418

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKA  250
            EV GFG +  SE+LCR+ L+KAQVALVPGDAFG+D CIRISYAASL TL+ A+  I K+
Sbjct  419  EVEGFGVIDCSEALCRFFLEKAQVALVPGDAFGNDDCIRISYAASLDTLRTAINNIEKS  477



>ref|XP_002965520.1| hypothetical protein SELMODRAFT_143343 [Selaginella moellendorffii]
 gb|EFJ32940.1| hypothetical protein SELMODRAFT_143343 [Selaginella moellendorffii]
Length=388

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+LPGMWERTLTVNGFSKAFAMTGWRLGY+A PK FV ACNK+QSQ TSGASSISQKA
Sbjct  203  SFAALPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKRFVTACNKVQSQLTSGASSISQKA  262

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAA+GLG+AGGEAVA MV+AF+ERRDF+V+    ++GVK+S PQGAFYLF DFS+YYG 
Sbjct  263  GVAAMGLGFAGGEAVAKMVEAFQERRDFMVRRLKSLKGVKLSVPQGAFYLFPDFSAYYGS  322

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLC++ L+KAQVALVPGDAFG+  C+RISYAAS+ +L+ A++ I ++L
Sbjct  323  EAQGFGTILDSESLCKFFLEKAQVALVPGDAFGEPRCVRISYAASMESLKTAMDSIEQSL  382

Query  246  LTIR  235
              I 
Sbjct  383  TLIN  386



>ref|XP_001763787.1| predicted protein [Physcomitrella patens]
 gb|EDQ71429.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+LPGMWERTLTVNGFSK FAMTGWRLGY+A PKHF+ ACN+IQSQSTSGASSISQKA
Sbjct  236  SFAALPGMWERTLTVNGFSKCFAMTGWRLGYLAAPKHFLVACNRIQSQSTSGASSISQKA  295

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAAL LG AGGE V TMVKAFRERRDFLV+    M+GV ++ PQGAFYLF DFS+Y+G 
Sbjct  296  GVAALALGKAGGEDVVTMVKAFRERRDFLVQRLQAMDGVVLAVPQGAFYLFPDFSAYFGS  355

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               GFG ++D+E+LCR+ L+KA+VALVPGDAFG+  CIRISYAAS+  L+ A+E I   +
Sbjct  356  HADGFGFISDAETLCRFFLEKAKVALVPGDAFGNGGCIRISYAASMEELKTAIESIESVM  415

Query  246  LTIRP  232
              ++P
Sbjct  416  ALLKP  420



>ref|XP_002982998.1| hypothetical protein SELMODRAFT_234146 [Selaginella moellendorffii]
 gb|EFJ15807.1| hypothetical protein SELMODRAFT_234146 [Selaginella moellendorffii]
Length=388

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+LPGMWERTLTVNGFSKAFAMTGWRLGY+A PK FV ACNK+QSQ TSGASSISQKA
Sbjct  203  SFAALPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKRFVTACNKVQSQLTSGASSISQKA  262

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAA+GLG+AGGEAVA MV+AF+ERRDF+V+    ++GVK+S PQGAFYLF DFS+YYG 
Sbjct  263  GVAAMGLGFAGGEAVAKMVEAFQERRDFMVRRLKSLKGVKLSVPQGAFYLFPDFSAYYGS  322

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            E  GFG + DSESLC++ L+KA VALVPGDAFG+  C+RISYAAS+ +L+ A++ I ++L
Sbjct  323  EAQGFGTILDSESLCKFFLEKAHVALVPGDAFGEPRCLRISYAASMESLKTAMDSIEQSL  382

Query  246  LTIR  235
              I 
Sbjct  383  TLIN  386



>gb|KCW54453.1| hypothetical protein EUGRSUZ_I00398 [Eucalyptus grandis]
Length=446

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  726  AFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKagvaalglgyaggeavATMVK  547
            AFAMTGWRLGY++GP+HFV+AC KIQSQ TSGASS++QKA  AAL +G AGGE +ATMVK
Sbjct  278  AFAMTGWRLGYLSGPRHFVSACAKIQSQLTSGASSVAQKAAFAALSMGNAGGETIATMVK  337

Query  546  AFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGVEVAGFGAVTDSESLCRYLLD  367
            AFRERRDFLVKSFGE+EGVKISEPQGAF++FIDFS YYG EV GFG +  SESLC YLLD
Sbjct  338  AFRERRDFLVKSFGELEGVKISEPQGAFHIFIDFSCYYGAEVEGFGVINGSESLCHYLLD  397

Query  366  KAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKALLTIRPVVPV  220
             A+V LVPG AFGDDTC+RISYAASL+TL+ A  RI+KAL+ +RP   V
Sbjct  398  SARVVLVPGVAFGDDTCVRISYAASLATLREAFGRIKKALVALRPAASV  446



>gb|KJB79026.1| hypothetical protein B456_013G030300 [Gossypium raimondii]
Length=482

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPK+F+AACNKIQSQSTSGASSI+QKA
Sbjct  291  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKNFIAACNKIQSQSTSGASSIAQKA  350

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+TMVKAFRERRDFLVKSFGE+EGVKISEPQGAFYLFIDFSSYYG+
Sbjct  351  GVAALGLGYAGGEVVSTMVKAFRERRDFLVKSFGELEGVKISEPQGAFYLFIDFSSYYGI  410

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALV  346
            EV GFG + +SESLCRYLLDK QV  +
Sbjct  411  EVEGFGKIENSESLCRYLLDKGQVCFI  437



>gb|KDO47026.1| hypothetical protein CISIN_1g012095mg [Citrus sinensis]
Length=429

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  283  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKA  342

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGE V+ MVKAFRERRDFLVKSFGE+EGVK+SEPQGAFYLFIDFS+YYG 
Sbjct  343  GVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSTYYGS  402

Query  426  EVAGFGAVTDSESLCRYLLDKAQVAL  349
            E  GFG + +SESLCRYLLDKAQV L
Sbjct  403  EAEGFGKIENSESLCRYLLDKAQVLL  428



>gb|KCW54514.1| hypothetical protein EUGRSUZ_I004632, partial [Eucalyptus grandis]
Length=241

 Score =   206 bits (524),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 121/189 (64%), Gaps = 49/189 (26%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY++GP+HFV+AC KI               
Sbjct  102  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLSGPRHFVSACAKI---------------  146

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
                                              + +GVKISEPQGAF++FIDFS YYG 
Sbjct  147  ----------------------------------QSQGVKISEPQGAFHIFIDFSCYYGA  172

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG +  SESLC YLLD A+V LVPG AFGDDTCIRISYAASL+TL+ A  RI+KAL
Sbjct  173  EVEGFGVINGSESLCHYLLDSARVVLVPGVAFGDDTCIRISYAASLATLREAFGRIKKAL  232

Query  246  LTIRPVVPV  220
            + +RP   V
Sbjct  233  VALRPAASV  241



>ref|XP_010030428.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like [Eucalyptus grandis]
Length=463

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 132/189 (70%), Gaps = 20/189 (11%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY++GP+HFV+AC KIQS           + 
Sbjct  295  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLSGPRHFVSACAKIQS-----------QH  343

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             V       A    +  +V A+   +         +EGVKISEPQGAF++FIDFS YYG 
Sbjct  344  CVWHCISALANWLNLFGVVAAYFSAK---------LEGVKISEPQGAFHIFIDFSCYYGA  394

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            EV GFG +  SESLC YLLD A+V LVPG AFGDDTCIRISYAASL+TL+ A  RI+KAL
Sbjct  395  EVEGFGVINGSESLCHYLLDSARVVLVPGVAFGDDTCIRISYAASLATLREAFGRIKKAL  454

Query  246  LTIRPVVPV  220
            + +RP   V
Sbjct  455  VALRPAASV  463



>gb|AGT17243.1| hypothetical protein SHCRBa_067_E24_F_120 [Saccharum hybrid cultivar 
R570]
Length=185

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = -3

Query  729  KAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassis------QKagvaalglgyagge  568
            +AFA TGWRLGY+A PKHFVAAC KIQSQ TSG    +       +  +AAL LGYAGGE
Sbjct  10   RAFATTGWRLGYLAAPKHFVAACGKIQSQFTSGQVRTAYHRRQGLQLWLAALNLGYAGGE  69

Query  567  avATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGVEVAGFGAVTDSES  388
            AV+TMVKAF+ERRD+LVK+F E+ GVKI EPQGAFYLF+DFS+YYG EV GFG + +SES
Sbjct  70   AVSTMVKAFQERRDYLVKNFKELPGVKIPEPQGAFYLFVDFSAYYGSEVEGFGTIKNSES  129

Query  387  LCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKALLTIRPVV  226
            LC +LL+KAQVALVPGDAFGDD CIRISYAASL+TLQ A+ R ++A+  ++P V
Sbjct  130  LCIFLLEKAQVALVPGDAFGDDKCIRISYAASLTTLQTAMARTKEAVALLKPCV  183



>ref|NP_001242772.1| uncharacterized protein LOC100780254 [Glycine max]
 gb|ACU20263.1| unknown [Glycine max]
Length=438

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTLTVNGFSK FAMTGWRLGYIAG KHFVAAC KIQSQ TSGASSI QKA
Sbjct  285  SFASLPGMWDRTLTVNGFSKTFAMTGWRLGYIAGTKHFVAACGKIQSQFTSGASSIFQKA  344

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAFRERRDFLV+SF EM+GVKISEPQGAFYLFIDFSSYYG 
Sbjct  345  GVAALGLGYAGGEAVSTMVKAFRERRDFLVESFREMDGVKISEPQGAFYLFIDFSSYYGR  404

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGD  337
            EV GFG + +S+SLCRYLLDK  VALVPG+
Sbjct  405  EVEGFGIIENSDSLCRYLLDKGLVALVPGE  434



>ref|XP_006591408.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X2 [Glycine 
max]
Length=407

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTL VNG SK FAMTGWRLGYIAGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  254  SFASLPGMWDRTLIVNGLSKTFAMTGWRLGYIAGPKHFVAACEKIQSQFTSGASSISQKA  313

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAFRERRDFLV+SF EM+GVKI EPQG FY+F+DFSSYYG 
Sbjct  314  GVAALGLGYAGGEAVSTMVKAFRERRDFLVESFREMDGVKICEPQGGFYVFLDFSSYYGR  373

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGD  337
            E  GFG + +S+SLCRYLLDK  VALVPG+
Sbjct  374  EAEGFGVIENSDSLCRYLLDKGLVALVPGE  403



>ref|XP_003538514.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase-like isoform X1 [Glycine 
max]
Length=437

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMW+RTL VNG SK FAMTGWRLGYIAGPKHFVAAC KIQSQ TSGASSISQKA
Sbjct  284  SFASLPGMWDRTLIVNGLSKTFAMTGWRLGYIAGPKHFVAACEKIQSQFTSGASSISQKA  343

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAALGLGYAGGEAV+TMVKAFRERRDFLV+SF EM+GVKI EPQG FY+F+DFSSYYG 
Sbjct  344  GVAALGLGYAGGEAVSTMVKAFRERRDFLVESFREMDGVKICEPQGGFYVFLDFSSYYGR  403

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAF  331
            E  GFG + +S+SLCRYLLDK  VALVPG+  
Sbjct  404  EAEGFGVIENSDSLCRYLLDKGLVALVPGECI  435



>gb|AFW81839.1| hypothetical protein ZEAMMB73_129784 [Zea mays]
Length=452

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGY+A PKHFVAAC KIQSQ TSGASSISQKA
Sbjct  273  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYLAAPKHFVAACGKIQSQYTSGASSISQKA  332

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL LGYAGGEAV+TMVKAF+ERRD+LV+SF E+ GVKISEPQGAFYLFIDFSSYYG 
Sbjct  333  GLAALNLGYAGGEAVSTMVKAFQERRDYLVRSFRELPGVKISEPQGAFYLFIDFSSYYGS  392

Query  426  EVAGFGAVTDSESLCRYLLDKAQV  355
            EV GFG + DSESLC +LL+KAQV
Sbjct  393  EVEGFGTIKDSESLCLFLLEKAQV  416



>ref|XP_001694895.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02047.1| predicted protein [Chlamydomonas reinhardtii]
Length=434

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 141/182 (77%), Gaps = 2/182 (1%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SF +LPGM+ERTLTVNGFSKA+AMTGWRLGY+A PKH+  A   IQSQSTSGASSISQ+A
Sbjct  241  SFGALPGMFERTLTVNGFSKAYAMTGWRLGYLAAPKHYAKAAAIIQSQSTSGASSISQQA  300

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL LG  GGE V  MV+AFRERRD++      + GV ++EP GAFY+  + S+++G 
Sbjct  301  ALAALALGPGGGEPVQAMVRAFRERRDYVSARLKAIPGVNLAEPAGAFYVLPEMSAFFGP  360

Query  426  EVA--GFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRK  253
              A  GFGAV DS++ CRYL++ A VA+VPGDAFG D+CIRISYAASL TL  A++RI  
Sbjct  361  GAAAQGFGAVPDSDTFCRYLIEVANVAVVPGDAFGADSCIRISYAASLETLGKALDRIAA  420

Query  252  AL  247
            AL
Sbjct  421  AL  422



>ref|XP_002502760.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO64018.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=459

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA++PGM ERTLTVNGFSKAFAMTGWRLGY+A P+HF  A  KIQ Q+TSG SSISQ+A
Sbjct  270  SFAAIPGMRERTLTVNGFSKAFAMTGWRLGYLAAPQHFATATAKIQGQTTSGPSSISQEA  329

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYG-  430
             +AALGLG  GG  VATM  AF++RRD++     ++EGVK++ PQGAFY+F D S   G 
Sbjct  330  AMAALGLGKFGGAPVATMKAAFQKRRDYVFDRLSKIEGVKLASPQGAFYVFPDVSGLVGD  389

Query  429  -VEVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRK  253
                 GFG + D+++LC YLL+KAQVALVPG AFG+  C+RISYAAS  TL+ A++RI K
Sbjct  390  GCVAEGFGPIADADALCEYLLEKAQVALVPGSAFGNPECLRISYAASDETLREALDRIEK  449

Query  252  AL  247
            AL
Sbjct  450  AL  451



>ref|XP_005648179.1| PLP-dependent transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE23635.1| PLP-dependent transferase [Coccomyxa subellipsoidea C-169]
Length=360

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 140/184 (76%), Gaps = 2/184 (1%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA LPGMW RT TVNGFSKAFAMTGWRLGY+A P+ F  A   +QSQ+TSGASSI+Q A
Sbjct  165  SFAVLPGMWPRTFTVNGFSKAFAMTGWRLGYLAAPRDFAKAAAIVQSQTTSGASSIAQHA  224

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AALGLG AGG+ VA M  AF+ERRD++++    +EGV+++ P GAFY+  D S+++G 
Sbjct  225  ALAALGLGKAGGQPVAAMRAAFQERRDYVMERLQRIEGVRVAAPDGAFYVLPDLSAFFGT  284

Query  426  EVAG--FGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRK  253
            +V    FG + D+++LCRY+L+K  VALVPGDAFG   C+RISYAASL TLQ  ++RI  
Sbjct  285  DVHADDFGPIPDADTLCRYILEKGNVALVPGDAFGAPACLRISYAASLETLQKGLDRIEG  344

Query  252  ALLT  241
            AL +
Sbjct  345  ALTS  348



>ref|XP_002946497.1| hypothetical protein VOLCADRAFT_103084 [Volvox carteri f. nagariensis]
 gb|EFJ52424.1| hypothetical protein VOLCADRAFT_103084 [Volvox carteri f. nagariensis]
Length=480

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SF +LPGMW+RTLTVNGFSKA+AMTGWRLGY+A P+ +  A   IQSQSTSGASSISQ+A
Sbjct  287  SFGALPGMWDRTLTVNGFSKAYAMTGWRLGYLAAPRIYAKAAAIIQSQSTSGASSISQQA  346

