BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7491

Length=723
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03143.1|  unnamed protein product                                366   2e-121   Coffea canephora [robusta coffee]
ref|XP_011078008.1|  PREDICTED: casein kinase I isoform delta-like      366   2e-121   Sesamum indicum [beniseed]
gb|EYU28389.1|  hypothetical protein MIMGU_mgv1a007204mg                363   2e-121   Erythranthe guttata [common monkey flower]
ref|XP_006451505.1|  hypothetical protein CICLE_v10008160mg             365   4e-121   Citrus clementina [clementine]
ref|XP_009764702.1|  PREDICTED: casein kinase I isoform delta-like      365   4e-121   Nicotiana sylvestris
ref|XP_009410794.1|  PREDICTED: casein kinase I-like                    365   5e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007024533.1|  Casein kinase 1-like protein 2                     365   7e-121   Theobroma cacao [chocolate]
ref|XP_009395821.1|  PREDICTED: casein kinase I-like isoform X2         364   8e-121   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT18264.1|  Casein kinase I isoform delta-like protein              364   8e-121   
gb|KDO53222.1|  hypothetical protein CISIN_1g011819mg                   362   8e-121   Citrus sinensis [apfelsine]
gb|EAY75552.1|  hypothetical protein OsI_03457                          364   9e-121   Oryza sativa Indica Group [Indian rice]
gb|EAZ13276.1|  hypothetical protein OsJ_03201                          364   1e-120   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB92346.1|  casein kinase I-like                                   364   1e-120   Oryza sativa Japonica Group [Japonica rice]
emb|CDM83770.1|  unnamed protein product                                364   1e-120   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006644591.1|  PREDICTED: casein kinase I isoform delta-lik...    364   1e-120   Oryza brachyantha
ref|XP_006644592.1|  PREDICTED: casein kinase I isoform delta-lik...    361   2e-120   Oryza brachyantha
pdb|3SV0|A  Chain A, Crystal Structure Of Casein Kinase-1 Like Pr...    364   2e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456234.1|  hypothetical protein SORBIDRAFT_03g032560          363   2e-120   Sorghum bicolor [broomcorn]
ref|XP_012068944.1|  PREDICTED: casein kinase I isoform delta-like      363   2e-120   Jatropha curcas
ref|XP_008806949.1|  PREDICTED: casein kinase I isoform delta-lik...    363   2e-120   Phoenix dactylifera
ref|XP_010232213.1|  PREDICTED: casein kinase I-like                    363   2e-120   Brachypodium distachyon [annual false brome]
ref|XP_010924972.1|  PREDICTED: casein kinase I isoform delta-lik...    363   2e-120   Elaeis guineensis
ref|XP_002309212.1|  casein kinase family protein                       363   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_011003341.1|  PREDICTED: casein kinase I isoform delta-like      363   2e-120   Populus euphratica
ref|XP_010262044.1|  PREDICTED: casein kinase I isoform delta-like      363   3e-120   Nelumbo nucifera [Indian lotus]
ref|XP_010696534.1|  PREDICTED: casein kinase I isoform delta-like      363   3e-120   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004969708.1|  PREDICTED: casein kinase I isoform delta-like      363   3e-120   Setaria italica
ref|XP_008459457.1|  PREDICTED: casein kinase I isoform delta-like      363   3e-120   Cucumis melo [Oriental melon]
gb|KGN60529.1|  hypothetical protein Csa_2G000380                       363   3e-120   Cucumis sativus [cucumbers]
dbj|BAD45136.1|  putative protein kinase ADK1                           354   3e-120   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001292664.1|  casein kinase I isoform delta-like                 363   3e-120   Cucumis sativus [cucumbers]
ref|XP_010090074.1|  Casein kinase I isoform delta-like protein         363   3e-120   Morus notabilis
ref|XP_007012783.1|  Casein kinase 1-like protein 2 isoform 1           363   4e-120   
ref|XP_007012784.1|  Casein kinase 1 isoform 2                          362   4e-120   
ref|XP_010924973.1|  PREDICTED: casein kinase I isoform delta-lik...    360   4e-120   
ref|XP_002521378.1|  casein kinase, putative                            363   4e-120   
ref|XP_004507951.1|  PREDICTED: casein kinase I isoform delta-lik...    362   4e-120   Cicer arietinum [garbanzo]
gb|KHG04851.1|  hypothetical protein F383_30273                         362   4e-120   Gossypium arboreum [tree cotton]
gb|KJB54402.1|  hypothetical protein B456_009G032600                    357   4e-120   Gossypium raimondii
ref|XP_004507950.1|  PREDICTED: casein kinase I isoform delta-lik...    362   4e-120   
ref|XP_010242267.1|  PREDICTED: casein kinase I isoform delta-like      362   5e-120   Nelumbo nucifera [Indian lotus]
ref|XP_003542336.1|  PREDICTED: casein kinase I isoform delta-lik...    362   6e-120   Glycine max [soybeans]
ref|XP_012076957.1|  PREDICTED: casein kinase I isoform delta-like      362   6e-120   Jatropha curcas
gb|KHG04850.1|  hypothetical protein F383_30273                         362   7e-120   Gossypium arboreum [tree cotton]
ref|XP_003549210.1|  PREDICTED: casein kinase I isoform delta-lik...    361   8e-120   Glycine max [soybeans]
ref|XP_009597979.1|  PREDICTED: casein kinase I isoform delta-like      362   8e-120   Nicotiana tomentosiformis
gb|KEH32501.1|  casein kinase I-like protein                            361   8e-120   Medicago truncatula
ref|XP_006371997.1|  casein kinase family protein                       362   1e-119   
ref|XP_010925467.1|  PREDICTED: casein kinase I isoform delta-lik...    362   1e-119   
ref|XP_009415492.1|  PREDICTED: casein kinase I-like                    362   1e-119   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006853888.1|  PREDICTED: casein kinase I isoform delta-like      361   2e-119   Amborella trichopoda
ref|XP_007154635.1|  hypothetical protein PHAVU_003G135100g             360   2e-119   Phaseolus vulgaris [French bean]
gb|KJB56939.1|  hypothetical protein B456_009G142600                    361   2e-119   Gossypium raimondii
ref|XP_004239254.1|  PREDICTED: casein kinase I isoform delta-like      361   2e-119   Solanum lycopersicum
ref|XP_002281345.2|  PREDICTED: casein kinase I isoform delta-like      361   2e-119   Vitis vinifera
ref|XP_008813454.1|  PREDICTED: casein kinase I isoform delta-like      361   2e-119   Phoenix dactylifera
ref|XP_010925469.1|  PREDICTED: casein kinase I isoform delta-lik...    360   2e-119   
ref|XP_009606359.1|  PREDICTED: casein kinase I isoform delta-like      360   2e-119   Nicotiana tomentosiformis
ref|XP_002277513.2|  PREDICTED: casein kinase I isoform delta-like      360   3e-119   Vitis vinifera
gb|KJB54404.1|  hypothetical protein B456_009G032600                    358   3e-119   Gossypium raimondii
ref|XP_006338113.1|  PREDICTED: casein kinase I isoform delta-like      360   4e-119   Solanum tuberosum [potatoes]
ref|XP_006597822.1|  PREDICTED: casein kinase I isoform delta-lik...    354   4e-119   
gb|KJB54403.1|  hypothetical protein B456_009G032600                    359   5e-119   Gossypium raimondii
ref|XP_008793211.1|  PREDICTED: casein kinase I isoform delta-lik...    357   5e-119   
ref|XP_011013818.1|  PREDICTED: casein kinase I isoform delta-like      359   7e-119   Populus euphratica
ref|XP_011079987.1|  PREDICTED: casein kinase I-like                    358   1e-118   Sesamum indicum [beniseed]
ref|XP_010049456.1|  PREDICTED: casein kinase I isoform delta-like      359   1e-118   Eucalyptus grandis [rose gum]
ref|XP_004243748.1|  PREDICTED: casein kinase I isoform delta-like      358   1e-118   Solanum lycopersicum
ref|XP_006357711.1|  PREDICTED: casein kinase I isoform delta-like      358   2e-118   Solanum tuberosum [potatoes]
ref|XP_010909190.1|  PREDICTED: casein kinase I isoform delta-like      358   2e-118   Elaeis guineensis
gb|KHN28842.1|  Casein kinase I isoform delta-like                      357   3e-118   Glycine soja [wild soybean]
ref|XP_003546462.1|  PREDICTED: casein kinase I isoform delta-lik...    357   3e-118   Glycine max [soybeans]
gb|EEC70925.1|  hypothetical protein OsI_02496                          358   3e-118   Oryza sativa Indica Group [Indian rice]
ref|XP_004151319.1|  PREDICTED: casein kinase I isoform delta-like      358   3e-118   Cucumis sativus [cucumbers]
ref|NP_001043372.1|  Os01g0570500                                       357   4e-118   
ref|XP_008447619.1|  PREDICTED: casein kinase I isoform delta-like      357   4e-118   Cucumis melo [Oriental melon]
gb|KHG11372.1|  hypothetical protein F383_02311                         357   5e-118   Gossypium arboreum [tree cotton]
emb|CDO97889.1|  unnamed protein product                                357   5e-118   Coffea canephora [robusta coffee]
ref|XP_009409360.1|  PREDICTED: casein kinase I-like                    357   6e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008656801.1|  PREDICTED: casein kinase I isoform delta-like      346   6e-118   
ref|XP_004287578.1|  PREDICTED: casein kinase I isoform delta-like      357   6e-118   Fragaria vesca subsp. vesca
ref|XP_008391353.1|  PREDICTED: casein kinase I isoform delta-like      357   1e-117   Malus domestica [apple tree]
ref|XP_008228258.1|  PREDICTED: casein kinase I isoform delta-like      357   1e-117   Prunus mume [ume]
ref|XP_007217223.1|  hypothetical protein PRUPE_ppa005139mg             357   1e-117   Prunus persica
gb|KCW69786.1|  hypothetical protein EUGRSUZ_F03150                     352   1e-117   Eucalyptus grandis [rose gum]
ref|XP_002299898.2|  hypothetical protein POPTR_0001s20450g             356   1e-117   
ref|XP_010685356.1|  PREDICTED: casein kinase I isoform delta-like      356   1e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009372402.1|  PREDICTED: casein kinase I isoform delta-like      356   1e-117   Pyrus x bretschneideri [bai li]
gb|KJB83052.1|  hypothetical protein B456_013G227100                    350   1e-117   Gossypium raimondii
gb|EEC79796.1|  hypothetical protein OsI_21224                          356   2e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_007138711.1|  hypothetical protein PHAVU_009G230800g             355   2e-117   Phaseolus vulgaris [French bean]
gb|KCW53570.1|  hypothetical protein EUGRSUZ_J02844                     352   2e-117   Eucalyptus grandis [rose gum]
ref|NP_001056503.1|  Os05g0593800                                       356   2e-117   
ref|XP_008793206.1|  PREDICTED: casein kinase I isoform delta-lik...    356   2e-117   Phoenix dactylifera
ref|XP_008793210.1|  PREDICTED: casein kinase I isoform delta-lik...    353   2e-117   Phoenix dactylifera
ref|XP_006597037.1|  PREDICTED: uncharacterized protein LOC100795...    355   2e-117   Glycine max [soybeans]
gb|KJB83051.1|  hypothetical protein B456_013G227100                    351   2e-117   Gossypium raimondii
gb|KHN30066.1|  Casein kinase I isoform delta-like                      355   2e-117   Glycine soja [wild soybean]
gb|KDO65165.1|  hypothetical protein CISIN_1g010674mg                   353   2e-117   Citrus sinensis [apfelsine]
ref|XP_006342964.1|  PREDICTED: casein kinase I isoform delta-like      355   2e-117   Solanum tuberosum [potatoes]
ref|XP_008242376.1|  PREDICTED: casein kinase I isoform delta-like      355   3e-117   Prunus mume [ume]
ref|XP_004235583.1|  PREDICTED: casein kinase I isoform delta-like      355   3e-117   Solanum lycopersicum
ref|XP_006465998.1|  PREDICTED: casein kinase I isoform delta-like      355   3e-117   Citrus sinensis [apfelsine]
ref|XP_006426585.1|  hypothetical protein CICLE_v10025527mg             355   4e-117   Citrus clementina [clementine]
ref|XP_003597565.1|  Casein kinase I isoform delta-like protein         355   4e-117   Medicago truncatula
ref|XP_010062655.1|  PREDICTED: casein kinase I isoform delta-lik...    355   5e-117   Eucalyptus grandis [rose gum]
ref|XP_009335830.1|  PREDICTED: casein kinase I isoform delta-like      355   5e-117   Pyrus x bretschneideri [bai li]
gb|KCW69785.1|  hypothetical protein EUGRSUZ_F03150                     353   5e-117   Eucalyptus grandis [rose gum]
gb|EYU45867.1|  hypothetical protein MIMGU_mgv1a005939mg                354   5e-117   Erythranthe guttata [common monkey flower]
gb|EPS64220.1|  hypothetical protein M569_10560                         353   6e-117   Genlisea aurea
ref|XP_008352372.1|  PREDICTED: casein kinase I isoform delta-like      354   7e-117   
ref|XP_008337722.1|  PREDICTED: casein kinase I isoform delta-like      354   7e-117   
ref|XP_002864491.1|  hypothetical protein ARALYDRAFT_918863             353   7e-117   Arabidopsis lyrata subsp. lyrata
gb|KJB83050.1|  hypothetical protein B456_013G227100                    354   7e-117   Gossypium raimondii
gb|KHG23724.1|  hypothetical protein F383_04752                         354   7e-117   Gossypium arboreum [tree cotton]
ref|XP_004303659.1|  PREDICTED: casein kinase I                         354   8e-117   Fragaria vesca subsp. vesca
gb|KJB83053.1|  hypothetical protein B456_013G227100                    353   8e-117   Gossypium raimondii
ref|XP_006413231.1|  hypothetical protein EUTSA_v10025148mg             354   8e-117   Eutrema salsugineum [saltwater cress]
ref|XP_006654877.1|  PREDICTED: casein kinase I isoform delta-like      354   8e-117   Oryza brachyantha
ref|XP_011009775.1|  PREDICTED: casein kinase I isoform delta-lik...    354   8e-117   Populus euphratica
gb|KHN35865.1|  Casein kinase I isoform delta-like                      353   8e-117   Glycine soja [wild soybean]
ref|XP_011009776.1|  PREDICTED: casein kinase I isoform delta-lik...    354   9e-117   Populus euphratica
ref|XP_010537581.1|  PREDICTED: casein kinase I                         353   9e-117   Tarenaya hassleriana [spider flower]
ref|XP_003567780.1|  PREDICTED: casein kinase I-like                    354   9e-117   Brachypodium distachyon [annual false brome]
ref|XP_006413230.1|  hypothetical protein EUTSA_v10025148mg             353   9e-117   Eutrema salsugineum [saltwater cress]
ref|XP_009361635.1|  PREDICTED: casein kinase I isoform delta-like      354   9e-117   Pyrus x bretschneideri [bai li]
ref|XP_009795173.1|  PREDICTED: casein kinase I isoform delta-like      354   1e-116   Nicotiana sylvestris
ref|XP_002441634.1|  hypothetical protein SORBIDRAFT_09g030690          354   1e-116   Sorghum bicolor [broomcorn]
ref|XP_001784922.1|  predicted protein                                  348   1e-116   
ref|XP_003533767.1|  PREDICTED: casein kinase I isoform delta-like      353   1e-116   Glycine max [soybeans]
ref|XP_011009743.1|  PREDICTED: casein kinase I isoform delta-lik...    351   1e-116   Populus euphratica
ref|XP_003543581.1|  PREDICTED: casein kinase I isoform delta-lik...    353   1e-116   Glycine max [soybeans]
ref|XP_011009742.1|  PREDICTED: casein kinase I isoform delta-lik...    353   1e-116   Populus euphratica
ref|XP_001774847.1|  predicted protein                                  348   1e-116   
ref|XP_004960994.1|  PREDICTED: casein kinase I isoform delta-lik...    351   1e-116   Setaria italica
ref|XP_009631851.1|  PREDICTED: casein kinase I isoform delta-like      353   2e-116   Nicotiana tomentosiformis
ref|XP_010033765.1|  PREDICTED: casein kinase I isoform delta-like      353   2e-116   Eucalyptus grandis [rose gum]
ref|XP_010539397.1|  PREDICTED: casein kinase I isoform delta-like      353   2e-116   Tarenaya hassleriana [spider flower]
ref|XP_009387717.1|  PREDICTED: casein kinase I-like                    353   2e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006385411.1|  hypothetical protein POPTR_0003s04170g             353   2e-116   
gb|KJB06829.1|  hypothetical protein B456_001G013300                    349   2e-116   Gossypium raimondii
gb|KJB06826.1|  hypothetical protein B456_001G013300                    353   2e-116   Gossypium raimondii
ref|XP_010536868.1|  PREDICTED: casein kinase I isoform delta-like      352   2e-116   Tarenaya hassleriana [spider flower]
gb|KJB06827.1|  hypothetical protein B456_001G013300                    352   3e-116   Gossypium raimondii
ref|XP_009798249.1|  PREDICTED: casein kinase I-like isoform X1         352   3e-116   Nicotiana sylvestris
ref|XP_006282246.1|  hypothetical protein CARUB_v10028520mg             351   3e-116   Capsella rubella
ref|XP_006357391.1|  PREDICTED: casein kinase I isoform delta-like      352   4e-116   Solanum tuberosum [potatoes]
gb|ACT34059.1|  putative protein kinase                                 352   4e-116   Aegilops tauschii
