BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7482

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAJ33892.1|  unnamed protein product                                238   4e-74   Eutrema halophilum
gb|KDO63405.1|  hypothetical protein CISIN_1g014750mg                   239   5e-74   Citrus sinensis [apfelsine]
gb|AGJ98225.1|  BIN2-like protein PSK8                                  241   7e-74   Petunia x hybrida [garden petunia]
gb|KDO63403.1|  hypothetical protein CISIN_1g014750mg                   238   3e-73   Citrus sinensis [apfelsine]
ref|XP_002881146.1|  hypothetical protein ARALYDRAFT_902112             238   4e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_006294432.1|  hypothetical protein CARUB_v10023447mg             237   5e-73   
gb|KFK42959.1|  hypothetical protein AALP_AA1G061200                    238   7e-73   Arabis alpina [alpine rockcress]
gb|KDO63404.1|  hypothetical protein CISIN_1g014750mg                   237   8e-73   Citrus sinensis [apfelsine]
ref|XP_006417928.1|  hypothetical protein EUTSA_v10007772mg             238   9e-73   Eutrema salsugineum [saltwater cress]
ref|XP_009365288.1|  PREDICTED: shaggy-related protein kinase eta...    238   1e-72   Pyrus x bretschneideri [bai li]
ref|XP_002889601.1|  hypothetical protein ARALYDRAFT_470656             237   1e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_006446814.1|  hypothetical protein CICLE_v10015375mg             237   1e-72   Citrus clementina [clementine]
gb|KDO63402.1|  hypothetical protein CISIN_1g014750mg                   237   2e-72   Citrus sinensis [apfelsine]
ref|XP_006468992.1|  PREDICTED: shaggy-related protein kinase zet...    237   2e-72   Citrus sinensis [apfelsine]
ref|XP_007215447.1|  hypothetical protein PRUPE_ppa006349mg             237   2e-72   Prunus persica
ref|XP_008365741.1|  PREDICTED: shaggy-related protein kinase eta...    237   2e-72   
dbj|BAH19519.1|  AT1G06390                                              236   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172127.1|  shaggy-related protein kinase iota                    236   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228934.1|  PREDICTED: shaggy-related protein kinase eta...    236   2e-72   Prunus mume [ume]
ref|XP_006348884.1|  PREDICTED: shaggy-related protein kinase zet...    237   2e-72   Solanum tuberosum [potatoes]
ref|XP_004243275.1|  PREDICTED: shaggy-related protein kinase eta...    237   3e-72   Solanum lycopersicum
gb|EYU30769.1|  hypothetical protein MIMGU_mgv1a006689mg                234   4e-72   Erythranthe guttata [common monkey flower]
ref|XP_010522087.1|  PREDICTED: shaggy-related protein kinase iota      236   4e-72   Tarenaya hassleriana [spider flower]
ref|XP_006307671.1|  hypothetical protein CARUB_v10009298mg             236   4e-72   Capsella rubella
ref|XP_008343093.1|  PREDICTED: shaggy-related protein kinase eta...    235   7e-72   Malus domestica [apple tree]
gb|AAM65084.1|  putative shaggy-like protein kinase dzeta               235   7e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CAA64408.1|  shaggy-like kinase dzeta                               235   8e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180655.1|  Shaggy-related protein kinase zeta                    235   8e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009593779.1|  PREDICTED: shaggy-related protein kinase eta...    235   1e-71   Nicotiana tomentosiformis
emb|CDP15948.1|  unnamed protein product                                235   1e-71   Coffea canephora [robusta coffee]
ref|XP_009801781.1|  PREDICTED: shaggy-related protein kinase eta...    235   1e-71   Nicotiana sylvestris
ref|XP_010104417.1|  Shaggy-related protein kinase zeta                 235   2e-71   
gb|KFK31745.1|  hypothetical protein AALP_AA6G153600                    233   3e-71   Arabis alpina [alpine rockcress]
ref|XP_010457765.1|  PREDICTED: shaggy-related protein kinase iota      234   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009141120.1|  PREDICTED: shaggy-related protein kinase zeta      233   3e-71   Brassica rapa
ref|XP_010486052.1|  PREDICTED: shaggy-related protein kinase iot...    233   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_003540001.1|  PREDICTED: shaggy-related protein kinase zet...    234   4e-71   Glycine max [soybeans]
ref|XP_004149276.1|  PREDICTED: shaggy-related protein kinase eta...    234   4e-71   Cucumis sativus [cucumbers]
ref|XP_010475366.1|  PREDICTED: shaggy-related protein kinase iot...    233   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_008448253.1|  PREDICTED: shaggy-related protein kinase eta...    234   5e-71   Cucumis melo [Oriental melon]
ref|XP_003527338.1|  PREDICTED: shaggy-related protein kinase zet...    233   6e-71   Glycine max [soybeans]
gb|KHN33940.1|  Shaggy-related protein kinase zeta                      233   6e-71   Glycine soja [wild soybean]
ref|XP_010510261.1|  PREDICTED: shaggy-related protein kinase zeta      233   7e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009378929.1|  PREDICTED: shaggy-related protein kinase eta...    233   9e-71   Pyrus x bretschneideri [bai li]
ref|XP_007132829.1|  hypothetical protein PHAVU_011G128000g             233   9e-71   Phaseolus vulgaris [French bean]
gb|EYU30768.1|  hypothetical protein MIMGU_mgv1a006689mg                233   1e-70   Erythranthe guttata [common monkey flower]
ref|XP_010469777.1|  PREDICTED: shaggy-related protein kinase zet...    232   1e-70   Camelina sativa [gold-of-pleasure]
emb|CBI22011.3|  unnamed protein product                                230   1e-70   Vitis vinifera
ref|XP_010557131.1|  PREDICTED: shaggy-related protein kinase zet...    232   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_010557132.1|  PREDICTED: shaggy-related protein kinase zet...    232   1e-70   Tarenaya hassleriana [spider flower]
gb|KHN34245.1|  Shaggy-related protein kinase zeta                      234   2e-70   Glycine soja [wild soybean]
ref|XP_010414192.1|  PREDICTED: shaggy-related protein kinase zet...    231   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_003596712.1|  Shaggy-related protein kinase                      231   7e-70   
ref|XP_010657061.1|  PREDICTED: shaggy-related protein kinase eta...    230   7e-70   Vitis vinifera
gb|AES66963.2|  shaggy-like kinase dzeta                                231   7e-70   Medicago truncatula
ref|XP_007048726.1|  GSK3/SHAGGY-like protein kinase 1 isoform 2        229   8e-70   
ref|XP_004303195.1|  PREDICTED: shaggy-related protein kinase eta...    230   1e-69   Fragaria vesca subsp. vesca
ref|XP_007048725.1|  SHAGGY-related protein kinase dZeta isoform 1      229   2e-69   Theobroma cacao [chocolate]
gb|ACJ85155.1|  unknown                                                 221   3e-69   Medicago truncatula
ref|XP_010100748.1|  Shaggy-related protein kinase eta                  226   4e-69   
gb|KDO77888.1|  hypothetical protein CISIN_1g016950mg                   224   6e-69   Citrus sinensis [apfelsine]
ref|XP_003633016.1|  PREDICTED: shaggy-related protein kinase eta...    226   8e-69   Vitis vinifera
ref|XP_004487575.1|  PREDICTED: shaggy-related protein kinase zet...    228   9e-69   Cicer arietinum [garbanzo]
gb|KDO63406.1|  hypothetical protein CISIN_1g014750mg                   226   1e-68   Citrus sinensis [apfelsine]
ref|NP_001190762.1|  Shaggy-related protein kinase eta                  223   1e-68   
ref|XP_007025343.1|  Kinase superfamily protein isoform 2               226   2e-68   
ref|XP_010689734.1|  PREDICTED: shaggy-related protein kinase eta       226   3e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009593781.1|  PREDICTED: shaggy-related protein kinase zet...    225   3e-68   
ref|XP_006467630.1|  PREDICTED: shaggy-related protein kinase eta...    224   4e-68   Citrus sinensis [apfelsine]
ref|XP_006449527.1|  hypothetical protein CICLE_v10015608mg             224   4e-68   Citrus clementina [clementine]
ref|XP_011082988.1|  PREDICTED: shaggy-related protein kinase eta       226   4e-68   Sesamum indicum [beniseed]
gb|EAY96932.1|  hypothetical protein OsI_18850                          219   4e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_011466966.1|  PREDICTED: shaggy-related protein kinase zet...    224   5e-68   Fragaria vesca subsp. vesca
ref|XP_009365289.1|  PREDICTED: shaggy-related protein kinase zet...    224   6e-68   Pyrus x bretschneideri [bai li]
ref|XP_008365740.1|  PREDICTED: shaggy-related protein kinase zet...    223   7e-68   
ref|XP_007148030.1|  hypothetical protein PHAVU_006G1745000g            219   9e-68   Phaseolus vulgaris [French bean]
ref|XP_008789340.1|  PREDICTED: shaggy-related protein kinase eta       224   9e-68   Phoenix dactylifera
ref|XP_010529205.1|  PREDICTED: shaggy-related protein kinase eta...    224   9e-68   Tarenaya hassleriana [spider flower]
emb|CAN73053.1|  hypothetical protein VITISV_015513                     225   1e-67   Vitis vinifera
ref|XP_008228935.1|  PREDICTED: shaggy-related protein kinase zet...    223   1e-67   Prunus mume [ume]
emb|CDY66894.1|  BnaCnng52760D                                          223   2e-67   Brassica napus [oilseed rape]
ref|XP_011657086.1|  PREDICTED: shaggy-related protein kinase zet...    223   2e-67   Cucumis sativus [cucumbers]
ref|XP_008448254.1|  PREDICTED: shaggy-related protein kinase zet...    223   2e-67   
dbj|BAJ33611.1|  unnamed protein product                                223   3e-67   Eutrema halophilum
gb|AAL77705.1|  AT4g18710/F28A21_120                                    223   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193606.1|  Shaggy-related protein kinase eta                     223   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870026.1|  hypothetical protein ARALYDRAFT_914806             223   3e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_011466967.1|  PREDICTED: shaggy-related protein kinase zet...    222   3e-67   Fragaria vesca subsp. vesca
ref|XP_008343095.1|  PREDICTED: shaggy-related protein kinase zet...    222   4e-67   Malus domestica [apple tree]
gb|KJB34904.1|  hypothetical protein B456_006G089400                    220   4e-67   Gossypium raimondii
gb|KGN46984.1|  hypothetical protein Csa_6G157100                       224   4e-67   Cucumis sativus [cucumbers]
emb|CAA64409.1|  shaggy-like kinase etha                                222   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686226.1|  PREDICTED: shaggy-related protein kinase eta       222   5e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010538570.1|  PREDICTED: shaggy-related protein kinase eta...    222   5e-67   Tarenaya hassleriana [spider flower]
gb|KJB34903.1|  hypothetical protein B456_006G089400                    220   6e-67   Gossypium raimondii
ref|XP_010274430.1|  PREDICTED: shaggy-related protein kinase eta...    223   6e-67   Nelumbo nucifera [Indian lotus]
ref|XP_009144602.1|  PREDICTED: shaggy-related protein kinase zet...    221   6e-67   
ref|XP_009132133.1|  PREDICTED: shaggy-related protein kinase eta       221   7e-67   Brassica rapa
emb|CDO96835.1|  unnamed protein product                                221   7e-67   Coffea canephora [robusta coffee]
ref|XP_012091803.1|  PREDICTED: shaggy-related protein kinase eta       221   7e-67   Jatropha curcas
ref|XP_007149727.1|  hypothetical protein PHAVU_005G094100g             223   7e-67   Phaseolus vulgaris [French bean]
ref|XP_003526266.1|  PREDICTED: shaggy-related protein kinase eta...    221   7e-67   Glycine max [soybeans]
ref|XP_009394828.1|  PREDICTED: shaggy-related protein kinase eta       222   8e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003522493.1|  PREDICTED: shaggy-related protein kinase eta...    221   8e-67   
gb|ABG74917.1|  BIN2-like protein                                       221   9e-67   Brassica napus [oilseed rape]
ref|XP_010052816.1|  PREDICTED: shaggy-related protein kinase eta       222   9e-67   Eucalyptus grandis [rose gum]
ref|XP_008439730.1|  PREDICTED: shaggy-related protein kinase eta       221   1e-66   Cucumis melo [Oriental melon]
ref|XP_009136953.1|  PREDICTED: shaggy-related protein kinase eta...    221   1e-66   Brassica rapa
ref|XP_007136978.1|  hypothetical protein PHAVU_009G089900g             221   1e-66   Phaseolus vulgaris [French bean]
gb|KJB34905.1|  hypothetical protein B456_006G089400                    220   1e-66   Gossypium raimondii
ref|XP_010920339.1|  PREDICTED: shaggy-related protein kinase eta       221   1e-66   Elaeis guineensis
ref|XP_010924595.1|  PREDICTED: shaggy-related protein kinase eta...    221   2e-66   Elaeis guineensis