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYG-  430
             +AAL LG  GGE V  MV+AF+ERRDF+      + GV ++EP GAFY+  + S+++G 
Sbjct  347  ALAALALGPGGGEPVQQMVRAFQERRDFVCARLRGIPGVNLAEPSGAFYVLPEMSAFFGP  406

Query  429  -VEVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRK  253
                 GFG V DS++ CRYL++KA VA+VPGDAFG D+CIRISYAASL TL  A++RI  
Sbjct  407  GAHADGFGPVPDSDTFCRYLIEKANVAVVPGDAFGADSCIRISYAASLETLGKALDRIAA  466

Query  252  AL  247
            +L
Sbjct  467  SL  468



>ref|XP_003060871.1| aspartate aminotransferase [Micromonas pusilla CCMP1545]
 gb|EEH54521.1| aspartate aminotransferase [Micromonas pusilla CCMP1545]
Length=464

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 130/182 (71%), Gaps = 2/182 (1%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA LPGM ERTLTVNGFSKAFAMTGWRLGY+A P+ F  A   IQ Q TSG SSISQ+A
Sbjct  275  SFAGLPGMMERTLTVNGFSKAFAMTGWRLGYLAAPRAFAKATATIQGQITSGPSSISQQA  334

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYG-  430
             +AALGLG  GG  VA M KAF  RRDF+      + GVK+  P GAFY+F D S+  G 
Sbjct  335  AIAALGLGLNGGAPVAAMKKAFETRRDFVAARLSNIPGVKLDVPAGAFYVFPDVSALVGD  394

Query  429  -VEVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRK  253
                 GFG V D + LCRYLL+KAQVALVPG AFG+  C+RISYAAS  TL+ A++RI K
Sbjct  395  GASAEGFGPVADGDELCRYLLEKAQVALVPGSAFGNPECVRISYAASDDTLKEALDRIEK  454

Query  252  AL  247
            AL
Sbjct  455  AL  456



>ref|XP_001421566.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99859.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=452

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 135/182 (74%), Gaps = 2/182 (1%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A++ GMWERT+ VNGFSK+FAMTGWRLGY+A PKHF  A + IQSQ TSG +SISQ+A
Sbjct  260  SIAAMDGMWERTMVVNGFSKSFAMTGWRLGYVAAPKHFARAMSMIQSQITSGPNSISQEA  319

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYG-  430
             +AAL LGY GGE VA MV+AF +RRDF+      ++GVK+ +  GAFY+F D S+++G 
Sbjct  320  ALAALELGYKGGEDVAAMVRAFEQRRDFVSARLNAIQGVKLPKVDGAFYVFPDVSAFFGG  379

Query  429  -VEVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRK  253
                 GFG V D + LCRY+L+K QVALVPG AFG   C+RISYAAS +TL+ A+ RI +
Sbjct  380  NASAEGFGPVADVDELCRYILEKGQVALVPGSAFGVPECLRISYAASNATLEEALSRIER  439

Query  252  AL  247
             L
Sbjct  440  CL  441



>ref|WP_014065957.1| aspartate aminotransferase [Rhodothermus marinus]
 gb|AEN72188.1| Aspartate transaminase [Rhodothermus marinus SG0.5JP17-172]
Length=402

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 124/184 (67%), Gaps = 3/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGM ERT+TVNGFSK FAMTGWRLGY+A  +  V A  K+QSQ TS   SISQKA
Sbjct  222  SFASLPGMKERTITVNGFSKGFAMTGWRLGYLAAERPIVKAAAKVQSQFTSAPCSISQKA  281

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL +          MV AFR+RRDF+++    ++G+   +P+GAFYLF   S++YG 
Sbjct  282  GLAALQMDKGPIR---EMVAAFRQRRDFVLERLQAIDGITCPKPEGAFYLFPQVSAFYGR  338

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
                   +TDSESLC YLL++  VALVPG AFGD   +RISYAAS+  L  A+ RI   L
Sbjct  339  RAPDGRTITDSESLCLYLLEQCHVALVPGQAFGDPNGVRISYAASMENLAEAMRRIEAGL  398

Query  246  LTIR  235
              +R
Sbjct  399  AALR  402



>ref|WP_012842775.1| aspartate aminotransferase [Rhodothermus marinus]
 gb|ACY47163.1| aminotransferase class I and II [Rhodothermus marinus DSM 4252]
Length=402

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 124/184 (67%), Gaps = 3/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGM ERT+TVNGFSK FAMTGWRLGY+A  +  V A  K+QSQ TS   SISQKA
Sbjct  222  SFASLPGMKERTITVNGFSKGFAMTGWRLGYLAAERPIVKAAAKVQSQFTSAPCSISQKA  281

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL +          MV AFR+RRDF+++    ++G+   +P+GAFYLF   S++YG 
Sbjct  282  GLAALQMDKGPIR---EMVAAFRQRRDFVLERLQAIDGITCPKPEGAFYLFPQVSAFYGR  338

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
                   +TDSESLC YLL++  VALVPG AFGD   +RISYAAS+  L  A+ RI   L
Sbjct  339  RTPDGRTITDSESLCLYLLEQCHVALVPGQAFGDPNGVRISYAASMENLAEAMRRIEAGL  398

Query  246  LTIR  235
              ++
Sbjct  399  AALQ  402



>emb|CAN61479.1| hypothetical protein VITISV_013818 [Vitis vinifera]
Length=315

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 124/176 (70%), Gaps = 30/176 (17%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFV-----------------AACN  658
            SFA+L GMWE  LTVNGFSKAF+MTGW+LGY+AGP   +                 ++ +
Sbjct  89   SFAALLGMWEGALTVNGFSKAFSMTGWQLGYLAGPSTLLLYVERSRVSGLYCEFNLSSVH  148

Query  657  KIqsqstsgass-------------isQKagvaalglgyaggeavATMVKAFRERRDFLV  517
            KI + S +                 I+QKA VAALG+GYAGGEAV+TMVKAF ERR FLV
Sbjct  149  KIITVSATSLVVWMQSLNSIGGASGIAQKAAVAALGMGYAGGEAVSTMVKAFXERRGFLV  208

Query  516  KSFGEMEGVKISEPQGAFYLFIDFSSYYGVEVAGFGAVTDSESLCRYLLDKAQVAL  349
            KSFGE+EGVKISEPQGAFYLF+DFSSYYG E  GFG + +SESLCRYL+DKAQVAL
Sbjct  209  KSFGELEGVKISEPQGAFYLFLDFSSYYGAEAEGFGIIENSESLCRYLVDKAQVAL  264



>ref|XP_005851526.1| hypothetical protein CHLNCDRAFT_48481 [Chlorella variabilis]
 gb|EFN59424.1| hypothetical protein CHLNCDRAFT_48481 [Chlorella variabilis]
Length=452

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 140/214 (65%), Gaps = 34/214 (16%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+LPGM+ERTLTVNGFSKA+AMTGWRLGY+A P+HF  A   IQSQSTSGASSI+Q A
Sbjct  230  SFAALPGMYERTLTVNGFSKAYAMTGWRLGYLAAPRHFAKAAAVIQSQSTSGASSIAQHA  289

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYY--  433
             VAALG+G  GG  V  M+ AF +RRDF+ +   ++ GV ++ PQGAFY+  + +++   
Sbjct  290  AVAALGMGPQGGPLVQDMIAAFEQRRDFVTQRLQQIPGVGLAAPQGAFYVMPEVAAFVGP  349

Query  432  GVEVAGFGAVTDSESL--------------------------------CRYLLDKAQVAL  349
            GVE  G+G V D ++L                                CRYL++ A VAL
Sbjct  350  GVEARGWGPVEDVDALCRCRTHSSPPACLAPPCACLPAPHPFHLSFLFCRYLIETANVAL  409

Query  348  VPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            VPGDAFG  +CIRISYAAS+ TL+ A++R+  AL
Sbjct  410  VPGDAFGAPSCIRISYAASMETLEKALDRVAAAL  443



>ref|WP_039745768.1| aspartate aminotransferase [Hassallia byssoidea]
 gb|KIF33845.1| aspartate aminotransferase [Hassallia byssoidea VB512170]
Length=399

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 124/184 (67%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A+LPGM++RT+TVNGF+K FAMTGWR+GYIA PK     CNK+Q Q TS   SISQ+ 
Sbjct  220  SMAALPGMFDRTITVNGFAKGFAMTGWRVGYIAAPKWIADGCNKVQGQITSANCSISQRG  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+       E    MVK + +RRD +     E+ GVK + PQGAFY F D SSY+G 
Sbjct  280  ALAAITGDMKPTE---EMVKQYHKRRDVVYNLLKEIPGVKANYPQGAFYFFPDVSSYFG-  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +  G   V +S+  C Y+L+KA V+LVPG+AFGD+ C+R+SYAA+   L  A++R++ AL
Sbjct  336  KSDGTRTVKNSDDFCMYMLEKAHVSLVPGEAFGDEKCVRLSYAAAEKDLVEALKRMKDAL  395

Query  246  LTIR  235
              ++
Sbjct  396  AQLK  399



>ref|XP_007512171.1| aspartate aminotransferase [Bathycoccus prasinos]
 emb|CCO66259.1| aspartate aminotransferase [Bathycoccus prasinos]
Length=466

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 130/185 (70%), Gaps = 5/185 (3%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS P MWERT+ VNGFSK+FAMTGWRLGY A P++F  A N +QSQ TSG SSI+Q+A
Sbjct  271  SAASFPNMWERTIVVNGFSKSFAMTGWRLGYSAAPEYFSKAFNMLQSQLTSGPSSIAQEA  330

Query  606  gvaa-lglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYG  430
             +A  + LG  GG  V  M K F+ERRD++++   +++GV I  P GAFY F D +   G
Sbjct  331  ALAGYVELGDKGGAPVELMRKKFQERRDYVIERLRKIDGVAIETPGGAFYAFPDVTKLCG  390

Query  429  VE----VAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVER  262
             +    V GFG V  S+ +CRYLL +A+VALVPG AFG D CIRISYAAS  TL+ A++R
Sbjct  391  GDKGGFVEGFGPVKGSDEMCRYLLQEARVALVPGSAFGVDECIRISYAASDETLEKALDR  450

Query  261  IRKAL  247
            I +AL
Sbjct  451  ITQAL  455



>ref|WP_009578666.1| Aspartate aminotransferase [Fulvivirga imtechensis]
 gb|ELR72616.1| Aspartate aminotransferase [Fulvivirga imtechensis AK7]
Length=397

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 114/180 (63%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S ASLPGM +RT+TVNGF+K FAMTGWR+GYI  P      CNK+Q Q TS   SI+Q+A
Sbjct  218  SIASLPGMVDRTVTVNGFAKGFAMTGWRVGYIGAPLWLAKGCNKVQGQITSANCSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
               A+            M +A++ RR  +     E+ G+K + PQGAFY F D S+Y+G 
Sbjct  278  AYVAITSDLEPTY---EMTRAYKNRRQIVYDLLREIPGIKTNMPQGAFYFFPDVSAYFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               GF  V D+   C Y+L+KA V+LV GDAFGD  C+R+SYAAS   L+ A++RI++ L
Sbjct  335  SADGF-KVNDASDFCMYILEKAHVSLVSGDAFGDPDCVRLSYAASEQELREAIKRIKEVL  393



>gb|AGT17131.1| hypothetical protein SHCRBa_170_F15_F_220 [Saccharum hybrid cultivar 
R570]
Length=145

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = -3

Query  558  TMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGVEVAGFGAVTDSESLCR  379
            TMVKAF+ERRD+LVK+F E+  VKI EPQGAFYLF+DFS+YYG EV GFG + +SESLC 
Sbjct  38   TMVKAFQERRDYLVKNFKELPSVKIPEPQGAFYLFVDFSAYYGSEVEGFGTIKNSESLCI  97

Query  378  YLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKALLTIRPVV  226
            +LL+KAQV        GDD CIRISYAASL+TLQ A+ R ++A+  ++P V
Sbjct  98   FLLEKAQVT-----HLGDDKCIRISYAASLTTLQTAMARTKEAVALLKPCV  143



>ref|WP_042563747.1| aspartate aminotransferase [Flavobacterium sp. MEB061]
 gb|KIQ22573.1| aspartate aminotransferase [Flavobacterium sp. MEB061]
Length=396

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM+ERT+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMFERTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MVKAF ERRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADASVLNH---MVKAFHERRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  L  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLKG-TEIKDANDLSMYLLGEANVATVTGDAFGNPNCIRFSYATSNDILKEALRRIKEAL  394



>ref|WP_014083232.1| aspartate aminotransferase [Flavobacterium branchiophilum]
 emb|CCB68752.1| Probable aspartate transaminase AspC1 [Flavobacterium branchiophilum 
FL-15]
Length=396

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM+++T+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSG++SI+Q+A
Sbjct  219  SIASIPGMFDKTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGSNSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    A       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPAVLN---DMVRAFHSRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  L  YLL +A VA V GDAFG+  CIR SYA S + L  A+ RI++AL
Sbjct  336  TLKG-TLINDANDLSMYLLAEANVATVTGDAFGNPNCIRFSYATSEALLTEALRRIKEAL  394



>ref|WP_007096871.1| aspartate aminotransferase [Kordia algicida]
 gb|EDP97823.1| putative aspartate aminotransferase [Kordia algicida OT-1]
Length=394

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 123/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A +P M++RT+TVNG SKAFAMTGWR+GYI  P+    ACNKIQ Q TSGA+ I+Q+A
Sbjct  218  SIARIPSMYDRTITVNGVSKAFAMTGWRIGYIGAPEKIARACNKIQGQITSGANCIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL       +    M+  F +RRD +++  GE+EG  I+ P+GAFY+F D SS++G 
Sbjct  278  TIAALEASKDKIQY---MMDEFLKRRDIVLELLGEIEGFNINVPEGAFYVFPDISSFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLLD+A VA V GDAFG+  CIRISYAAS   L+ A+++I++AL
Sbjct  335  TLRG-KTINNATDFSLYLLDEALVATVTGDAFGNPNCIRISYAASEEELRTAIKQIKEAL  393



>ref|WP_035135035.1| aspartate aminotransferase [Flavobacterium beibuense]
 gb|KGO79528.1| aspartate aminotransferase [Flavobacterium beibuense F44-8]
Length=394

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM ERT+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIGSIPGMLERTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +  +    MV AF +RRD +V    E+ G KI+ P+GAFY+F D S Y+G 
Sbjct  278  TIAAVEADPSAIKY---MVDAFHKRRDLVVNLVKEIPGFKINVPEGAFYVFPDVSDYFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             V GF  + +++    YLL+ A VA V GDAFG+  CIR SYA S   L  A+ RI++AL
Sbjct  335  TVNGF-EIKNADDFSMYLLEHANVATVTGDAFGNPNCIRFSYATSEDQLIEAIRRIKEAL  393



>ref|XP_003083519.1| putative aspartate aminotransferase (ISS) [Ostreococcus tauri]
 emb|CAL58068.1| Aminotransferases,class-I,pyridoxal-phosphate-binding site [Ostreococcus 
tauri]
Length=448

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A+   MWERTL VNGFSK+FAMTGWRLGY+A PKHF  A + +QSQ TSG +SISQ+A
Sbjct  256  SIAACDDMWERTLVVNGFSKSFAMTGWRLGYVAAPKHFARAMSMLQSQITSGPNSISQEA  315

Query  606  gvaalglg-yaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYY-  433
             +AAL      GG+AVA MV+AF  RRDF+      ++GVK+    GAFY+F D S+   
Sbjct  316  ALAALQQLGPRGGDAVAEMVRAFERRRDFVSARLCAIDGVKLPRVDGAFYVFPDVSALVG  375

Query  432  -GVEVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIR  256
             G    GFG + D + LCRYLL+K  VA+VPG AFG   C+R+SYAA+ S L  A+ RI 
Sbjct  376  DGASAEGFGPIADVDELCRYLLEKGLVAVVPGSAFGVPNCLRVSYAAADSVLDEALSRIE  435