ref|NP_194340.1|  casein kinase 1                                       352   4e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486851.1|  PREDICTED: casein kinase I isoform delta-like      353   4e-116   Cicer arietinum [garbanzo]
gb|KHN11262.1|  Casein kinase I isoform delta-like                      352   4e-116   Glycine soja [wild soybean]
ref|XP_006585502.1|  PREDICTED: casein kinase I isoform delta-lik...    352   4e-116   Glycine max [soybeans]
ref|XP_006286042.1|  hypothetical protein CARUB_v10007571mg             352   5e-116   Capsella rubella
ref|XP_004960993.1|  PREDICTED: casein kinase I isoform delta-lik...    352   5e-116   Setaria italica
gb|KHG18061.1|  hypothetical protein F383_22405                         352   5e-116   Gossypium arboreum [tree cotton]
ref|XP_006585503.1|  PREDICTED: casein kinase I isoform delta-lik...    352   5e-116   Glycine max [soybeans]
emb|CDM83167.1|  unnamed protein product                                352   7e-116   Triticum aestivum [Canadian hard winter wheat]
gb|EPS64405.1|  hypothetical protein M569_10374                         346   7e-116   Genlisea aurea
gb|KJB06830.1|  hypothetical protein B456_001G013300                    352   8e-116   Gossypium raimondii
ref|XP_008650083.1|  PREDICTED: casein kinase I isoform delta-like      352   8e-116   
ref|XP_010448325.1|  PREDICTED: casein kinase I isoform delta-like      351   9e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010433551.1|  PREDICTED: casein kinase I isoform delta-like      351   9e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010438803.1|  PREDICTED: casein kinase I isoform delta-like      351   9e-116   Camelina sativa [gold-of-pleasure]
ref|XP_008656114.1|  PREDICTED: casein kinase I isoform delta-lik...    348   9e-116   Zea mays [maize]
ref|XP_002867580.1|  hypothetical protein ARALYDRAFT_492204             351   1e-115   
gb|KFK27260.1|  hypothetical protein AALP_AA8G358800                    350   1e-115   Arabis alpina [alpine rockcress]
gb|KHN39324.1|  Casein kinase I isoform delta-like                      351   2e-115   Glycine soja [wild soybean]
ref|XP_009395780.1|  PREDICTED: casein kinase I-like                    351   2e-115   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO65159.1|  hypothetical protein CISIN_1g010674mg                   351   2e-115   Citrus sinensis [apfelsine]
ref|XP_004241866.1|  PREDICTED: casein kinase I-like                    350   2e-115   Solanum lycopersicum
gb|AFV33949.1|  casein kinase I                                         350   2e-115   Gossypium hirsutum [American cotton]
ref|XP_008656113.1|  PREDICTED: casein kinase I isoform delta-lik...    350   4e-115   Zea mays [maize]
gb|KFK29120.1|  hypothetical protein AALP_AA7G091500                    349   5e-115   Arabis alpina [alpine rockcress]
ref|NP_001242599.1|  uncharacterized protein LOC100795570               349   5e-115   Glycine max [soybeans]
ref|XP_006401255.1|  hypothetical protein EUTSA_v10013573mg             346   6e-115   
ref|XP_008338713.1|  PREDICTED: casein kinase I isoform alpha-like      340   7e-115   
ref|XP_002972659.1|  hypothetical protein SELMODRAFT_231975             343   8e-115   
ref|NP_680447.1|  casein kinase I-like 12                               348   9e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401254.1|  hypothetical protein EUTSA_v10013573mg             348   9e-115   Eutrema salsugineum [saltwater cress]
ref|XP_009400542.1|  PREDICTED: casein kinase I isoform delta-lik...    345   1e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010483192.1|  PREDICTED: casein kinase I isoform delta-like      347   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_002988150.1|  hypothetical protein SELMODRAFT_127114             344   1e-114   
gb|KDO65156.1|  hypothetical protein CISIN_1g010674mg                   348   1e-114   Citrus sinensis [apfelsine]
gb|ABK24232.1|  unknown                                                 348   2e-114   Picea sitchensis
ref|XP_010474302.1|  PREDICTED: casein kinase I isoform delta-like      338   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010443365.1|  PREDICTED: casein kinase I isoform delta-like      347   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_009407307.1|  PREDICTED: casein kinase I-like isoform X2         347   4e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007135523.1|  hypothetical protein PHAVU_010G136500g             347   4e-114   Phaseolus vulgaris [French bean]
ref|XP_010531866.1|  PREDICTED: casein kinase I isoform delta-like      347   4e-114   Tarenaya hassleriana [spider flower]
emb|CDX94377.1|  BnaC01g18070D                                          347   5e-114   
gb|EYU21357.1|  hypothetical protein MIMGU_mgv1a023567mg                342   5e-114   Erythranthe guttata [common monkey flower]
ref|XP_009139890.1|  PREDICTED: casein kinase I isoform delta-like      347   5e-114   Brassica rapa
ref|XP_010451725.1|  PREDICTED: casein kinase I isoform delta-like      345   7e-114   Camelina sativa [gold-of-pleasure]
ref|XP_009349379.1|  PREDICTED: casein kinase I isoform delta-like      345   1e-113   Pyrus x bretschneideri [bai li]
gb|KJB54401.1|  hypothetical protein B456_009G032600                    344   1e-113   Gossypium raimondii
ref|XP_009400540.1|  PREDICTED: casein kinase I-like isoform X1         345   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR18116.1|  unknown                                                 346   2e-113   Picea sitchensis
ref|XP_009395822.1|  PREDICTED: casein kinase I-like isoform X3         344   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY11892.1|  BnaC03g13180D                                          343   3e-113   Brassica napus [oilseed rape]
ref|XP_006390631.1|  hypothetical protein EUTSA_v10018502mg             339   4e-113   
ref|NP_177415.1|  casein kinase 1-like protein 2                        344   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004510406.1|  PREDICTED: casein kinase I isoform delta-like      344   6e-113   Cicer arietinum [garbanzo]
ref|XP_002887448.1|  hypothetical protein ARALYDRAFT_476408             344   6e-113   
ref|XP_004969013.1|  PREDICTED: casein kinase I isoform delta-like      344   6e-113   Setaria italica
ref|XP_009394112.1|  PREDICTED: casein kinase I-like                    344   6e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395820.1|  PREDICTED: casein kinase I isoform delta-lik...    345   7e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006390630.1|  hypothetical protein EUTSA_v10018502mg             339   9e-113   
gb|AAA50233.1|  casein kinase I-like protein; similar to the rat ...    341   1e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88601.1|  BnaA03g10480D                                          342   2e-112   
ref|XP_009132156.1|  PREDICTED: casein kinase I isoform delta-like      342   2e-112   Brassica rapa
ref|XP_003627159.1|  Casein kinase I isoform delta-like protein         343   2e-112   Medicago truncatula
ref|XP_003627160.1|  Casein kinase I isoform delta-like protein         340   3e-112   
ref|XP_006390629.1|  hypothetical protein EUTSA_v10018502mg             342   4e-112   Eutrema salsugineum [saltwater cress]
ref|XP_009105934.1|  PREDICTED: casein kinase I isoform delta-lik...    342   4e-112   
ref|XP_009105937.1|  PREDICTED: casein kinase I isoform delta-lik...    342   5e-112   Brassica rapa
emb|CDX72938.1|  BnaC06g33860D                                          342   6e-112   
ref|XP_009126906.1|  PREDICTED: casein kinase I isoform delta-lik...    340   6e-112   
ref|XP_006302226.1|  hypothetical protein CARUB_v10020246mg             342   6e-112   Capsella rubella
emb|CDY20695.1|  BnaA02g08350D                                          340   6e-112   Brassica napus [oilseed rape]
emb|CDY49859.1|  BnaA02g16080D                                          341   7e-112   Brassica napus [oilseed rape]
emb|CDY32908.1|  BnaC02g11920D                                          340   7e-112   Brassica napus [oilseed rape]
ref|XP_010428166.1|  PREDICTED: casein kinase I-like                    341   9e-112   Camelina sativa [gold-of-pleasure]
gb|ACJ85725.1|  unknown                                                 341   1e-111   Medicago truncatula
ref|XP_010416034.1|  PREDICTED: casein kinase I isoform delta-like      341   1e-111   Camelina sativa [gold-of-pleasure]
ref|XP_009126905.1|  PREDICTED: casein kinase I isoform delta-lik...    340   1e-111   Brassica rapa
gb|KFK41692.1|  hypothetical protein AALP_AA2G160600                    339   5e-111   Arabis alpina [alpine rockcress]
ref|XP_009120217.1|  PREDICTED: casein kinase I isoform delta-like      336   2e-110   Brassica rapa
emb|CDY38255.1|  BnaA10g11030D                                          336   3e-110   Brassica napus [oilseed rape]
ref|XP_001774851.1|  predicted protein                                  332   4e-110   
emb|CDY54387.1|  BnaC09g53710D                                          334   2e-109   Brassica napus [oilseed rape]
ref|XP_007201986.1|  hypothetical protein PRUPE_ppa004932mg             335   2e-109   
ref|XP_009127947.1|  PREDICTED: casein kinase I isoform delta-like      335   2e-109   Brassica rapa
gb|KFK40308.1|  hypothetical protein AALP_AA3G358100                    330   5e-108   Arabis alpina [alpine rockcress]
ref|XP_003057018.1|  predicted protein                                  325   7e-108   Micromonas pusilla CCMP1545
ref|XP_002883988.1|  hypothetical protein ARALYDRAFT_899935             329   2e-107   Arabidopsis lyrata subsp. lyrata
ref|NP_179537.1|  casein kinase I-like 5                                328   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002981109.1|  hypothetical protein SELMODRAFT_113824             326   5e-107   
ref|XP_002982581.1|  hypothetical protein SELMODRAFT_116791             326   5e-107   
ref|XP_006409051.1|  hypothetical protein EUTSA_v10022691mg             325   6e-107   
ref|XP_002502415.1|  predicted protein                                  325   9e-107   Micromonas commoda
ref|XP_001416096.1|  predicted protein                                  322   2e-106   Ostreococcus lucimarinus CCE9901
ref|XP_006409052.1|  hypothetical protein EUTSA_v10022691mg             326   2e-106   
ref|XP_009112605.1|  PREDICTED: casein kinase I isoform delta-like      326   4e-106   Brassica rapa
ref|XP_002455818.1|  hypothetical protein SORBIDRAFT_03g025700          326   6e-106   Sorghum bicolor [broomcorn]
ref|XP_003595230.1|  Casein kinase I isoform delta-like protein         326   6e-106   Medicago truncatula
ref|XP_010415390.1|  PREDICTED: casein kinase I-like                    324   1e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010489492.1|  PREDICTED: casein kinase I-like                    324   1e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010467893.1|  PREDICTED: casein kinase I-like                    324   2e-105   Camelina sativa [gold-of-pleasure]
emb|CEG01144.1|  Serine/threonine-protein kinase, active site           322   2e-105   Ostreococcus tauri
ref|XP_006296706.1|  hypothetical protein CARUB_v10013750mg             323   4e-105   Capsella rubella
ref|XP_004513434.1|  PREDICTED: casein kinase I isoform delta-like      324   6e-105   Cicer arietinum [garbanzo]
ref|XP_005837939.1|  hypothetical protein GUITHDRAFT_92876              316   3e-104   Guillardia theta CCMP2712
gb|AFK44603.1|  unknown                                                 308   3e-103   Lotus japonicus
ref|XP_005651142.1|  ser/thr kinase                                     313   4e-103   Coccomyxa subellipsoidea C-169
gb|EMS68429.1|  ATP-dependent zinc metalloprotease FTSH 5, mitoch...    333   1e-102   Triticum urartu
ref|XP_007513942.1|  predicted protein                                  315   1e-102   Bathycoccus prasinos
gb|EMS66353.1|  Casein kinase I isoform delta-like protein              318   1e-102   Triticum urartu
gb|KIZ00217.1|  Casein kinase I isoform delta                           314   2e-102   Monoraphidium neglectum
ref|XP_001693999.1|  ser/thr kinase                                     310   2e-101   Chlamydomonas reinhardtii
ref|XP_005844274.1|  hypothetical protein CHLNCDRAFT_32696              310   2e-101   Chlorella variabilis
ref|XP_011397037.1|  Casein kinase I isoform delta-like protein         311   4e-101   Auxenochlorella protothecoides
ref|XP_010526388.1|  PREDICTED: casein kinase I                         312   4e-101   Tarenaya hassleriana [spider flower]
ref|XP_002956390.1|  serine/threonine kinase                            309   5e-101   Volvox carteri f. nagariensis
gb|AAB47968.1|  dual specificity kinase 1                               308   1e-100   Arabidopsis thaliana [mouse-ear cress]
gb|KFV53203.1|  Casein kinase I isoform epsilon                         305   1e-100   Gavia stellata
ref|XP_011650925.1|  PREDICTED: casein kinase I isoform delta-lik...    308   1e-100   Cucumis sativus [cucumbers]
ref|XP_008438506.1|  PREDICTED: casein kinase I isoform delta-lik...    308   1e-100   Cucumis melo [Oriental melon]
ref|XP_003589958.1|  Casein kinase I isoform delta-like protein         306   2e-100   
ref|XP_006305308.1|  hypothetical protein CARUB_v10009684mg             307   2e-100   
ref|XP_009809825.1|  PREDICTED: casein kinase I isoform epsilon-like    305   2e-100   Gavia stellata
gb|KJB09990.1|  hypothetical protein B456_001G179300                    305   3e-100   Gossypium raimondii
ref|XP_005681126.1|  PREDICTED: casein kinase I isoform epsilon-l...    304   3e-100   
ref|XP_011649149.1|  PREDICTED: casein kinase I-like isoform X2         309   4e-100   Cucumis sativus [cucumbers]
ref|XP_008460652.1|  PREDICTED: casein kinase I-like isoform X2         309   4e-100   Cucumis melo [Oriental melon]
gb|KJB42310.1|  hypothetical protein B456_007G147800                    310   6e-100   Gossypium raimondii
ref|XP_002687979.1|  PREDICTED: casein kinase I isoform delta           303   6e-100   
gb|KHG21090.1|  hypothetical protein F383_27358                         310   6e-100   Gossypium arboreum [tree cotton]
ref|XP_006383707.1|  hypothetical protein POPTR_0005s248602g            303   6e-100   
ref|XP_009768908.1|  PREDICTED: casein kinase I isoform delta-like      300   8e-100   Nicotiana sylvestris
ref|XP_003589959.1|  Casein kinase I isoform delta-like protein         306   1e-99    
ref|NP_001131184.1|  putative casein kinase family protein              310   1e-99    
ref|XP_009358035.1|  PREDICTED: casein kinase I-like isoform X3         307   1e-99    
ref|XP_004147150.1|  PREDICTED: casein kinase I-like isoform X1         310   1e-99    
ref|XP_008460651.1|  PREDICTED: casein kinase I-like isoform X1         310   1e-99    
gb|AII16522.1|  casein kinase I epsilon                                 305   1e-99    
ref|NP_563695.2|  dual specificity kinase 1                             310   2e-99    
gb|KHG20826.1|  hypothetical protein F383_06417                         308   2e-99    
ref|XP_008438504.1|  PREDICTED: casein kinase I-like isoform X1         309   2e-99    
gb|KJB09986.1|  hypothetical protein B456_001G179300                    305   2e-99    
ref|XP_004134054.1|  PREDICTED: casein kinase I isoform X1              309   2e-99    
gb|KJB09989.1|  hypothetical protein B456_001G179300                    305   2e-99    
ref|XP_004497860.1|  PREDICTED: casein kinase I isoform delta-like      309   2e-99    
gb|KHN30577.1|  Casein kinase I isoform delta-like                      309   2e-99    
ref|XP_010265010.1|  PREDICTED: casein kinase I-like                    309   2e-99    
ref|XP_010262366.1|  PREDICTED: casein kinase I-like                    309   2e-99    
ref|XP_002184539.1|  predicted protein                                  304   3e-99    
ref|XP_003556378.1|  PREDICTED: casein kinase I isoform delta-like      309   3e-99    
ref|XP_010906780.1|  PREDICTED: casein kinase I-like isoform X3         307   3e-99    
ref|XP_003536218.1|  PREDICTED: casein kinase I isoform delta-lik...    308   3e-99    
ref|XP_010934296.1|  PREDICTED: casein kinase I-like isoform X2         309   3e-99    
ref|XP_010934295.1|  PREDICTED: casein kinase I-like isoform X1         309   3e-99    
tpg|DAA29136.1|  TPA: casein kinase 1 epsilon                           303   3e-99    
ref|XP_007908489.1|  PREDICTED: casein kinase I isoform epsilon         307   3e-99    
ref|XP_009250468.1|  PREDICTED: casein kinase I isoform delta iso...    303   4e-99    
pdb|3UYS|A  Chain A, Crystal Structure Of Apo Human Ck1d                303   4e-99    
ref|XP_007050239.1|  Casein kinase I-like 10 isoform 3                  303   4e-99    