ref|XP_010655538.1|  PREDICTED: shaggy-related protein kinase eta...    220   2e-66   Vitis vinifera
ref|XP_006285118.1|  hypothetical protein CARUB_v10006451mg             220   2e-66   Capsella rubella
ref|XP_010246462.1|  PREDICTED: shaggy-related protein kinase eta       221   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_002317404.1|  GSK3/SHAGGY-LIKE protein KINASE 1                  220   3e-66   Populus trichocarpa [western balsam poplar]
ref|XP_011039408.1|  PREDICTED: shaggy-related protein kinase eta...    220   3e-66   Populus euphratica
gb|KHG20434.1|  Shaggy-related protein kinase eta                       220   3e-66   Gossypium arboreum [tree cotton]
gb|AES66964.2|  shaggy-like kinase dzeta                                219   3e-66   Medicago truncatula
emb|CDY34051.1|  BnaC03g62810D                                          220   3e-66   Brassica napus [oilseed rape]
gb|AFK40474.1|  unknown                                                 220   3e-66   Medicago truncatula
gb|AFK46922.1|  unknown                                                 219   3e-66   Lotus japonicus
gb|KJB34902.1|  hypothetical protein B456_006G089400                    220   3e-66   Gossypium raimondii
gb|AGV54503.1|  shaggy-related protein kinase eta-like protein          219   4e-66   Phaseolus vulgaris [French bean]
gb|ACJ84750.1|  unknown                                                 219   4e-66   Medicago truncatula
ref|XP_008790026.1|  PREDICTED: shaggy-related protein kinase eta...    220   4e-66   Phoenix dactylifera
ref|XP_004485912.1|  PREDICTED: shaggy-related protein kinase eta...    219   4e-66   Cicer arietinum [garbanzo]
ref|XP_009619543.1|  PREDICTED: shaggy-related protein kinase eta       219   5e-66   Nicotiana tomentosiformis
ref|XP_009781118.1|  PREDICTED: shaggy-related protein kinase eta       219   5e-66   Nicotiana sylvestris
ref|XP_009378930.1|  PREDICTED: shaggy-related protein kinase zet...    219   5e-66   Pyrus x bretschneideri [bai li]
gb|KDO77889.1|  hypothetical protein CISIN_1g016950mg                   219   6e-66   Citrus sinensis [apfelsine]
ref|NP_001054901.1|  Os05g0207500                                       219   7e-66   
gb|KJB68373.1|  hypothetical protein B456_010G241600                    219   1e-65   Gossypium raimondii
ref|XP_010518815.1|  PREDICTED: shaggy-related protein kinase eta...    218   1e-65   Tarenaya hassleriana [spider flower]
gb|KJB68374.1|  hypothetical protein B456_010G241600                    218   1e-65   Gossypium raimondii
ref|XP_002522231.1|  Glycogen synthase kinase-3 beta, putative          218   1e-65   Ricinus communis
ref|XP_007025342.1|  Kinase superfamily protein isoform 1               218   1e-65   
ref|XP_010529206.1|  PREDICTED: shaggy-related protein kinase eta...    218   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_009108386.1|  PREDICTED: shaggy-related protein kinase eta...    218   1e-65   Brassica rapa
ref|XP_003542973.1|  PREDICTED: shaggy-related protein kinase eta...    218   2e-65   Glycine max [soybeans]
ref|XP_002305736.1|  hypothetical protein POPTR_0004s05770g             218   2e-65   
gb|KJB34899.1|  hypothetical protein B456_006G089300                    218   2e-65   Gossypium raimondii
emb|CDY62551.1|  BnaA03g58360D                                          214   2e-65   Brassica napus [oilseed rape]
ref|XP_010999759.1|  PREDICTED: shaggy-related protein kinase eta       218   2e-65   Populus euphratica
ref|XP_003546036.1|  PREDICTED: shaggy-related protein kinase eta...    218   2e-65   Glycine max [soybeans]
gb|ABK95578.1|  unknown                                                 218   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010925615.1|  PREDICTED: shaggy-related protein kinase eta...    218   2e-65   Elaeis guineensis
gb|KDO77890.1|  hypothetical protein CISIN_1g016950mg                   217   3e-65   Citrus sinensis [apfelsine]
ref|XP_006449528.1|  hypothetical protein CICLE_v10015608mg             217   3e-65   
ref|XP_010915474.1|  PREDICTED: shaggy-related protein kinase eta...    218   3e-65   Elaeis guineensis
emb|CDX99437.1|  BnaC01g11150D                                          217   5e-65   
ref|XP_009394192.1|  PREDICTED: shaggy-related protein kinase eta...    218   5e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010496879.1|  PREDICTED: shaggy-related protein kinase eta...    216   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010449479.1|  PREDICTED: shaggy-related protein kinase eta       216   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010439822.1|  PREDICTED: shaggy-related protein kinase eta...    216   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_004134656.1|  PREDICTED: shaggy-related protein kinase eta       216   1e-64   Cucumis sativus [cucumbers]
dbj|BAH57105.1|  AT4G18710                                              215   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293965.1|  PREDICTED: shaggy-related protein kinase eta       215   2e-64   Fragaria vesca subsp. vesca
emb|CDY70859.1|  BnaAnng35300D                                          215   2e-64   Brassica napus [oilseed rape]
ref|XP_008225315.1|  PREDICTED: shaggy-related protein kinase eta       215   2e-64   Prunus mume [ume]
emb|CDX78886.1|  BnaA01g09530D                                          215   2e-64   
ref|XP_007211435.1|  hypothetical protein PRUPE_ppa007161mg             215   2e-64   Prunus persica
emb|CDY64921.1|  BnaC07g50210D                                          214   3e-64   Brassica napus [oilseed rape]
ref|XP_011085977.1|  PREDICTED: shaggy-related protein kinase eta...    215   3e-64   Sesamum indicum [beniseed]
ref|XP_009396521.1|  PREDICTED: shaggy-related protein kinase eta...    215   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010538571.1|  PREDICTED: shaggy-related protein kinase eta...    214   5e-64   Tarenaya hassleriana [spider flower]
gb|KHN29604.1|  Shaggy-related protein kinase eta                       213   7e-64   Glycine soja [wild soybean]
ref|XP_009351457.1|  PREDICTED: shaggy-related protein kinase eta       214   7e-64   Pyrus x bretschneideri [bai li]
ref|XP_004233047.1|  PREDICTED: shaggy-related protein kinase eta       214   7e-64   
ref|XP_008383613.1|  PREDICTED: shaggy-related protein kinase eta       214   8e-64   
ref|XP_008371494.1|  PREDICTED: shaggy-related protein kinase eta...    213   8e-64   Malus domestica [apple tree]
gb|KHN07046.1|  Shaggy-related protein kinase eta                       213   8e-64   Glycine soja [wild soybean]
ref|XP_009352741.1|  PREDICTED: shaggy-related protein kinase eta...    213   9e-64   Pyrus x bretschneideri [bai li]
gb|KCW47359.1|  hypothetical protein EUGRSUZ_K01144                     213   1e-63   Eucalyptus grandis [rose gum]
gb|KJB34900.1|  hypothetical protein B456_006G089300                    213   1e-63   Gossypium raimondii
ref|XP_008794094.1|  PREDICTED: shaggy-related protein kinase eta       214   1e-63   Phoenix dactylifera
ref|XP_003540409.1|  PREDICTED: shaggy-related protein kinase zet...    213   2e-63   Glycine max [soybeans]
gb|EPS63039.1|  hypothetical protein M569_11747                         211   2e-63   Genlisea aurea
gb|ACR37222.1|  unknown                                                 204   2e-63   Zea mays [maize]
ref|XP_006594815.1|  PREDICTED: shaggy-related protein kinase zet...    213   3e-63   Glycine max [soybeans]
gb|EYU28104.1|  hypothetical protein MIMGU_mgv1a008133mg                212   3e-63   Erythranthe guttata [common monkey flower]
ref|XP_010035873.1|  PREDICTED: shaggy-related protein kinase eta...    213   4e-63   Eucalyptus grandis [rose gum]
gb|ACJ83284.1|  unknown                                                 204   6e-63   Medicago truncatula
dbj|BAJ91341.1|  predicted protein                                      211   7e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB68372.1|  hypothetical protein B456_010G241600                    211   8e-63   Gossypium raimondii
gb|AGK41245.1|  SHAGGY-like kinase                                      211   9e-63   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003565257.1|  PREDICTED: shaggy-related protein kinase eta...    211   9e-63   Brachypodium distachyon [annual false brome]
ref|XP_010518816.1|  PREDICTED: shaggy-related protein kinase eta...    211   9e-63   Tarenaya hassleriana [spider flower]
gb|EMT19129.1|  Shaggy-related protein kinase iota                      211   1e-62   
gb|KHN28622.1|  Shaggy-related protein kinase eta                       210   1e-62   Glycine soja [wild soybean]
gb|AGJ93555.1|  SHAGGY-like kinase                                      211   1e-62   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006594547.1|  PREDICTED: shaggy-related protein kinase eta...    210   1e-62   
emb|CDM82043.1|  unnamed protein product                                211   1e-62   Triticum aestivum [Canadian hard winter wheat]
gb|AGJ93554.1|  SHAGGY-like kinase                                      211   2e-62   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009380485.1|  PREDICTED: shaggy-related protein kinase eta...    211   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006367136.1|  PREDICTED: shaggy-related protein kinase eta...    210   2e-62   Solanum tuberosum [potatoes]
ref|XP_009770234.1|  PREDICTED: shaggy-related protein kinase eta...    210   2e-62   Nicotiana sylvestris
ref|XP_004234083.1|  PREDICTED: shaggy-related protein kinase eta...    210   2e-62   Solanum lycopersicum
gb|AFW76550.1|  putative glycogen synthase kinase family protein        204   2e-62   
gb|EYU43326.1|  hypothetical protein MIMGU_mgv1a008172mg                209   4e-62   Erythranthe guttata [common monkey flower]
gb|ERM98330.1|  hypothetical protein AMTR_s00170p00028260               208   5e-62   Amborella trichopoda
ref|XP_004965568.1|  PREDICTED: shaggy-related protein kinase zet...    209   5e-62   Setaria italica
gb|AEQ94156.1|  shaggy-related protein kinase                           203   6e-62   Elaeis guineensis
ref|XP_002873682.1|  kinase family protein                              209   6e-62   
emb|CAB87631.1|  protein kinase MSK-3-like                              209   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453592.1|  PREDICTED: shaggy-related protein kinase eps...    209   7e-62   Camelina sativa [gold-of-pleasure]
ref|XP_006594816.1|  PREDICTED: shaggy-related protein kinase zet...    208   7e-62   Glycine max [soybeans]
ref|XP_006833052.2|  PREDICTED: shaggy-related protein kinase zeta      208   7e-62   Amborella trichopoda
ref|XP_010492276.1|  PREDICTED: shaggy-related protein kinase eps...    209   7e-62   Camelina sativa [gold-of-pleasure]
ref|NP_196968.2|  Shaggy-related protein kinase 13                      209   8e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420109.1|  PREDICTED: shaggy-related protein kinase eps...    209   8e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010231609.1|  PREDICTED: shaggy-related protein kinase eta       209   9e-62   Brachypodium distachyon [annual false brome]
ref|XP_006399977.1|  hypothetical protein EUTSA_v10013689mg             209   9e-62   Eutrema salsugineum [saltwater cress]
gb|AEQ94143.1|  putative Glycogen synthase kinase 3                     203   1e-61   Elaeis guineensis
gb|EEE54080.1|  hypothetical protein OsJ_00810                          209   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|AGJ98224.1|  BIN2-like protein PSK9                                  208   1e-61   Petunia x hybrida [garden petunia]
gb|KJB45482.1|  hypothetical protein B456_007G308500                    204   2e-61   Gossypium raimondii
ref|XP_011085978.1|  PREDICTED: shaggy-related protein kinase eta...    207   2e-61   
ref|XP_006287860.1|  hypothetical protein CARUB_v10001087mg             208   2e-61   
dbj|BAA92966.1|  putative shaggy-like kinase dzeta                      208   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008345980.1|  PREDICTED: shaggy-related protein kinase eta       207   2e-61   
gb|EEC70138.1|  hypothetical protein OsI_00828                          207   2e-61   Oryza sativa Indica Group [Indian rice]
emb|CDX70574.1|  BnaC03g06580D                                          208   3e-61   
emb|CDX78587.1|  BnaA03g04990D                                          208   3e-61   
ref|XP_009131419.1|  PREDICTED: shaggy-related protein kinase eps...    208   3e-61   Brassica rapa
ref|XP_009151155.1|  PREDICTED: shaggy-related protein kinase alpha     207   3e-61   Brassica rapa