Query  255  KAL  247
            + L
Sbjct  436  RCL  438



>ref|WP_023575472.1| aspartate aminotransferase [Flavobacterium saliperosum]
 gb|ESU27916.1| aspartate aminotransferase [Flavobacterium saliperosum S13]
Length=400

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 121/182 (66%), Gaps = 4/182 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM ERT+TVNG +KAFAMTGWR+GYI GP+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIGSIPGMLERTITVNGVAKAFAMTGWRIGYIGGPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +  +    MV AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  278  TIAAVDADPSVLKH---MVDAFHSRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++A+
Sbjct  335  TLKG-TEIKDATDFSMYLLAEANVATVTGDAFGNPNCIRFSYATSEDLLKEALRRIKEAV  393

Query  246  LT  241
             T
Sbjct  394  TT  395



>ref|WP_026991273.1| aspartate aminotransferase [Flavobacterium subsaxonicum]
 gb|KGO92119.1| aspartate aminotransferase [Flavobacterium subsaxonicum WB 4.1-42 
= DSM 21790]
Length=395

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 123/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A++PGM+++T+TVNG +KAFAMTGWR+GYI GP+    AC K+Q Q TSGA+SI+Q+A
Sbjct  218  SIATIPGMYDKTITVNGVAKAFAMTGWRIGYIGGPEFIAKACTKMQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    A  +    MV AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  278  TITAVDADPAVLK---DMVAAFHSRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +++ L  YLL+ A VA V GDAFG+  CIR SYA S   L  A++RI++AL
Sbjct  335  TLKGV-EIKNADDLSMYLLEHANVATVTGDAFGNPDCIRFSYATSEEILTEALKRIKEAL  393



>ref|WP_022834450.1| aspartate aminotransferase [Salisaeta longa]
Length=403

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 121/184 (66%), Gaps = 3/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA+LPGM ERT+TVNGFSKA+AMTGWRLGY+A P     A  K+Q Q TS  SSISQKA
Sbjct  223  SFAALPGMQERTVTVNGFSKAYAMTGWRLGYLAAPAPIRDAAAKVQGQFTSAPSSISQKA  282

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            G+AAL +G    +    MV AFR+RRD++++    + GV   EPQGAFYLF   +   G 
Sbjct  283  GIAALEMGPGPVQ---EMVAAFRQRRDYVLERLRALPGVTCPEPQGAFYLFPHIADVLGA  339

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
                   +  SE LC YLL+   VALVPG+AFG    +R+SYA+S+  L+ A++RI + L
Sbjct  340  RTPDGTRIESSEDLCFYLLEHCHVALVPGEAFGAPEGMRLSYASSMEDLETALDRITEGL  399

Query  246  LTIR  235
              +R
Sbjct  400  NALR  403



>ref|XP_007048023.1| Aspartate aminotransferase isoform 4 [Theobroma cacao]
 gb|EOX92180.1| Aspartate aminotransferase isoform 4 [Theobroma cacao]
Length=401

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 101/105 (96%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQ TSGASSISQKA
Sbjct  292  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQYTSGASSISQKA  351

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQ  472
            GVAALGLGYAGGEAV+TMVKAFRERRDFLVKS GE+EGVKISEPQ
Sbjct  352  GVAALGLGYAGGEAVSTMVKAFRERRDFLVKSLGELEGVKISEPQ  396



>ref|WP_029273240.1| aspartate aminotransferase [Flavobacterium sp. KJJ]
Length=396

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM+ERT+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMFERTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF ERRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVQAFHERRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLRG-TEIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSNDILKEALRRIKEAL  394



>ref|WP_009392912.1| aspartate aminotransferase [Capnocytophaga sp. oral taxon 329]
 gb|KHE70209.1| putative aspartate aminotransferase [Capnocytophaga sp. oral 
taxon 329 str. F0087]
Length=396

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 127/180 (71%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA++ GM+ERT+T+NG SKAFAMTGWR+GY+A P+    ACNK+Q Q TSG ++I+Q+A
Sbjct  220  SFAAIEGMYERTITINGLSKAFAMTGWRIGYLAAPEWIAKACNKVQGQITSGTNAIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F++RRD ++    E+EG+K++ P+GAFY+F D SS++G 
Sbjct  280  AIAALKAPKSEIQY---MIDEFKKRRDLVLALLSEVEGLKVNVPEGAFYVFPDVSSFFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL++A VA V G+AFGD  CIRISYAAS   L+ A+ RI+++L
Sbjct  337  TLRG-RTIRNASDFSLYLLEEAMVATVTGEAFGDANCIRISYAASEKELREAIRRIKESL  395



>ref|WP_041517563.1| aspartate aminotransferase [Flavobacterium hibernum]
 gb|KIO52985.1| aspartate aminotransferase [Flavobacterium hibernum]
Length=396

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIASIPGMLEKTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVQAFHSRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  L  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLKG-TEIKDANDLSMYLLGEANVATVTGDAFGNPNCIRFSYATSDDILKEALRRIKEAL  394



>ref|WP_023578516.1| aspartate/tyrosine/aromatic aminotransferase [Flavobacterium 
limnosediminis]
 gb|ESU29449.1| aspartate/tyrosine/aromatic aminotransferase [Flavobacterium 
limnosediminis JC2902]
Length=400

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 121/182 (66%), Gaps = 4/182 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM ERT+TVNG +KAFAMTGWR+GYI GP+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIGSIPGMLERTITVNGVAKAFAMTGWRIGYIGGPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +  +    MV AF  RRD +V    E+ G+KI+ P+GAFY+F D S+++G 
Sbjct  278  TIAAVDADPSVLKH---MVDAFHSRRDLVVGLLKEIPGIKINVPEGAFYVFPDVSAFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++A+
Sbjct  335  TLKG-TEIKDATDFSMYLLAEANVATVTGDAFGNPNCIRFSYATSEDLLKEALRRIKEAV  393

Query  246  LT  241
             T
Sbjct  394  TT  395



>ref|WP_011962581.1| aspartate aminotransferase [Flavobacterium psychrophilum]
 ref|YP_001295341.1| Probable aspartate transaminase AspC1 [Flavobacterium psychrophilum 
JIP02/86]
 emb|CAL42523.1| Probable aspartate transaminase AspC1 [Flavobacterium psychrophilum 
JIP02/86]
Length=395

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM++RT+TVNG +KAFAMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+A
Sbjct  219  SIASIPGMFDRTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKMQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +       MV AF+ RRD +V    E+ G+K++ P+GAFY+F D S+Y+G 
Sbjct  279  TIAAVDADPSVLNE---MVTAFKSRRDLVVALIKEIPGLKLNTPEGAFYVFPDVSAYFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +++    YLL +A VA V GDAFG+  CIRISYA S   L  A+ RI++ L
Sbjct  336  TLRG-KTINNADDFSMYLLGEANVATVTGDAFGNPNCIRISYATSEEILTEAIRRIKEVL  394



>ref|WP_035670024.1| aspartate aminotransferase [Flavobacterium sp. 83]
Length=396

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM ERT+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  219  SIASIPGMLERTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +  +    MV AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLKH---MVDAFHSRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++  L  YLL +A VA V GDAFG+  CIR SYA S   L+ A++RI+ AL
Sbjct  336  TLKG-TEIKNAMDLSMYLLAEANVATVTGDAFGNPDCIRFSYATSDEILKEALKRIKDAL  394



>ref|WP_034099044.1| aspartate aminotransferase [Flavobacterium psychrophilum]
 gb|AIG29327.1| aspartate aminotransferase [Flavobacterium psychrophilum]
 gb|AIG31604.1| aspartate aminotransferase [Flavobacterium psychrophilum]
 gb|AIG33758.1| aspartate aminotransferase [Flavobacterium psychrophilum]
 gb|AIG36120.1| aspartate aminotransferase [Flavobacterium psychrophilum]
 gb|AIG38386.1| aspartate aminotransferase [Flavobacterium psychrophilum]
 gb|AIG40653.1| aspartate aminotransferase [Flavobacterium psychrophilum]
 gb|AIN73309.1| aspartate aminotransferase [Flavobacterium psychrophilum FPG3]
 gb|AIT64704.1| aspartate aminotransferase [Flavobacterium psychrophilum]
Length=395

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM++RT+TVNG +KAFAMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+A
Sbjct  219  SIASIPGMFDRTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKMQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +       MV AF+ RRD +V    E+ G+K++ P+GAFY+F D S+Y+G 
Sbjct  279  TIAAVDADPSVLNE---MVTAFKSRRDLVVALIKEIPGLKLNTPEGAFYVFPDVSAYFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +++    YLL +A VA V GDAFG+  CIRISYA S   L  A+ RI++ L
Sbjct  336  TLRG-KTINNADDFSMYLLGEANVATVTGDAFGNPNCIRISYATSEEILTEAIRRIKEVL  394



>ref|WP_038503298.1| aspartate aminotransferase [Flavobacterium psychrophilum]
 gb|AIJ36944.1| Aspartate aminotransferase [Flavobacterium psychrophilum]
 gb|AIN70906.1| aspartate aminotransferase [Flavobacterium psychrophilum FPG101]
Length=395

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM++RT+TVNG +KAFAMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+A
Sbjct  219  SIASIPGMFDRTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKMQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +       MV AF+ RRD +V    E+ G+K++ P+GAFY+F D S+Y+G 
Sbjct  279  TIAAVDADPSVLNE---MVTAFKSRRDLVVALIKEIPGLKLNTPEGAFYVFPDVSAYFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +++    YLL +A VA V GDAFG+  CIRISYA S   L  A+ RI++ L
Sbjct  336  TLRG-KTINNADDFSMYLLGEANVATVTGDAFGNPNCIRISYATSEEILTEAIRRIKEVL  394



>ref|WP_008991255.1| aspartate aminotransferase [Galbibacter marinus]
 gb|EKF55430.1| aspartate transaminase [Galbibacter marinus]
Length=397

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 124/180 (69%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+ GM++RT+TVNG SKAFAMTGWR+GYI  P     ACNKIQ Q TSGA+SI+Q+A
Sbjct  219  SIASIEGMFDRTVTVNGVSKAFAMTGWRIGYIGAPDWIARACNKIQGQITSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F+ERRD ++   GE+EG +++ P+GAFY+F + SS++G 
Sbjct  279  TIAALEAPVSSIQF---MIDKFKERRDLVLSLLGEIEGFQLNVPEGAFYVFPNVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL+ A VA V G+AFG+  CIRISYAAS  +L+ A+ RI+ A+
Sbjct  336  TLKG-NKIENASDFALYLLEHANVATVTGEAFGNPNCIRISYAASEESLKEAISRIKAAV  394



>ref|XP_011399542.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26604.1| Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate 
aminotransferase [Auxenochlorella protothecoides]
Length=451

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 126/182 (69%), Gaps = 2/182 (1%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFASLPGM  RTLTVNGFSKA+AMTGWRLGY+A P  F  A   +QSQ TSGASSI+Q A
Sbjct  257  SFASLPGMAHRTLTVNGFSKAYAMTGWRLGYLAAPPTFATAAGVVQSQCTSGASSIAQHA  316

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYY--  433
             +AALGLG  GG+ VA MV AFRERRD++V     + GV +  P GAFY+F D S+    
Sbjct  317  ALAALGLGPHGGDPVARMVAAFRERRDYVVARLRAIPGVVLDAPDGAFYVFPDASALVGP  376

Query  432  GVEVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRK  253
            G E  GFG V     LCRY+L+ A V +VPG+AFG+  C RISYA S+  L+  ++RI  
Sbjct  377  GAEAPGFGPVPTVAELCRYILEVAHVVVVPGEAFGEPACFRISYATSMEQLEKGLDRIAA  436

Query  252  AL  247
            AL
Sbjct  437  AL  438



>ref|WP_016990821.1| aspartate aminotransferase [Flavobacterium sp. ACAM 123]
Length=395

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM E+T+TVNG +KAFAMTGWR+GYI GP+    AC KIQ Q TSGA+SI+Q+A
Sbjct  219  SIASIPGMLEKTVTVNGVAKAFAMTGWRIGYIGGPEFIAKACTKIQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +  +    MV AF  RRD +V    E+ G+KI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLQH---MVDAFHSRRDLVVGLLKEIPGIKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     YLL +A VA V GDAFG+  CIR SYA S   L  A++RI++A+
Sbjct  336  TLRG-TLIKDANDFAMYLLGEANVATVTGDAFGNPDCIRFSYATSEDILTEALKRIKEAV  394



>ref|WP_023570671.1| aspartate aminotransferase [Flavobacterium cauense]
 gb|ESU20122.1| aspartate aminotransferase [Flavobacterium cauense R2A-7]
 gb|KGO83925.1| aspartate aminotransferase [Flavobacterium cauense R2A-7]
Length=400

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 120/182 (66%), Gaps = 4/182 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM ERT+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIGSIPGMLERTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +  +    MV AF  RRD +V    E+ G+KI+ P+GAFY+F D SS++G 
Sbjct  278  TIAAVDADPSVLKH---MVDAFHSRRDLVVGLLKEIPGIKINVPEGAFYVFPDVSSFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++A+
Sbjct  335  TLKG-TEIKDATDFSMYLLAEANVATVTGDAFGNPNCIRFSYATSEDLLKEALRRIKEAV  393

Query  246  LT  241
             T
Sbjct  394  TT  395



>ref|WP_024981404.1| aspartate aminotransferase [Flavobacterium succinicans]
Length=395

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM E+T+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIASIPGMLEKTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +       MV+AF  RRD +V    E+ G+KI+ P+GAFY+F D SS++G 
Sbjct  278  TITALDADPSVLNE---MVQAFHSRRDLVVGLLKEIPGIKINVPEGAFYVFPDVSSFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S + L  A++RI+ AL
Sbjct  335  TLRG-TEIKDANDVSMYLLAEACVATVTGDAFGNPNCIRFSYATSEAVLTEALKRIKDAL  393



>ref|WP_022826688.1| aspartate aminotransferase [Flavobacterium antarcticum]
Length=395

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM++RT+TVNG +KAFAMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+ 
Sbjct  219  SIASIPGMFDRTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKMQGQVTSGANSIAQR-  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              A +    A    +  MV AF+ RRD +VK   ++ G+K++ P+GAFY+F D SSY+G 
Sbjct  278  --ATIAAVEADPSVLNDMVAAFKSRRDLVVKLIQDIPGLKLNVPEGAFYVFPDVSSYFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     YLL +A VA V G+AFG+  C+R+SYA S   L  A+ RI+KAL
Sbjct  336  TLNG-TEIKDATDFAMYLLAEANVATVTGEAFGNPNCLRLSYATSEEELTDALTRIKKAL  394



>ref|WP_010418596.1| aspartate aminotransferase [Anaerophaga thermohalophila]
Length=398

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 121/184 (66%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            + AS PGM ER + VNG SK +AMTGWRLGYIA P+   +AC+++Q Q TSG S+ISQKA
Sbjct  219  TLASFPGMQERVVIVNGVSKGYAMTGWRLGYIAAPEWIASACSRLQGQYTSGTSTISQKA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+            MV+AFR RRD +VK   E+ G+K + P+GAFYLF D SS++G 
Sbjct  279  ALAAINGPQDDTRK---MVEAFRRRRDLVVKLANEIPGLKNNNPEGAFYLFPDISSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
                   + +S  LC YLL++  VA V G AFG DTCIR SYA+S   L+ A++RI++ L
Sbjct  336  SYKN-KTINNSSDLCFYLLEEVHVATVTGTAFGCDTCIRFSYASSDEILREAMKRIKEGL  394

Query  246  LTIR  235
              ++
Sbjct  395  ARLK  398



>ref|WP_007137614.1| aspartate aminotransferase [Flavobacterium frigoris]
 gb|EIA09531.1| aspartate aminotransferase [Flavobacterium frigoris PS1]
Length=395