ref|XP_003772355.1|  PREDICTED: casein kinase I isoform epsilon         306   4e-99    
pdb|4JJR|A  Chain A, A P21 Crystal Form Of Mammalian Casein Kinas...    303   4e-99    
pdb|4HNI|A  Chain A, Crystal Structure Of Ck1e In Complex With Pf...    303   4e-99    
gb|ABV21579.1|  casein kinase I delta                                   303   4e-99    
ref|NP_001151631.1|  casein kinase I isoform delta-like                 308   4e-99    
ref|XP_010671010.1|  PREDICTED: casein kinase I isoform X2              308   4e-99    
ref|XP_010671009.1|  PREDICTED: casein kinase I isoform X1              308   5e-99    
ref|XP_008643813.1|  PREDICTED: casein kinase I isoform delta-lik...    308   5e-99    
ref|XP_002872415.1|  predicted protein                                  303   5e-99    
ref|XP_007223111.1|  hypothetical protein PRUPE_ppa005419mg             308   5e-99    
ref|XP_008565111.1|  PREDICTED: casein kinase I isoform epsilon i...    303   5e-99    
ref|XP_004296378.1|  PREDICTED: casein kinase I-like                    308   6e-99    
ref|XP_010935955.1|  PREDICTED: casein kinase I-like isoform X2         308   6e-99    
ref|NP_001048470.1|  Os02g0810400                                       308   6e-99    
ref|XP_004695572.1|  PREDICTED: casein kinase I isoform delta           303   6e-99    
ref|XP_009358033.1|  PREDICTED: casein kinase I-like isoform X1         308   6e-99    
ref|XP_008312966.1|  PREDICTED: casein kinase I isoform epsilon-like    306   7e-99    
ref|XP_011404912.1|  PREDICTED: casein kinase I isoform epsilon         302   7e-99    
ref|XP_002295127.1|  hypothetical protein THAPSDRAFT_14638              303   7e-99    
ref|XP_008810305.1|  PREDICTED: casein kinase I-like                    308   7e-99    
pdb|1CKJ|A  Chain A, Casein Kinase I Delta Truncation Mutant Cont...    303   7e-99    
ref|XP_009663624.1|  PREDICTED: casein kinase I isoform epsilon         305   7e-99    
ref|XP_008391228.1|  PREDICTED: casein kinase I-like isoform X1         308   7e-99    
ref|XP_006420256.1|  hypothetical protein CICLE_v10004925mg             303   8e-99    
ref|XP_009358034.1|  PREDICTED: casein kinase I-like isoform X2         308   8e-99    
ref|XP_003961565.1|  PREDICTED: casein kinase I isoform epsilon         306   8e-99    
ref|XP_010475026.1|  PREDICTED: casein kinase I-like isoform X2         308   8e-99    
ref|XP_008391230.1|  PREDICTED: casein kinase I-like isoform X2         308   9e-99    
ref|XP_010729078.1|  PREDICTED: casein kinase I isoform epsilon-like    306   9e-99    
ref|XP_002529843.1|  casein kinase, putative                            305   9e-99    
gb|KJB09985.1|  hypothetical protein B456_001G179300                    307   9e-99    
gb|AAH44700.1|  CkIdelta protein                                        304   9e-99    
ref|XP_008295008.1|  PREDICTED: casein kinase I isoform epsilon-like    306   9e-99    
ref|XP_009400806.1|  PREDICTED: casein kinase I-like isoform X2         308   1e-98    
ref|XP_010843406.1|  PREDICTED: casein kinase I isoform epsilon i...    302   1e-98    
gb|KJB11365.1|  hypothetical protein B456_001G254700                    307   1e-98    
ref|XP_009400805.1|  PREDICTED: casein kinase I-like isoform X1         308   1e-98    
ref|XP_008224339.1|  PREDICTED: casein kinase I isoform X2              307   1e-98    
ref|XP_001113761.1|  PREDICTED: casein kinase I isoform delta-like      303   1e-98    
ref|XP_007540214.1|  PREDICTED: casein kinase I isoform epsilon-l...    306   1e-98    
ref|XP_008224338.1|  PREDICTED: casein kinase I isoform X1              307   1e-98    
gb|KJB38368.1|  hypothetical protein B456_006G253000                    308   1e-98    
gb|ETE72828.1|  Casein kinase I isoform epsilon                         306   1e-98    
ref|XP_010475024.1|  PREDICTED: casein kinase I-like isoform X1         308   1e-98    
ref|XP_004071842.1|  PREDICTED: casein kinase I isoform epsilon i...    305   1e-98    
ref|XP_008434487.1|  PREDICTED: casein kinase I isoform epsilon-l...    306   1e-98    
ref|XP_004954310.1|  PREDICTED: casein kinase I isoform delta-lik...    307   1e-98    
ref|XP_007540216.1|  PREDICTED: casein kinase I isoform epsilon-l...    306   1e-98    
ref|XP_005816998.1|  PREDICTED: casein kinase I isoform epsilon-like    306   1e-98    
ref|XP_005448080.1|  PREDICTED: casein kinase I isoform epsilon-l...    306   1e-98    
ref|XP_010895021.1|  PREDICTED: casein kinase I isoform epsilon         306   1e-98    
ref|XP_005011618.1|  PREDICTED: casein kinase I isoform delta iso...    304   1e-98    
ref|XP_008224340.1|  PREDICTED: casein kinase I isoform X3              307   1e-98    
ref|XP_004563122.1|  PREDICTED: casein kinase I isoform epsilon-like    306   1e-98    
ref|XP_009436674.1|  PREDICTED: casein kinase I isoform epsilon i...    303   1e-98    
ref|XP_003589957.1|  Casein kinase I isoform delta-like protein         307   1e-98    
gb|AFW83711.1|  putative casein kinase family protein                   296   1e-98    
ref|XP_011601997.1|  PREDICTED: casein kinase I isoform epsilon-l...    305   1e-98    
ref|XP_005803388.1|  PREDICTED: casein kinase I isoform epsilon-like    306   1e-98    
ref|XP_011476808.1|  PREDICTED: casein kinase I isoform epsilon i...    306   1e-98    
ref|XP_003964448.1|  PREDICTED: casein kinase I isoform epsilon-l...    306   1e-98    
gb|ACN34880.1|  unknown                                                 307   1e-98    
emb|CAF90192.1|  unnamed protein product                                306   1e-98    
gb|AES60208.2|  casein kinase I-like protein                            307   1e-98    
gb|AAP87440.1|  casein kinase 1 epsilon                                 305   1e-98    
ref|XP_008434486.1|  PREDICTED: casein kinase I isoform epsilon-l...    306   1e-98    
ref|NP_001084228.1|  casein kinase 1, epsilon                           305   1e-98    
ref|XP_009060168.1|  hypothetical protein LOTGIDRAFT_205749             302   1e-98    
ref|XP_006807372.1|  PREDICTED: casein kinase I isoform epsilon-l...    306   1e-98    
gb|ACL53695.1|  unknown                                                 307   1e-98    
ref|XP_005737991.1|  PREDICTED: casein kinase I isoform epsilon-like    305   1e-98    
ref|XP_010566423.1|  PREDICTED: casein kinase I isoform delta iso...    303   1e-98    
ref|XP_006378328.1|  hypothetical protein POPTR_0010s08110g             303   1e-98    
ref|XP_009981374.1|  PREDICTED: casein kinase I isoform epsilon         305   1e-98    
ref|XP_005016001.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_007069158.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_008494331.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_011598460.1|  PREDICTED: casein kinase I isoform delta iso...    303   2e-98    
ref|XP_008328512.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_003443159.1|  PREDICTED: casein kinase I isoform epsilon-like    305   2e-98    
ref|XP_008071348.1|  PREDICTED: casein kinase I isoform epsilon i...    301   2e-98    
ref|XP_007111788.1|  PREDICTED: casein kinase I isoform epsilon i...    301   2e-98    
ref|XP_008413765.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_005302552.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    305   2e-98    
ref|XP_003964352.1|  PREDICTED: casein kinase I isoform delta           301   2e-98    
ref|XP_010222459.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_006029915.1|  PREDICTED: casein kinase I isoform epsilon i...    305   2e-98    
ref|XP_009566715.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_003227197.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
gb|AAP47012.1|  casein kinase I epsilon                                 305   2e-98    
ref|XP_009330923.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_009757941.1|  PREDICTED: casein kinase I isoform X2              306   2e-98    
ref|XP_004954308.1|  PREDICTED: casein kinase I isoform delta-lik...    308   2e-98    
ref|NP_001011137.1|  casein kinase I isoform epsilon                    305   2e-98    
ref|XP_006029917.1|  PREDICTED: casein kinase I isoform epsilon i...    305   2e-98    
ref|XP_007560283.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_006378329.1|  hypothetical protein POPTR_0010s08110g             303   2e-98    
ref|XP_009900790.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_007050238.1|  Casein kinase I isoform 2                          305   2e-98    
ref|XP_010308309.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
gb|KHG01603.1|  hypothetical protein F383_21209                         306   2e-98    
ref|XP_005039794.1|  PREDICTED: casein kinase I isoform epsilon i...    305   2e-98    
ref|XP_010291439.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_003570340.1|  PREDICTED: casein kinase I                         307   2e-98    
ref|XP_005955737.1|  PREDICTED: casein kinase I isoform epsilon         306   2e-98    
ref|XP_010001904.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|NP_989708.3|  casein kinase I isoform epsilon                       305   2e-98    
ref|XP_009484649.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_010679311.1|  PREDICTED: casein kinase I-like                    306   2e-98    
ref|XP_002768537.1|  Casein kinase I, putative                          302   2e-98    
ref|XP_008939813.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
gb|EFB26732.1|  hypothetical protein PANDA_002512                       305   2e-98    
ref|XP_010086106.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    305   2e-98    
gb|EMS51179.1|  Casein kinase I isoform delta-like protein              307   2e-98    
ref|XP_010408882.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_008294592.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_009602201.1|  PREDICTED: casein kinase I isoform X2              306   2e-98    
ref|XP_008360424.1|  PREDICTED: casein kinase I-like isoform X2         306   2e-98    
ref|XP_010129331.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_007189109.1|  PREDICTED: casein kinase I isoform epsilon i...    305   2e-98    
ref|XP_008360423.1|  PREDICTED: casein kinase I-like isoform X1         306   2e-98    
ref|XP_006102486.1|  PREDICTED: casein kinase I isoform epsilon i...    305   2e-98    
ref|XP_004466285.1|  PREDICTED: casein kinase I isoform epsilon i...    305   2e-98    
ref|NP_199223.1|  casein kinase I-like 7                                307   2e-98    
ref|XP_010746310.1|  PREDICTED: casein kinase I isoform epsilon         305   2e-98    
ref|XP_007454085.1|  PREDICTED: casein kinase I isoform epsilon i...    305   3e-98    
ref|XP_006119016.1|  PREDICTED: casein kinase I isoform epsilon i...    305   3e-98    
ref|XP_003554293.1|  PREDICTED: casein kinase I isoform delta-lik...    306   3e-98    
ref|XP_010611312.1|  PREDICTED: casein kinase I isoform epsilon i...    303   3e-98    
emb|CDQ75112.1|  unnamed protein product                                305   3e-98    
ref|XP_008565109.1|  PREDICTED: casein kinase I isoform epsilon i...    305   3e-98    
ref|XP_008849484.1|  PREDICTED: casein kinase I isoform epsilon i...    305   3e-98    
ref|XP_004279531.1|  PREDICTED: casein kinase I isoform epsilon         305   3e-98    
ref|XP_011217131.1|  PREDICTED: casein kinase I isoform epsilon i...    305   3e-98    
ref|XP_004883528.1|  PREDICTED: casein kinase I isoform epsilon i...    305   3e-98    
ref|XP_005934455.1|  PREDICTED: casein kinase I isoform epsilon-l...    305   3e-98    
ref|NP_038795.3|  casein kinase I isoform epsilon isoform a             305   3e-98    
ref|XP_006886187.1|  PREDICTED: casein kinase I isoform delta iso...    305   3e-98    
gb|EDL04651.1|  casein kinase 1, epsilon, isoform CRA_b                 305   3e-98    
ref|XP_006886186.1|  PREDICTED: casein kinase I isoform delta iso...    305   3e-98    
ref|NP_001268517.1|  casein kinase 1, epsilon                           305   3e-98    
ref|XP_004845668.1|  PREDICTED: casein kinase I isoform epsilon i...    305   3e-98    
ref|XP_002964626.1|  hypothetical protein SELMODRAFT_81432              301   3e-98    
ref|XP_010093064.1|  Casein kinase I isoform delta-like protein         306   3e-98    
ref|XP_004700308.1|  PREDICTED: casein kinase I isoform epsilon         305   3e-98    
ref|XP_004650366.1|  PREDICTED: casein kinase I isoform epsilon         305   3e-98    
ref|XP_003419814.1|  PREDICTED: casein kinase I isoform epsilon         305   3e-98    
gb|ABV71923.1|  casein kinase I epsilon                                 305   3e-98    
ref|NP_113805.1|  casein kinase I isoform epsilon                       305   3e-98    
gb|ELK10231.1|  Casein kinase I isoform epsilon                         305   3e-98    
ref|XP_010843405.1|  PREDICTED: casein kinase I isoform epsilon i...    303   3e-98    
ref|XP_009436666.1|  PREDICTED: casein kinase I isoform epsilon i...    305   3e-98    
ref|XP_007111787.1|  PREDICTED: casein kinase I isoform epsilon i...    303   3e-98    
ref|XP_007939854.1|  PREDICTED: casein kinase I isoform epsilon         305   3e-98    
ref|XP_004404515.1|  PREDICTED: casein kinase I isoform delta           305   3e-98    
ref|XP_009277679.1|  PREDICTED: casein kinase I isoform delta iso...    302   4e-98    
ref|XP_007189103.1|  PREDICTED: casein kinase I isoform epsilon i...    303   4e-98    
ref|XP_004743291.1|  PREDICTED: casein kinase I isoform epsilon i...    305   4e-98    
ref|XP_004557609.1|  PREDICTED: casein kinase I isoform epsilon-l...    305   4e-98    
ref|XP_850168.1|  PREDICTED: casein kinase I isoform epsilon isof...    305   4e-98    
ref|XP_006979210.1|  PREDICTED: casein kinase I isoform epsilon         305   4e-98    
ref|XP_006865250.1|  PREDICTED: casein kinase I isoform epsilon i...    305   4e-98    
ref|XP_010893852.1|  PREDICTED: casein kinase I isoform epsilon-like    305   4e-98    
ref|XP_003126072.1|  PREDICTED: casein kinase I isoform epsilon i...    305   4e-98    
ref|XP_008565108.1|  PREDICTED: casein kinase I isoform epsilon i...    305   4e-98    
ref|XP_004743290.1|  PREDICTED: casein kinase I isoform epsilon i...    305   4e-98    
ref|XP_006071407.1|  PREDICTED: casein kinase I isoform epsilon i...    303   4e-98    
ref|XP_006647534.1|  PREDICTED: casein kinase I isoform delta-like      306   4e-98    
ref|XP_007030401.1|  Casein kinase I isoform 1                          306   4e-98    
ref|XP_004675720.1|  PREDICTED: casein kinase I isoform epsilon         305   4e-98    
ref|XP_006636954.1|  PREDICTED: casein kinase I homolog 1-like          307   4e-98    
ref|XP_011083042.1|  PREDICTED: casein kinase I-like                    306   4e-98    
emb|CDQ75971.1|  unnamed protein product                                305   4e-98    
pdb|4TW9|A  Chain A, Difluoro-dioxolo-benzoimidazol-benzamides As...    300   4e-98    
ref|XP_006890186.1|  PREDICTED: casein kinase I isoform epsilon         304   4e-98    
ref|XP_009612126.1|  PREDICTED: casein kinase I-like isoform X2         303   4e-98    
ref|XP_008959351.1|  PREDICTED: casein kinase I isoform delta iso...    304   4e-98    
ref|XP_004954305.1|  PREDICTED: casein kinase I isoform delta-lik...    308   4e-98    
ref|XP_008849485.1|  PREDICTED: casein kinase I isoform epsilon i...    303   4e-98    
ref|XP_004861085.1|  PREDICTED: casein kinase I isoform delta iso...    304   4e-98    
ref|XP_005655567.1|  PREDICTED: casein kinase I isoform epsilon i...    303   4e-98    
ref|XP_003470539.1|  PREDICTED: casein kinase I isoform epsilon i...    304   4e-98    
ref|XP_007519382.1|  PREDICTED: casein kinase I isoform epsilon i...    303   4e-98    
ref|XP_004621117.1|  PREDICTED: casein kinase I isoform delta iso...    304   4e-98    
ref|XP_008255269.1|  PREDICTED: casein kinase I isoform epsilon i...    304   4e-98    
ref|XP_004410828.1|  PREDICTED: casein kinase I isoform epsilon         304   4e-98    
ref|XP_006886188.1|  PREDICTED: casein kinase I isoform delta iso...    304   4e-98    
ref|XP_005322313.1|  PREDICTED: casein kinase I isoform epsilon         304   4e-98    
ref|NP_001884.2|  casein kinase I isoform delta isoform 1               304   4e-98    
ref|XP_008413305.1|  PREDICTED: casein kinase I isoform delta iso...    304   4e-98    
ref|XP_012031035.1|  PREDICTED: casein kinase I isoform epsilon i...    303   4e-98    
ref|XP_007524517.1|  PREDICTED: casein kinase I isoform delta iso...    305   4e-98    
ref|XP_006869543.1|  PREDICTED: casein kinase I isoform delta iso...    304   4e-98    
gb|AAQ02559.1|  casein kinase 1, epsilon                                304   4e-98    