ref|XP_009588662.1|  PREDICTED: shaggy-related protein kinase eta...    207   3e-61   Nicotiana tomentosiformis
gb|KDO66115.1|  hypothetical protein CISIN_1g0141741mg                  202   3e-61   Citrus sinensis [apfelsine]
gb|ACG33869.1|  shaggy-related protein kinase eta                       207   3e-61   Zea mays [maize]
ref|NP_001130511.1|  uncharacterized protein LOC100191610               207   3e-61   Zea mays [maize]
gb|KDO66112.1|  hypothetical protein CISIN_1g0141741mg                  202   3e-61   Citrus sinensis [apfelsine]
ref|XP_010546768.1|  PREDICTED: shaggy-related protein kinase alpha     207   4e-61   Tarenaya hassleriana [spider flower]
ref|XP_006647108.1|  PREDICTED: shaggy-related protein kinase zet...    206   4e-61   Oryza brachyantha
emb|CDX80585.1|  BnaC07g28590D                                          207   4e-61   
ref|XP_002453590.1|  hypothetical protein SORBIDRAFT_04g008580          207   5e-61   Sorghum bicolor [broomcorn]
ref|XP_011003165.1|  PREDICTED: shaggy-related protein kinase alp...    207   5e-61   Populus euphratica
ref|XP_002302794.1|  Glycogen synthase kinase-3 MsK-3 family protein    207   5e-61   Populus trichocarpa [western balsam poplar]
gb|AGJ93556.1|  SHAGGY-like kinase                                      207   5e-61   Triticum aestivum [Canadian hard winter wheat]
gb|EMS65432.1|  Shaggy-related protein kinase iota                      207   6e-61   Triticum urartu
ref|XP_010550142.1|  PREDICTED: shaggy-related protein kinase eps...    207   6e-61   Tarenaya hassleriana [spider flower]
gb|AFW80358.1|  putative glycogen synthase kinase family protein        204   6e-61   
gb|AGK41246.1|  SHAGGY-like kinase                                      207   6e-61   Triticum aestivum [Canadian hard winter wheat]
gb|AFM94293.1|  glycogen synthase kinase                                206   7e-61   Oncidium hybrid cultivar
ref|NP_001046390.1|  Os02g0236200                                       206   7e-61   
ref|NP_001149135.1|  shaggy-related protein kinase eta                  206   8e-61   Zea mays [maize]
gb|EYU34726.1|  hypothetical protein MIMGU_mgv1a007335mg                206   9e-61   Erythranthe guttata [common monkey flower]
gb|KDO86865.1|  hypothetical protein CISIN_1g015632mg                   203   9e-61   Citrus sinensis [apfelsine]
gb|KDO45354.1|  hypothetical protein CISIN_1g015298mg                   205   1e-60   Citrus sinensis [apfelsine]
ref|XP_002454973.1|  hypothetical protein SORBIDRAFT_03g002380          206   1e-60   Sorghum bicolor [broomcorn]
ref|XP_006299606.1|  hypothetical protein CARUB_v10015785mg             206   1e-60   Capsella rubella
ref|XP_009629200.1|  PREDICTED: shaggy-related protein kinase NtK...    206   1e-60   Nicotiana tomentosiformis
ref|XP_008672878.1|  PREDICTED: shaggy-related protein kinase eta...    207   1e-60   Zea mays [maize]
ref|XP_004230343.1|  PREDICTED: shaggy-related protein kinase NtK-1     206   1e-60   Solanum lycopersicum
gb|AAM62970.1|  shaggy related protein kinase ASK-GAMMA                 206   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493927.1|  PREDICTED: shaggy-related protein kinase alp...    206   1e-60   Camelina sativa [gold-of-pleasure]
gb|KJB45480.1|  hypothetical protein B456_007G308500                    204   1e-60   Gossypium raimondii
emb|CAA53181.1|  shaggy related kinase                                  206   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568486.1|  Shaggy-related protein kinase alpha                   206   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010455024.1|  PREDICTED: shaggy-related protein kinase alp...    206   1e-60   Camelina sativa [gold-of-pleasure]
emb|CAA04265.1|  shaggy-like kinase alpha                               206   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394905.1|  hypothetical protein EUTSA_v10004319mg             206   1e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006289925.1|  hypothetical protein CARUB_v10003541mg             206   1e-60   Capsella rubella
gb|EAZ22360.1|  hypothetical protein OsJ_06019                          206   1e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010421531.1|  PREDICTED: shaggy-related protein kinase alp...    206   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_002874323.1|  hypothetical protein ARALYDRAFT_489503             206   1e-60   
ref|XP_009410923.1|  PREDICTED: shaggy-related protein kinase eta...    205   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392422.1|  PREDICTED: shaggy-related protein kinase eta...    206   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_187235.1|  Shaggy-related protein kinase gamma                   206   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KDO45355.1|  hypothetical protein CISIN_1g015298mg                   204   2e-60   Citrus sinensis [apfelsine]
ref|XP_006408021.1|  hypothetical protein EUTSA_v10020835mg             206   2e-60   Eutrema salsugineum [saltwater cress]
ref|XP_002882438.1|  hypothetical protein ARALYDRAFT_477878             206   2e-60   
ref|XP_006408022.1|  hypothetical protein EUTSA_v10020835mg             206   2e-60   Eutrema salsugineum [saltwater cress]
gb|ABG74911.1|  AtSK12-like protein                                     206   2e-60   Brassica napus [oilseed rape]
ref|XP_009147201.1|  PREDICTED: shaggy-related protein kinase gamma     206   2e-60   Brassica rapa
ref|XP_011040636.1|  PREDICTED: shaggy-related protein kinase alp...    205   2e-60   Populus euphratica
emb|CDY05202.1|  BnaC05g46010D                                          205   2e-60   
emb|CDY49981.1|  BnaC03g34380D                                          206   2e-60   Brassica napus [oilseed rape]
ref|XP_009410924.1|  PREDICTED: shaggy-related protein kinase iot...    204   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI39647.3|  unnamed protein product                                204   2e-60   Vitis vinifera
gb|AAQ23107.1|  shaggy-related protein kinase 2                         206   2e-60   
emb|CDP02094.1|  unnamed protein product                                205   3e-60   
ref|XP_001763265.1|  predicted protein                                  206   3e-60   
gb|ACJ85100.1|  unknown                                                 201   3e-60   
ref|XP_009134851.1|  PREDICTED: shaggy-related protein kinase gamma     205   3e-60   
ref|XP_010251221.1|  PREDICTED: shaggy-related protein kinase eps...    204   3e-60   
ref|XP_002987888.1|  GSK3/shaggy-like protein kinase                    206   3e-60   
ref|XP_010524830.1|  PREDICTED: shaggy-related protein kinase alp...    205   3e-60   
ref|XP_002512564.1|  Glycogen synthase kinase-3 beta, putative          204   3e-60   
gb|ABY60447.1|  serine/threonine protein kinase                         205   3e-60   
gb|ACG33866.1|  shaggy-related protein kinase eta                       204   4e-60   
gb|AGJ93558.1|  SHAGGY-like kinase                                      204   4e-60   
ref|XP_004951349.1|  PREDICTED: shaggy-related protein kinase eta...    205   4e-60   
gb|KDO45353.1|  hypothetical protein CISIN_1g015298mg                   205   4e-60   
gb|AFW71144.1|  putative glycogen synthase kinase family protein        205   4e-60   
ref|NP_001131812.1|  putative glycogen synthase kinase family pro...    204   4e-60   
ref|XP_010486058.1|  PREDICTED: shaggy-related protein kinase gam...    204   4e-60   
ref|XP_010317426.1|  PREDICTED: shaggy-related protein kinase eta...    204   4e-60   
gb|ACG34459.1|  shaggy-related protein kinase eta                       204   4e-60   
ref|XP_012088843.1|  PREDICTED: shaggy-related protein kinase alpha     204   5e-60   
ref|XP_010432712.1|  PREDICTED: shaggy-related protein kinase gam...    204   5e-60   
ref|XP_006382290.1|  hypothetical protein POPTR_0005s00710g             204   5e-60   
ref|XP_008246288.1|  PREDICTED: shaggy-related protein kinase alpha     204   5e-60   
ref|XP_011039006.1|  PREDICTED: shaggy-related protein kinase alpha     204   5e-60   
ref|XP_011092192.1|  PREDICTED: shaggy-related protein kinase alpha     204   5e-60   
ref|XP_007205270.1|  hypothetical protein PRUPE_ppa006473mg             204   5e-60   
ref|XP_006444574.1|  hypothetical protein CICLE_v10020852mg             203   5e-60   
ref|XP_006480288.1|  PREDICTED: shaggy-related protein kinase alp...    204   5e-60   
emb|CDY19757.1|  BnaA09g04100D                                          204   5e-60   
ref|XP_010464137.1|  PREDICTED: shaggy-related protein kinase gamma     204   6e-60   
gb|EEC72801.1|  hypothetical protein OsI_06492                          203   6e-60   
ref|XP_002280673.1|  PREDICTED: shaggy-related protein kinase alpha     204   6e-60   
gb|KDO86864.1|  hypothetical protein CISIN_1g015632mg                   203   6e-60   
ref|NP_001274855.1|  Shaggy-like protein kinase NtK-1                   204   7e-60   
ref|XP_011079505.1|  PREDICTED: shaggy-related protein kinase alp...    204   7e-60   
ref|XP_009111716.1|  PREDICTED: shaggy-related protein kinase alp...    204   7e-60   
emb|CAN64359.1|  hypothetical protein VITISV_041427                     205   7e-60   
emb|CDX87033.1|  BnaC09g03480D                                          204   7e-60   
ref|XP_001781586.1|  predicted protein                                  204   7e-60   
gb|AES82237.2|  glycogen synthase kinase                                203   7e-60   
ref|NP_001167685.1|  shaggy-related protein kinase eta                  204   8e-60   
ref|NP_001131188.1|  putative glycogen synthase kinase family pro...    204   8e-60   
ref|XP_009131508.1|  PREDICTED: shaggy-related protein kinase eps...    201   8e-60   
ref|XP_010251218.1|  PREDICTED: shaggy-related protein kinase eps...    203   8e-60   
gb|AFN42826.1|  GSK3-like protein                                       203   8e-60   
gb|EMT26120.1|  Shaggy-related protein kinase iota                      204   8e-60   
ref|XP_010941497.1|  PREDICTED: shaggy-related protein kinase alpha     204   8e-60   
ref|XP_010270906.1|  PREDICTED: shaggy-related protein kinase alp...    204   9e-60   
ref|XP_009334099.1|  PREDICTED: shaggy-related protein kinase eps...    204   9e-60   
ref|XP_008812956.1|  PREDICTED: shaggy-related protein kinase alp...    204   1e-59   
ref|XP_008343189.1|  PREDICTED: glycogen synthase kinase-3 homolo...    202   1e-59   
gb|KHG02936.1|  Shaggy-related protein kinase alpha                     204   1e-59   
ref|XP_004252662.1|  PREDICTED: shaggy-related protein kinase eps...    203   1e-59   
gb|EYU34725.1|  hypothetical protein MIMGU_mgv1a007335mg                204   1e-59   
ref|XP_006428242.1|  hypothetical protein CICLE_v10013624mg             204   1e-59   
ref|XP_002515218.1|  Glycogen synthase kinase-3 beta, putative          203   1e-59   
ref|XP_011097427.1|  PREDICTED: shaggy-related protein kinase eps...    203   1e-59   
ref|XP_007031229.1|  Shaggy-related kinase 11, 11 isoform 1             203   1e-59   
gb|KJB45479.1|  hypothetical protein B456_007G308500                    203   1e-59   
gb|EEC80781.1|  hypothetical protein OsI_23306                          203   1e-59   
ref|XP_008357735.1|  PREDICTED: shaggy-related protein kinase eps...    203   1e-59   
ref|XP_010251217.1|  PREDICTED: shaggy-related protein kinase eps...    203   1e-59   
ref|XP_004494455.1|  PREDICTED: glycogen synthase kinase-3 homolo...    202   1e-59   
ref|NP_001057824.1|  Os06g0547900                                       203   1e-59   
ref|XP_007031504.1|  Shaggy-like kinase 13 isoform 1                    203   1e-59   
emb|CAA73848.1|  shaggy-like kinase etha (OSKetha)                      203   1e-59   
ref|XP_010660897.1|  PREDICTED: shaggy-related protein kinase eps...    203   1e-59   
emb|CDY27737.1|  BnaA05g31460D                                          206   1e-59   
ref|XP_009759533.1|  PREDICTED: shaggy-related protein kinase eps...    203   1e-59   
gb|ACJ85178.1|  unknown                                                 202   2e-59   
ref|XP_007145031.1|  hypothetical protein PHAVU_007G204000g             203   2e-59   
gb|KCW84977.1|  hypothetical protein EUGRSUZ_B01797                     200   2e-59   
ref|XP_007031506.1|  Shaggy-like kinase 13 isoform 3                    203   2e-59   
ref|XP_006364003.1|  PREDICTED: shaggy-related protein kinase eps...    203   2e-59   
ref|XP_010660896.1|  PREDICTED: shaggy-related protein kinase eps...    203   2e-59   
gb|KHG00969.1|  Glycogen synthase kinase-3 MsK-3                        203   2e-59   