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM E+T+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIASIPGMLEKTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +  +    MV AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  278  TITAVDADPSVLKH---MVDAFHSRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++  L  YLL +A VA V GDAFG+  CIR SYA S   L+ A++RI+ AL
Sbjct  335  TLRG-TEINNAMDLSMYLLAEANVATVTGDAFGNPDCIRFSYATSDDILKEALKRIKDAL  393



>ref|WP_020212359.1| aspartate aminotransferase [Flavobacterium rivuli]
 gb|KGO87997.1| aspartate aminotransferase [Flavobacterium rivuli WB 3.3-2 = 
DSM 21788]
Length=395

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A++PGM+++T+TVNG +KAFAMTGWR+GYI GP+    AC K+Q Q TSGA+SI+Q+A
Sbjct  218  SIATIPGMYDKTITVNGVAKAFAMTGWRIGYIGGPEFIAKACTKMQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    A  +    MV AF  RRD +V    E+ GVKI+ P+GAFY+F D S ++G 
Sbjct  278  TITAVDADPAVLK---DMVAAFHSRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSFFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +++ L  YLL+ A VA V GDAFG+  CIR SYA S   L  A++RI++AL
Sbjct  335  TLKGI-EIKNADDLSMYLLEHANVATVTGDAFGNPDCIRFSYATSEDILTEALKRIKEAL  393



>ref|WP_026712367.1| aspartate aminotransferase [Flavobacterium daejeonense]
Length=396

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM+E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  219  SIASIPGMFEKTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF +RRD +V    E+ G+KI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVQAFHKRRDLVVGLLKEIPGIKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L+ A++RI+ AL
Sbjct  336  TLRG-KEIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSDDLLKEALKRIKDAL  394



>ref|WP_026812169.1| aspartate aminotransferase [Arenibacter certesii]
Length=394

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 123/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A++ GM++RT+TVNG SKAFAMTGWR+GYI  P+    ACNK Q Q TSGA++I+Q+A
Sbjct  219  SIANVEGMYDRTVTVNGVSKAFAMTGWRIGYIGAPEWIAKACNKFQGQITSGANAIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F +RRD +++  GE+EG  ++ P+GAFY+F D SS++G 
Sbjct  279  TIAALNAPVSSIKF---MIDEFHKRRDIVLELLGEIEGFNLNVPEGAFYVFPDISSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL+KA VA V G+AFG++ CIRISYAAS   L+ A+ RI+  L
Sbjct  336  TLNG-TTINNASDFSLYLLEKANVATVTGEAFGNENCIRISYAASEKELREAIARIKAVL  394



>ref|WP_035617997.1| aspartate aminotransferase [Flavobacterium hydatis]
 gb|KFF19908.1| aspartate aminotransferase [Flavobacterium hydatis]
Length=396

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLEKTITVNGVAKAFAMTGYRVGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MVKAF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVKAFHTRRDLVVGLLKEIPGVKINIPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  L  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLRG-TEIKDANDLSMYLLAEANVATVTGDAFGNPNCIRFSYATSDDILKEALRRIKEAL  394



>ref|WP_035660695.1| aspartate aminotransferase [Flavobacterium sp. EM1321]
 gb|KDN54455.1| aspartate aminotransferase [Flavobacterium sp. EM1321]
Length=396

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PG+++RT+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  219  SIASIPGLFDRTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MVKAF  RRD +V    E+ G+KI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVKAFHSRRDLVVGLLKEIPGIKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L+ A++RI+ AL
Sbjct  336  TLKG-TEIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSDELLKEALKRIKDAL  394



>ref|WP_027419920.1| aspartate aminotransferase [Crocinitomix catalasitica]
Length=397

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 122/184 (66%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA    ++++T+TVNG SKAFAMTGWR+GYI  P     AC KIQ Q TSGA+SISQ+A
Sbjct  218  SFAQFDNVFDKTITVNGVSKAFAMTGWRIGYIGAPVEIANACIKIQGQYTSGAASISQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              AA+            MV AF++RRD +V    E+EG+KI+ P+GAFY+F D SS++G 
Sbjct  278  AKAAVEADPEEIRF---MVDAFKKRRDLVVGLLKEIEGLKINNPEGAFYVFPDISSFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
                F  V ++  L  YLL +A VA+V G+AFGD  CIRISYAAS + L  A+ RI++AL
Sbjct  335  TNGDF-KVNNATDLSLYLLSEALVAIVTGEAFGDPNCIRISYAASEAELIEAISRIKRAL  393

Query  246  LTIR  235
              ++
Sbjct  394  EKLK  397



>ref|WP_035685508.1| aspartate aminotransferase [Flavobacterium reichenbachii]
 gb|KFF06739.1| aspartate aminotransferase [Flavobacterium reichenbachii]
Length=396

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM ERT+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLERTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVQAFHTRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLRG-TEIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSDDILKEALRRIKEAL  394



>ref|WP_026979598.1| aspartate aminotransferase [Flavobacterium suncheonense]
 gb|KGO88808.1| aspartate aminotransferase [Flavobacterium suncheonense GH29-5 
= DSM 17707]
Length=400

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 121/182 (66%), Gaps = 4/182 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM++RT+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIASIPGMFDRTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+       +    MV AF  RRD +V    E+ G+KI+ P+GAFY+F D S+++G 
Sbjct  278  TITAVDADPKVLKY---MVDAFHSRRDLVVGLIREIPGMKINVPEGAFYVFPDVSAFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +++    YLL+ A VA V GDAFG+  CIR SYA S   L+ A+ RI++A+
Sbjct  335  TLNGV-KINNADDFSMYLLEHANVATVTGDAFGNPNCIRFSYATSEDLLKEALRRIKEAV  393

Query  246  LT  241
             T
Sbjct  394  AT  395



>ref|WP_039116426.1| MULTISPECIES: aspartate aminotransferase [Flavobacterium]
 gb|KIA92900.1| aspartate aminotransferase [Flavobacterium sp. KMS]
 gb|KIC01823.1| aspartate aminotransferase [Flavobacterium sp. JRM]
Length=396

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLEKTITVNGVAKAFAMTGYRVGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVQAFHTRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  L  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLKG-THIKDANDLSMYLLGEANVATVTGDAFGNPNCIRFSYATSDDILKEALRRIKEAL  394



>ref|WP_031442683.1| aspartate aminotransferase [Arenibacter algicola]
Length=394

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A++ GM++RT+TVNG SKAFAMTGWR+GYI GP     AC K Q Q TSGA+SI+Q+A
Sbjct  219  SIANIEGMYDRTITVNGVSKAFAMTGWRIGYIGGPDWIAKACTKFQGQITSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F +RRD +++  GE++G  ++ P+GAFY+F D SS++G 
Sbjct  279  TIAALNAPISSIKF---MIDEFHKRRDLVLELLGEIKGFNLNVPEGAFYVFPDISSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL+KA VA V G+AFG+D CIRISYAAS   L+ A+ RI+  L
Sbjct  336  TING-TLINNASDFALYLLEKANVATVTGEAFGNDNCIRISYAASEKELREAMARIKAVL  394



>ref|WP_007803254.1| aspartate aminotransferase [Flavobacterium sp. CF136]
 gb|EJL67097.1| aspartate/tyrosine/aromatic aminotransferase [Flavobacterium 
sp. CF136]
Length=395

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLEKTVTVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVQAFHSRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  L  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLKG-TEIKDANDLSMYLLAEANVATVTGDAFGNPDCIRFSYATSEDILKEALRRIKEAL  394



>ref|WP_031454536.1| aspartate aminotransferase [Flavobacterium chungangense]
Length=396

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLEKTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVQAFHTRRDLVVALLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLKG-TEIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSDDILKEALRRIKEAL  394



>ref|WP_039108878.1| aspartate aminotransferase [Flavobacterium sp. AED]
 gb|KIA87400.1| aspartate aminotransferase [Flavobacterium sp. AED]
Length=401

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM ERT+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  219  SIASIPGMLERTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +  +    MV AF  RRD +V    ++ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLKH---MVDAFHSRRDLVVGLLKDIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++A+
Sbjct  336  TLKG-TFIKDANDFSMYLLGEANVATVTGDAFGNPDCIRFSYATSEDLLKEALRRIKEAV  394



>ref|WP_042005698.1| aspartate aminotransferase [Capnocytophaga canimorsus]
 emb|CEN50778.1| Aspartate aminotransferase A [Capnocytophaga canimorsus]
Length=395

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 124/180 (69%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA + GM+ERT+TVNG SKA+AMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+A
Sbjct  219  SFAEIEGMYERTITVNGVSKAYAMTGWRIGYIGAPEWITKACTKMQGQITSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F+ RRD +++  GE+EG K++ P+GAFY+F D S ++G 
Sbjct  279  TIAALKAPVSNIQY---MIDQFKNRRDLVLRLLGEIEGFKLNVPEGAFYVFPDISYFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G    T S+    YLL++A VA V G+AFGD+ CIRISYAAS   L  A+ RI+++L
Sbjct  336  TLRGKEIKTASD-FSLYLLEEAGVATVTGEAFGDERCIRISYAASEQELTEAIRRIKESL  394



>ref|WP_041985251.1| aspartate aminotransferase [Capnocytophaga canimorsus]
 emb|CEN41010.1| Aspartate aminotransferase A [Capnocytophaga canimorsus]
 emb|CEN48296.1| Aspartate aminotransferase A [Capnocytophaga canimorsus]
 emb|CEN50210.1| Aspartate aminotransferase A [Capnocytophaga canimorsus]
Length=395

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 123/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A + GM+ERT+TVNG SKAFAMTGWR+GYI  P+    AC K+Q Q TSGA++I+Q+A
Sbjct  219  SIAEIDGMFERTITVNGVSKAFAMTGWRIGYIGAPEWITKACTKMQGQITSGANAIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +  +    M+  F++RRD +++   E+EG K++ P+GAFY+F D S ++G 
Sbjct  279  TIAAVKAPVSKIQY---MIDEFKKRRDLVLELLSEIEGFKLNIPEGAFYVFPDISYFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G    T S+    +LL+ A VA V G+AFGDD CIRISYAAS   L+ A+ RI++AL
Sbjct  336  TLKGQKIETASD-FSLFLLENAHVATVTGEAFGDDNCIRISYAASEKELREAIHRIKEAL  394



>ref|WP_026703982.1| aspartate aminotransferase [Flavobacterium soli]
Length=394

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 120/181 (66%), Gaps = 4/181 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM ERT+TVNG +KAFAMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+A
Sbjct  218  SIASIPGMLERTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKMQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV AF+ RRD +V     + G+K++ P+GAFY+F D SSY+G 
Sbjct  278  TITAVDADPSVLNE---MVGAFKSRRDLVVGLIKNIPGLKLNVPEGAFYVFPDVSSYFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +++    YLL +A VA V GDAFG+  CIR SYA S   L  A++RI++AL
Sbjct  335  TLRG-TEIKNADDFSMYLLAEANVATVTGDAFGNPNCIRFSYATSEEVLTEALKRIKEAL  393

Query  246  L  244
            +
Sbjct  394  V  394



>ref|WP_004351052.1| aspartate aminotransferase [Prevotella buccalis]
 gb|EFA90963.1| aminotransferase, class I/II [Prevotella buccalis ATCC 35310]
Length=397

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 118/184 (64%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  PGM ERT+ VNG SKA+AMTGWR+GYIA P+  V  CNK+Q Q TSG  S+SQ+ 
Sbjct  218  SIAQFPGMKERTILVNGVSKAYAMTGWRIGYIAAPEWIVKGCNKLQGQYTSGPCSVSQR-  276

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              AAL         V  M +AF+ RRD +V+   E+ G +++EPQGAFYLF   SSY+G 
Sbjct  277  --AALAAYVTEQACVEEMRQAFQRRRDLIVRLAKEIGGFEVNEPQGAFYLFPKCSSYFG-  333

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +  G   +  +  L  YLL+ A VA V GDAFGD  CIR+SYA S   ++ A++R++ AL
Sbjct  334  KSDGQHTINSATDLAMYLLETAHVATVGGDAFGDSECIRMSYATSDENIREALKRMKDAL  393

Query  246  LTIR  235
              ++
Sbjct  394  AKLK  397



>ref|WP_035275908.1| aspartate aminotransferase [Desulfobulbus japonicus]
Length=402

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 115/179 (64%), Gaps = 4/179 (2%)
 Frame = -3

Query  771  PGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKagvaal  592
            P + E+TL +NG SK+F+MTGWR+GY AGP H + A NKIQSQSTS  ++    +  AAL
Sbjct  228  PDLKEQTLILNGVSKSFSMTGWRIGYSAGPLHLIKAMNKIQSQSTSNPAA---PSQYAAL  284

Query  591  glgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGVEVAGF  412
                   +    M+K+FR RR F+V SF  M+GV   EP GAFY+F +FSSYYG +    
Sbjct  285  AALTGPQDFTKMMMKSFRPRRRFIVDSFQAMKGVSCVEPAGAFYVFPNFSSYYGKKSKN-  343

Query  411  GAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKALLTIR  235
            G +T S SL  YLLD+A VA VPG AFG D  IR S+A S+  +   +ER+ KAL  ++
Sbjct  344  GEITGSVSLADYLLDEALVATVPGAAFGSDEFIRFSFATSMEIIHEGMERVTKALEELK  402



>ref|WP_026985617.1| aspartate aminotransferase [Flavobacterium sp. URHB0058]
Length=396

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLEKTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVQAFHTRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLRG-TEIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSDDILKEALRRIKEAL  394



>ref|WP_012023823.1| aspartate aminotransferase [Flavobacterium johnsoniae]
 gb|ABQ04779.1| aminotransferase [Flavobacterium johnsoniae UW101]
Length=396

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLEKTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNE---MVQAFHGRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLKGH-EIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSNDILKEALRRIKEAL  394



>ref|WP_026730628.1| aspartate aminotransferase [Flavobacterium denitrificans]
Length=396

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLEKTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVEAFHGRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLKGH-EIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSNDILKEALRRIKEAL  394



>ref|WP_013551019.1| aspartate aminotransferase [Cellulophaga algicola]
 gb|ADV49544.1| Aspartate transaminase [Cellulophaga algicola DSM 14237]
Length=396

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  P M++RT+TVNG +KAFAMTGWR+GYI  P +   ACNK+Q Q TSGA+ I+Q+A
Sbjct  220  SMAEFPDMFDRTVTVNGVAKAFAMTGWRIGYIGAPAYIARACNKLQGQVTSGANCIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV  F+ERR  ++    ++ G K +EP+GAFY+F D S+Y+G 
Sbjct  280  VITALLEPVSRIQY---MVDKFKERRKLILGLLQDIPGFKSNEPEGAFYVFPDVSAYFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +S  L  YLL+ A VA V GD+FG++ CIRISYAAS + +  A+ RI+KA+
Sbjct  337  TLNGI-KINNSSDLSMYLLETANVATVAGDSFGNNNCIRISYAASEAQITEAMARIKKAV  395



>ref|WP_008467231.1| aspartate aminotransferase [Flavobacterium sp. F52]
 gb|EJG00442.1| class I and II aminotransferase [Flavobacterium sp. F52]
Length=396

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM +RT+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLDRTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ G+KI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNE---MVQAFHGRRDLVVGLLQEIPGIKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLKGH-EIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSNDILKEALRRIKEAL  394



>emb|CBI21451.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   141 bits (355),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  558  TMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGVEVAGFGAVTDSESLCR  379
            TMVKAFRERRDFLVKSFGE+EGVKISEPQGAFYLF+DFSSYYG E  GFG + +SESLCR
Sbjct  132  TMVKAFRERRDFLVKSFGELEGVKISEPQGAFYLFLDFSSYYGAEAEGFGIIENSESLCR  191