>emb|CDP03143.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_011078008.1| PREDICTED: casein kinase I isoform delta-like [Sesamum indicum]
Length=474

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|EYU28389.1| hypothetical protein MIMGU_mgv1a007204mg [Erythranthe guttata]
Length=415

 Score =   363 bits (933),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_006451505.1| hypothetical protein CICLE_v10008160mg [Citrus clementina]
 ref|XP_006475484.1| PREDICTED: casein kinase I isoform delta-like [Citrus sinensis]
 gb|ESR64745.1| hypothetical protein CICLE_v10008160mg [Citrus clementina]
 gb|KDO53217.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=477

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 174/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_009764702.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana sylvestris]
Length=471

 Score =   365 bits (937),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_009410794.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   365 bits (937),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_007024533.1| Casein kinase 1-like protein 2 [Theobroma cacao]
 gb|EOY27155.1| Casein kinase 1-like protein 2 [Theobroma cacao]
Length=477

 Score =   365 bits (936),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 174/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_009395821.1| PREDICTED: casein kinase I-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   364 bits (935),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNF+MGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFIMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|EMT18264.1| Casein kinase I isoform delta-like protein [Aegilops tauschii]
Length=472

 Score =   364 bits (935),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KDO53222.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=407

 Score =   362 bits (929),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 174/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|EAY75552.1| hypothetical protein OsI_03457 [Oryza sativa Indica Group]
Length=472

 Score =   364 bits (935),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|EAZ13276.1| hypothetical protein OsJ_03201 [Oryza sativa Japonica Group]
Length=472

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>dbj|BAB92346.1| casein kinase I-like [Oryza sativa Japonica Group]
Length=472

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>emb|CDM83770.1| unnamed protein product [Triticum aestivum]
Length=472

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_006644591.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Oryza 
brachyantha]
Length=472

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_006644592.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Oryza 
brachyantha]
Length=387

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In 
Plant
Length=483

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_002456234.1| hypothetical protein SORBIDRAFT_03g032560 [Sorghum bicolor]
 gb|EES01354.1| hypothetical protein SORBIDRAFT_03g032560 [Sorghum bicolor]
Length=470

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_012068944.1| PREDICTED: casein kinase I isoform delta-like [Jatropha curcas]
 ref|XP_012068945.1| PREDICTED: casein kinase I isoform delta-like [Jatropha curcas]
 gb|KDP40745.1| hypothetical protein JCGZ_24744 [Jatropha curcas]
Length=472

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_008806949.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806957.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008806963.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806971.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
Length=474

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNAQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_010232213.1| PREDICTED: casein kinase I-like [Brachypodium distachyon]
Length=471

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_010924972.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Elaeis 
guineensis]
Length=476

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNAQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_002309212.1| casein kinase family protein [Populus trichocarpa]
 gb|EEE92735.1| casein kinase family protein [Populus trichocarpa]
Length=475

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_011003341.1| PREDICTED: casein kinase I isoform delta-like [Populus euphratica]
Length=475

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_010262044.1| PREDICTED: casein kinase I isoform delta-like [Nelumbo nucifera]
Length=475

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_010696534.1| PREDICTED: casein kinase I isoform delta-like [Beta vulgaris 
subsp. vulgaris]
 gb|ABM55249.1| casein kinase [Beta vulgaris]
Length=473

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRK SLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_004969708.1| PREDICTED: casein kinase I isoform delta-like [Setaria italica]
Length=471

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_008459457.1| PREDICTED: casein kinase I isoform delta-like [Cucumis melo]
Length=477

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|KGN60529.1| hypothetical protein Csa_2G000380 [Cucumis sativus]
Length=479

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>dbj|BAD45136.1| putative protein kinase ADK1 [Oryza sativa Japonica Group]
Length=228

 Score =   354 bits (908),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYMIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|NP_001292664.1| casein kinase I isoform delta-like [Cucumis sativus]
 emb|CCM43976.1| Caesin kinase I isoform delta like protein [Cucumis sativus]
Length=479

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_010090074.1| Casein kinase I isoform delta-like protein [Morus notabilis]
 gb|EXB38871.1| Casein kinase I isoform delta-like protein [Morus notabilis]
Length=475

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG K+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGGKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_007012783.1| Casein kinase 1-like protein 2 isoform 1 [Theobroma cacao]
 gb|EOY30402.1| Casein kinase 1-like protein 2 isoform 1 [Theobroma cacao]
Length=470

 Score =   363 bits (931),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGAEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_007012784.1| Casein kinase 1 isoform 2 [Theobroma cacao]
 gb|EOY30403.1| Casein kinase 1 isoform 2 [Theobroma cacao]
Length=463

 Score =   362 bits (930),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGAEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_010924973.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Elaeis 
guineensis]
Length=397

 Score =   360 bits (924),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNAQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_002521378.1| casein kinase, putative [Ricinus communis]
 gb|EEF41046.1| casein kinase, putative [Ricinus communis]
Length=472

 Score =   363 bits (931),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_004507951.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Cicer 
arietinum]
Length=454

 Score =   362 bits (929),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|KHG04851.1| hypothetical protein F383_30273 [Gossypium arboreum]
Length=467

 Score =   362 bits (930),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKY+LGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKYKLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFAH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KJB54402.1| hypothetical protein B456_009G032600 [Gossypium raimondii]
Length=311

 Score =   357 bits (916),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_004507950.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Cicer 
arietinum]
Length=471

 Score =   362 bits (930),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_010242267.1| PREDICTED: casein kinase I isoform delta-like [Nelumbo nucifera]
Length=476

 Score =   362 bits (930),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_003542336.1| PREDICTED: casein kinase I isoform delta-like isoform 1 [Glycine 
max]
 gb|KHN06627.1| Casein kinase I isoform delta-like [Glycine soja]
Length=454

 Score =   362 bits (928),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_012076957.1| PREDICTED: casein kinase I isoform delta-like [Jatropha curcas]
 gb|KDP33855.1| hypothetical protein JCGZ_07426 [Jatropha curcas]
Length=477

 Score =   362 bits (930),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYMIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|KHG04850.1| hypothetical protein F383_30273 [Gossypium arboreum]
Length=480

 Score =   362 bits (930),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKY+LGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKYKLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFAH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_003549210.1| PREDICTED: casein kinase I isoform delta-like isoform 1 [Glycine 
max]
Length=454

 Score =   361 bits (927),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_009597979.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana tomentosiformis]
Length=471

 Score =   362 bits (928),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGIPNVRWFGVEGNYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQV++IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVFVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KEH32501.1| casein kinase I-like protein [Medicago truncatula]
Length=454

 Score =   361 bits (927),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_006371997.1| casein kinase family protein [Populus trichocarpa]
 gb|ERP49794.1| casein kinase family protein [Populus trichocarpa]
Length=475

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN+KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_010925467.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010925468.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Elaeis 
guineensis]
Length=474

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +K FLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  AKYFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_009415492.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=493

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN+KTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNF+MGLGRRANQVYIIDFGLAKKYRDTS+HQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFIMGLGRRANQVYIIDFGLAKKYRDTSSHQHIPYRENKNLTG  175



>ref|XP_006853888.1| PREDICTED: casein kinase I isoform delta-like [Amborella trichopoda]
 gb|ERN15355.1| hypothetical protein AMTR_s00036p00147120 [Amborella trichopoda]
Length=476

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SK FLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKCFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTATHQHIPYRENKNLTG  175



>ref|XP_007154635.1| hypothetical protein PHAVU_003G135100g [Phaseolus vulgaris]
 gb|ESW26629.1| hypothetical protein PHAVU_003G135100g [Phaseolus vulgaris]
Length=455

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|KJB56939.1| hypothetical protein B456_009G142600 [Gossypium raimondii]
Length=475

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKY+LGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKYKLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF H
Sbjct  61   GGTGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFSH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_004239254.1| PREDICTED: casein kinase I isoform delta-like [Solanum lycopersicum]
Length=469

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    METRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRW+GVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGIPNVRWYGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_002281345.2| PREDICTED: casein kinase I isoform delta-like [Vitis vinifera]
 emb|CAN80417.1| hypothetical protein VITISV_024542 [Vitis vinifera]
 emb|CBI27888.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTATHQHIPYRENKNLTG  175



>ref|XP_008813454.1| PREDICTED: casein kinase I isoform delta-like [Phoenix dactylifera]
Length=479

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN QTNEEV IKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNTQTNEEVGIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_010925469.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Elaeis 
guineensis]
Length=470

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +K FLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  AKYFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_009606359.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana tomentosiformis]
Length=471

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/175 (99%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGTNIQTNEE+AIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MESRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEELAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_002277513.2| PREDICTED: casein kinase I isoform delta-like [Vitis vinifera]
 emb|CBI35912.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   360 bits (925),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|KJB54404.1| hypothetical protein B456_009G032600 [Gossypium raimondii]
Length=410

 Score =   358 bits (919),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_006338113.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=468

 Score =   360 bits (924),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/175 (98%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    METRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRW+GVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGIPNVRWYGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_006597822.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Glycine 
max]
Length=312

 Score =   354 bits (909),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAD MINRVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYCIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|KJB54403.1| hypothetical protein B456_009G032600 [Gossypium raimondii]
Length=460