ref|XP_009598967.1|  PREDICTED: shaggy-related protein kinase eps...    203   2e-59   
gb|KJB49765.1|  hypothetical protein B456_008G136600                    203   2e-59   
ref|XP_003591238.1|  Glycogen synthase kinase                           203   2e-59   
ref|XP_010270905.1|  PREDICTED: shaggy-related protein kinase alp...    204   2e-59   
ref|XP_008793304.1|  PREDICTED: shaggy-related protein kinase alp...    203   2e-59   
ref|XP_004252661.1|  PREDICTED: shaggy-related protein kinase eps...    203   2e-59   
ref|XP_007215466.1|  hypothetical protein PRUPE_ppa006497mg             203   2e-59   
sp|P51137.1|MSK1_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    203   2e-59   
ref|XP_008230580.1|  PREDICTED: shaggy-related protein kinase eps...    203   2e-59   
gb|EYU46859.1|  hypothetical protein MIMGU_mgv1a007395mg                203   2e-59   
gb|ERN02393.1|  hypothetical protein AMTR_s00096p00102520               201   2e-59   
ref|XP_009775930.1|  PREDICTED: shaggy-related protein kinase NtK...    203   2e-59   
ref|XP_008781189.1|  PREDICTED: shaggy-related protein kinase alp...    203   2e-59   
gb|ABR16348.1|  unknown                                                 203   2e-59   
ref|XP_001781582.1|  predicted protein                                  203   2e-59   
ref|XP_003626019.1|  Protein kinase, putative                           202   2e-59   
ref|NP_001149983.1|  shaggy-related protein kinase eta                  202   3e-59   
ref|XP_002991115.1|  hypothetical protein SELMODRAFT_451471             204   3e-59   
gb|AAQ23108.1|  shaggy-related protein kinase 3                         203   3e-59   
gb|AFK38277.1|  unknown                                                 202   3e-59   
gb|EYU38392.1|  hypothetical protein MIMGU_mgv1a007572mg                202   3e-59   
dbj|BAJ34573.1|  unnamed protein product                                202   3e-59   
emb|CDP15204.1|  unnamed protein product                                202   3e-59   
ref|XP_003518657.1|  PREDICTED: glycogen synthase kinase-3 homolo...    202   3e-59   
sp|P51139.2|MSK3_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    202   3e-59   
ref|XP_010248490.1|  PREDICTED: shaggy-related protein kinase eps...    202   3e-59   
ref|XP_006444573.1|  hypothetical protein CICLE_v10020852mg             202   3e-59   
emb|CAA48472.1|  protein kinase                                         202   3e-59   
ref|XP_006588497.1|  PREDICTED: uncharacterized protein LOC100817...    202   3e-59   
ref|XP_004148581.1|  PREDICTED: glycogen synthase kinase-3 homolo...    202   4e-59   
gb|AFH00876.1|  glycogen synthase kinase-3                              202   4e-59   
ref|XP_010910596.1|  PREDICTED: shaggy-related protein kinase alp...    202   4e-59   
ref|XP_006588432.1|  PREDICTED: glycogen synthase kinase-3 isofor...    202   4e-59   
ref|XP_003555781.1|  PREDICTED: glycogen synthase kinase-3 homolo...    202   4e-59   
ref|XP_010921357.1|  PREDICTED: shaggy-related protein kinase alpha     202   4e-59   
emb|CAA58594.1|  Petunia Shaggy kinase 4                                202   4e-59   
ref|XP_008778092.1|  PREDICTED: shaggy-related protein kinase alp...    202   4e-59   
ref|XP_004495628.1|  PREDICTED: glycogen synthase kinase-3 homolo...    202   4e-59   
gb|KHN16033.1|  Glycogen synthase kinase-3 like MsK-1                   202   4e-59   
ref|XP_008353866.1|  PREDICTED: glycogen synthase kinase-3 homolo...    202   5e-59   
ref|XP_006841582.1|  PREDICTED: glycogen synthase kinase-3 homolo...    202   5e-59   
gb|KHN00323.1|  Glycogen synthase kinase-3 like MsK-2                   201   5e-59   
ref|NP_001242406.1|  uncharacterized protein LOC100788612               202   5e-59   
ref|XP_003554602.1|  PREDICTED: shaggy-related protein kinase alp...    202   5e-59   
ref|XP_006576226.1|  PREDICTED: uncharacterized protein LOC100788...    202   5e-59   
ref|XP_001762052.1|  predicted protein                                  202   6e-59   
ref|XP_004232308.1|  PREDICTED: shaggy-related protein kinase eps...    202   6e-59   
emb|CBI37005.3|  unnamed protein product                                201   6e-59   
gb|AAQ23109.1|  shaggy-related protein kinase 4                         202   6e-59   
gb|KHG08917.1|  Shaggy-related protein kinase eta                       201   6e-59   
ref|XP_003626020.1|  Protein kinase, putative                           202   6e-59   
ref|XP_010091400.1|  Glycogen synthase kinase-3-MsK-3-like protein      202   6e-59   
gb|EPS63877.1|  hypothetical protein M569_10905                         201   7e-59   
ref|XP_009363099.1|  PREDICTED: glycogen synthase kinase-3 homolo...    201   7e-59   
ref|XP_010097328.1|  Shaggy-related protein kinase alpha                204   7e-59   
gb|ACQ91102.1|  glycogen synthase kinase                                201   7e-59   
ref|XP_004968576.1|  PREDICTED: shaggy-related protein kinase iot...    201   7e-59   
ref|XP_004304635.1|  PREDICTED: shaggy-related protein kinase eps...    201   7e-59   
ref|XP_011622016.1|  PREDICTED: shaggy-related protein kinase eps...    201   7e-59   
ref|XP_007051226.1|  Shaggy-related kinase 11, 11 isoform 1             201   8e-59   
ref|XP_006446534.1|  hypothetical protein CICLE_v10015323mg             202   8e-59   
ref|XP_008381452.1|  PREDICTED: glycogen synthase kinase-3 homolo...    201   8e-59   
ref|XP_007221484.1|  hypothetical protein PRUPE_ppa006462mg             201   8e-59   
ref|XP_004495625.1|  PREDICTED: glycogen synthase kinase-3 homolo...    202   8e-59   
ref|XP_006470301.1|  PREDICTED: shaggy-related protein kinase eps...    202   8e-59   
ref|XP_006588498.1|  PREDICTED: uncharacterized protein LOC100817...    201   9e-59   
ref|XP_002279596.1|  PREDICTED: shaggy-related protein kinase alp...    201   1e-58   
ref|XP_003591341.1|  Glycogen synthase kinase-3-like protein            200   1e-58   
ref|XP_010038314.1|  PREDICTED: shaggy-related protein kinase alp...    201   1e-58   
ref|XP_008227813.1|  PREDICTED: glycogen synthase kinase-3 homolo...    201   1e-58   
ref|XP_003591340.1|  Glycogen synthase kinase-3-like protein            201   1e-58   
gb|AES61591.2|  glycogen synthase kinase                                201   2e-58   
sp|P51138.1|MSK2_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    201   2e-58   
ref|XP_010276519.1|  PREDICTED: shaggy-related protein kinase alpha     201   2e-58   
gb|ABB55385.1|  Ser/Thr protein kinase-like                             200   2e-58   
ref|XP_009416503.1|  PREDICTED: shaggy-related protein kinase eta...    201   2e-58   
ref|XP_010493929.1|  PREDICTED: shaggy-related protein kinase alp...    199   2e-58   
ref|XP_010674528.1|  PREDICTED: shaggy-related protein kinase alpha     200   2e-58   
ref|XP_009366055.1|  PREDICTED: shaggy-related protein kinase alp...    200   2e-58   
ref|XP_008363964.1|  PREDICTED: shaggy-related protein kinase alpha     200   2e-58   
ref|XP_009335521.1|  PREDICTED: shaggy-related protein kinase alpha     200   2e-58   
ref|XP_011023844.1|  PREDICTED: shaggy-related protein kinase alpha     200   2e-58   
ref|XP_006382289.1|  hypothetical protein POPTR_0005s00710g             200   2e-58   
gb|EPS73818.1|  hypothetical protein M569_00937                         200   2e-58   
ref|XP_010278583.1|  PREDICTED: shaggy-related protein kinase eps...    201   2e-58   
ref|XP_006338577.1|  PREDICTED: shaggy-related protein kinase eps...    200   3e-58   
ref|XP_006338576.1|  PREDICTED: shaggy-related protein kinase eps...    200   3e-58   
ref|XP_004495878.1|  PREDICTED: glycogen synthase kinase-3 homolo...    200   3e-58   
emb|CDP17018.1|  unnamed protein product                                199   3e-58   
gb|ABK93098.1|  unknown                                                 200   3e-58   
gb|EPS68698.1|  hypothetical protein M569_06069                         197   3e-58   
ref|XP_002319468.1|  Glycogen synthase kinase-3 MsK-1 family protein    200   3e-58   
gb|KHN00229.1|  Glycogen synthase kinase-3 like MsK-3                   204   3e-58   
dbj|BAD95892.1|  Ser/Thr protein kinase                                 200   4e-58   
ref|NP_001242661.1|  glycogen synthase kinase-3                         199   4e-58   
gb|AAQ23111.1|  shaggy-related protein kinase 1                         199   4e-58   
gb|ABK24355.1|  unknown                                                 198   4e-58   
tpg|DAA53953.1|  TPA: putative glycogen synthase kinase family pr...    197   4e-58   
ref|XP_010938176.1|  PREDICTED: shaggy-related protein kinase alp...    199   4e-58   
ref|XP_001763270.1|  predicted protein                                  200   5e-58   
ref|XP_010679446.1|  PREDICTED: shaggy-related protein kinase NtK-1     199   5e-58   
ref|NP_001269276.1|  glycogen synthase kinase-3 homolog MsK-1-like      199   5e-58   
ref|XP_010042192.1|  PREDICTED: shaggy-related protein kinase alpha     199   5e-58   
sp|Q40518.1|MSK1_TOBAC  RecName: Full=Shaggy-related protein kina...    199   6e-58   
ref|XP_010251219.1|  PREDICTED: shaggy-related protein kinase eps...    198   6e-58   
ref|XP_007031230.1|  Shaggy-related kinase 11, 11 isoform 2             199   7e-58   
ref|XP_001765207.1|  predicted protein                                  199   7e-58   
gb|KDO86866.1|  hypothetical protein CISIN_1g015632mg                   198   8e-58   
ref|XP_009415683.1|  PREDICTED: uncharacterized protein LOC103996486    207   8e-58   
ref|XP_008443540.1|  PREDICTED: shaggy-related protein kinase eps...    198   1e-57   
ref|XP_008388444.1|  PREDICTED: shaggy-related protein kinase alpha     198   1e-57   
ref|XP_010652295.1|  PREDICTED: shaggy-related protein kinase alp...    198   1e-57   
ref|NP_001242506.1|  uncharacterized protein LOC100817819               197   1e-57   
emb|CDX78658.1|  BnaA03g05700D                                          202   1e-57   
tpg|DAA53950.1|  TPA: putative glycogen synthase kinase family pr...    197   1e-57   
ref|XP_009386339.1|  PREDICTED: shaggy-related protein kinase alp...    198   1e-57   
ref|XP_009403747.1|  PREDICTED: shaggy-related protein kinase alp...    198   2e-57   
gb|ADE76936.1|  unknown                                                 197   2e-57   
ref|XP_009383704.1|  PREDICTED: shaggy-related protein kinase alpha     197   2e-57   
gb|KHN26183.1|  Glycogen synthase kinase-3 like MsK-1                   196   2e-57   
gb|EPS68300.1|  hypothetical protein M569_06467                         197   3e-57   
gb|KDO86034.1|  hypothetical protein CISIN_1g011138mg                   193   3e-57   
ref|XP_009617298.1|  PREDICTED: shaggy-related protein kinase NtK-1     197   4e-57   
ref|NP_001150105.1|  LOC100283734                                       197   4e-57   
tpg|DAA53951.1|  TPA: putative glycogen synthase kinase family pr...    197   4e-57   
emb|CDM82575.1|  unnamed protein product                                197   4e-57   
dbj|BAF36565.1|  Shaggy-like kinase                                     197   5e-57   
ref|NP_001148880.1|  glycogen synthase kinase-3 MsK-3                   197   5e-57   
ref|XP_012082965.1|  PREDICTED: shaggy-related protein kinase alp...    197   5e-57   
ref|XP_003591339.1|  Glycogen synthase kinase-3-like protein            196   5e-57   
ref|XP_010070089.1|  PREDICTED: shaggy-related protein kinase alp...    197   5e-57   
gb|AFW79696.1|  putative glycogen synthase kinase family protein        196   5e-57   
ref|XP_002455378.1|  hypothetical protein SORBIDRAFT_03g009580          197   5e-57   
ref|XP_004967857.1|  PREDICTED: shaggy-related protein kinase alp...    196   5e-57   
ref|XP_004141099.2|  PREDICTED: shaggy-related protein kinase eps...    197   5e-57   
ref|XP_010070081.1|  PREDICTED: shaggy-related protein kinase alp...    196   6e-57   
ref|XP_009384996.1|  PREDICTED: shaggy-related protein kinase alp...    196   6e-57   
ref|XP_008672929.1|  PREDICTED: LOC100283734 isoform X1                 197   9e-57   
ref|XP_009382471.1|  PREDICTED: shaggy-related protein kinase alp...    196   1e-56   
ref|XP_007140965.1|  hypothetical protein PHAVU_008G156000g             196   1e-56   
gb|EMT32435.1|  Glycogen synthase kinase-3-MsK-3-like protein           196   1e-56   
ref|NP_001042602.1|  Os01g0252100                                       196   1e-56   
ref|XP_003566380.1|  PREDICTED: shaggy-related protein kinase alpha     196   1e-56   
ref|XP_006643997.1|  PREDICTED: shaggy-related protein kinase alp...    196   1e-56   
ref|XP_009382470.1|  PREDICTED: shaggy-related protein kinase alp...    196   1e-56   