Query  378  YLLDKAQVALVPGDAF  331
            YLLDKAQVALVPGDA 
Sbjct  192  YLLDKAQVALVPGDAL  207


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  765  MWERTLTVNGFSKAFAMTGWRLGYIAGPKHFV  670
            MWE TL+VNGFSKAFAMTGWRLGY+AGP   +
Sbjct  1    MWEGTLSVNGFSKAFAMTGWRLGYLAGPNTLL  32



>ref|WP_023573422.1| aspartate/tyrosine/aromatic aminotransferase [Flavobacterium 
enshiense]
 gb|ESU23263.1| aspartate/tyrosine/aromatic aminotransferase [Flavobacterium 
enshiense DK69]
 gb|KGO96505.1| aspartate aminotransferase [Flavobacterium enshiense DK69]
Length=400

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM+E+T+TVNG +KAFAMTGWR+GY+  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIGSIPGMFEKTITVNGVAKAFAMTGWRIGYMGAPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +  +    MV AF  RRD +V    E+ G+KI+ P+GAFY+F D SS++G 
Sbjct  278  TITAVDADPSVLKH---MVDAFHSRRDLVVGLLKEIPGIKINVPEGAFYVFPDVSSFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++A+
Sbjct  335  TLRGH-EIKDANDFSMYLLAEANVATVTGDAFGNPNCIRFSYATSEDLLKEALRRIKEAV  393



>gb|KDD72845.1| class I/II aminotransferase [Helicosporidium sp. ATCC 50920]
Length=233

 Score =   141 bits (355),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 124/186 (67%), Gaps = 3/186 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S ASLPGM ERTLTVNGFSKA+AMTGWRLGY+AGP     A N +QSQSTSG SSI+Q A
Sbjct  47   SIASLPGMAERTLTVNGFSKAYAMTGWRLGYVAGPLPLARAMNIVQSQSTSGPSSIAQHA  106

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISE-PQGAFYLFIDFSSYYG  430
             +AAL +G  GG+ V   V+AF+ RRD +V+    M GV + E P GAFY   + S   G
Sbjct  107  ALAALAMGSRGGKVVQETVRAFQRRRDLVVEKLRAMPGVALPEVPMGAFYALPNVSGLVG  166

Query  429  V--EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIR  256
                  G+G + D+E+L  YLL  A VA+VPGDAFG    +R+S+A +   L+ A++R+ 
Sbjct  167  KGRSAKGYGPIPDAEALADYLLQSAHVAVVPGDAFGVPESLRLSFALADDQLERALDRMA  226

Query  255  KALLTI  238
            +AL  +
Sbjct  227  EALARV  232



>ref|WP_011403699.1| aspartate aminotransferase [Salinibacter ruber]
 ref|YP_445071.1| aspartate aminotransferase [Salinibacter ruber DSM 13855]
 gb|ABC45510.1| aspartate aminotransferase [Salinibacter ruber DSM 13855]
Length=404

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 118/184 (64%), Gaps = 3/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            +FASLP M ERT+TVNGFSK FAMTGWRLGY+A P     A  KIQ Q TS  SSI+QKA
Sbjct  224  AFASLPDMKERTVTVNGFSKGFAMTGWRLGYMAAPGPIAEAAGKIQGQFTSAPSSITQKA  283

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
            GVAAL +     E    MV AFR RRD +++    ++GV+   P+GAFY + D S+++G 
Sbjct  284  GVAALEMDKEPVE---EMVSAFRRRRDVVLERLRAIDGVQCPTPEGAFYAYPDVSAFFGA  340

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
                   + D   LC YLL++  VALVPG AFG+   +R+SYA+S+  L+  ++RI   L
Sbjct  341  TAPDGSTIEDGGDLCFYLLEEQDVALVPGPAFGEPDGLRLSYASSMEDLETGLDRIEAGL  400

Query  246  LTIR  235
              +R
Sbjct  401  AALR  404



>ref|WP_042346104.1| aspartate aminotransferase [Capnocytophaga canimorsus]
 emb|CEN42681.1| Aspartate aminotransferase A [Capnocytophaga canimorsus]
Length=395

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 125/180 (69%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA + GM++RT+TVNG SKA+AMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+A
Sbjct  219  SFAEIEGMYDRTITVNGVSKAYAMTGWRIGYIGAPEWITKACTKMQGQITSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F+ RRD +++  GE+EG K++ P+GAFY+F D S ++G 
Sbjct  279  TIAALKAPVSNIQY---MIDQFKNRRDLVLRLLGEIEGFKLNVPEGAFYVFPDISYFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G    T S+    YLL++A VA V G+AFGD+ CIRISYAAS   L+ A+ RI+++L
Sbjct  336  TLRGKEIKTASD-FSLYLLEEAGVATVTGEAFGDERCIRISYAASEQELREAIRRIKESL  394



>ref|WP_026976631.1| aspartate aminotransferase [Flavobacterium tegetincola]
Length=395

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 122/181 (67%), Gaps = 4/181 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM+++T+TVNG +KAFAMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+A
Sbjct  219  SIASIPGMFDQTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKMQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +       MV AF+ RRD +VK   ++ G+K++ P+GAFY+F D SSY+G 
Sbjct  279  TIAAVEADPSVLNE---MVGAFKSRRDLVVKLIQDIPGLKLNIPEGAFYVFPDVSSYFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     YLL +A VA V G+AFG+  C+R+SYA S   L  A  RI+KAL
Sbjct  336  TLNG-TEIKDATDFAMYLLAEANVASVTGEAFGNPNCLRLSYATSEDQLTEAFTRIKKAL  394

Query  246  L  244
            +
Sbjct  395  V  395



>ref|WP_026348612.1| aspartate aminotransferase [Eudoraea adriatica]
Length=394

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 118/177 (67%), Gaps = 4/177 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+ GM+ERT+TVNG SKAFAMTGWR+GYI  P+    AC K Q Q TSGA++I+Q++
Sbjct  219  SIASINGMYERTITVNGVSKAFAMTGWRIGYIGAPEWIAKACTKFQGQITSGANAIAQRS  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    M+  F +RRD L++  GE+ G  ++ P+GAFY+F D SSY+G 
Sbjct  279  TIEALNAPVSKIQF---MIDEFHKRRDLLLELLGEINGFSLNVPEGAFYVFPDISSYFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIR  256
             + G   + ++     YLL+ A VA V G+AFG+  CIRISYAAS   L+ AV+RI+
Sbjct  336  TLKG-TTIKNASDFALYLLENANVATVTGEAFGNPNCIRISYAASEDELREAVKRIK  391



>ref|WP_013869150.1| aspartate aminotransferase [Lacinutrix sp. 5H-3-7-4]
 gb|AEH00370.1| Aspartate transaminase [Lacinutrix sp. 5H-3-7-4]
Length=396

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A + GM+ERT+T+NG SKAFAMTGWR+GYI  P     ACNKIQ Q TSGA+ I+Q+A
Sbjct  220  SMAGVDGMFERTVTINGVSKAFAMTGWRIGYIGAPDWIARACNKIQGQITSGANCIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    M+  F+ERRD +++S   +EG K + P+GAFY+F D S ++G 
Sbjct  280  VITALNADASVVDY---MIDEFKERRDMILESLNSIEGFKTNTPEGAFYVFPDISYFFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             V G   + ++     +LL++A VA V G+AFG+  CIRISYAAS   ++ A+ RI++AL
Sbjct  337  TVKG-KTINNATDFSLFLLEEALVATVTGEAFGNPDCIRISYAASQEQIKEAIRRIKEAL  395



>ref|WP_008122897.1| aspartate aminotransferase [Prevotella timonensis]
 gb|EFA98060.1| aminotransferase, class I/II [Prevotella timonensis CRIS 5C-B1]
Length=397

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 119/184 (65%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  PGM ERT+ VNG SKA+AMTGWR+GYIA P+  V  CNK+Q Q TSG  SISQ+A
Sbjct  218  SIAQFPGMKERTIIVNGISKAYAMTGWRIGYIAAPEWIVKGCNKLQGQYTSGPCSISQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA     A  E    M +AF+ RRD +VK   ++ G+++ EP GAFYLF   + ++G 
Sbjct  278  AIAAYTQSQACVE---EMRQAFQRRRDLIVKLAKDIHGLEVIEPNGAFYLFPKCNYFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G+  + +S  L  YLL+KA VA V GDAFG+  C+R+SYA S   +Q A+ RI+ AL
Sbjct  335  STDGY-YIQNSTDLSMYLLEKAHVATVGGDAFGEPNCLRMSYATSDENIQEALRRIKNAL  393

Query  246  LTIR  235
              ++
Sbjct  394  EQLQ  397



>ref|WP_042345091.1| aspartate aminotransferase [Capnocytophaga canimorsus]
 emb|CEN48931.1| Aspartate aminotransferase A [Capnocytophaga canimorsus]
Length=395

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 124/180 (69%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA + GM++RT+TVNG SKA+AMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+A
Sbjct  219  SFAEIEGMYDRTITVNGVSKAYAMTGWRIGYIGAPEWITKACTKMQGQITSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F+ RRD +++  GE+EG K++ P+GAFY+F D S ++G 
Sbjct  279  TIAALKAPVSNIQY---MIDQFKNRRDLVLRLLGEIEGFKLNVPEGAFYVFPDISYFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G    T S+    YLL++A VA V G+AFGD+ CIRISYAAS   L  A+ RI+++L
Sbjct  336  TLRGKEIKTASD-FSLYLLEEAGVATVTGEAFGDERCIRISYAASEQELTEAIRRIKESL  394



>ref|WP_034664548.1| aspartate aminotransferase [Cellulophaga sp. E6(2014)]
 gb|KGK31727.1| aspartate aminotransferase [Cellulophaga sp. E6(2014)]
Length=396

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  P M++RT+TVNG +KAFAMTGWR+GYI  P +   ACNK+Q Q TSGA+ I+Q+A
Sbjct  220  SMAEFPDMFDRTVTVNGVAKAFAMTGWRIGYIGAPAYIARACNKLQGQVTSGANCIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV  F+ERR  ++    ++ G K +EP+GAFY+F D ++Y+G 
Sbjct  280  VITALLEPVSRIQY---MVDKFKERRKLILSLLQDIPGFKCNEPEGAFYVFPDVTAYFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +S     YLL+ A VA V GDAFG++ CIRISYAAS + +  A+ RI+KA+
Sbjct  337  TLNGV-KINNSSDFSMYLLETANVATVAGDAFGNNNCIRISYAASEAQITEALARIKKAV  395



>ref|WP_035651685.1| aspartate aminotransferase [Flavobacterium sp. Fl]
Length=396

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 118/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM +RT+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLDRTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ G+KI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVQAFHGRRDLVVGLLKEIPGIKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L  A+ RI++AL
Sbjct  336  TLKG-TEIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSNDILTEALRRIKEAL  394



>ref|WP_017497784.1| aspartate aminotransferase [Flavobacterium sp. WG21]
Length=396

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLEKTITVNGVAKAFAMTGYRIGYIGAPEFIAKACVKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVEADPSVLNH---MVQAFHTRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++AL
Sbjct  336  TLRG-TEIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSDDILKEALRRIKEAL  394



>ref|WP_015362480.1| aminotransferase class I /II [Nonlabens dokdonensis]
 gb|AGC76983.1| aminotransferase class I /II [Nonlabens dokdonensis DSW-6]
Length=395

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+P M++RT+T+NG SKAFAMTGWR+GYI  P     ACNK+Q Q TSG + I+Q+A
Sbjct  219  SMASIPSMYDRTVTINGVSKAFAMTGWRVGYIGAPTWIARACNKMQGQITSGTNCIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    M+ AF ERRD +++   E+EG K   P+GAFY+F D S+++G 
Sbjct  279  VITALEAPVSKIKY---MIDAFAERRDLILQLLSEIEGFKTDSPEGAFYVFPDVSAFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     +LL++A VA V GDAFG   CIRISYAAS   ++ A++RI++ L
Sbjct  336  TIKG-QKIENATDFSLFLLEEALVATVTGDAFGAPNCIRISYAASTEQIKEAMKRIKEVL  394



>ref|WP_024481675.1| aspartate aminotransferase [Cellulophaga baltica]
Length=396

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  P M++RT+TVNG +KAFAMTGWR+GYI  P +   ACNK+Q Q TSGA+ I+Q+A
Sbjct  220  SMAEFPDMFDRTVTVNGVAKAFAMTGWRIGYIGAPAYIARACNKLQGQVTSGANCIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV  F+ERR  ++    ++ G K +EP+GAFY+F D ++Y+G 
Sbjct  280  VITALLEPVSRIQY---MVDKFKERRKLILSLLQDIPGFKCNEPEGAFYVFPDVTAYFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +S     YLL+ A VA V GDAFG++ CIRISYAAS + +  A+ RI+KA+
Sbjct  337  TLNGV-KINNSSDFSMYLLEAANVATVAGDAFGNNNCIRISYAASEAQITEALARIKKAV  395



>ref|WP_025615820.1| aspartate aminotransferase [Cellulophaga baltica]
 gb|AIY13271.1| aspartate aminotransferase [Cellulophaga baltica NN016038]
Length=396

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  P M++RT+TVNG +KAFAMTGWR+GYI  P +   ACNK+Q Q TSGA+ I+Q+A
Sbjct  220  SMAEFPDMFDRTVTVNGVAKAFAMTGWRIGYIGAPAYIARACNKLQGQVTSGANCIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV  F+ERR  ++    ++ G K +EP+GAFY+F D ++Y+G 
Sbjct  280  VITALLEPVSRIQY---MVDKFKERRKLILSLLQDIPGFKCNEPEGAFYVFPDVTAYFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +S     YLL+ A VA V GDAFG++ CIRISYAAS + +  A+ RI+KA+
Sbjct  337  TLNGV-KINNSSDFSMYLLEAANVATVAGDAFGNNNCIRISYAASEAQITEALARIKKAV  395



>ref|WP_029447030.1| aspartate aminotransferase [Cellulophaga baltica]
 gb|AIZ41629.1| aspartate aminotransferase [Cellulophaga baltica 18]
Length=396

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  P M++RT+TVNG +KAFAMTGWR+GYI  P +   ACNK+Q Q TSGA+ I+Q+A
Sbjct  220  SMAEFPDMFDRTVTVNGVAKAFAMTGWRIGYIGAPAYIARACNKLQGQVTSGANCIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV  F+ERR  ++    ++ G K +EP+GAFY+F D ++Y+G 
Sbjct  280  VITALLEPVSRIQY---MVDKFKERRKLILSLLQDIPGFKCNEPEGAFYVFPDVTAYFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +S     YLL+ A VA V GDAFG++ CIRISYAAS + +  A+ RI+KA+
Sbjct  337  TLNGV-KINNSSDFSMYLLEAANVATVAGDAFGNNNCIRISYAASEAQITEALARIKKAV  395



>ref|WP_026724278.1| aspartate aminotransferase [Flavobacterium sasangense]
Length=394

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 118/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM ERT+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIGSIPGMLERTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV AF+ RRD +V    E+ G K++ P+GAFY+F D SSY+G 
Sbjct  278  TITAVEADPSVLNE---MVTAFKNRRDLVVGLVKEIPGFKLNVPEGAFYVFPDVSSYFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     +LL +A VA V GDAFG+  CIR SYA S + L+ A+ RI++A+
Sbjct  335  TLKG-QLIKDATDFSMFLLAEANVATVTGDAFGNPNCIRFSYATSEALLREAMRRIKEAV  393



>ref|WP_038266081.1| aspartate aminotransferase [Zhouia amylolytica]
 gb|ETN94869.1| aspartate/tyrosine/aromatic aminotransferase [Zhouia amylolytica 
AD3]
Length=395