 Score =   359 bits (922),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_008793211.1| PREDICTED: casein kinase I isoform delta-like isoform X3 [Phoenix 
dactylifera]
Length=381

 Score =   357 bits (915),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVE DYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLM+ADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVESDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMIADQMINRVEFLH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +K FLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  AKYFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_011013818.1| PREDICTED: casein kinase I isoform delta-like [Populus euphratica]
Length=474

 Score =   359 bits (922),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN+KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGL KKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLVKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_011079987.1| PREDICTED: casein kinase I-like [Sesamum indicum]
Length=461

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_010049456.1| PREDICTED: casein kinase I isoform delta-like [Eucalyptus grandis]
 gb|KCW82052.1| hypothetical protein EUGRSUZ_C03421 [Eucalyptus grandis]
Length=475

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNF+MGLGRRANQVY+IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFVMGLGRRANQVYVIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_004243748.1| PREDICTED: casein kinase I isoform delta-like [Solanum lycopersicum]
Length=472

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENNKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTS+HQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSSHQHIPYRENKNLTG  175



>ref|XP_006357711.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=472

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENNKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTS+HQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSSHQHIPYRENKNLTG  175



>ref|XP_010909190.1| PREDICTED: casein kinase I isoform delta-like [Elaeis guineensis]
Length=479

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRK+GSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKVGSGSFGEIYLGTNTQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGI NVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGILNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>gb|KHN28842.1| Casein kinase I isoform delta-like [Glycine soja]
Length=456

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAD MINRVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYCIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_003546462.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Glycine 
max]
Length=456

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAD MINRVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYCIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|EEC70925.1| hypothetical protein OsI_02496 [Oryza sativa Indica Group]
Length=472

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYMIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_004151319.1| PREDICTED: casein kinase I isoform delta-like [Cucumis sativus]
 gb|KGN59801.1| hypothetical protein Csa_3G847620 [Cucumis sativus]
Length=471

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK++LGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFKLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|NP_001043372.1| Os01g0570500 [Oryza sativa Japonica Group]
 dbj|BAD45137.1| putative protein kinase ADK1 [Oryza sativa Japonica Group]
 dbj|BAF05286.1| Os01g0570500 [Oryza sativa Japonica Group]
 dbj|BAG99373.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54833.1| hypothetical protein OsJ_02280 [Oryza sativa Japonica Group]
Length=472

 Score =   357 bits (917),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYMIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_008447619.1| PREDICTED: casein kinase I isoform delta-like [Cucumis melo]
Length=470

 Score =   357 bits (917),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/175 (97%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK++LGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFKLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KHG11372.1| hypothetical protein F383_02311 [Gossypium arboreum]
Length=459

 Score =   357 bits (916),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>emb|CDO97889.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   357 bits (916),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGI NVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAD MINRVEFVH
Sbjct  61   GGTGISNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_009409360.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=470

 Score =   357 bits (916),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG+N+Q+NEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGSNVQSNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+VH
Sbjct  61   GGTGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_008656801.1| PREDICTED: casein kinase I isoform delta-like [Zea mays]
 gb|AFW83712.1| putative casein kinase family protein [Zea mays]
Length=172

 Score =   346 bits (887),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENK  711
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDTSTHQHIPYR  K
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRHRK  171



>ref|XP_004287578.1| PREDICTED: casein kinase I isoform delta-like [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   357 bits (916),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 169/175 (97%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGN++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD++T QHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYMIDFGLAKKYRDSTTRQHIPYRENKNLTG  175



>ref|XP_008391353.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=477

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  3    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  63   GGTGVPNVRWFGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  122

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQ+YIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  123  SKSFLHRDIKPDNFLMGLGRRANQIYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  177



>ref|XP_008228258.1| PREDICTED: casein kinase I isoform delta-like [Prunus mume]
Length=475

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQ+Y+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQIYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_007217223.1| hypothetical protein PRUPE_ppa005139mg [Prunus persica]
 gb|EMJ18422.1| hypothetical protein PRUPE_ppa005139mg [Prunus persica]
Length=475

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQ+Y+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQIYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KCW69786.1| hypothetical protein EUGRSUZ_F03150 [Eucalyptus grandis]
Length=359

 Score =   352 bits (904),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE VKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLETVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            G TGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFCSRK SLKTVLMLADQM+NR+EFVH
Sbjct  61   GATGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMMNRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_002299898.2| hypothetical protein POPTR_0001s20450g [Populus trichocarpa]
 gb|EEE84703.2| hypothetical protein POPTR_0001s20450g [Populus trichocarpa]
Length=470

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG NIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGANIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_010685356.1| PREDICTED: casein kinase I isoform delta-like [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLV+DLLGPSLEDLFNFCSRK SLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+++HQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYMIDFGLAKKYRDSTSHQHIPYRENKNLTG  175



>ref|XP_009372402.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
 ref|XP_009340677.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=477

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  3    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  63   GGTGVPNVRWFGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  122

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQ+Y+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  123  SKSFLHRDIKPDNFLMGLGRRANQIYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  177



>gb|KJB83052.1| hypothetical protein B456_013G227100 [Gossypium raimondii]
Length=310

 Score =   350 bits (899),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 174/175 (99%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNV+VMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVMVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNF+MGLGRRANQVY+IDFGLAKKYRD S+HQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFIMGLGRRANQVYMIDFGLAKKYRD-SSHQHIPYRENKNLTG  174



>gb|EEC79796.1| hypothetical protein OsI_21224 [Oryza sativa Indica Group]
Length=473

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_007138711.1| hypothetical protein PHAVU_009G230800g [Phaseolus vulgaris]
 gb|ESW10705.1| hypothetical protein PHAVU_009G230800g [Phaseolus vulgaris]
Length=456

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQ NEEVA+KLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQNNEEVAVKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  CKSFLHRDIKPDNFLMGLGRRANQVYCIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|KCW53570.1| hypothetical protein EUGRSUZ_J02844 [Eucalyptus grandis]
Length=365

 Score =   352 bits (903),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE VKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTHVQTNEEVAIKLEPVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGIPNVRWFGAEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|NP_001056503.1| Os05g0593800 [Oryza sativa Japonica Group]
 gb|AAT44307.1| putative protein kinase ADK1 [Oryza sativa Japonica Group]
 dbj|BAF18417.1| Os05g0593800 [Oryza sativa Japonica Group]
 dbj|BAG99503.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64906.1| hypothetical protein OsJ_19766 [Oryza sativa Japonica Group]
Length=473

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_008793206.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793207.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793208.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
Length=475

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVE DYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLM+ADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVESDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMIADQMINRVEFLH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +K FLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  AKYFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_008793210.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Phoenix 
dactylifera]
Length=394

 Score =   353 bits (905),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVE DYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLM+ADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVESDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMIADQMINRVEFLH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +K FLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  AKYFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_006597037.1| PREDICTED: uncharacterized protein LOC100795570 isoform X1 [Glycine 
max]
Length=471

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVANKFRLGRKIGSGSFGEIYLGTNTQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCTRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KJB83051.1| hypothetical protein B456_013G227100 [Gossypium raimondii]
Length=335

 Score =   351 bits (900),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 174/175 (99%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNV+VMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVMVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNF+MGLGRRANQVY+IDFGLAKKYRD S+HQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFIMGLGRRANQVYMIDFGLAKKYRD-SSHQHIPYRENKNLTG  174



>gb|KHN30066.1| Casein kinase I isoform delta-like [Glycine soja]
Length=472

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRKIGSGSFGEIYLGTN QTNEEVA+KLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVANKFRLGRKIGSGSFGEIYLGTNTQTNEEVAVKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCTRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KDO65165.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=404

 Score =   353 bits (906),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLQYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAK+YRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKRYRDTATHQHIPYRENKNLTG  175



>ref|XP_006342964.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=471

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKK+RD++THQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKFRDSTTHQHIPYRENKNLTG  175



>ref|XP_008242376.1| PREDICTED: casein kinase I isoform delta-like [Prunus mume]
Length=470

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMI+RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMISRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD++T QHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYMIDFGLAKKYRDSTTRQHIPYRENKNLTG  175



>ref|XP_004235583.1| PREDICTED: casein kinase I isoform delta-like [Solanum lycopersicum]
Length=470

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKK+RD++THQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKFRDSTTHQHIPYRENKNLTG  175



>ref|XP_006465998.1| PREDICTED: casein kinase I isoform delta-like [Citrus sinensis]
 gb|KDO65157.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=474

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLQYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAK+YRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKRYRDTATHQHIPYRENKNLTG  175



>ref|XP_006426585.1| hypothetical protein CICLE_v10025527mg [Citrus clementina]
 gb|ESR39825.1| hypothetical protein CICLE_v10025527mg [Citrus clementina]
Length=474

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLQYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAK+YRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKRYRDTATHQHIPYRENKNLTG  175



>ref|XP_003597565.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|AES67816.1| casein kinase I-like protein [Medicago truncatula]
Length=475

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN+KTKHPQLLYESKLY++LQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEG+YNVLVMDLLGPSLEDLF+FCSRKLSLKTVLMLADQMINRVE++H
Sbjct  61   GGTGIPNVRWFGVEGEYNVLVMDLLGPSLEDLFSFCSRKLSLKTVLMLADQMINRVEYIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_010062655.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Eucalyptus 
grandis]
Length=474

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE VKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLETVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            G TGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFCSRK SLKTVLMLADQM+NR+EFVH
Sbjct  61   GATGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMMNRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_009335830.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=476

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  3    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNVRW+G EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  63   GGTGVPNVRWYGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  122

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQ+YIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  123  SKSFLHRDIKPDNFLMGLGRRANQIYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  177



>gb|KCW69785.1| hypothetical protein EUGRSUZ_F03150 [Eucalyptus grandis]
Length=433

 Score =   353 bits (906),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE VKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLETVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            G TGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFCSRK SLKTVLMLADQM+NR+EFVH
Sbjct  61   GATGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMMNRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|EYU45867.1| hypothetical protein MIMGU_mgv1a005939mg [Erythranthe guttata]
Length=464

 Score =   354 bits (909),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCS KLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSSKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|EPS64220.1| hypothetical protein M569_10560 [Genlisea aurea]
Length=444

 Score =   353 bits (907),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIP VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPGVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_008352372.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=459

 Score =   354 bits (908),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN KTKHPQLLYESKLYRIL 
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENAKTKHPQLLYESKLYRILS  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMI+RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMISRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+ST QHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYMIDFGLAKKYRDSSTRQHIPYRENKNLTG  175



>ref|XP_008337722.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=459

 Score =   354 bits (908),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN KTKHPQLLYESKLYRIL 
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENAKTKHPQLLYESKLYRILS  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMI+RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMISRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+ST QHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYMIDFGLAKKYRDSSTRQHIPYRENKNLTG  175



>ref|XP_002864491.1| hypothetical protein ARALYDRAFT_918863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40750.1| hypothetical protein ARALYDRAFT_918863 [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>gb|KJB83050.1| hypothetical protein B456_013G227100 [Gossypium raimondii]
Length=465

 Score =   354 bits (908),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 174/175 (99%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNV+VMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVMVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNF+MGLGRRANQVY+IDFGLAKKYRD S+HQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFIMGLGRRANQVYMIDFGLAKKYRD-SSHQHIPYRENKNLTG  174



>gb|KHG23724.1| hypothetical protein F383_04752 [Gossypium arboreum]
Length=465

 Score =   354 bits (908),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 174/175 (99%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNV+VMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVMVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNF+MGLGRRANQVY+IDFGLAKKYRD S+HQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFIMGLGRRANQVYMIDFGLAKKYRD-SSHQHIPYRENKNLTG  174



>ref|XP_004303659.1| PREDICTED: casein kinase I [Fragaria vesca subsp. vesca]
Length=473

 Score =   354 bits (909),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQ+Y+IDFGLAKKYRDTSTHQHIPYR+NKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQIYVIDFGLAKKYRDTSTHQHIPYRDNKNLTG  175



>gb|KJB83053.1| hypothetical protein B456_013G227100 [Gossypium raimondii]
Length=444

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 174/175 (99%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNV+VMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVMVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNF+MGLGRRANQVY+IDFGLAKKYRD S+HQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFIMGLGRRANQVYMIDFGLAKKYRD-SSHQHIPYRENKNLTG  174



>ref|XP_006413231.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
 gb|ESQ54684.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
Length=461

 Score =   354 bits (908),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MESRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_006654877.1| PREDICTED: casein kinase I isoform delta-like [Oryza brachyantha]
Length=468

 Score =   354 bits (908),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLG+RANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGKRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_011009775.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Populus 
euphratica]
Length=470

 Score =   354 bits (908),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG NIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGANIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KHN35865.1| Casein kinase I isoform delta-like [Glycine soja]
Length=443

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNNQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGL RRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLRRRANQVYCIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_011009776.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Populus 
euphratica]
Length=470

 Score =   354 bits (908),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG NIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGANIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_010537581.1| PREDICTED: casein kinase I [Tarenaya hassleriana]
 ref|XP_010537582.1| PREDICTED: casein kinase I [Tarenaya hassleriana]
Length=463

 Score =   353 bits (907),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNE+VAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEDVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGIPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_003567780.1| PREDICTED: casein kinase I-like [Brachypodium distachyon]
Length=473

 Score =   354 bits (908),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYCIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_006413230.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
 gb|ESQ54683.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
Length=460

 Score =   353 bits (907),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MESRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_009361635.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=466

 Score =   354 bits (908),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 168/175 (96%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRIL 
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILA  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMI+RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMISRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD++T QHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYMIDFGLAKKYRDSTTRQHIPYRENKNLTG  175



>ref|XP_009795173.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana sylvestris]
Length=472

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEV +KLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVGVKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_002441634.1| hypothetical protein SORBIDRAFT_09g030690 [Sorghum bicolor]
 gb|EES20064.1| hypothetical protein SORBIDRAFT_09g030690 [Sorghum bicolor]
Length=474

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_001784922.1| predicted protein [Physcomitrella patens]
 gb|EDQ50269.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEV IKLE++KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVGIKLESIKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFG+EGDYNVLV+DLLGPSLEDLFNFCSRK SLKTVLMLADQ+INRVE+VH
Sbjct  61   GGTGIPNIRWFGIEGDYNVLVLDLLGPSLEDLFNFCSRKFSLKTVLMLADQLINRVEYVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD STHQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDPSTHQHIPYRENKNLTG  175



>ref|XP_003533767.1| PREDICTED: casein kinase I isoform delta-like [Glycine max]
Length=456

 Score =   353 bits (906),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNNQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGL RRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLRRRANQVYCIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_011009743.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Populus 
euphratica]
Length=398

 Score =   351 bits (901),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLAD MINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_003543581.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Glycine 
max]
 ref|XP_006595083.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Glycine 
max]
Length=472

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRKIGSGSFGEIYLGTN QTNEEVA+KLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVANKFRLGRKIGSGSFGEIYLGTNTQTNEEVAVKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCTRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKK+RDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKHRDTSTHQHIPYRENKNLTG  175



>ref|XP_011009742.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Populus 
euphratica]
Length=464

 Score =   353 bits (906),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLAD MINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_001774847.1| predicted protein [Physcomitrella patens]
 gb|EDQ60388.1| predicted protein [Physcomitrella patens]
Length=323