>dbj|BAJ33892.1| unnamed protein product [Thellungiella halophila]
Length=322

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PE+++DKEMSAAV EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  32   PELDSDKEMSAAVTEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  91

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVMEYV
Sbjct  92   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMEYV  151

Query  617  P  619
            P
Sbjct  152  P  152



>gb|KDO63405.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=340

 Score =   239 bits (609),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT++DELFLNLVMEYV
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSKDELFLNLVMEYV  157

Query  617  P  619
            P
Sbjct  158  P  158



>gb|AGJ98225.1| BIN2-like protein PSK8 [Petunia x hybrida]
Length=420

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEME+DKEMSAAVVEGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  39   PEMESDKEMSAAVVEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  98

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQD+RYKNRELQLMRLMDHPNVI LKHCFFSTT+RDELFLNLVM+YV
Sbjct  99   CLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVICLKHCFFSTTSRDELFLNLVMDYV  158

Query  617  P  619
            P
Sbjct  159  P  159



>gb|KDO63403.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=375

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT++DELFLNLVMEYV
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSKDELFLNLVMEYV  157

Query  617  P  619
            P
Sbjct  158  P  158



>ref|XP_002881146.1| hypothetical protein ARALYDRAFT_902112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57405.1| hypothetical protein ARALYDRAFT_902112 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M+TDKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDMDTDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT RDELFLNLVMEYV
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTTRDELFLNLVMEYV  150

Query  617  P  619
            P
Sbjct  151  P  151



>ref|XP_006294432.1| hypothetical protein CARUB_v10023447mg [Capsella rubella]
 gb|EOA27330.1| hypothetical protein CARUB_v10023447mg [Capsella rubella]
Length=376

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+++TDK+MSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDIDTDKDMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT+RDELFLNLVMEYV
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSRDELFLNLVMEYV  150

Query  617  P  619
            P
Sbjct  151  P  151



>gb|KFK42959.1| hypothetical protein AALP_AA1G061200 [Arabis alpina]
Length=409

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 120/120 (100%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            EM++DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  32   EMDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  91

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  92   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  151



>gb|KDO63404.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=395

 Score =   237 bits (605),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT++DELFLNLVMEYV
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSKDELFLNLVMEYV  157

Query  617  P  619
            P
Sbjct  158  P  158



>ref|XP_006417928.1| hypothetical protein EUTSA_v10007772mg [Eutrema salsugineum]
 gb|ESQ36281.1| hypothetical protein EUTSA_v10007772mg [Eutrema salsugineum]
Length=410

 Score =   238 bits (606),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PE+++DKEMSAAV EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  32   PELDSDKEMSAAVTEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  91

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVMEYV
Sbjct  92   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMEYV  151

Query  617  P  619
            P
Sbjct  152  P  152



>ref|XP_009365288.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Pyrus x bretschneideri]
Length=416

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSA VVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PQMDSDKEMSAPVVEGNAAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            C++TGETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTTA+DELFLNLVMEYV
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTAKDELFLNLVMEYV  154

Query  617  P  619
            P
Sbjct  155  P  155



>ref|XP_002889601.1| hypothetical protein ARALYDRAFT_470656 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65860.1| hypothetical protein ARALYDRAFT_470656 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEM++DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  32   PEMDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  91

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYV
Sbjct  92   CLETGESVAIKKVLQDRRYKNRELQLMRPMDHPNVISLKHCFFSTTSRDELFLNLVMEYV  151

Query  617  P  619
            P
Sbjct  152  P  152



>ref|XP_006446814.1| hypothetical protein CICLE_v10015375mg [Citrus clementina]
 gb|ESR60054.1| hypothetical protein CICLE_v10015375mg [Citrus clementina]
Length=419

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT++DELFLNLVMEYV
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSKDELFLNLVMEYV  157

Query  617  P  619
            P
Sbjct  158  P  158



>gb|KDO63402.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=419

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT++DELFLNLVMEYV
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSKDELFLNLVMEYV  157

Query  617  P  619
            P
Sbjct  158  P  158



>ref|XP_006468992.1| PREDICTED: shaggy-related protein kinase zeta-like [Citrus sinensis]
Length=419

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 121/121 (100%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT++DELFLNLVMEYV
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSKDELFLNLVMEYV  157

Query  617  P  619
            P
Sbjct  158  P  158



>ref|XP_007215447.1| hypothetical protein PRUPE_ppa006349mg [Prunus persica]
 gb|EMJ16646.1| hypothetical protein PRUPE_ppa006349mg [Prunus persica]
Length=416

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PDMDSDKEMSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            C++TGETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT++DELFLNLVMEYV
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSKDELFLNLVMEYV  154

Query  617  P  619
            P
Sbjct  155  P  155



>ref|XP_008365741.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Malus 
domestica]
Length=416

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSA VVEGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PQMDSDKEMSAPVVEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            C++TGETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTTA+DELFLNLVMEY 
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTAKDELFLNLVMEYX  154

Query  617  P  619
            P
Sbjct  155  P  155



>dbj|BAH19519.1| AT1G06390 [Arabidopsis thaliana]
Length=407

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PE+++DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  29   PELDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  88

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYV
Sbjct  89   CLETGESVAIKKVLQDRRYKNRELQLMRPMDHPNVISLKHCFFSTTSRDELFLNLVMEYV  148

Query  617  P  619
            P
Sbjct  149  P  149



>ref|NP_172127.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
 ref|NP_973771.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
 sp|Q39012.1|KSG9_ARATH RecName: Full=Shaggy-related protein kinase iota; AltName: Full=ASK-iota 
[Arabidopsis thaliana]
 gb|AAF82167.1|AC068143_9 Contains a very strong similarity to a shaggy-like kinase iota 
from Arabidopsis thaliana gb|X99696 and contains an eukaryotic 
protein kinase PF|00069 domain. EST gb|N37432 comes from 
this gene [Arabidopsis thaliana]
 emb|CAA68027.1| shaggy-like protein kinase iota [Arabidopsis thaliana]
 gb|AAB71545.1| GSK3/shaggy-like protein kinase [Arabidopsis thaliana]
 gb|AAK59553.1| putative shaggy kinase [Arabidopsis thaliana]
 gb|AAK93730.1| putative shaggy kinase [Arabidopsis thaliana]
 gb|AEE27980.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
 gb|AEE27981.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
Length=407

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PE+++DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  29   PELDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  88

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYV
Sbjct  89   CLETGESVAIKKVLQDRRYKNRELQLMRPMDHPNVISLKHCFFSTTSRDELFLNLVMEYV  148

Query  617  P  619
            P
Sbjct  149  P  149



>ref|XP_008228934.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Prunus 
mume]
Length=416

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PDMDSDKEMSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            C++TGETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT++DELFLNLVMEYV
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSKDELFLNLVMEYV  154

Query  617  P  619
            P
Sbjct  155  P  155



>ref|XP_006348884.1| PREDICTED: shaggy-related protein kinase zeta-like [Solanum tuberosum]
Length=434

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEME++KEMSAAVVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  53   PEMESEKEMSAAVVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  112

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQD+RYKNRELQLMRLMDHPNVI+LKHCFFSTT+RDELFLNLVM+YV
Sbjct  113  CLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVITLKHCFFSTTSRDELFLNLVMDYV  172

Query  617  P  619
            P
Sbjct  173  P  173



>ref|XP_004243275.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum lycopersicum]
Length=437

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEME++KEMSAAVVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  56   PEMESEKEMSAAVVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  115

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQD+RYKNRELQLMRLMDHPNVI+LKHCFFSTT+RDELFLNLVM+YV
Sbjct  116  CLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVITLKHCFFSTTSRDELFLNLVMDYV  175

Query  617  P  619
            P
Sbjct  176  P  176



>gb|EYU30769.1| hypothetical protein MIMGU_mgv1a006689mg [Erythranthe guttata]
Length=349

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
             M+TDKEM+A+VVEGN+ +TGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  52   SMDTDKEMAASVVEGNDPLTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKC  111

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT RDELFLNLVM+YVP
Sbjct  112  LETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTTRDELFLNLVMDYVP  171



>ref|XP_010522087.1| PREDICTED: shaggy-related protein kinase iota [Tarenaya hassleriana]
Length=411

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 120/120 (100%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +M++DKEMS+AV+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  30   DMDSDKEMSSAVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKC  89

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  90   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  149



>ref|XP_006307671.1| hypothetical protein CARUB_v10009298mg [Capsella rubella]
 gb|EOA40569.1| hypothetical protein CARUB_v10009298mg [Capsella rubella]
Length=412

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/121 (91%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEM+ AVVEGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDMDSDKEMTPAVVEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVMEYV
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMEYV  150

Query  617  P  619
            P
Sbjct  151  P  151



>ref|XP_008343093.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Malus 
domestica]
Length=416

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PQMDSDKEMSAPVMEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            C++TGETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT +DELFLNLVMEYV
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTTKDELFLNLVMEYV  154

Query  617  P  619
            P
Sbjct  155  P  155



>gb|AAM65084.1| putative shaggy-like protein kinase dzeta [Arabidopsis thaliana]
Length=412

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+++ DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDIDNDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT RDELFLNLVMEYV
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTTRDELFLNLVMEYV  150

Query  617  P  619
            P
Sbjct  151  P  151



>emb|CAA64408.1| shaggy-like kinase dzeta [Arabidopsis thaliana]
 emb|CAA70483.1| serine/threonine kinase [Arabidopsis thaliana]
Length=412

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+++ DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDIDNDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT RDELFLNLVMEYV
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTTRDELFLNLVMEYV  150