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A + GM++RT+TVNG SKAFAMTGWR+G+I  P+    ACNKIQ Q TSGA++I Q+A
Sbjct  219  SIAEIDGMYDRTITVNGVSKAFAMTGWRIGFIGAPEFVARACNKIQGQVTSGANAIGQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F++RRD ++    E+EG K++ P+GAFY+F D SS++G 
Sbjct  279  TIAALDAPVSKIQF---MIDEFKKRRDLVLGLLEEIEGFKLNVPEGAFYVFPDISSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             V G   + ++      LL++A VA V G+AFGD  CIRISYAAS   L+ A+ RI++AL
Sbjct  336  TVKG-RKINNASDFAMLLLEEANVATVTGEAFGDPNCIRISYAASEKELREAIGRIKEAL  394



>ref|WP_026811714.1| aspartate aminotransferase [Arenibacter latericius]
Length=394

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A++ GM++RT+TVNG SKAFAMTGWR+GYI GP+    AC K Q Q+TSGA++I+Q+A
Sbjct  219  SIANIDGMYDRTVTVNGVSKAFAMTGWRIGYIGGPEWIAKACTKFQGQNTSGANAIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F +RRD +++  GE+EG  ++ P+GAFY+F D SS++G 
Sbjct  279  TIAALDAPVSSIKF---MIDEFHKRRDIVLELLGEIEGFNLNVPEGAFYVFPDISSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL+ A VA V G+AFG+  CIRISYAAS   L+ A+ RI+  L
Sbjct  336  TLNG-TTINNASDFSLYLLEHANVATVTGEAFGNKNCIRISYAASEKELREAIARIKAVL  394



>ref|WP_016777057.1| aspartate aminotransferase [Anaerophaga thermohalophila]
Length=398

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 119/184 (65%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            + AS PGM ER + VNG SK +AMTGWRLGYIA P    +AC+++Q Q TSG S+ISQKA
Sbjct  219  TLASFPGMQERVVIVNGVSKGYAMTGWRLGYIAAPDWIASACSRLQGQYTSGTSTISQKA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+            MVKAFR RRD +VK   E+ G+K + P+GAFY+F D SS++G 
Sbjct  279  ALAAINGPLDDTRK---MVKAFRRRRDLVVKLANEIPGLKNNNPEGAFYMFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
                   + +S  L  YLL++  VA V G AFG DTCIR SYA+S   L+ A++RI++ L
Sbjct  336  SYKN-KTINNSNDLSFYLLEEVHVATVTGTAFGCDTCIRFSYASSDEILREAMKRIKEGL  394

Query  246  LTIR  235
              ++
Sbjct  395  ARLK  398



>ref|WP_033194606.1| aspartate aminotransferase [Flavobacteriaceae bacterium S85]
Length=376

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 124/181 (69%), Gaps = 4/181 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A++P M++RT+TVNG +K FAMTGWR+G+I  P+    AC K+Q Q TSG + I+Q+A
Sbjct  200  SIAAIPSMYDRTITVNGLAKGFAMTGWRIGFIGAPEWIAKACTKMQGQITSGTNCIAQRA  259

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV  F++RRD +++  GE+EGVK++ P+GAFY+F D S+++G 
Sbjct  260  AITALSEPVSRIQY---MVDEFQKRRDMMLELLGEIEGVKLNVPKGAFYIFPDVSAFFGK  316

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++      LL++A VA V G+AFG  TCIRISYAAS + L+ AV+RI++ L
Sbjct  317  TIKG-KEIQNATDFSMLLLEEANVATVTGEAFGAPTCIRISYAASEAQLREAVKRIKEVL  375

Query  246  L  244
            +
Sbjct  376  V  376



>dbj|GAE19495.1| aspartate aminotransferase [Bacteroides pyogenes DSM 20611 = 
JCM 6294]
Length=218

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 116/184 (63%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A LPGM ERT+ VNG SKA+AMTGWR+G+IA P+  V ACNK+Q Q TSG  S+SQK 
Sbjct  39   SIAQLPGMKERTVIVNGVSKAYAMTGWRIGFIAAPEWIVKACNKLQGQYTSGPCSVSQK-  97

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              AA        E V  M KAF  RRD +V    E+ G +++ PQGAFYLF    S++G 
Sbjct  98   --AAEAAYTGTQEPVREMQKAFERRRDLIVGLAKEVPGFEVNVPQGAFYLFPKCDSFFG-  154

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            + AG   + DS+ L  YLL+ A VA V G +FG   CIR+SYA S   +  A+ RI++AL
Sbjct  155  KSAGDRVIKDSDDLALYLLETAHVACVGGASFGAPDCIRMSYATSDENIVEAIRRIKEAL  214

Query  246  LTIR  235
              ++
Sbjct  215  AKLK  218



>ref|WP_025071956.1| aspartate aminotransferase [Prevotella timonensis]
Length=397

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 119/184 (65%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  PGM ERT+ VNG SKA+AMTGWR+GYIA P+  V  CNK+Q Q TSG  SISQ+A
Sbjct  218  SIAQFPGMKERTIIVNGISKAYAMTGWRIGYIAAPEWIVKGCNKLQGQYTSGPCSISQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA     A  E    M +AF+ RRD +VK   ++ G+++ EP+GAFYLF   + ++G 
Sbjct  278  AIAAYTQSQACVE---EMRQAFQRRRDLIVKLAKDIHGLEVIEPKGAFYLFPKCNYFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G+  + +S  L  YLL+KA VA V GDAFG+  C+R+SYA S   +Q A  RI+ AL
Sbjct  335  STDGY-YIKNSTDLSMYLLEKAHVATVGGDAFGEPNCLRMSYATSDENIQEAFRRIKNAL  393

Query  246  LTIR  235
              ++
Sbjct  394  EQLQ  397



>ref|WP_020535732.1| hypothetical protein [Lewinella cohaerens]
Length=402

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 113/180 (63%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  ++P + +RT+TVNGF+K +AMTGWRLGYI  P     AC KIQ Q TSGA++ +QKA
Sbjct  223  SIGTIPSVKDRTITVNGFAKGYAMTGWRLGYIGAPTVIAEACAKIQGQFTSGANAFAQKA  282

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
               AL    +       M  AF +RR  ++     + G+K++ PQGAFY+F D +SYYG 
Sbjct  283  ATHALEADMSPTH---AMRDAFEKRRQVIIDGLEGIPGMKVNRPQGAFYIFPDVTSYYGK  339

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +   F  +   + +C YLL KA VA V G AFG   CIRISYAAS  TL+ A++RI+ AL
Sbjct  340  KSGDF-EINSDDDVCEYLLQKAYVATVSGGAFGTPGCIRISYAASEETLKEAIQRIKDAL  398



>ref|WP_040471430.1| aspartate aminotransferase [Flavobacteria bacterium MS024-2A]
Length=376

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A++P +++RT+TVNG +KAFAMTGWR+GYI  P+    ACNK+Q Q TSGA+ I+Q+A
Sbjct  200  SIAAIPELYDRTITVNGVAKAFAMTGWRIGYIGAPQWIAKACNKMQGQITSGANCIAQRA  259

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F +RR  ++     + G K+++PQGAFY+F D S Y+G 
Sbjct  260  TIAALEAPVSNIQY---MIDEFAKRRVMIIDLLSAIPGFKMNKPQGAFYVFPDVSYYFGK  316

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   ++ +     +LL++A VA V G+AFG+D CIRISYAAS+  +Q AV+RI KAL
Sbjct  317  TIQG-KTISTASDFSMFLLEEAHVATVTGEAFGNDACIRISYAASVENIQEAVKRIAKAL  375



>gb|EEG41973.1| aminotransferase class I and II [Flavobacteria bacterium MS024-2A]
Length=394

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A++P +++RT+TVNG +KAFAMTGWR+GYI  P+    ACNK+Q Q TSGA+ I+Q+A
Sbjct  218  SIAAIPELYDRTITVNGVAKAFAMTGWRIGYIGAPQWIAKACNKMQGQITSGANCIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F +RR  ++     + G K+++PQGAFY+F D S Y+G 
Sbjct  278  TIAALEAPVSNIQY---MIDEFAKRRVMIIDLLSAIPGFKMNKPQGAFYVFPDVSYYFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   ++ +     +LL++A VA V G+AFG+D CIRISYAAS+  +Q AV+RI KAL
Sbjct  335  TIQG-KTISTASDFSMFLLEEAHVATVTGEAFGNDACIRISYAASVENIQEAVKRIAKAL  393



>ref|WP_035123291.1| aspartate aminotransferase [Flavobacterium aquatile]
 gb|KGD69257.1| aspartate aminotransferase [Flavobacterium aquatile LMG 4008]
Length=395

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM+ERT+TVNG +KAFAMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+A
Sbjct  219  SIASIPGMFERTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKMQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV AF+ RRD +V    E+ G+KI+ P+GAFY+F D SS++  
Sbjct  279  TITAVDADPSVLNE---MVAAFKSRRDLVVGLIKEIPGLKINVPEGAFYVFPDVSSFFRK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + +++    YLL +A VA V GDAFG+  CIR SYA S   L  A++RI++ L
Sbjct  336  TLRG-TLINNADDFSMYLLSEANVATVTGDAFGNPNCIRFSYATSEELLTEAMKRIKEVL  394



>ref|WP_008631434.1| Aspartate aminotransferase [Mariniradius saccharolyticus]
 gb|EMS31406.1| Aspartate aminotransferase [Mariniradius saccharolyticus AK6]
Length=400

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S ASLPGM+ERT+TVNGFSK +AMTGWR+GYI  P     AC K+Q Q TSG + I+Q+A
Sbjct  221  SIASLPGMFERTITVNGFSKGYAMTGWRVGYICAPVFIAKACEKMQGQFTSGGTGIAQRA  280

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+       +    M KA+  RRD ++    ++ G+K   P+GAFY F D ++++G 
Sbjct  281  ALAAITGDQTPSK---EMEKAYLRRRDLVLGLLKDIPGIKTHIPEGAFYFFPDVTAFFGK  337

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               GF  V +++ LC Y+L+KA V+LV G+AFG   C+R+SYAAS   L  A++R++ AL
Sbjct  338  SADGF-KVNNADDLCLYILEKANVSLVTGEAFGAPNCVRLSYAASDEELVEALKRMKSAL  396



>ref|WP_008867926.1| aspartate aminotransferase [Flavobacteria bacterium MS024-3C]
 gb|EEG42944.1| aminotransferase class I and II [Flavobacteria bacterium MS024-3C]
Length=397

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 123/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A +PGM++RT+TVNG SKAFAMTGWR+GYI  P+    AC K Q Q+TSGA+SI+Q+A
Sbjct  220  SIAGIPGMYDRTITVNGVSKAFAMTGWRIGYIGAPEWIAKACTKFQGQNTSGANSIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +       M++AF +RRD +++  GE+ G +++ P+GAFY+F D S ++G 
Sbjct  280  TIAALKAPVSSISH---MIEAFHQRRDLVLELLGEIPGFRLNIPEGAFYVFPDVSEFFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     +LL++A VA V G AFG+  CIRISYAAS   L+ A+ RI+KA+
Sbjct  337  TLKG-TLIKDASDFAIFLLEEALVATVTGAAFGNPNCIRISYAASEEALREAMARIKKAV  395



>ref|WP_009415879.1| putative aspartate aminotransferase [Capnocytophaga sp. oral 
taxon 332]
 gb|EKY10229.1| putative aspartate aminotransferase [Capnocytophaga sp. oral 
taxon 332 str. F0381]
Length=396

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 125/180 (69%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A + G+++RT+TVNG SKAFAMTGWR+GY+A P+    ACNK+Q Q TSG ++I+Q+A
Sbjct  219  SMAEIDGLYDRTITVNGLSKAFAMTGWRIGYLAAPEWIAKACNKVQGQVTSGTNAIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    M+  F +RR+ +++  GE++G+K++ P+GAFY+F D SS++G 
Sbjct  279  SIVALRAPKSKIQY---MIDEFLKRRNLVLQLLGEIKGLKLNVPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL++A VA V G+AFGD  CIR+SYAAS   L+ A+ RI+++L
Sbjct  336  TLRG-RTINNASDFSLYLLEEAGVATVTGEAFGDPKCIRLSYAASEEELRKAIARIKESL  394



>ref|WP_045972938.1| aspartate aminotransferase [Flavobacterium sp. 316]
 gb|KIX19664.1| aspartate aminotransferase [Flavobacterium sp. 316]
Length=394

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM +RT+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIGSIPGMLDRTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+            MV+AF +RRD +V    E+ G+KI+ P+GAFY+F D S Y+G 
Sbjct  278  TIAAVEADPKVLNY---MVEAFHKRRDLVVGLIQEIPGLKINVPEGAFYVFPDVSDYFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL +A VA V G+AFG+  CIR SYA S   L+ A++RI++AL
Sbjct  335  TLKG-TKIENATDFSMYLLAEANVATVTGEAFGNPNCIRFSYATSEELLKEALKRIKEAL  393



>ref|WP_002989614.1| MULTISPECIES: aspartate aminotransferase [Myroides]
 gb|EHQ42976.1| aminotransferase class I and II [Myroides odoratus DSM 2801]
 gb|EKB07285.1| hypothetical protein HMPREF9716_02008 [Myroides [odoratimimus] 
CIP 103059]
Length=396

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+  + +RT+TVNG SKAFAMTG+R+GYI  P+    AC K+Q Q TSGA++I+Q+A
Sbjct  220  SIGSIGNLLDRTITVNGISKAFAMTGYRIGYIGAPEFIAKACAKMQGQVTSGANTIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +  +    MV AF+ RRD +V    E+ GVK++ P GAFYLF D SS++G 
Sbjct  280  TITAVNADPSVLK---DMVHAFKNRRDLVVNLLREIPGVKVNVPDGAFYLFPDVSSFFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++  L  YLLDKA VA V GDAFG+  CIR+SYA S   L  A++R+++AL
Sbjct  337  TLQGV-TINNANDLSMYLLDKAYVATVTGDAFGNPNCIRLSYATSEDQLTEALKRMKEAL  395



>ref|WP_044402523.1| aspartate aminotransferase [Lacinutrix sp. Hel_I_90]
Length=396

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+ GM++RT+TVNG SKAFAMTGWR+GYI  P     ACNK+Q Q TSG + I+Q+A
Sbjct  220  SMASIAGMFDRTITVNGVSKAFAMTGWRVGYIGAPDWIARACNKMQGQITSGTNCIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    M+  F+ERRD +++   ++EG + + P+GAFY+F + SS++G 
Sbjct  280  VITALNAEPSTVKY---MIDEFKERRDLVLELLNDIEGFQTNIPEGAFYVFPNVSSFFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL++A VA V GDAFG+  CIRISYAAS   ++ AV+R+++ L
Sbjct  337  TLRG-KTINNANDFSLYLLEEALVATVTGDAFGNPNCIRISYAASQEQIKEAVKRVKEVL  395



>ref|WP_044226184.1| aspartate aminotransferase [Phaeodactylibacter xiamenensis]
 gb|KGE86122.1| aspartate aminotransferase [Phaeodactylibacter xiamenensis]
Length=402

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 115/180 (64%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S   + +RT+TVNGFSK FAMTGWRLGYI  P+   +AC KIQ Q TSGA++  Q  
Sbjct  223  SIGSFENVKDRTVTVNGFSKGFAMTGWRLGYIGAPQWIASACAKIQGQFTSGATAFGQ--  280

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +A      +       M  AF +RRD +++   ++ G+K+++PQGAFY+F D S+Y+G 
Sbjct  281  -MAGAHALTSDMTPTHEMKTAFLQRRDMMIEELSKISGMKVNKPQGAFYIFPDISAYFGK  339

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +   F A+ D++  C YLL +A VA+V G AFG   C RISYAAS + L+ AV+RI  A+
Sbjct  340  KAGDF-AINDADDFCEYLLKEAHVAVVTGSAFGAPECFRISYAASETELREAVKRIAAAV  398



>ref|WP_036928356.1| aspartate aminotransferase [Prevotella timonensis]
 gb|KGI21603.1| aspartate aminotransferase [Prevotella timonensis S9-PR14]
Length=397