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTN+QTNEEV IKLE++KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNVQTNEEVGIKLESIKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFG+EGDYNVLV+DLLGPSLEDLFNFCSRK SLKTVLMLADQ+INRVE+VH
Sbjct  61   GGTGIPNIRWFGIEGDYNVLVLDLLGPSLEDLFNFCSRKFSLKTVLMLADQLINRVEYVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD STHQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDPSTHQHIPYRENKNLTG  175



>ref|XP_004960994.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Setaria 
italica]
Length=394

 Score =   351 bits (900),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_009631851.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana tomentosiformis]
Length=472

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEV +KLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVGVKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_010033765.1| PREDICTED: casein kinase I isoform delta-like [Eucalyptus grandis]
 gb|KCW53569.1| hypothetical protein EUGRSUZ_J02844 [Eucalyptus grandis]
Length=475

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE VKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTHVQTNEEVAIKLEPVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGIPNVRWFGAEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_010539397.1| PREDICTED: casein kinase I isoform delta-like [Tarenaya hassleriana]
Length=455

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIK ENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKFENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN +WFGVEGDYNVL MDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGVPNAKWFGVEGDYNVLAMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_009387717.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
 ref|XP_009387718.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+W+GVEGDYNVLV+DLLGPSLEDLF+FCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWYGVEGDYNVLVIDLLGPSLEDLFSFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFL+GLGRR NQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLVGLGRRVNQVYMIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_006385411.1| hypothetical protein POPTR_0003s04170g [Populus trichocarpa]
 gb|ERP63208.1| hypothetical protein POPTR_0003s04170g [Populus trichocarpa]
Length=464

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLAD MINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KJB06829.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=365

 Score =   349 bits (896),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SK+FLHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKAFLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|KJB06826.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=459

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SK+FLHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKAFLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_010536868.1| PREDICTED: casein kinase I isoform delta-like [Tarenaya hassleriana]
Length=448

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEE+AIK ENVKT+HPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEIAIKFENVKTRHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGVPNIKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>gb|KJB06827.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=463

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SK+FLHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKAFLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_009798249.1| PREDICTED: casein kinase I-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009798250.1| PREDICTED: casein kinase I-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009798251.1| PREDICTED: casein kinase I-like isoform X2 [Nicotiana sylvestris]
 ref|XP_009798252.1| PREDICTED: casein kinase I-like isoform X3 [Nicotiana sylvestris]
 ref|XP_009798253.1| PREDICTED: casein kinase I-like isoform X3 [Nicotiana sylvestris]
Length=466

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG N+QTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGANVQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++WFGVEGDYN LVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNLKWFGVEGDYNALVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYMIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_006282246.1| hypothetical protein CARUB_v10028520mg [Capsella rubella]
 gb|EOA15144.1| hypothetical protein CARUB_v10028520mg [Capsella rubella]
Length=435

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE  H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVELFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_006357391.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=467

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG N+QTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGGNVQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRK+SLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGVPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKMSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|ACT34059.1| putative protein kinase [Aegilops tauschii]
Length=474

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKCRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYCIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|NP_194340.1| casein kinase 1 [Arabidopsis thaliana]
 sp|P42158.2|KC1D_ARATH RecName: Full=Casein kinase I isoform delta-like; Short=CKI-delta 
[Arabidopsis thaliana]
 emb|CAB39675.1| Col-0 casein kinase I-like protein [Arabidopsis thaliana]
 emb|CAB79465.1| Col-0 casein kinase I-like protein [Arabidopsis thaliana]
 gb|AAK92719.1| putative Col-0 casein kinase I [Arabidopsis thaliana]
 gb|AAM14238.1| putative Col-0 casein kinase I [Arabidopsis thaliana]
 gb|AAY24532.1| casein kinase 1-like protein 1 [Arabidopsis thaliana]
 gb|AEE85157.1| casein kinase 1 [Arabidopsis thaliana]
Length=450

 Score =   352 bits (902),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEE+AIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_004486851.1| PREDICTED: casein kinase I isoform delta-like [Cicer arietinum]
Length=480

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+ NK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN+KTKHPQLLYESKLY++LQ
Sbjct  1    MEPRIANKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEG+YNVLVMDLLGPSLEDLF+FCSRKLSLKTVLMLADQMINRVE++H
Sbjct  61   GGTGIPNVRWFGVEGEYNVLVMDLLGPSLEDLFSFCSRKLSLKTVLMLADQMINRVEYIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KHN11262.1| Casein kinase I isoform delta-like [Glycine soja]
Length=476

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVA+KLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAVKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GG GIPNV+W+GVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQM+NRVEFVH
Sbjct  61   GGNGIPNVKWYGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMLNRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_006585502.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Glycine 
max]
Length=478

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVA+KLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAVKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GG GIPNV+W+GVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQM+NRVEFVH
Sbjct  61   GGNGIPNVKWYGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMLNRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_006286042.1| hypothetical protein CARUB_v10007571mg [Capsella rubella]
 gb|EOA18940.1| hypothetical protein CARUB_v10007571mg [Capsella rubella]
Length=453

 Score =   352 bits (902),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNI TNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MESRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_004960993.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Setaria 
italica]
Length=474

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KHG18061.1| hypothetical protein F383_22405 [Gossypium arboreum]
Length=463

 Score =   352 bits (903),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SK+FLHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKAFLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_006585503.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Glycine 
max]
Length=476

 Score =   352 bits (904),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVA+KLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAVKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GG GIPNV+W+GVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQM+NRVEFVH
Sbjct  61   GGNGIPNVKWYGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMLNRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>emb|CDM83167.1| unnamed protein product [Triticum aestivum]
Length=467

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRVGNKYRLGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGI NV+WFGVEGDYNVLVMD+LGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGISNVKWFGVEGDYNVLVMDVLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYMIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|EPS64405.1| hypothetical protein M569_10374, partial [Genlisea aurea]
Length=303

 Score =   346 bits (887),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLG+KIGSGSFGEIYLGTNIQTNEEVAIKLE+ KT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGKKIGSGSFGEIYLGTNIQTNEEVAIKLESAKTRHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GG GIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVE++H
Sbjct  61   GGNGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEYIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|KJB06830.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=467

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SK+FLHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKAFLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_008650083.1| PREDICTED: casein kinase I isoform delta-like [Zea mays]
Length=474

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVEF H
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVY+IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYVIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_010448325.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=453

 Score =   351 bits (900),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE  H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVELFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_010433551.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=453

 Score =   351 bits (900),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE  H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVELFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_010438803.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=453

 Score =   351 bits (900),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE  H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVELFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_008656114.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Zea 
mays]
 gb|AFW81338.1| putative casein kinase family protein [Zea mays]
Length=393

 Score =   348 bits (894),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+ C+RKLSLKTVLM+ADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSCCNRKLSLKTVLMIADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_002867580.1| hypothetical protein ARALYDRAFT_492204 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43839.1| hypothetical protein ARALYDRAFT_492204 [Arabidopsis lyrata subsp. 
lyrata]
Length=454

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>gb|KFK27260.1| hypothetical protein AALP_AA8G358800 [Arabis alpina]
Length=432

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVK+KHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKSKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>gb|KHN39324.1| Casein kinase I isoform delta-like [Glycine soja]
Length=474

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVA+KLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAVKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GG GIPNV+W+GVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQM+NRVEFVH
Sbjct  61   GGNGIPNVKWYGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMLNRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_009395780.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+W+GVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVKWYGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFMH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KDO65159.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=475

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/176 (95%), Positives = 174/176 (99%), Gaps = 1/176 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLQYEAKLYKILQ  60

Query  379  GG-TGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFV  555
            GG TGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFV
Sbjct  61   GGSTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFV  120

Query  556  HSKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            HSKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAK+YRDT+THQHIPYRENKNLTG
Sbjct  121  HSKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKRYRDTATHQHIPYRENKNLTG  176



>ref|XP_004241866.1| PREDICTED: casein kinase I-like [Solanum lycopersicum]
Length=467

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG N+QTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGGNVQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFC+RK+SLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGVPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKMSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>gb|AFV33949.1| casein kinase I [Gossypium hirsutum]
Length=463

 Score =   350 bits (898),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SK+FLHRDIKPDNFLMGLGRR NQVYIID+GLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKAFLHRDIKPDNFLMGLGRRTNQVYIIDYGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_008656113.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Zea 
mays]
 gb|AFW81339.1| putative casein kinase family protein [Zea mays]
Length=475

 Score =   350 bits (898),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 174/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+ C+RKLSLKTVLM+ADQMINRVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSCCNRKLSLKTVLMIADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>gb|KFK29120.1| hypothetical protein AALP_AA7G091500 [Arabis alpina]
Length=458

 Score =   349 bits (895),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLETVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKY+D++T+QHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYKDSTTNQHIPYRENKNLTG  175



>ref|NP_001242599.1| uncharacterized protein LOC100795570 [Glycine max]
 gb|ACU21096.1| unknown [Glycine max]
Length=471

 Score =   349 bits (896),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRKIGSGS  EIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVANKFRLGRKIGSGSSCEIYLGTNTQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLADQMINRVEF+H
Sbjct  61   GGTGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCTRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY IDFGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDTSTHQHIPYRENKNLTG  175



>ref|XP_006401255.1| hypothetical protein EUTSA_v10013573mg [Eutrema salsugineum]
 gb|ESQ42708.1| hypothetical protein EUTSA_v10013573mg [Eutrema salsugineum]
Length=367

 Score =   346 bits (887),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_008338713.1| PREDICTED: casein kinase I isoform alpha-like [Malus domestica]
Length=208

 Score =   340 bits (871),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  3    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNVRW+G EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  63   GGTGVPNVRWYGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  122

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKN  714
            SKSFLHRDIKPDNFLMGLGRRANQ+YIIDFGLAKKYRDTSTHQHIPYR   N
Sbjct  123  SKSFLHRDIKPDNFLMGLGRRANQIYIIDFGLAKKYRDTSTHQHIPYRCTAN  174



>ref|XP_002972659.1| hypothetical protein SELMODRAFT_231975 [Selaginella moellendorffii]
 gb|EFJ25880.1| hypothetical protein SELMODRAFT_231975 [Selaginella moellendorffii]
Length=315

 Score =   343 bits (881),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFG+EGDYN LV+DLLGPSLEDLFNFC+RK SLKTVLMLADQ+INRVE+VH
Sbjct  61   GGTGIPNIRWFGIEGDYNGLVLDLLGPSLEDLFNFCNRKFSLKTVLMLADQLINRVEYVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD STHQHI YRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDPSTHQHIAYRENKNLTG  175



>ref|NP_680447.1| casein kinase I-like 12 [Arabidopsis thaliana]
 gb|AAL49861.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14260.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43502.1| putative Col-0 casein kinase I-like protein [Arabidopsis thaliana]
 gb|AAY24545.1| casein kinase 1-like protein 12 [Arabidopsis thaliana]
 gb|AED96834.1| casein kinase I-like 12 [Arabidopsis thaliana]
Length=435

 Score =   348 bits (892),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++WFGVEGDYN LVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNIKWFGVEGDYNTLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQV+IIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVHIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_006401254.1| hypothetical protein EUTSA_v10013573mg [Eutrema salsugineum]
 gb|ESQ42707.1| hypothetical protein EUTSA_v10013573mg [Eutrema salsugineum]
Length=438

 Score =   348 bits (892),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_009400542.1| PREDICTED: casein kinase I isoform delta-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=379

 Score =   345 bits (886),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRK+GSGSFGEI+LGTNIQTNEEVAIKLENVKTKHPQLLYESK+Y+ILQ
Sbjct  1    MEPRVANKFRLGRKVGSGSFGEIFLGTNIQTNEEVAIKLENVKTKHPQLLYESKVYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLVMDLLGPSLEDLFNFC+RK SLKTVLMLAD MINRVEFVH
Sbjct  61   GGTGIPNMRWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKFSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SK FLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+ST+QHIPYRENKNLTG
Sbjct  121  SKCFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTYQHIPYRENKNLTG  175



>ref|XP_010483192.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=437

 Score =   347 bits (891),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  3    MESRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  63   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  122

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHI YRENKNLTG
Sbjct  123  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIAYRENKNLTG  177



>ref|XP_002988150.1| hypothetical protein SELMODRAFT_127114 [Selaginella moellendorffii]
 gb|EFJ10942.1| hypothetical protein SELMODRAFT_127114 [Selaginella moellendorffii]
Length=345

 Score =   344 bits (883),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFG+EGDYN LV+DLLGPSLEDLFNFC+RK SLKTVLMLADQ+INRVE+VH
Sbjct  61   GGTGIPNIRWFGIEGDYNGLVLDLLGPSLEDLFNFCNRKFSLKTVLMLADQLINRVEYVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD STHQHI YRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDPSTHQHIAYRENKNLTG  175



>gb|KDO65156.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=473

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 173/175 (99%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKL NVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKL-NVKTKHPQLQYEAKLYKILQ  59

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  60   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  119

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAK+YRDT+THQHIPYRENKNLTG
Sbjct  120  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKRYRDTATHQHIPYRENKNLTG  174



>gb|ABK24232.1| unknown [Picea sitchensis]
Length=481

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQ+NEEVAIKLENVKTKHPQL+YE+KLYR+LQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQSNEEVAIKLENVKTKHPQLVYEAKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGI NVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGIANVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            S+ FLHRD+KPDNFLMGLGRRANQVY+IDFGLAKKYRD  +HQHIPYRENKNLTG
Sbjct  121  SRCFLHRDVKPDNFLMGLGRRANQVYVIDFGLAKKYRDPVSHQHIPYRENKNLTG  175



>ref|XP_010474302.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=196

 Score =   338 bits (867),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLG+KIG GSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGKKIGGGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S HQHIPYRENKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNHQHIPYRENKNLTG  174



>ref|XP_010443365.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
 ref|XP_010443366.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=438

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  3    MESRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  63   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  122

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHI YRENKNLTG
Sbjct  123  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIAYRENKNLTG  177



>ref|XP_009407307.1| PREDICTED: casein kinase I-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG+K+RLGRKIGSGSFGEIYLG NIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGDKFRLGRKIGSGSFGEIYLGINIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRW+G+EG+YNVLVMDLLGPSLEDLFNFC RK SLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWYGIEGEYNVLVMDLLGPSLEDLFNFCGRKFSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SK FLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPYRENKNLTG
Sbjct  121  SKYFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPYRENKNLTG  175



>ref|XP_007135523.1| hypothetical protein PHAVU_010G136500g [Phaseolus vulgaris]
 gb|ESW07517.1| hypothetical protein PHAVU_010G136500g [Phaseolus vulgaris]
Length=479

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    METRVGNKFRLGRKIGSGSFGEIYLGTNFQTNEEVAIKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GG GIPNV+W+GVEG+YN+LVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGNGIPNVKWYGVEGEYNILVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRDT+THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTTTHQHIPYRENKNLTG  175



>ref|XP_010531866.1| PREDICTED: casein kinase I isoform delta-like [Tarenaya hassleriana]
Length=462

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG+GSFG+IY+GTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGAGSFGDIYIGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKT LMLADQMINR+E VH
Sbjct  61   GGTGIPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTALMLADQMINRIEIVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKK+RD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKFRDSTTHQHIPYRENKNLTG  175



>emb|CDX94377.1| BnaC01g18070D [Brassica napus]
Length=460

 Score =   347 bits (889),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MESRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>gb|EYU21357.1| hypothetical protein MIMGU_mgv1a023567mg, partial [Erythranthe 
guttata]
Length=319