Query  617  P  619
            P
Sbjct  151  P  151



>ref|NP_180655.1| Shaggy-related protein kinase zeta [Arabidopsis thaliana]
 sp|Q39010.2|KSG6_ARATH RecName: Full=Shaggy-related protein kinase zeta; AltName: Full=ASK-zeta 
[Arabidopsis thaliana]
 gb|AAC20732.1| putative shaggy-like protein kinase dzeta [Arabidopsis thaliana]
 gb|AAL36376.1| putative shaggy protein kinase dzeta [Arabidopsis thaliana]
 gb|AAM19796.1| At2g30980/F7F1.19 [Arabidopsis thaliana]
 gb|AAM20332.1| putative shaggy protein kinase dzeta [Arabidopsis thaliana]
 gb|AEC08470.1| Shaggy-related protein kinase zeta [Arabidopsis thaliana]
Length=412

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+++ DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDIDNDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT RDELFLNLVMEYV
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTTRDELFLNLVMEYV  150

Query  617  P  619
            P
Sbjct  151  P  151



>ref|XP_009593779.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Nicotiana 
tomentosiformis]
Length=430

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PE ++DKEMSAA VEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  49   PETDSDKEMSAAAVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  108

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQD+RYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVM+YV
Sbjct  109  CLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMDYV  168

Query  617  P  619
            P
Sbjct  169  P  169



>emb|CDP15948.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +M++DKEMSAAVVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  53   DMDSDKEMSAAVVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKC  112

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMRLM+HPNVISLKHCFFSTT RDELFLNLVMEYVP
Sbjct  113  LETGETVAIKKVLQDRRYKNRELQLMRLMNHPNVISLKHCFFSTTTRDELFLNLVMEYVP  172



>ref|XP_009801781.1| PREDICTED: shaggy-related protein kinase eta-like [Nicotiana 
sylvestris]
Length=424

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PE ++DKEMSAAVVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  43   PETDSDKEMSAAVVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  102

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQD+RYKNRELQLMRLMDHPNVI LKHCFFSTT+RDELFLNLVM+YV
Sbjct  103  CLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVICLKHCFFSTTSRDELFLNLVMDYV  162

Query  617  P  619
            P
Sbjct  163  P  163



>ref|XP_010104417.1| Shaggy-related protein kinase zeta [Morus notabilis]
 gb|EXC00262.1| Shaggy-related protein kinase zeta [Morus notabilis]
Length=436

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +METDK+MSA V+EGN+ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  35   DMETDKDMSATVIEGNDQVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKC  94

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  95   LETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  154



>gb|KFK31745.1| hypothetical protein AALP_AA6G153600 [Arabis alpina]
Length=405

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  24   MDSDKEMSAAVIDGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  83

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  84   ETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  142



>ref|XP_010457765.1| PREDICTED: shaggy-related protein kinase iota [Camelina sativa]
Length=413

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            E ++DKEM+AAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  33   ETDSDKEMTAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  93   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  152



>ref|XP_009141120.1| PREDICTED: shaggy-related protein kinase zeta [Brassica rapa]
 emb|CDX97773.1| BnaC04g41660D [Brassica napus]
Length=410

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +M+TDK+MSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  30   DMDTDKDMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKC  89

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  90   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  149



>ref|XP_010486052.1| PREDICTED: shaggy-related protein kinase iota-like [Camelina 
sativa]
Length=413

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            E ++DKEM+AAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  33   ETDSDKEMTAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  93   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  152



>ref|XP_003540001.1| PREDICTED: shaggy-related protein kinase zeta-like [Glycine max]
Length=420

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +METDK+MSA V+EGN+AVTGHIISTTIGGKNGEPK TI+YMAERVVGTGSFG+VFQAKC
Sbjct  40   DMETDKDMSATVIEGNDAVTGHIISTTIGGKNGEPKETISYMAERVVGTGSFGVVFQAKC  99

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  100  LETGEAVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  159



>ref|XP_004149276.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Cucumis 
sativus]
Length=425

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M+TDKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG+GSFGIVFQAKCL
Sbjct  45   MDTDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGSGSFGIVFQAKCL  104

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQD+RYKNRELQLMRLMDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  105  ETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  163



>ref|XP_010475366.1| PREDICTED: shaggy-related protein kinase iota-like [Camelina 
sativa]
Length=417

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            E ++DKEM+AAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  37   ETDSDKEMTAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  96

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  97   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  156



>ref|XP_008448253.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Cucumis 
melo]
Length=425

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M+TDKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG+GSFGIVFQAKCL
Sbjct  45   MDTDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGSGSFGIVFQAKCL  104

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQD+RYKNRELQLMRLMDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  105  ETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  163



>ref|XP_003527338.1| PREDICTED: shaggy-related protein kinase zeta-like [Glycine max]
Length=419

 Score =   233 bits (594),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +METDK+MSA V+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKC
Sbjct  39   DMETDKDMSATVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKC  98

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT++DELFLNLVMEYVP
Sbjct  99   LETGEAVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSKDELFLNLVMEYVP  158



>gb|KHN33940.1| Shaggy-related protein kinase zeta [Glycine soja]
Length=415

 Score =   233 bits (594),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +METDK+MSA V+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKC
Sbjct  35   DMETDKDMSATVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKC  94

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT++DELFLNLVMEYVP
Sbjct  95   LETGEAVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSKDELFLNLVMEYVP  154



>ref|XP_010510261.1| PREDICTED: shaggy-related protein kinase zeta [Camelina sativa]
Length=411

 Score =   233 bits (593),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+++TDK+MSAAV+EGN+AVTGHIISTTIGGKNGEPK+ I+YMAERVVGTGSFGIVFQAK
Sbjct  30   PDVDTDKDMSAAVIEGNDAVTGHIISTTIGGKNGEPKQVISYMAERVVGTGSFGIVFQAK  89

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRL+DHPNV+SLKHCFFSTT+RDELFLNLVMEYV
Sbjct  90   CLETGESVAIKKVLQDRRYKNRELQLMRLIDHPNVVSLKHCFFSTTSRDELFLNLVMEYV  149

Query  617  P  619
            P
Sbjct  150  P  150



>ref|XP_009378929.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Pyrus 
x bretschneideri]
Length=416

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DKEMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PQMDSDKEMSAPVMEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            C++TGETVAIKKVLQDRRYKNRELQLMRLMDHPNV+ LKHCFFSTT +DELFLNLVMEYV
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVLLKHCFFSTTTKDELFLNLVMEYV  154

Query  617  P  619
            P
Sbjct  155  P  155



>ref|XP_007132829.1| hypothetical protein PHAVU_011G128000g [Phaseolus vulgaris]
 gb|ESW04823.1| hypothetical protein PHAVU_011G128000g [Phaseolus vulgaris]
Length=419

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +METDK+MSA V+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKC
Sbjct  39   DMETDKDMSATVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKC  98

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE VAIKKVLQDR+YKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  99   LETGEPVAIKKVLQDRQYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  158



>gb|EYU30768.1| hypothetical protein MIMGU_mgv1a006689mg [Erythranthe guttata]
Length=435

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M+TDKEM+A+VVEGN+ +TGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  53   MDTDKEMAASVVEGNDPLTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  112

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT RDELFLNLVM+YVP
Sbjct  113  ETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTTRDELFLNLVMDYVP  171



>ref|XP_010469777.1| PREDICTED: shaggy-related protein kinase zeta-like [Camelina 
sativa]
Length=411

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DK+MSAAV+EGN AVTGHIISTTIGGKNGEPK+ I+YMAERVVGTGSFGIVFQAK
Sbjct  30   PDMDSDKDMSAAVIEGNYAVTGHIISTTIGGKNGEPKQVISYMAERVVGTGSFGIVFQAK  89

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRL+DHPNV+SLKHCFFSTT+RDELFLNLVMEYV
Sbjct  90   CLETGESVAIKKVLQDRRYKNRELQLMRLIDHPNVVSLKHCFFSTTSRDELFLNLVMEYV  149

Query  617  P  619
            P
Sbjct  150  P  150



>emb|CBI22011.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            +++DKEMSAAV+EGN+ VTGHIISTTIGGKNGEPK+TI+YMAER+VGTGSFGIVFQAKCL
Sbjct  34   LDSDKEMSAAVIEGNDPVTGHIISTTIGGKNGEPKQTISYMAERIVGTGSFGIVFQAKCL  93

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQL+RLMDHPNV++LKHCFFSTT+RDELFLNLVMEYVP
Sbjct  94   ETGETVAIKKVLQDRRYKNRELQLLRLMDHPNVVTLKHCFFSTTSRDELFLNLVMEYVP  152



>ref|XP_010557131.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X1 
[Tarenaya hassleriana]
Length=411

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK TI+YMAERVVGTGSFGIVFQAKC
Sbjct  30   DMDSDKEMSAAVIDGNDAVTGHIISTTIGGKNGEPKGTISYMAERVVGTGSFGIVFQAKC  89

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNV+SL+HCFFSTT+RDELFLNLVMEYVP
Sbjct  90   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLRHCFFSTTSRDELFLNLVMEYVP  149



>ref|XP_010557132.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X2 
[Tarenaya hassleriana]
Length=410

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK TI+YMAERVVGTGSFGIVFQAKC
Sbjct  30   DMDSDKEMSAAVIDGNDAVTGHIISTTIGGKNGEPKGTISYMAERVVGTGSFGIVFQAKC  89

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE+VAIKKVLQDRRYKNRELQLMRLMDHPNV+SL+HCFFSTT+RDELFLNLVMEYVP
Sbjct  90   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLRHCFFSTTSRDELFLNLVMEYVP  149



>gb|KHN34245.1| Shaggy-related protein kinase zeta [Glycine soja]
Length=502

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +METDK+MSA V+EGN+AVTGHIISTTIGGKNGEPK TI+YMAERVVGTGSFG+VFQAKC
Sbjct  122  DMETDKDMSATVIEGNDAVTGHIISTTIGGKNGEPKETISYMAERVVGTGSFGVVFQAKC  181

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  182  LETGEAVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  241



>ref|XP_010414192.1| PREDICTED: shaggy-related protein kinase zeta-like [Camelina 
sativa]
Length=411

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P+M++DK+MSAAV+EGN+AVTGHIISTTIGGKNGEPK+ I+YMAERVVGTGSFGIVFQAK
Sbjct  30   PDMDSDKDMSAAVIEGNDAVTGHIISTTIGGKNGEPKQVISYMAERVVGTGSFGIVFQAK  89

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE+VAIKKVLQDRRYKNRELQLMRL+DHPNV+SLKHCFFSTT+RDELFL+LVMEYV
Sbjct  90   CLETGESVAIKKVLQDRRYKNRELQLMRLIDHPNVVSLKHCFFSTTSRDELFLHLVMEYV  149

Query  617  P  619
            P
Sbjct  150  P  150



>ref|XP_003596712.1| Shaggy-related protein kinase [Medicago truncatula]
Length=423

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M+TDKEMSA+VV+ N+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  46   MDTDKEMSASVVDSNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  105

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQD+RYKNRELQLMR+MDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  106  ETGEAVAIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  164



>ref|XP_010657061.1| PREDICTED: shaggy-related protein kinase eta-like [Vitis vinifera]
Length=413

 Score =   230 bits (587),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            +++DKEMSAAV+EGN+ VTGHIISTTIGGKNGEPK+TI+YMAER+VGTGSFGIVFQAKCL
Sbjct  34   LDSDKEMSAAVIEGNDPVTGHIISTTIGGKNGEPKQTISYMAERIVGTGSFGIVFQAKCL  93

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQL+RLMDHPNV++LKHCFFSTT+RDELFLNLVMEYVP
Sbjct  94   ETGETVAIKKVLQDRRYKNRELQLLRLMDHPNVVTLKHCFFSTTSRDELFLNLVMEYVP  152



>gb|AES66963.2| shaggy-like kinase dzeta [Medicago truncatula]
Length=426

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M+TDKEMSA+VV+ N+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  49   MDTDKEMSASVVDSNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  108

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQD+RYKNRELQLMR+MDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  109  ETGEAVAIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  167



>ref|XP_007048726.1| GSK3/SHAGGY-like protein kinase 1 isoform 2 [Theobroma cacao]
 gb|EOX92883.1| GSK3/SHAGGY-like protein kinase 1 isoform 2 [Theobroma cacao]
Length=384

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +M++DKEMSA VVEGN  VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  29   DMDSDKEMSAPVVEGNNQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  88

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+T ETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  89   LETSETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  148



>ref|XP_004303195.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Fragaria 
vesca subsp. vesca]
Length=417

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +M++ KEMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAER VGTGSFGIVFQAKC
Sbjct  37   DMDSHKEMSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERAVGTGSFGIVFQAKC  96

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT +DELFLNLVMEYVP
Sbjct  97   LETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTTKDELFLNLVMEYVP  156



>ref|XP_007048725.1| SHAGGY-related protein kinase dZeta isoform 1 [Theobroma cacao]
 gb|EOX92882.1| SHAGGY-related protein kinase dZeta isoform 1 [Theobroma cacao]
Length=409