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 119/184 (65%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  PGM ERT+ VNG SKA+AMTGWR+GYIA P+  V  CNK+Q Q TSG  SISQ+A
Sbjct  218  SIAQFPGMKERTIIVNGISKAYAMTGWRIGYIAAPEWIVKGCNKLQGQYTSGPCSISQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA     A  E    M +AF+ RRD +VK   ++ G+++ EP+GAFY+F   + ++G 
Sbjct  278  AIAAYTQSQACVE---EMRQAFQRRRDLIVKLAKDIHGLEVIEPKGAFYIFPKCNYFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G+  + +S  L  YLL+KA VA V GDAFG+  C+R+SYA S   +Q A  RI+ AL
Sbjct  335  STDGY-YIKNSTDLSMYLLEKAHVATVGGDAFGEPNCLRMSYATSDENIQEAFRRIKNAL  393

Query  246  LTIR  235
              ++
Sbjct  394  EQLQ  397



>ref|WP_021855241.1| aspartate aminotransferase [Prevotella sp. CAG:255]
 emb|CCX68015.1| aspartate aminotransferase [Prevotella sp. CAG:255]
Length=397

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 118/184 (64%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A +PGM ERT+ VNG SKA+AMTGWR+GYIA P+  V  CNK+Q Q TSG  S+SQK 
Sbjct  218  SIALVPGMKERTIIVNGVSKAYAMTGWRIGYIAAPEWIVKGCNKLQGQYTSGPCSVSQK-  276

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              AA+    A  E V TM +AF  RRD +VK   E+ G++++ P+GAFYLF   S+++G 
Sbjct  277  --AAVEAYTASQECVETMRQAFHRRRDLIVKLAKEIPGLEVNVPEGAFYLFPKCSNFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G   +  S  L  YLL+ A VA V GDAFGD  C R+SYA S   +  A+ RI++AL
Sbjct  335  SYEGH-VINTSTDLAMYLLEVAHVATVAGDAFGDPACFRMSYATSDENICEAMRRIKEAL  393

Query  246  LTIR  235
              ++
Sbjct  394  AKLK  397



>ref|WP_022429991.1| putative aspartate transaminase [Prevotella stercorea CAG:629]
 emb|CDE30587.1| putative aspartate transaminase [Prevotella stercorea CAG:629]
Length=397

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 115/184 (63%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  PGM ERT+ VNG SKA+AMTGWR+G+IA P+  V  CNK+Q Q TSG  S+SQK 
Sbjct  218  SIAQFPGMKERTIIVNGVSKAYAMTGWRIGFIAAPEWIVKGCNKLQGQYTSGPCSVSQK-  276

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              AA        E V TM KAF  RRD +VK   E+ G++++ PQGAFYLF   S +YG 
Sbjct  277  --AAEAAYTTSQECVETMRKAFERRRDLIVKLAKEIPGLEVNCPQGAFYLFPKCSGFYGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G   + +S  L  +LL++  VA V GDAFGD  C R+SYA S   ++ A+ RI++ L
Sbjct  335  SYEG-KTINNSTDLAMFLLEEGHVATVGGDAFGDPECFRMSYATSDDNIREAMRRIKETL  393

Query  246  LTIR  235
              ++
Sbjct  394  AKLK  397



>ref|WP_026707658.1| aspartate aminotransferase [Flavobacterium frigidarium]
Length=395

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM+++T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S +Q+A
Sbjct  218  SIGSIPGMFDKTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSPAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +  +    MV AF  RRD +V    E+ GVKI+ P+GAFY+F D SS++G 
Sbjct  278  TITAVDADPSVLKH---MVDAFHSRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSSFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++  L  YLL +A VA V GDAFG+  CIR SYA S   L+ A++RI++AL
Sbjct  335  TLKG-TEIKNAMDLSMYLLAEANVATVTGDAFGNPDCIRFSYATSDDILKEALKRIKEAL  393



>ref|WP_021990972.1| aspartate aminotransferase [Prevotella sp. CAG:1092]
 emb|CCZ12161.1| aspartate aminotransferase [Prevotella sp. CAG:1092]
Length=196

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 117/184 (64%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A   GM ERT+ VNG SKA+AMTGWR+GYIA P+  V  CNK+Q Q TSG  S+SQK 
Sbjct  17   SIAKAEGMRERTIIVNGVSKAYAMTGWRIGYIAAPEWIVKGCNKLQGQYTSGPCSVSQK-  75

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              AA          V TM +AF+ RRD +V+   ++ G++++ P+GAFYLF   SS+YG 
Sbjct  76   --AAEAAYTMDQTCVETMRQAFQRRRDLIVELAKDIPGLEVNVPEGAFYLFPKCSSFYG-  132

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +  G   + +S  L  +LL++  VA V GDAFGD  C R+SYA S   ++ A++RI++ L
Sbjct  133  KACGDKVINNSTDLAMFLLEEGHVATVGGDAFGDPECFRMSYATSDDNIREAMKRIKETL  192

Query  246  LTIR  235
              ++
Sbjct  193  AKLK  196



>ref|WP_024283330.1| aspartate aminotransferase [Algoriphagus marincola]
Length=400

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 117/180 (65%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S ASLPGM++RT+TVNGFSK +AMTGWR+GYI  P     AC KIQ Q TSG + I+Q+A
Sbjct  221  SIASLPGMFDRTITVNGFSKGYAMTGWRVGYICAPLAIAKACEKIQGQFTSGGTGIAQRA  280

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+       +    M +A+  RR  ++    E+ G+K   P+GAFY F D ++++G 
Sbjct  281  ALAAISGDQTPSK---EMAEAYFNRRQLVLDLLQEIPGIKTHIPEGAFYFFPDVTAFFGK  337

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G   V D++ LC YLL+ A V+LV G AFG   C+R+SYAAS   L+ A++RI+KAL
Sbjct  338  SAHGH-TVKDADDLCLYLLEVANVSLVTGGAFGAPNCVRLSYAASEDELKEALKRIKKAL  396



>ref|WP_013997944.1| aspartate aminotransferase [Capnocytophaga canimorsus]
 gb|AEK23960.1| Transaminase A [Capnocytophaga canimorsus Cc5]
Length=395

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 122/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A + GM+ERT+TVNG SKAFAMTGWR+GYI  P+    AC K+Q Q TSGA++I+Q+A
Sbjct  219  SIAEIDGMFERTITVNGVSKAFAMTGWRIGYIGAPEWITKACTKMQGQITSGANAIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +  +    M+  F++RRD +++   E+EG K++ P+GAFY+F D S ++G 
Sbjct  279  TIAAVKAPVSKIQY---MIDEFKKRRDLVLELLSEIEGFKLNIPEGAFYVFPDISYFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G    T S+    +LL+ A VA V G+AFGD+ CIRISYA S   L+ A+ RI++AL
Sbjct  336  TLKGQKIETASD-FSLFLLENAHVATVTGEAFGDNNCIRISYATSEKELREAIHRIKEAL  394



>ref|WP_027395725.1| aspartate aminotransferase [Aquimarina latercula]
Length=395

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 116/180 (64%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A    M+ERT+TVNG +KAFAMTGWR+GYI  PK    ACNK+Q Q TSGA+ I+Q+A
Sbjct  219  SMAQFDDMYERTVTVNGVAKAFAMTGWRIGYIGAPKAIARACNKMQGQVTSGANCIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV  F+ RR  ++    E+ G + +EP+GAFY+F D S Y+G 
Sbjct  279  VITALEAPVSKIQY---MVDEFKNRRKLILDLLAEIPGFECNEPEGAFYVFPDVSYYFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     +LL++A VA V GDAFG+  CIRISYAAS   ++ A+ RI+KAL
Sbjct  336  TING-NIIKNASDFSMFLLEQANVATVTGDAFGNGNCIRISYAASTEQIKEAINRIKKAL  394



>ref|WP_004568839.1| aspartate aminotransferase [Polaribacter irgensii]
 gb|EAR11758.1| putative aspartate aminotransferase [Polaribacter irgensii 23-P]
Length=376

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA++  M++RT+TVNG +KAFAMTGWR+GYI  P+    AC K+Q Q TSGA+ I+Q+A
Sbjct  200  SFAAIENMYDRTITVNGLAKAFAMTGWRIGYIGAPEWIAKACTKMQGQVTSGANCIAQRA  259

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +  +    MV  FR RRD +V    E++G +++ P+GAFY+F D S+++G 
Sbjct  260  AITAVLAPVSKIQY---MVDEFRARRDIVVDLLREIDGFRVNIPEGAFYVFPDISAFFGK  316

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             ++G   + ++     +LL+KA VA V GDAFG   CIR+SYAAS   L+ A++RI+ AL
Sbjct  317  TISGLK-IENANDFSLFLLEKANVATVTGDAFGAPNCIRMSYAASEVQLREAIKRIKNAL  375



>ref|WP_026946928.1| aspartate aminotransferase [Algoriphagus marincola]
Length=400

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 118/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S ASLPGM++RT+TVNGFSK +AMTGWR+GYI  P     AC KIQ Q TSG + I+Q+A
Sbjct  221  SIASLPGMFDRTITVNGFSKGYAMTGWRVGYICAPLAIAKACEKIQGQFTSGGTGIAQRA  280

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +  +    M +A+  RR  ++    E+ G+K   P+GAFY F D ++++G 
Sbjct  281  ALAAISGDQSPSK---EMAEAYFNRRQLVLDLLQEIPGIKTHIPEGAFYFFPDVTAFFGK  337

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G   V D++ LC YLL+ A V+LV G AFG   C+R+SYAAS   L+ A++RI+KAL
Sbjct  338  TAHGH-TVKDADDLCLYLLEVANVSLVTGGAFGAPNCVRLSYAASEDELKEALKRIKKAL  396



>ref|WP_036788341.1| aspartate aminotransferase [Polaribacter sp. Hel1_33_49]
Length=376

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA++  M++RT+TVNG +KAFAMTGWR+GYI  P+    AC K+Q Q TSG + I+Q+A
Sbjct  200  SFAAIESMYDRTITVNGLAKAFAMTGWRIGYIGAPEWIAKACTKMQGQITSGTNCIAQRA  259

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +  +    MV  F+ RRD ++    E++G K++ P+GAFY+F D S+Y+G 
Sbjct  260  AITAVLAPVSKIQF---MVDEFKTRRDIIIGLLREIDGFKVNVPEGAFYVFPDISAYFGK  316

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     ++L+KA VA V GDAFG   CIRISYAAS   ++ A++RI+KAL
Sbjct  317  SIDGI-KIENASDFSLFILEKANVATVTGDAFGAPNCIRISYAASELQIREAIKRIKKAL  375



>ref|WP_027886157.1| aspartate aminotransferase [Mesonia mobilis]
Length=396

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A    M++RT+TVNG SKAFAMTGWR+GYI  P++   ACNKIQ Q TSGA+ I+Q+A
Sbjct  220  SMAQFDDMYDRTVTVNGVSKAFAMTGWRIGYIGAPEYIARACNKIQGQITSGANCIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    M+  F+ERR  ++    E+EG K +EP+GAFY+F + S+ +G 
Sbjct  280  TITALKAPVSKIQY---MIDKFKERRTLILDLLNEVEGFKCNEPEGAFYVFPNVSALFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G   + ++  L  YLL++AQVA V G+AFG+  CIRISYAAS   ++ A+ +I++AL
Sbjct  337  TFKG-NKIENATDLSMYLLEEAQVATVTGEAFGNPDCIRISYAASEDDIKNAIAQIKEAL  395



>ref|WP_035635398.1| aspartate aminotransferase [Flavobacterium sp. EM1308]
 gb|KFC60107.1| aspartate aminotransferase [Flavobacterium sp. EM1308]
Length=401

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 118/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  219  SIGSIPGMLEKTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ G+KI+ P+GAFY+F D SS++G 
Sbjct  279  TITAVDADPSVLNH---MVQAFHSRRDLVVGLLKEIPGIKINSPEGAFYVFPDVSSFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     YLL +A VA V GDAFG+  CIR SYA S   L+ A+ RI++A+
Sbjct  336  TLKG-TLIKDANDFSMYLLAEACVATVTGDAFGNPNCIRFSYATSEELLKEALRRIKEAV  394



>ref|WP_025572910.1| aspartate aminotransferase [Flavobacterium sp. JGI 0001001-D01]
Length=396

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 117/180 (65%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S+PGM E+T+TVNG +KAFAMTG+R+GYI  P+    AC KIQ Q TSGA+S++Q+A
Sbjct  219  SIGSIPGMLEKTITVNGVAKAFAMTGYRIGYIGAPEFIAKACTKIQGQVTSGANSVAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV+AF  RRD +V    E+ GVKI+ P+GAFY+F D S ++G 
Sbjct  279  TITAVDADPSVLNE---MVQAFHGRRDLVVGLLKEIPGVKINVPEGAFYVFPDVSYFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+  +  YLL +A VA V GDAFG+  CIR SYA S   L  A+ RI++AL
Sbjct  336  TLKGH-EIKDANDVSMYLLAEANVATVTGDAFGNPNCIRFSYATSNDILTEALRRIKEAL  394



>gb|KGL61505.1| aspartate aminotransferase [Polaribacter sp. Hel1_33_49]
Length=395

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            SFA++  M++RT+TVNG +KAFAMTGWR+GYI  P+    AC K+Q Q TSG + I+Q+A
Sbjct  219  SFAAIESMYDRTITVNGLAKAFAMTGWRIGYIGAPEWIAKACTKMQGQITSGTNCIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +  +    MV  F+ RRD ++    E++G K++ P+GAFY+F D S+Y+G 
Sbjct  279  AITAVLAPVSKIQF---MVDEFKTRRDIIIGLLREIDGFKVNVPEGAFYVFPDISAYFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     ++L+KA VA V GDAFG   CIRISYAAS   ++ A++RI+KAL
Sbjct  336  SIDGI-KIENASDFSLFILEKANVATVTGDAFGAPNCIRISYAASELQIREAIKRIKKAL  394



>ref|WP_026450535.1| aspartate aminotransferase [Aequorivita capsosiphonis]
Length=395

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 123/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A    M++RT+ VNG SKAF+MTGWR+GYI GP+    ACNK+Q Q TSGA+ I+Q+A
Sbjct  219  SMAEFEDMYDRTVVVNGVSKAFSMTGWRIGYIGGPEWIARACNKMQGQVTSGANCIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV AF+ERR  ++    E+EG K ++P+GAFY+F D S ++G 
Sbjct  279  AITALENPPSKIKF---MVDAFKERRKLILGLLSEIEGFKTNQPEGAFYVFPDISYFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G    T S+ L  YLL++A+VA V G+AFGD  CIR+SYAAS + ++ A++RI++A+
Sbjct  336  TLRGKNINTASD-LSLYLLEEAKVATVTGEAFGDPNCIRLSYAASETDIKEAIKRIKEAV  394



>ref|WP_013620221.1| MULTISPECIES: aspartate aminotransferase [Cellulophaga]
 gb|ADY28473.1| Aspartate transaminase [Cellulophaga lytica DSM 7489]
 gb|EWH11816.1| aspartate transaminase [Cellulophaga geojensis KL-A]
 gb|AIM59527.1| aspartate aminotransferase [Cellulophaga lytica]
Length=394

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A + GM+ERT+TVNG SKAFAMTGWR+G+I  P+    AC K Q Q+TSGA++I+Q+A
Sbjct  219  SIAGIDGMYERTITVNGVSKAFAMTGWRIGFIGAPEFIAKACTKFQGQNTSGANAIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AAL    +  +    M+  F +RRD +++  G++EG  ++ P+GAFY+F D S+++G 
Sbjct  279  TIAALEAPVSKIQF---MIDEFHKRRDLVLELLGQIEGFNLNVPEGAFYVFPDISAFFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++  L  YLL+ A VA V G+AFG+  CIRISYAAS   L+ A+ RI+  L
Sbjct  336  TLNG-TTINNASDLSMYLLENANVATVTGEAFGNPNCIRISYAASEKELKEAISRIKAVL  394