 Score =   342 bits (876),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLVYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDL NFCSRKLSLKTVLMLA+QMINRVE++H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLSNFCSRKLSLKTVLMLAEQMINRVEYIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLG+RA+QVY IDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGKRAHQVYAIDFGLAKKYRDSNTHQHIPYRENKNLTG  175



>ref|XP_009139890.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=460

 Score =   347 bits (889),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MESRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_010451725.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=438

 Score =   345 bits (886),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVG+KYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  3    MESRVGSKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  63   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  122

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHI YRENKNLTG
Sbjct  123  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIAYRENKNLTG  177



>ref|XP_009349379.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=459

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEI+LGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRIL 
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIHLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILS  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            G TGIPNVRWFGVEG YNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLADQMI+RVEFVH
Sbjct  61   GATGIPNVRWFGVEGGYNVLVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMISRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD+ST QHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYMIDFGLAKKYRDSSTRQHIPYRENKNLTG  175



>gb|KJB54401.1| hypothetical protein B456_009G032600 [Gossypium raimondii]
Length=418

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/167 (97%), Positives = 167/167 (100%), Gaps = 0/167 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPY  699
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD+STHQHIPY
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHQHIPY  167



>ref|XP_009400540.1| PREDICTED: casein kinase I-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRK+GSGSFGEI+LGTNIQTNEEVAIKLENVKTKHPQLLYESK+Y+ILQ
Sbjct  1    MEPRVANKFRLGRKVGSGSFGEIFLGTNIQTNEEVAIKLENVKTKHPQLLYESKVYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLVMDLLGPSLEDLFNFC+RK SLKTVLMLAD MINRVEFVH
Sbjct  61   GGTGIPNMRWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKFSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SK FLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+ST+QHIPYRENKNLTG
Sbjct  121  SKCFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTYQHIPYRENKNLTG  175



>gb|ABR18116.1| unknown [Picea sitchensis]
Length=479

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGTN+QTNEEVAIKLE+V+TKHPQLLYESKLYRILQ
Sbjct  1    METRVGNKYRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLESVRTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RWFGVEG+YNVLVMDLLGPSLEDLFNFCSRK SLKTVLMLADQMINR+E+VH
Sbjct  61   GGTGIPNIRWFGVEGEYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEYVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDT + QHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTVSFQHIPYRENKNLTG  175



>ref|XP_009395822.1| PREDICTED: casein kinase I-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=424

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 175/206 (85%), Gaps = 31/206 (15%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGT-------------------------------GIPNVRWFGVEGDYNVLVMDLLGPSL  465
            GG+                               GIPNVRWFGVEGDYNVLVMDLLGPSL
Sbjct  61   GGSNENFKPFCCQAVRLNFSISYYCFLFFFFGTAGIPNVRWFGVEGDYNVLVMDLLGPSL  120

Query  466  EDLFNFCSRKLSLKTVLMLADQMINRVEFVHSKSFLHRDIKPDNFLMGLGRRANQVYIID  645
            EDLFNFCSRKLSLKTVLMLADQMINRVEFVHSKSFLHRDIKPDNF+MGLGRRANQVYIID
Sbjct  121  EDLFNFCSRKLSLKTVLMLADQMINRVEFVHSKSFLHRDIKPDNFIMGLGRRANQVYIID  180

Query  646  FGLAKKYRDTSTHQHIPYRENKNLTG  723
            FGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  181  FGLAKKYRDTSTHQHIPYRENKNLTG  206



>emb|CDY11892.1| BnaC03g13180D [Brassica napus]
Length=430

 Score =   343 bits (881),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEI+LGT++QTNEEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIHLGTHLQTNEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_006390631.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
 gb|ESQ27917.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
Length=316

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S HQHIPYR+NKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNHQHIPYRDNKNLTG  174



>ref|NP_177415.1| casein kinase 1-like protein 2 [Arabidopsis thaliana]
 gb|AAG51841.1|AC010926_4 putative casein kinase I; 37964-34339 [Arabidopsis thaliana]
 gb|AAL24332.1| putative casein kinase I [Arabidopsis thaliana]
 gb|AAQ55279.1| At1g72710 [Arabidopsis thaliana]
 gb|AAY24533.1| casein kinase 1-like protein 2 [Arabidopsis thaliana]
 gb|AEE35363.1| casein kinase 1-like protein 2 [Arabidopsis thaliana]
Length=465

 Score =   344 bits (883),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S HQHIPYRENKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNHQHIPYRENKNLTG  174



>ref|XP_004510406.1| PREDICTED: casein kinase I isoform delta-like [Cicer arietinum]
Length=474

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEV IKLENVKTKHPQLLYE+KLY++LQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVGIKLENVKTKHPQLLYEAKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++W GVEG+YNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNIKWSGVEGEYNVLVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKK+RD++TH+HIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKFRDSTTHRHIPYRENKNLTG  175



>ref|XP_002887448.1| hypothetical protein ARALYDRAFT_476408 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63707.1| hypothetical protein ARALYDRAFT_476408 [Arabidopsis lyrata subsp. 
lyrata]
Length=465

 Score =   344 bits (882),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S HQHIPYRENKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNHQHIPYRENKNLTG  174



>ref|XP_004969013.1| PREDICTED: casein kinase I isoform delta-like [Setaria italica]
Length=469

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRK+GSGSFGEIYLGT++QTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVANKFRLGRKLGSGSFGEIYLGTHVQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLADQMINRVE+VH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEYVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLG+RANQVY+IDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  IKSFLHRDIKPDNFLMGLGKRANQVYMIDFGLAKKYRDSATHQHIPYRENKNLTG  175



>ref|XP_009394112.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 167/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHP+LLYESKLYRILQ
Sbjct  1    MEPRVENKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPRLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+ FGVEGD+NVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQ INRVEFVH
Sbjct  61   GGTGIPNVKRFGVEGDHNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQTINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYR TSTHQHIPYRENKNLTG
Sbjct  121  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRVTSTHQHIPYRENKNLTG  175



>ref|XP_009395820.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=501

 Score =   345 bits (885),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 175/206 (85%), Gaps = 31/206 (15%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGT-------------------------------GIPNVRWFGVEGDYNVLVMDLLGPSL  465
            GG+                               GIPNVRWFGVEGDYNVLVMDLLGPSL
Sbjct  61   GGSNENFKPFCCQAVRLNFSISYYCFLFFFFGTAGIPNVRWFGVEGDYNVLVMDLLGPSL  120

Query  466  EDLFNFCSRKLSLKTVLMLADQMINRVEFVHSKSFLHRDIKPDNFLMGLGRRANQVYIID  645
            EDLFNFCSRKLSLKTVLMLADQMINRVEFVHSKSFLHRDIKPDNF+MGLGRRANQVYIID
Sbjct  121  EDLFNFCSRKLSLKTVLMLADQMINRVEFVHSKSFLHRDIKPDNFIMGLGRRANQVYIID  180

Query  646  FGLAKKYRDTSTHQHIPYRENKNLTG  723
            FGLAKKYRDTSTHQHIPYRENKNLTG
Sbjct  181  FGLAKKYRDTSTHQHIPYRENKNLTG  206



>ref|XP_006390630.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
 gb|ESQ27916.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
Length=348

 Score =   339 bits (870),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S HQHIPYR+NKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNHQHIPYRDNKNLTG  174



>gb|AAA50233.1| casein kinase I-like protein; similar to the rat delta isoform 
of casein kinase I, Swiss-Prot Accession Number Q06486 [Arabidopsis 
thaliana]
Length=387

 Score =   341 bits (874),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEE+AIKLENVKTKH QLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHQQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+K  NFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKQTNFLMGLGRRANQVYIIDFGLAKKYRDMTTHQHIPYRENKNLTG  175



>emb|CDX88601.1| BnaA03g10480D [Brassica napus]
Length=430

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEI+LGT++QTNEEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIHLGTHLQTNEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_009132156.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=430

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEI+LGT++QTNEEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIHLGTHLQTNEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_003627159.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|AET01635.1| casein kinase I-like protein [Medicago truncatula]
Length=474

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 172/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+W GVEG+YN+LVMDLLGPSLEDLFNFC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWSGVEGEYNILVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKK+RD S HQHIPYRENKNLTG
Sbjct  121  TKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKFRD-SAHQHIPYRENKNLTG  174



>ref|XP_003627160.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|AET01636.1| casein kinase I-like protein [Medicago truncatula]
Length=408

 Score =   340 bits (872),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 172/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+W GVEG+YN+LVMDLLGPSLEDLFNFC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWSGVEGEYNILVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKK+RD S HQHIPYRENKNLTG
Sbjct  121  TKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKFRD-SAHQHIPYRENKNLTG  174



>ref|XP_006390629.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
 gb|ESQ27915.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
Length=466

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S HQHIPYR+NKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNHQHIPYRDNKNLTG  174



>ref|XP_009105934.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
 ref|XP_009105935.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
 ref|XP_009105936.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
Length=467

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+G EGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGTEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S +QHIPYRENKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNNQHIPYRENKNLTG  174



>ref|XP_009105937.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Brassica 
rapa]
 emb|CDX96430.1| BnaA07g30410D [Brassica napus]
Length=465

 Score =   342 bits (876),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+G EGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGTEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S +QHIPYRENKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNNQHIPYRENKNLTG  174



>emb|CDX72938.1| BnaC06g33860D [Brassica napus]
Length=473

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+G EGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGTEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S +QHIPYRENKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNNQHIPYRENKNLTG  174



>ref|XP_009126906.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Brassica 
rapa]
Length=418

 Score =   340 bits (872),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQT+EEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTHEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMI RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMITRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_006302226.1| hypothetical protein CARUB_v10020246mg [Capsella rubella]
 gb|EOA35124.1| hypothetical protein CARUB_v10020246mg [Capsella rubella]
Length=466

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLG+KIG GSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGKKIGGGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S HQHIPYRENKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNHQHIPYRENKNLTG  174



>emb|CDY20695.1| BnaA02g08350D [Brassica napus]
Length=418

 Score =   340 bits (871),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQT+EEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTHEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMI RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMITRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>emb|CDY49859.1| BnaA02g16080D [Brassica napus]
Length=465

 Score =   341 bits (875),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 172/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTDIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++W+GVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNIKWYGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             +SFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD S HQHIPYRENKNLTG
Sbjct  121  QRSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD-SNHQHIPYRENKNLTG  174



>emb|CDY32908.1| BnaC02g11920D [Brassica napus]
Length=419

 Score =   340 bits (871),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQT+EEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTHEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMI RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMITRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_010428166.1| PREDICTED: casein kinase I-like [Camelina sativa]
 ref|XP_010428167.1| PREDICTED: casein kinase I-like [Camelina sativa]
 ref|XP_010428168.1| PREDICTED: casein kinase I-like [Camelina sativa]
Length=460

 Score =   341 bits (874),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLG+KIG GSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGKKIGGGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S HQHIPYRENKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNHQHIPYRENKNLTG  174



>gb|ACJ85725.1| unknown [Medicago truncatula]
 gb|AFK40133.1| unknown [Medicago truncatula]
Length=474

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 172/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNV+W GVEG+YN+LVMDLLGPSLEDLFNFC+RKLSLKTVLMLADQMINRVEFVH
Sbjct  61   GGTGIPNVKWSGVEGEYNILVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRA+QVYIIDFGLAKK+RD S HQHIPYRENKNLTG
Sbjct  121  TKSFLHRDIKPDNFLMGLGRRADQVYIIDFGLAKKFRD-SAHQHIPYRENKNLTG  174



>ref|XP_010416034.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=465

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLG+KIG GSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGKKIGGGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD S HQHIPYRENKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRD-SNHQHIPYRENKNLTG  174



>ref|XP_009126905.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
Length=442

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQT+EEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTHEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+WFGVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLADQMI RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMITRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>gb|KFK41692.1| hypothetical protein AALP_AA2G160600 [Arabis alpina]
Length=461

 Score =   339 bits (869),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 170/175 (97%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPLVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKK+RD S HQHIPYRENKNLTG
Sbjct  121  QKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKFRD-SNHQHIPYRENKNLTG  174



>ref|XP_009120217.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=433

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME  VG K+RLGRKIGSGSFGEI+LGT+IQTNEEVAIKLEN KTKHPQLLYESKLY++LQ
Sbjct  1    MEHLVGKKFRLGRKIGSGSFGEIHLGTHIQTNEEVAIKLENAKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNIKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>emb|CDY38255.1| BnaA10g11030D [Brassica napus]
Length=430

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME  VG K+RLGRKIGSGSFGEI+LGT+IQTNEEVAIKLEN KTKHPQLLYESKLY++LQ
Sbjct  1    MEHLVGKKFRLGRKIGSGSFGEIHLGTHIQTNEEVAIKLENAKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNIKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_001774851.1| predicted protein [Physcomitrella patens]
 gb|EDQ60392.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   332 bits (851),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 170/176 (97%), Gaps = 1/176 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTN+ T+EEV IKLE++K KHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNLVTHEEVGIKLESIKAKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RW+G+EGDYNV+V+DLLGPSLEDLFNFCSRK SLKTVLMLADQ+INRVE+VH
Sbjct  61   GGTGIPNIRWYGIEGDYNVMVLDLLGPSLEDLFNFCSRKFSLKTVLMLADQLINRVEYVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQ-VYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSFLHRDIKPDNFLMGLGRRANQ VY+IDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  AKSFLHRDIKPDNFLMGLGRRANQVVYMIDFGLAKKYRDPTTHQHIPYRENKNLTG  176



>emb|CDY54387.1| BnaC09g53710D [Brassica napus]
Length=433

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME  VG K+RLGRKIGSGSFGEI+LGT+IQTNEEVAIKLEN KTKHPQLLYESKLY++LQ
Sbjct  1    MEHLVGKKFRLGRKIGSGSFGEIHLGTHIQTNEEVAIKLENAKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++WFGVE DYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLADQMINRVE+ H
Sbjct  61   GGTGVPNIKWFGVESDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSFLHRD+KPDNFLMGLGRRANQVYIIDFGLAKKYRD +THQHIPYRENKNLTG
Sbjct  121  SKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDNTTHQHIPYRENKNLTG  175



>ref|XP_007201986.1| hypothetical protein PRUPE_ppa004932mg [Prunus persica]
 gb|EMJ03185.1| hypothetical protein PRUPE_ppa004932mg [Prunus persica]
Length=485

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 171/190 (90%), Gaps = 15/190 (8%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGE---------------IYLGTNIQTNEEVAIKLENVKTK  333
            MEPRVGNK+RLGRKIGSGSF                 IY+ TNIQTNEEVAIKLENVKTK
Sbjct  1    MEPRVGNKFRLGRKIGSGSFERSISLVPFLHLLSYLFIYICTNIQTNEEVAIKLENVKTK  60

Query  334  HPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTV  513
            HPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTV
Sbjct  61   HPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTV  120

Query  514  LMLADQMINRVEFVHSKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHI  693
            LMLADQMI+RVEFVH+KSFLHRDIKPDNFLMGLGRRANQVY+IDFGLAKKYRD++T QHI
Sbjct  121  LMLADQMISRVEFVHAKSFLHRDIKPDNFLMGLGRRANQVYMIDFGLAKKYRDSTTRQHI  180

Query  694  PYRENKNLTG  723
            PYRENKNLTG
Sbjct  181  PYRENKNLTG  190



>ref|XP_009127947.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=465

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 170/175 (97%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTDIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PN++W+GVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLADQMINR+EFVH
Sbjct  61   GGTGVPNIKWYGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             +SFLHRDIKP N LMGLGRRANQVYIIDFGLAKKYRD S HQHIPYRENKNLTG
Sbjct  121  QRSFLHRDIKPVNSLMGLGRRANQVYIIDFGLAKKYRD-SNHQHIPYRENKNLTG  174



>gb|KFK40308.1| hypothetical protein AALP_AA3G358100 [Arabis alpina]
Length=417

 Score =   330 bits (845),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKT HPQL YES++YR+LQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTDIQTNEEVAIKLENVKTPHPQLSYESRIYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++W+GVEGDYNVLVMDLLGPSLEDLF++C+RK +LKTVLMLADQMINR+E++H
Sbjct  61   GGTGIPNMKWYGVEGDYNVLVMDLLGPSLEDLFSYCNRKFTLKTVLMLADQMINRLEYIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKS+LHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STH+HIPYRENK+L G
Sbjct  121  SKSYLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHRHIPYRENKSLIG  175



>ref|XP_003057018.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58663.1| predicted protein [Micromonas pusilla CCMP1545]
Length=293

 Score =   325 bits (833),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            +E RVGNKYRLGRKIGSGSFG+IYLGT+IQT EEV IKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  5    LELRVGNKYRLGRKIGSGSFGDIYLGTHIQTGEEVGIKLESVKTKHPQLLYESKLYKILQ  64

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYN++V+DLLGPSLEDLFNFC+RKLSLKTVLMLADQ+++R+E+VH
Sbjct  65   GGTGIPNVRWFGVEGDYNIMVLDLLGPSLEDLFNFCNRKLSLKTVLMLADQLVSRIEYVH  124

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSF+HRDIKPDNFLMGLG+RANQV IIDFGLAKKYRD  +HQHIPYRENKNLTG
Sbjct  125  SKSFIHRDIKPDNFLMGLGKRANQVNIIDFGLAKKYRDPKSHQHIPYRENKNLTG  179



>ref|XP_002883988.1| hypothetical protein ARALYDRAFT_899935 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60247.1| hypothetical protein ARALYDRAFT_899935 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++W+GVEGDYNVLVMDLLGPSLEDLF +C RK SLKTVLMLADQMINR+EF+H
Sbjct  61   GGTGIPNMKWYGVEGDYNVLVMDLLGPSLEDLFGYCHRKFSLKTVLMLADQMINRLEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKS+LHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STH+HIPYRENK+L G
Sbjct  121  SKSYLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHRHIPYRENKSLIG  175



>ref|NP_179537.1| casein kinase I-like 5 [Arabidopsis thaliana]
 gb|AAD10146.1| putative casein kinase I [Arabidopsis thaliana]
 gb|AAM20688.1| putative casein kinase I [Arabidopsis thaliana]
 gb|AAM64335.1| putative casein kinase I [Arabidopsis thaliana]
 gb|AAP31924.1| At2g19470 [Arabidopsis thaliana]
 gb|AAY24534.1| casein kinase 1-like protein 5 [Arabidopsis thaliana]
 gb|AEC06884.1| casein kinase I-like 5 [Arabidopsis thaliana]
Length=433

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++W+GVEGDYNVLVMDLLGPSLEDLF++C R+ SLKTVLMLADQMINR+EF+H
Sbjct  61   GGTGIPNMKWYGVEGDYNVLVMDLLGPSLEDLFSYCKRQFSLKTVLMLADQMINRLEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKS+LHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STH+HIPYRENK+L G
Sbjct  121  SKSYLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHRHIPYRENKSLIG  175



>ref|XP_002981109.1| hypothetical protein SELMODRAFT_113824 [Selaginella moellendorffii]
 gb|EFJ17810.1| hypothetical protein SELMODRAFT_113824 [Selaginella moellendorffii]
Length=379

 Score =   326 bits (835),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIY G + QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MERRVGNKFRLGRKIGSGSFGEIYHGVHTQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RW+GVEGD+NV+V++LLGPSLEDLFNFC RK SLKTVLMLADQ++NRVE VH
Sbjct  61   GGTGIPNIRWYGVEGDFNVMVIELLGPSLEDLFNFCGRKFSLKTVLMLADQLVNRVELVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSF+HRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD +T+QHIPY+ENKNLTG
Sbjct  121  AKSFIHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDPTTYQHIPYKENKNLTG  175



>ref|XP_002982581.1| hypothetical protein SELMODRAFT_116791 [Selaginella moellendorffii]
 gb|EFJ16334.1| hypothetical protein SELMODRAFT_116791 [Selaginella moellendorffii]
Length=379

 Score =   326 bits (835),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIY G + QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MERRVGNKFRLGRKIGSGSFGEIYHGVHTQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN+RW+GVEGD+NV+V++LLGPSLEDLFNFC RK SLKTVLMLADQ++NRVE VH
Sbjct  61   GGTGIPNIRWYGVEGDFNVMVIELLGPSLEDLFNFCGRKFSLKTVLMLADQLVNRVELVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            +KSF+HRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD +T+QHIPY+ENKNLTG
Sbjct  121  AKSFIHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDPTTYQHIPYKENKNLTG  175



>ref|XP_006409051.1| hypothetical protein EUTSA_v10022691mg [Eutrema salsugineum]
 gb|ESQ50504.1| hypothetical protein EUTSA_v10022691mg [Eutrema salsugineum]
Length=369

 Score =   325 bits (834),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  205  PRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGG  384
            PR+G+K+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR+LQGG
Sbjct  4    PRIGSKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQGG  63

Query  385  TGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVHSK  564
            TGIPN++W+GVEGDYNVLVMDLLGPSLEDLF++C+RK +LKTVLMLADQMINR+EF+HSK
Sbjct  64   TGIPNMKWYGVEGDYNVLVMDLLGPSLEDLFSYCNRKFTLKTVLMLADQMINRLEFIHSK  123

Query  565  SFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            S+LHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STH+HIPYRENK+LTG
Sbjct  124  SYLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHRHIPYRENKSLTG  176



>ref|XP_002502415.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63673.1| predicted protein [Micromonas sp. RCC299]
Length=389

 Score =   325 bits (834),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            +E RVGNKYRLGRKIGSGSFG+IYLGT+IQT EEV IKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  5    LELRVGNKYRLGRKIGSGSFGDIYLGTHIQTGEEVGIKLESVKTKHPQLLYESKLYKILQ  64

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPNVRWFGVEGDYN++V+DLLGPSLEDLFNFC+RKLSLKTVLMLADQ+++R+E+VH
Sbjct  65   GGTGIPNVRWFGVEGDYNIMVLDLLGPSLEDLFNFCNRKLSLKTVLMLADQLVSRIEYVH  124

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSF+HRDIKPDNFLMGLG+RANQV IIDFGLAKKYRD  +HQHIPYRENKNLTG
Sbjct  125  SKSFIHRDIKPDNFLMGLGKRANQVNIIDFGLAKKYRDPKSHQHIPYRENKNLTG  179



>ref|XP_001416096.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94388.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=295

 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            +E RVGNKYRLGRKIGSGSFG+IYLGT+I+TNEEV IKLE+ KTKHPQLLYES+LY+ILQ
Sbjct  7    LELRVGNKYRLGRKIGSGSFGDIYLGTHIKTNEEVGIKLESCKTKHPQLLYESRLYKILQ  66

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNVRW+GVEGDYN++VMDLLGPSLEDLFNFC+RKLSLKTVLMLADQ+++R+E+VH
Sbjct  67   GGTGVPNVRWYGVEGDYNIMVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQLVSRIEYVH  126

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSF+HRDIKPDNFLMGLG+RANQV IIDFGLAKKYRD  TH HIPYRENKNLTG
Sbjct  127  SKSFIHRDIKPDNFLMGLGKRANQVNIIDFGLAKKYRDPKTHLHIPYRENKNLTG  181



>ref|XP_006409052.1| hypothetical protein EUTSA_v10022691mg [Eutrema salsugineum]
 gb|ESQ50505.1| hypothetical protein EUTSA_v10022691mg [Eutrema salsugineum]
Length=441

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  205  PRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGG  384
            PR+G+K+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR+LQGG
Sbjct  4    PRIGSKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQGG  63

Query  385  TGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVHSK  564
            TGIPN++W+GVEGDYNVLVMDLLGPSLEDLF++C+RK +LKTVLMLADQMINR+EF+HSK
Sbjct  64   TGIPNMKWYGVEGDYNVLVMDLLGPSLEDLFSYCNRKFTLKTVLMLADQMINRLEFIHSK  123

Query  565  SFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            S+LHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRD+STH+HIPYRENK+LTG
Sbjct  124  SYLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDSSTHRHIPYRENKSLTG  176



>ref|XP_009112605.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=437

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR GN++RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR++Q
Sbjct  1    MEPRFGNRFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVVQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++WFG EGDYNVLVMDLLGPSLEDLF +CSRK +LKTVLMLADQMINR+EF+H
Sbjct  61   GGTGIPNIKWFGAEGDYNVLVMDLLGPSLEDLFGYCSRKFTLKTVLMLADQMINRLEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKS+LHRDIKPDNFLMGLGRR+NQVYIIDFGLAKK+RD+STH+HIPYRENK+L G
Sbjct  121  SKSYLHRDIKPDNFLMGLGRRSNQVYIIDFGLAKKFRDSSTHRHIPYRENKSLIG  175



>ref|XP_002455818.1| hypothetical protein SORBIDRAFT_03g025700 [Sorghum bicolor]
 gb|EES00938.1| hypothetical protein SORBIDRAFT_03g025700 [Sorghum bicolor]
Length=470

 Score =   326 bits (836),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 170/175 (97%), Gaps = 1/175 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRK+GSGSFGEI+LGT++QTNE+VAIKLEN+KTKHPQLLYE+KLYRILQ
Sbjct  1    MEPRVANKFRLGRKLGSGSFGEIFLGTHVQTNEQVAIKLENMKTKHPQLLYEAKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++WFGVEGDYNVLVMDLLGPSLE+LF+FC+RKLSLKTVLMLADQ+INR+E+VH
Sbjct  61   GGTGIPNIKWFGVEGDYNVLVMDLLGPSLEELFSFCNRKLSLKTVLMLADQLINRIEYVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
             KSFLHRDIKPDNFLMGLG+R NQ Y+IDFGLAKKYRD ST+QHIPYRENKNLTG
Sbjct  121  MKSFLHRDIKPDNFLMGLGKRMNQAYVIDFGLAKKYRD-STNQHIPYRENKNLTG  174



>ref|XP_003595230.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|ABN09106.1| Protein kinase [Medicago truncatula]
 gb|AES65481.1| casein kinase I-like protein [Medicago truncatula]
Length=471

 Score =   326 bits (836),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+R+GRKIGSGSFGEIYLGTNI TNE+VAIKLENV+TK+PQLLYESKLYR+LQ
Sbjct  1    MERRVGNKFRVGRKIGSGSFGEIYLGTNIVTNEDVAIKLENVRTKNPQLLYESKLYRMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            G  GIPN++WFGVEGDYNVLVMDLLGPSLE++FNFCSRKLSLKTVLMLA+QMI RVEFVH
Sbjct  61   GEPGIPNIKWFGVEGDYNVLVMDLLGPSLEEMFNFCSRKLSLKTVLMLAEQMIKRVEFVH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKS LHRDIKPDNFLMGLG+R NQVY IDFGLAKKYRD++THQHIPYRENKNLTG
Sbjct  121  SKSLLHRDIKPDNFLMGLGKRENQVYCIDFGLAKKYRDSTTHQHIPYRENKNLTG  175



>ref|XP_010415390.1| PREDICTED: casein kinase I-like [Camelina sativa]
Length=434

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR GNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR+LQ
Sbjct  1    MEPRFGNKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++W+G EGD+NVLVMDLLGPSLEDLF +C+RK SLKTVLMLADQMINR+EF+H
Sbjct  61   GGTGIPNMKWYGTEGDFNVLVMDLLGPSLEDLFGYCNRKFSLKTVLMLADQMINRLEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKS+LHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STH+HIPYRENK+L G
Sbjct  121  SKSYLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHRHIPYRENKSLIG  175



>ref|XP_010489492.1| PREDICTED: casein kinase I-like [Camelina sativa]
Length=434

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR GNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR+LQ
Sbjct  1    MEPRFGNKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++W+G EGD+NVLVMDLLGPSLEDLF +C+RK SLKTVLMLADQMINR+EF+H
Sbjct  61   GGTGIPNMKWYGTEGDFNVLVMDLLGPSLEDLFGYCNRKFSLKTVLMLADQMINRLEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKS+LHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STH+HIPYRENK+L G
Sbjct  121  SKSYLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHRHIPYRENKSLIG  175



>ref|XP_010467893.1| PREDICTED: casein kinase I-like [Camelina sativa]
Length=434

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR GNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR+LQ
Sbjct  1    MEPRFGNKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++W+G EGD+NVLVMDLLGPSLEDLF +C+RK SLKTVLMLADQMINR+EF+H
Sbjct  61   GGTGIPNMKWYGTEGDFNVLVMDLLGPSLEDLFGYCNRKFSLKTVLMLADQMINRLEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKS+LHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STH+HIPYRENK+L G
Sbjct  121  SKSYLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHRHIPYRENKSLIG  175



>emb|CEG01144.1| Serine/threonine-protein kinase, active site [Ostreococcus tauri]
Length=390

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            +E RVGNKYRLGRKIGSGSFG+IYLGT+I+TNEEV IKLE+ KTKHPQLLYE++LY+ILQ
Sbjct  8    LELRVGNKYRLGRKIGSGSFGDIYLGTHIKTNEEVGIKLESCKTKHPQLLYETRLYKILQ  67

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTG+PNVRW+G+EGDYN++VMDLLGPSLEDLFNFC+RKLSLKTVLMLADQ+++R+E+VH
Sbjct  68   GGTGVPNVRWYGIEGDYNIMVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQLVSRIEYVH  127

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKSF+HRDIKPDNFLMGLG+RANQV IIDFGLAKKYRD  TH HIPYRENKNLTG
Sbjct  128  SKSFIHRDIKPDNFLMGLGKRANQVNIIDFGLAKKYRDPKTHLHIPYRENKNLTG  182



>ref|XP_006296706.1| hypothetical protein CARUB_v10013750mg [Capsella rubella]
 gb|EOA29604.1| hypothetical protein CARUB_v10013750mg [Capsella rubella]
Length=433

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME R+GNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++Y++LQ
Sbjct  1    MEHRIGNKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLAYESRIYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  558
            GGTGIPN++W+G+EGDYNVLVMDLLGPSLEDLF +C+RK SLKTVLMLADQMINR+EF+H
Sbjct  61   GGTGIPNMKWYGIEGDYNVLVMDLLGPSLEDLFGYCNRKFSLKTVLMLADQMINRLEFIH  120

Query  559  SKSFLHRDIKPDNFLMGLGRRANQVYIIDFGLAKKYRDTSTHQHIPYRENKNLTG  723
            SKS+LHRDIKPDNFLMGLGRRANQVYIID+GLAKKYRD+STH+HIPYRENK+L G
Sbjct  121  SKSYLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYRDSSTHRHIPYRENKSLIG  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1337034311616