>ref|WP_008256239.1| aspartate aminotransferase [Flavobacteria bacterium BAL38]
 gb|EAZ95512.1| putative aspartate aminotransferase [Flavobacteria bacterium 
BAL38]
Length=394

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 118/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM ERT+TVNG +KAFAMTGWR+GYI  P+    AC KIQ Q TSGA+SI+Q+A
Sbjct  218  SIASIPGMLERTITVNGVAKAFAMTGWRIGYIGAPEFIAKACTKIQGQVTSGANSIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + A+    +       MV AF+ RRD +V    ++ G K++ P+GAFY+F D S Y+G 
Sbjct  278  TITAVEADPSVLNE---MVSAFKNRRDLVVGLVNQIPGFKLNVPEGAFYVFPDVSFYFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     +LL +A VA V GDAFG+  CIR SYA S + L  A++RI++A+
Sbjct  335  TIKG-TEIKNATDFSMFLLAEANVATVTGDAFGNPNCIRFSYATSEALLTEAMKRIKEAV  393



>gb|EHJ36817.1| putative aspartate transaminase [Prevotella stercorea DSM 18206]
Length=379

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 115/184 (63%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  PGM ERT+ VNG SKA+AMTGWR+G+IA P+  V  CNK+Q Q TSG  S+SQK 
Sbjct  200  SIAQFPGMKERTIIVNGVSKAYAMTGWRIGFIAAPEWIVKGCNKLQGQYTSGPCSVSQK-  258

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              AA        E V TM KAF  RRD +VK   E+ G++++ PQGAFYLF   S +YG 
Sbjct  259  --AAEAAYTTSQECVETMRKAFERRRDLIVKLAKEIPGLEVNCPQGAFYLFPKCSGFYGK  316

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G   + +S  L  +LL++  VA V GDAFGD  C R+SYA S   ++ A+ RI++ L
Sbjct  317  CYKG-KTINNSTDLAMFLLEEGHVATVGGDAFGDPECFRMSYATSDDNIREAMRRIKETL  375

Query  246  LTIR  235
              ++
Sbjct  376  AKLK  379



>ref|WP_026718238.1| aspartate aminotransferase [Flavobacterium gelidilacus]
Length=396

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 116/180 (64%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S AS+PGM+ERT+TVNG +KAFAMTGWR+GYI   +    AC K+Q Q TSGA+SI+Q+A
Sbjct  220  SIASIPGMFERTITVNGVAKAFAMTGWRIGYIGASEIIAKACTKMQGQVTSGANSIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+            MV AF+ RR+ +V    E+ G+KI+ P+GAFY+F D S Y+G 
Sbjct  280  TIAAVDADPKVLNE---MVSAFKSRRNLVVGLIQEIPGLKINSPEGAFYVFPDVSHYFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + D+     YLL +A VA V G+AFG+  CIR SYA S   L  A+ RI+ AL
Sbjct  337  TLKG-TEIKDANDFAMYLLSEANVATVTGEAFGNPNCIRFSYATSEELLTEAMRRIKDAL  395



>ref|WP_044164400.1| aspartate aminotransferase [Bacteroides reticulotermitis]
 dbj|GAE85343.1| aspartate aminotransferase [Bacteroides reticulotermitis JCM 
10512]
Length=397

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 114/184 (62%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  PGM ERT+ VNG SKA+AMTGWR+G+IAGP   V ACNK+Q Q TSG  S+SQK 
Sbjct  218  SIAQFPGMKERTVIVNGVSKAYAMTGWRIGFIAGPDWLVKACNKLQGQYTSGPCSVSQK-  276

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              AA        E V  M KAF  RRD +V+   E+ G +++ PQGAFYLF    SY+G 
Sbjct  277  --AAEAAYTGTQEPVKEMQKAFERRRDLIVELAKEVPGFEVNVPQGAFYLFPKCDSYFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G   V DS+ L  YLL +A VA V G +FG   CIR+SYA S   +  A+ RI++AL
Sbjct  335  SF-GDQVVKDSDDLAMYLLGEAHVACVGGTSFGAPDCIRMSYATSDENIVEAIRRIKEAL  393

Query  246  LTIR  235
              ++
Sbjct  394  AKLK  397



>ref|WP_040596931.1| aspartate aminotransferase [Prevotella stercorea]
Length=397

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 115/184 (63%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  PGM ERT+ VNG SKA+AMTGWR+G+IA P+  V  CNK+Q Q TSG  S+SQK 
Sbjct  218  SIAQFPGMKERTIIVNGVSKAYAMTGWRIGFIAAPEWIVKGCNKLQGQYTSGPCSVSQK-  276

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              AA        E V TM KAF  RRD +VK   E+ G++++ PQGAFYLF   S +YG 
Sbjct  277  --AAEAAYTTSQECVETMRKAFERRRDLIVKLAKEIPGLEVNCPQGAFYLFPKCSGFYGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G   + +S  L  +LL++  VA V GDAFGD  C R+SYA S   ++ A+ RI++ L
Sbjct  335  CYKG-KTINNSTDLAMFLLEEGHVATVGGDAFGDPECFRMSYATSDDNIREAMRRIKETL  393

Query  246  LTIR  235
              ++
Sbjct  394  AKLK  397



>ref|WP_013453900.1| aspartate aminotransferase [Marivirga tractuosa]
 gb|ADR21753.1| aminotransferase class I and II [Marivirga tractuosa DSM 4126]
Length=400

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 118/184 (64%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S ASLPGM ERT+T+NGFSK FAMTGWR+GYI+ P     A  KIQ Q TSG SSI+Q+A
Sbjct  221  SMASLPGMAERTITINGFSKGFAMTGWRVGYISAPLPIAKAATKIQGQITSGNSSIAQRA  280

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+            M K + +RRD ++    EM GV  + P+GAFY+F D S+++G 
Sbjct  281  ALAAITEDLKPTM---DMTKTYHKRRDMMLDLLKEMPGVVTNVPKGAFYIFPDISNFFG-  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +  G   V +++ L  Y+L KA V++V G AFG   CIRISYAAS   L+ A+ R++K L
Sbjct  337  KSDGETKVKNADELAIYILKKANVSVVTGTAFGAPNCIRISYAASDDELKEAMARLKKVL  396

Query  246  LTIR  235
              ++
Sbjct  397  AELK  400



>dbj|BAO76230.1| aspartate aminotransferase [Winogradskyella sp. PG-2]
Length=376

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 118/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A    M++RT+TVNG SKAFAMTGWR+GYI  P     ACNK+Q Q TSGA+ I Q+A
Sbjct  200  SIAEFEDMYDRTITVNGVSKAFAMTGWRIGYIGAPDWIARACNKMQGQVTSGANCIGQRA  259

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV  F+ RR  ++    E++G K +EP+GAFY+F D S+Y+G 
Sbjct  260  VITALEAPASSVQY---MVDEFKVRRKLILSLINEIDGFKANEPEGAFYVFPDVSAYFGK  316

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++  +  +LL++A VA V G+AFG+  CIRISYAAS   ++ A++RI+KAL
Sbjct  317  TIKG-TTINNASDMSLFLLEEALVATVTGEAFGNPNCIRISYAASQENIKEAIKRIKKAL  375



>ref|WP_036872256.1| aspartate aminotransferase [Prevotella buccalis]
 gb|KGF35619.1| aspartate aminotransferase [Prevotella buccalis DNF00853]
Length=397

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 117/184 (64%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  PGM ERT+ VNG SKA+AMTGWR+GYIA P+  V  CNK+Q Q TSG  S+SQ+A
Sbjct  218  SIAQFPGMKERTILVNGVSKAYAMTGWRIGYIAAPEWIVKGCNKLQGQYTSGPCSVSQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA        E    M +AF+ RRD +V+   E++G +++ PQGAFYLF   SSY+G 
Sbjct  278  ALAAYVTEQVCVE---EMRQAFQRRRDLIVRLAKEIDGFEVNVPQGAFYLFPKCSSYFG-  333

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
            +  G   +  +  L  YLL+   VA V GDAFGD  CIR+SYA S   ++ A+ R+++ L
Sbjct  334  KSDGQHTINSATDLAMYLLENGHVATVGGDAFGDPECIRMSYATSDENIREALRRMKEVL  393

Query  246  LTIR  235
              ++
Sbjct  394  AKLK  397



>ref|WP_045471920.1| aspartate aminotransferase [Winogradskyella sp. PG-2]
Length=394

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 118/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A    M++RT+TVNG SKAFAMTGWR+GYI  P     ACNK+Q Q TSGA+ I Q+A
Sbjct  218  SIAEFEDMYDRTITVNGVSKAFAMTGWRIGYIGAPDWIARACNKMQGQVTSGANCIGQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV  F+ RR  ++    E++G K +EP+GAFY+F D S+Y+G 
Sbjct  278  VITALEAPASSVQY---MVDEFKVRRKLILSLINEIDGFKANEPEGAFYVFPDVSAYFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++  +  +LL++A VA V G+AFG+  CIRISYAAS   ++ A++RI+KAL
Sbjct  335  TIKG-TTINNASDMSLFLLEEALVATVTGEAFGNPNCIRISYAASQENIKEAIKRIKKAL  393



>ref|WP_035327609.1| MULTISPECIES: aspartate aminotransferase [Dokdonia]
 gb|EAQ38012.1| aminotransferase class I and II [Dokdonia sp. MED134]
 gb|KGO07506.1| aspartate aminotransferase [Dokdonia donghaensis DSW-1]
Length=394

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 119/180 (66%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  P M++RT+TVNG SKAFAMTGWR+GYI GP++   ACNK+Q Q TSG + I+Q+A
Sbjct  218  SMAQFPDMYDRTVTVNGVSKAFAMTGWRVGYIGGPEYIARACNKMQGQITSGTNCIAQRA  277

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    M+  F+ RR  ++    ++EG K +EP+GAFY+F + S Y+G 
Sbjct  278  VITALEAPVSKVQY---MIDEFKSRRTLILDLLNDIEGFKCNEPEGAFYVFPNISHYFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL+ A VA V G+AFG+  CIRISYAAS+  ++ A+++I+ A+
Sbjct  335  TLGG-QKIENATDFSLYLLEAANVATVTGEAFGNPDCIRISYAASVDNIKDAMKQIKAAV  393



>ref|WP_021965095.1| aspartate aminotransferase [Prevotella sp. CAG:1185]
 emb|CCY81945.1| aspartate aminotransferase [Prevotella sp. CAG:1185]
Length=397

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 119/184 (65%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A  PGM ERT+ VNG SKA+AMTGWR+GYIA P+  V  CNK+Q Q TSG  S+SQK 
Sbjct  218  SIALAPGMKERTILVNGVSKAYAMTGWRIGYIAAPEWIVKGCNKLQGQYTSGPCSVSQK-  276

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
              AA+    A  E V TM +AF+ RRD +VK   E+ G++++ P+GAFYLF   S+++G 
Sbjct  277  --AAVEAYTASQECVETMRQAFQRRRDLIVKLAKEIPGLEVNVPEGAFYLFPKCSNFFGK  334

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
               G   +  S  L  YLL+ A VA V GDAFGD  C R+SYA S   +  A++RI++AL
Sbjct  335  SCDGR-VINTSTDLAMYLLEVAHVATVAGDAFGDPDCFRMSYATSDENICEAMKRIKEAL  393

Query  246  LTIR  235
              ++
Sbjct  394  AKLK  397



>ref|WP_008238499.1| aspartate aminotransferase [Imtechella halotolerans]
 gb|EID75769.1| transaminase A [Imtechella halotolerans K1]
Length=396

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 123/180 (68%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A + GM+ERT+TVNG SKAFAMTGWR+GYI  P+    AC K+Q Q TSGA+SI+Q+A
Sbjct  220  SIAEIDGMYERTITVNGVSKAFAMTGWRIGYIGAPEWIAKACTKMQGQITSGANSIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +  +    M+  F +RRD +++  GE+EG K++ P+GAFY+F +   ++G 
Sbjct  280  TIAAVKAPVSSIKF---MIDEFHKRRDLVLELLGEIEGFKLNVPEGAFYVFPNIEYFFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   +  +     YLL++A VA V G+AFG+D CIRISYAAS   L+ A++RI+++L
Sbjct  337  TLRG-RLINTAADFSMYLLEEANVATVTGEAFGNDNCIRISYAASEVELREAMKRIKESL  395



>ref|WP_034261266.1| aspartate aminotransferase [Altibacter lentus]
Length=396

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 120/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A+   M++RT+ VNG SKA+AMTGWR+GYI GP+    ACNK+Q Q TSGA+ I+Q+A
Sbjct  219  SMAAFEDMYDRTVVVNGVSKAYAMTGWRIGYIGGPEWIARACNKMQGQITSGANCIAQRA  278

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV AF+ERR  ++    E+ G K +EP+GAFY+F D S Y+G 
Sbjct  279  TITALENPPSKIQY---MVDAFKERRSLILNLLSEIPGFKTNEPEGAFYVFPDISYYFGK  335

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL++A VA V G+AFGD  CIRISYAAS + ++ A++RIR ++
Sbjct  336  TLRG-KKIENASDFSLYLLEEATVATVTGEAFGDSNCIRISYAASEAEIKEAMKRIRASV  394



>ref|WP_009751122.1| putative aspartate aminotransferase [Capnocytophaga sp. oral 
taxon 326]
 gb|EKY21277.1| putative aspartate aminotransferase [Capnocytophaga sp. oral 
taxon 326 str. F0382]
Length=396

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 121/180 (67%), Gaps = 4/180 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S A + G++ERT+TVNG SKAFAMTGWR+GY+  P+    AC K+Q Q TSGA++I+Q+A
Sbjct  220  SVAEINGLYERTITVNGMSKAFAMTGWRIGYMGAPEWIAKACAKVQGQVTSGANAIAQRA  279

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             + AL    +  +    MV  F+ RRD +++   E+EG K++ P+GAFY+F D SS++G 
Sbjct  280  SIVALKAPKSKIQY---MVDEFKRRRDLVLQLLNEIEGFKLNIPEGAFYVFPDISSFFGK  336

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             + G   + ++     YLL++A VA V G+AFGD  CIR SYAAS   L+ A+ RI+++L
Sbjct  337  TLRG-RVINNATDFSLYLLEEAMVATVTGEAFGDANCIRFSYAASEKDLREAIRRIKESL  395



>ref|WP_009184199.1| aspartate aminotransferase [Cecembia lonarensis]
 gb|EKB50152.1| Aspartate aminotransferase [Cecembia lonarensis LW9]
Length=400

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 120/184 (65%), Gaps = 4/184 (2%)
 Frame = -3

Query  786  SFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIqsqstsgassisQKa  607
            S  S PGM++RT+TVNGFSK +AMTGWR+GYI  P     AC K+Q Q TSG + I+Q+A
Sbjct  221  SIGSFPGMFDRTITVNGFSKGYAMTGWRVGYICAPLFIAKACEKMQGQFTSGGTGIAQRA  280

Query  606  gvaalglgyaggeavATMVKAFRERRDFLVKSFGEMEGVKISEPQGAFYLFIDFSSYYGV  427
             +AA+    +  +    M KA+ +RRD +++   E+ G K   P+GAFY F + S ++G 
Sbjct  281  ALAAISGDQSPSK---EMEKAYLKRRDLVLQLIQEIPGFKTHVPEGAFYFFPEVSHFFGK  337

Query  426  EVAGFGAVTDSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLSTLQAAVERIRKAL  247
             V GF  + +++  C Y+L+KA V+LV G+AFG   C+RISYAAS   L  A++RI++A 
Sbjct  338  SVDGF-QIKNADDFCLYILEKANVSLVTGEAFGAPNCVRISYAASEEELIEAIKRIKEAC  396

Query  246  LTIR  235
              I+
Sbjct  397  ARIQ  400



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1586636554460