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +M++DKEMSA VVEGN  VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  29   DMDSDKEMSAPVVEGNNQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  88

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+T ETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  89   LETSETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  148



>gb|ACJ85155.1| unknown [Medicago truncatula]
Length=172

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MSEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNV +LKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVATLKHCFFSTTSTDELFLNLVMEYVP  119



>ref|XP_010100748.1| Shaggy-related protein kinase eta [Morus notabilis]
 gb|EXB84051.1| Shaggy-related protein kinase eta [Morus notabilis]
Length=323

 Score =   226 bits (575),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+SA++V+GN++VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISASIVDGNDSVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVP  119



>gb|KDO77888.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=314

 Score =   224 bits (572),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVP  119



>ref|XP_003633016.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Vitis 
vinifera]
 emb|CBI30705.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   226 bits (577),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+SA VV+GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MSDDKEISAPVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRTMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  119



>ref|XP_004487575.1| PREDICTED: shaggy-related protein kinase zeta-like [Cicer arietinum]
Length=420

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +M+TDKEMS+ VV+ N+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  42   DMDTDKEMSSTVVDSNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKC  101

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+T E VAIKKVLQD+RYKNRELQLMR+MDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  102  LETSEAVAIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  161



>gb|KDO63406.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=376

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = +2

Query  278  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  457
            EMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGET
Sbjct  2    EMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGET  61

Query  458  VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT++DELFLNLVMEYVP
Sbjct  62   VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTSKDELFLNLVMEYVP  115



>ref|NP_001190762.1| Shaggy-related protein kinase eta [Arabidopsis thaliana]
 gb|AEE84080.1| Shaggy-related protein kinase eta [Arabidopsis thaliana]
Length=280

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  119



>ref|XP_007025343.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
 gb|EOY27965.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
Length=376

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSAAVV+GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  53   MADDKEMSAAVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  112

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  113  ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  171



>ref|XP_010689734.1| PREDICTED: shaggy-related protein kinase eta [Beta vulgaris subsp. 
vulgaris]
Length=407

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS AV++GN+ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  32   MSDDKEMSPAVIQGNDQVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  91

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMRL+DH NVISLKHCFFSTT++DELFLNLVMEYVP
Sbjct  92   ETGETVAIKKVLQDRRYKNRELQLMRLLDHANVISLKHCFFSTTSKDELFLNLVMEYVP  150



>ref|XP_009593781.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Nicotiana 
tomentosiformis]
Length=376

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +2

Query  278  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  457
            EMSAA VEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGET
Sbjct  2    EMSAAAVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGET  61

Query  458  VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            VAIKKVLQD+RYKNRELQLMRLMDHPNVISLKHCFFSTT+RDELFLNLVM+YVP
Sbjct  62   VAIKKVLQDKRYKNRELQLMRLMDHPNVISLKHCFFSTTSRDELFLNLVMDYVP  115



>ref|XP_006467630.1| PREDICTED: shaggy-related protein kinase eta-like [Citrus sinensis]
 gb|KDO77887.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=380

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVP  119



>ref|XP_006449527.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
 gb|ESR62767.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
Length=380

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVP  119



>ref|XP_011082988.1| PREDICTED: shaggy-related protein kinase eta [Sesamum indicum]
Length=430

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            ME DKEM +++VEGN+ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  49   MEADKEMPSSMVEGNDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  108

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE+VAIKKVLQDRRYKNRELQLMRLMDH NVISLKHCFFSTT RDELFLNLVM+YVP
Sbjct  109  ETGESVAIKKVLQDRRYKNRELQLMRLMDHSNVISLKHCFFSTTTRDELFLNLVMDYVP  167



>gb|EAY96932.1| hypothetical protein OsI_18850 [Oryza sativa Indica Group]
Length=220

 Score =   219 bits (559),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  275  KEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGE  454
            +E  A   EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGE
Sbjct  28   QEGEAPYAEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGE  87

Query  455  TVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            TVAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  88   TVAIKKVLQDRRYKNRELQLMRAMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  142



>ref|XP_011466966.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  275  KEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGE  454
            +EMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAER VGTGSFGIVFQAKCL+TGE
Sbjct  11   EEMSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERAVGTGSFGIVFQAKCLETGE  70

Query  455  TVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            TVAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT +DELFLNLVMEYVP
Sbjct  71   TVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTTKDELFLNLVMEYVP  125



>ref|XP_009365289.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X2 
[Pyrus x bretschneideri]
Length=374

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSA VVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MSAPVVEGNAAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTTA+DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTAKDELFLNLVMEYVP  113



>ref|XP_008365740.1| PREDICTED: shaggy-related protein kinase zeta isoform X1 [Malus 
domestica]
Length=356

 Score =   223 bits (569),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSA VVEGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MSAPVVEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTTA+DELFLNLVMEY P
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTAKDELFLNLVMEYXP  113



>ref|XP_007148030.1| hypothetical protein PHAVU_006G1745000g, partial [Phaseolus vulgaris]
 gb|ESW20024.1| hypothetical protein PHAVU_006G1745000g, partial [Phaseolus vulgaris]
Length=238

 Score =   219 bits (558),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS++V+ GN+++TGHIISTTIGGKNGEPK+TI+Y AERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSSSVINGNDSLTGHIISTTIGGKNGEPKQTISYKAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTSTDELFLNLVMEYVP  119



>ref|XP_008789340.1| PREDICTED: shaggy-related protein kinase eta [Phoenix dactylifera]
Length=406

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 115/121 (95%), Gaps = 2/121 (2%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEM  DK+  A+VVEGN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  27   PEMAEDKQ--ASVVEGNDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  84

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYV
Sbjct  85   CLETGETVAIKKVLQDRRYKNRELQLMRAMDHPNVISLKHCFFSTTSRDELFLNLVMEYV  144

Query  617  P  619
            P
Sbjct  145  P  145



>ref|XP_010529205.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Tarenaya hassleriana]
Length=380

 Score =   224 bits (570),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  +KEMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADEKEMSAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  119



>emb|CAN73053.1| hypothetical protein VITISV_015513 [Vitis vinifera]
Length=435

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 114/115 (99%), Gaps = 0/115 (0%)
 Frame = +2

Query  275  KEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGE  454
            +EMSAAV+EGN+ VTGHIISTTIGGKNGEPK+TI+YMAER+VGTGSFGIVFQAKCL+TGE
Sbjct  52   REMSAAVIEGNDPVTGHIISTTIGGKNGEPKQTISYMAERIVGTGSFGIVFQAKCLETGE  111

Query  455  TVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            TVAIKKVLQDRRYKNRELQL+RLMDHPNV++LKHCFFSTT+RDELFLNLVMEYVP
Sbjct  112  TVAIKKVLQDRRYKNRELQLLRLMDHPNVVTLKHCFFSTTSRDELFLNLVMEYVP  166



>ref|XP_008228935.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Prunus 
mume]
Length=374

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  113



>emb|CDY66894.1| BnaCnng52760D [Brassica napus]
Length=374

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG GSFGIVFQAKCL+TGE+V
Sbjct  1    MSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGESV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  113



>ref|XP_011657086.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Cucumis 
sativus]
Length=375

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG+GSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGSGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQD+RYKNRELQLMRLMDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   AIKKVLQDKRYKNRELQLMRLMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  113



>ref|XP_008448254.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Cucumis 
melo]
Length=375

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG+GSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGSGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQD+RYKNRELQLMRLMDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   AIKKVLQDKRYKNRELQLMRLMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  113



>dbj|BAJ33611.1| unnamed protein product [Thellungiella halophila]
Length=380

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  119



>gb|AAL77705.1| AT4g18710/F28A21_120 [Arabidopsis thaliana]
Length=380

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  119



>ref|NP_193606.1| Shaggy-related protein kinase eta [Arabidopsis thaliana]
 sp|Q39011.2|KSG7_ARATH RecName: Full=Shaggy-related protein kinase eta; AltName: Full=ASK-eta; 
AltName: Full=Protein BRASSINOSTEROID INSENSITIVE 
2; AltName: Full=Protein ULTRACURVATA 1 [Arabidopsis thaliana]
 emb|CAB37456.1| shaggy-like protein kinase etha (EC 2.7.1.-) [Arabidopsis thaliana]
 emb|CAB78873.1| shaggy-like protein kinase etha (EC 2.7.1.-) [Arabidopsis thaliana]
 gb|AAM63594.1| shaggy-like protein kinase etha (EC 2.7.1.-) [Arabidopsis thaliana]
 gb|AAN71719.1| glycogen synthase kinase 3 beta protein kinase DWARF12 [Arabidopsis 
thaliana]
 gb|ABG48387.1| At4g18710 [Arabidopsis thaliana]
 gb|AEE84079.1| Shaggy-related protein kinase eta [Arabidopsis thaliana]
 gb|KFK28543.1| hypothetical protein AALP_AA7G010300 [Arabis alpina]
Length=380

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  119



>ref|XP_002870026.1| hypothetical protein ARALYDRAFT_914806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46285.1| hypothetical protein ARALYDRAFT_914806 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  119



>ref|XP_011466967.1| PREDICTED: shaggy-related protein kinase zeta isoform X3 [Fragaria 
vesca subsp. vesca]
Length=374

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAER VGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERAVGTGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT +DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTTKDELFLNLVMEYVP  113



>ref|XP_008343095.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Malus 
domestica]
Length=374

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MSAPVMEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT +DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTTKDELFLNLVMEYVP  113



>gb|KJB34904.1| hypothetical protein B456_006G089400 [Gossypium raimondii]
Length=317

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSALVVDVNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  119



>gb|KGN46984.1| hypothetical protein Csa_6G157100 [Cucumis sativus]
Length=441

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 16/135 (12%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQ----  430
            M+TDKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG+GSFGIVFQ    
Sbjct  45   MDTDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGSGSFGIVFQFVLS  104

Query  431  ------------AKCLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTT  574
                        AKCL+TGETVAIKKVLQD+RYKNRELQLMRLMDHPNV+SLKHCFFSTT
Sbjct  105  VQFLKSKCPSFQAKCLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVVSLKHCFFSTT  164

Query  575  ARDELFLNLVMEYVP  619
            ++DELFLNLVMEYVP
Sbjct  165  SKDELFLNLVMEYVP  179



>emb|CAA64409.1| shaggy-like kinase etha [Arabidopsis thaliana]
 emb|CAA70144.1| shaggy-like kinase etha [Arabidopsis thaliana]
Length=380

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT +DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTEKDELFLNLVMEYVP  119



>ref|XP_010686226.1| PREDICTED: shaggy-related protein kinase eta [Beta vulgaris subsp. 
vulgaris]
Length=380

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+S+ VV+ N AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKELSSTVVDSNGAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTSKDELFLNLVMEYVP  119



>ref|XP_010538570.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Tarenaya hassleriana]
Length=380

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MAEDKEMSAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +T ETVAIKKVLQDRRYKNRELQ+MR+MDHPNVISLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETRETVAIKKVLQDRRYKNRELQIMRVMDHPNVISLKHCFFSTTSKDELFLNLVMEYVP  119



>gb|KJB34903.1| hypothetical protein B456_006G089400 [Gossypium raimondii]
Length=319

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSALVVDVNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  119



>ref|XP_010274430.1| PREDICTED: shaggy-related protein kinase eta-like [Nelumbo nucifera]
Length=412

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            EM  DKEMS  V+EGN+ VTGHIISTTIGGKNGE KRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  32   EMGDDKEMSTPVIEGNDPVTGHIISTTIGGKNGEAKRTISYMAERVVGTGSFGIVFQAKC  91

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  92   LETGETVAIKKVLQDRRYKNRELQLMRSMDHPNVISLKHCFFSTTSKNELFLNLVMEYVP  151



>ref|XP_009144602.1| PREDICTED: shaggy-related protein kinase zeta-like [Brassica 
rapa]
Length=358

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            M AAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVF+AKCL+TGE+V
Sbjct  1    MFAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFEAKCLETGESV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  113



>ref|XP_009132133.1| PREDICTED: shaggy-related protein kinase eta [Brassica rapa]
Length=380

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  D+EM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDREMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  119



>emb|CDO96835.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA +++G++ VTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MANDKEMSAPIMDGHDTVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR MDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRTMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  119



>ref|XP_012091803.1| PREDICTED: shaggy-related protein kinase eta [Jatropha curcas]
 gb|KDP21116.1| hypothetical protein JCGZ_21587 [Jatropha curcas]
Length=379

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA VV+GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSARVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQD+RYKNRELQLMR+MDHPNVISLKHCFFSTT  +ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFSTTNNNELFLNLVMEYVP  119



>ref|XP_007149727.1| hypothetical protein PHAVU_005G094100g [Phaseolus vulgaris]
 gb|ESW21721.1| hypothetical protein PHAVU_005G094100g [Phaseolus vulgaris]
Length=425

 Score =   223 bits (567),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 114/119 (96%), Gaps = 2/119 (2%)
 Frame = +2

Query  269  TDKEMSAAVVEGNEA--VTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            ++KEMSA V EGNEA  +TGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  44   SNKEMSAPVAEGNEAHALTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  103

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNVISL+HCFFSTT+RDELFLNLVMEYVP
Sbjct  104  ETGEAVAIKKVLQDRRYKNRELQLMRMMDHPNVISLRHCFFSTTSRDELFLNLVMEYVP  162



>ref|XP_003526266.1| PREDICTED: shaggy-related protein kinase eta-like [Glycine max]
Length=380

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSTDELFLNLVMEYVP  119



>ref|XP_009394828.1| PREDICTED: shaggy-related protein kinase eta [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 114/121 (94%), Gaps = 3/121 (2%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEM  DK   A+VVEGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG GSFGIVFQAK
Sbjct  28   PEMAQDK---ASVVEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGNGSFGIVFQAK  84

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMR +DHPNVISLKHCFFSTT+RDELFLNLVMEYV
Sbjct  85   CLETGETVAIKKVLQDRRYKNRELQLMRSIDHPNVISLKHCFFSTTSRDELFLNLVMEYV  144

Query  617  P  619
            P
Sbjct  145  P  145



>ref|XP_003522493.1| PREDICTED: shaggy-related protein kinase eta-like [Glycine max]
Length=380

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSTDELFLNLVMEYVP  119



>gb|ABG74917.1| BIN2-like protein [Brassica napus]
Length=387

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  D+EM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDREMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  119



>ref|XP_010052816.1| PREDICTED: shaggy-related protein kinase eta [Eucalyptus grandis]
 gb|KCW89654.1| hypothetical protein EUGRSUZ_A01926 [Eucalyptus grandis]
Length=419

 Score =   222 bits (566),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M+TDKE S +++E NEAVTG IISTTIGGKNGEPK+TI+Y AERVVGTGSFG+VFQAKCL
Sbjct  40   MDTDKEASPSIIENNEAVTGQIISTTIGGKNGEPKQTISYKAERVVGTGSFGVVFQAKCL  99

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMRLMDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  100  ETGEMVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  158



>ref|XP_008439730.1| PREDICTED: shaggy-related protein kinase eta [Cucumis melo]
Length=379

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS  V++GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVF+AKCL
Sbjct  1    MADDKEMSGPVIDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFKAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT +DELFLNLVMEYVP
Sbjct  61   ETGENVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTTKDELFLNLVMEYVP  119



>ref|XP_009136953.1| PREDICTED: shaggy-related protein kinase eta-like [Brassica rapa]
Length=380

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKV QDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVFQDRRYKNRELQLMRVMDHPNVVRLKHCFFSTTSKDELFLNLVMEYVP  119



>ref|XP_007136978.1| hypothetical protein PHAVU_009G089900g [Phaseolus vulgaris]
 gb|ESW08972.1| hypothetical protein PHAVU_009G089900g [Phaseolus vulgaris]
Length=380

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS AV+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSNAVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNVI+LKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVITLKHCFFSTTSTDELFLNLVMEYVP  119



>gb|KJB34905.1| hypothetical protein B456_006G089400 [Gossypium raimondii]
Length=357

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSALVVDVNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  119



>ref|XP_010920339.1| PREDICTED: shaggy-related protein kinase eta [Elaeis guineensis]
Length=406

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 2/121 (2%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEM  DK+  A+V+EGN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  27   PEMAEDKQ--ASVIEGNDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  84

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+T ETVAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYV
Sbjct  85   CLETQETVAIKKVLQDRRYKNRELQLMRTMDHPNVISLKHCFFSTTSRDELFLNLVMEYV  144

Query  617  P  619
            P
Sbjct  145  P  145



>ref|XP_010924595.1| PREDICTED: shaggy-related protein kinase eta-like [Elaeis guineensis]
Length=406

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 2/121 (2%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEM  DK+  A+++EGN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  27   PEMAEDKQ--ASIIEGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  84

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMR MDHPNVI+LKHCFFSTT RDELFLNLVMEYV
Sbjct  85   CLETGETVAIKKVLQDRRYKNRELQLMRSMDHPNVITLKHCFFSTTTRDELFLNLVMEYV  144

Query  617  P  619
            P
Sbjct  145  P  145



>ref|XP_010655538.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Vitis 
vinifera]
Length=376

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +2

Query  278  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  457
            E+SA VV+GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGET
Sbjct  2    EISAPVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGET  61

Query  458  VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            VAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  62   VAIKKVLQDRRYKNRELQLMRTMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  115



>ref|XP_006285118.1| hypothetical protein CARUB_v10006451mg [Capsella rubella]
 gb|EOA18016.1| hypothetical protein CARUB_v10006451mg [Capsella rubella]
Length=380

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM  AVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPDAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  119



>ref|XP_010246462.1| PREDICTED: shaggy-related protein kinase eta [Nelumbo nucifera]
Length=405

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            EM  DKEMSA VVEGN+ VTGHIISTTIGGKNGE KRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  25   EMGDDKEMSAPVVEGNDPVTGHIISTTIGGKNGEAKRTISYMAERVVGTGSFGIVFQAKC  84

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMR M+HPNVI LKHCFFSTT+++ELFLNLVMEYVP
Sbjct  85   LETGETVAIKKVLQDRRYKNRELQLMRSMEHPNVICLKHCFFSTTSKNELFLNLVMEYVP  144



>ref|XP_002317404.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
 gb|EEE98016.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
Length=380

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM+A V +GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMNARVADGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT  +ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTDNNELFLNLVMEYVP  119



>ref|XP_011039408.1| PREDICTED: shaggy-related protein kinase eta-like [Populus euphratica]
 ref|XP_011039409.1| PREDICTED: shaggy-related protein kinase eta-like [Populus euphratica]
Length=380

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM+A V +GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMNARVADGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT  +ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTDNNELFLNLVMEYVP  119



>gb|KHG20434.1| Shaggy-related protein kinase eta [Gossypium arboreum]
Length=381

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAPVVDVNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  119



>gb|AES66964.2| shaggy-like kinase dzeta [Medicago truncatula]
Length=372

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSA+VV+ N+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSASVVDSNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQD+RYKNRELQLMR+MDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  61   AIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  113



>emb|CDY34051.1| BnaC03g62810D [Brassica napus]
Length=380

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+ AAVV G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEVPAAVVNGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  119



>gb|AFK40474.1| unknown [Medicago truncatula]
 gb|KEH36622.1| shaggy-like kinase dzeta [Medicago truncatula]
Length=380

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MSEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNV++LKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVVTLKHCFFSTTSTDELFLNLVMEYVP  119



>gb|AFK46922.1| unknown [Lotus japonicus]
Length=380

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ++GE VAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ESGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSTDELFLNLVMEYVP  119



>gb|KJB34902.1| hypothetical protein B456_006G089400 [Gossypium raimondii]
Length=381

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSALVVDVNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  119



>gb|AGV54503.1| shaggy-related protein kinase eta-like protein [Phaseolus vulgaris]
Length=380

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSNSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNVI+LKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVITLKHCFFSTTSTDELFLNLVMEYVP  119



>gb|ACJ84750.1| unknown [Medicago truncatula]
Length=380

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MSEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNV++LKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVVTLKHCFFSTTSTDELFLNLVMEYVP  119



>ref|XP_008790026.1| PREDICTED: shaggy-related protein kinase eta-like [Phoenix dactylifera]
Length=403

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 112/121 (93%), Gaps = 2/121 (2%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEM  DKE  A+VVEGN  VTGHIISTTIGGKNGE KRTI+YMAERVVGTGSFGIVFQAK
Sbjct  24   PEMAEDKE--ASVVEGNGPVTGHIISTTIGGKNGEAKRTISYMAERVVGTGSFGIVFQAK  81

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT RDELFLNLVMEYV
Sbjct  82   CLETGETVAIKKVLQDRRYKNRELQLMRSMDHPNVISLKHCFFSTTNRDELFLNLVMEYV  141

Query  617  P  619
            P
Sbjct  142  P  142



>ref|XP_004485912.1| PREDICTED: shaggy-related protein kinase eta-like [Cicer arietinum]
Length=379

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNV++LKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVVTLKHCFFSTTSTDELFLNLVMEYVP  119



>ref|XP_009619543.1| PREDICTED: shaggy-related protein kinase eta [Nicotiana tomentosiformis]
Length=382

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA V++GN+AVTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAPVMDGNDAVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            + GETVAIKKVLQDRRYKNRELQLMR +DHPNV+ LKHCF+STT++DELFLNLVMEYVP
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTLDHPNVVCLKHCFYSTTSKDELFLNLVMEYVP  119



>ref|XP_009781118.1| PREDICTED: shaggy-related protein kinase eta [Nicotiana sylvestris]
Length=382

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA V++GN+AVTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAPVMDGNDAVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            + GETVAIKKVLQDRRYKNRELQLMR +DHPNV+ LKHCF+STT++DELFLNLVMEYVP
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTLDHPNVVCLKHCFYSTTSKDELFLNLVMEYVP  119



>ref|XP_009378930.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Pyrus 
x bretschneideri]
Length=374

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MSAPVMEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMRLMDHPNV+ LKHCFFSTT +DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVLLKHCFFSTTTKDELFLNLVMEYVP  113



>gb|KDO77889.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=376

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +2

Query  278  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  457
            EMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGET
Sbjct  2    EMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGET  61

Query  458  VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            VAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  62   VAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVP  115



>ref|NP_001054901.1| Os05g0207500 [Oryza sativa Japonica Group]
 gb|AAU90187.1| putative shaggy-related protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF16815.1| Os05g0207500 [Oryza sativa Japonica Group]
Length=402

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +2

Query  275  KEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGE  454
            +E  A   EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGE
Sbjct  28   QEGEAPYAEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGE  87

Query  455  TVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            TVAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  88   TVAIKKVLQDRRYKNRELQLMRAMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  142



>gb|KJB68373.1| hypothetical protein B456_010G241600 [Gossypium raimondii]
Length=385

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS  VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSTPVVDRNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  119



>ref|XP_010518815.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Tarenaya 
hassleriana]
Length=380

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS AVV+G++ VTGHIISTTIGGKNGEPK+T++YMAE VVGTGSFGIVF+AKCL
Sbjct  1    MADDKEMSDAVVDGHDQVTGHIISTTIGGKNGEPKQTMSYMAESVVGTGSFGIVFRAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  119



>gb|KJB68374.1| hypothetical protein B456_010G241600 [Gossypium raimondii]
Length=381

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS  VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSTPVVDRNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  119



>ref|XP_002522231.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF40089.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=380

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM+A VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMAARVVDSNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQD+RYKNRELQLMR+MDHPNVISLKHCFFSTT  +ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFSTTNNNELFLNLVMEYVP  119



>ref|XP_007025342.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY27964.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=362

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSAAVV+GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  113



>ref|XP_010529206.1| PREDICTED: shaggy-related protein kinase eta-like isoform X2 
[Tarenaya hassleriana]
Length=374

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  113



>ref|XP_009108386.1| PREDICTED: shaggy-related protein kinase eta-like [Brassica rapa]
Length=380

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+  AVV G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEVPGAVVNGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  119



>ref|XP_003542973.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Glycine max]
 gb|KHN08421.1| Shaggy-related protein kinase eta [Glycine soja]
Length=380

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS++V  G++++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSSSVTNGDDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTSTDELFLNLVMEYVP  119



>ref|XP_002305736.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
 ref|XP_006384065.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
 ref|XP_006384066.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
 gb|EEE86247.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
 gb|ERP61862.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
 gb|ERP61863.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
Length=380

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM+  V +GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MAEDKEMTTRVADGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT  +ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTNNNELFLNLVMEYVP  119



>gb|KJB34899.1| hypothetical protein B456_006G089300 [Gossypium raimondii]
Length=381

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+SA VV+ N+ VTGH+ISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDVNDPVTGHVISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  119



>emb|CDY62551.1| BnaA03g58360D, partial [Brassica napus]
Length=264

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  275  KEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGE  454
            +EM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE
Sbjct  4    QEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGE  63

Query  455  TVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            TVAIKK LQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  64   TVAIKKGLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  118



>ref|XP_010999759.1| PREDICTED: shaggy-related protein kinase eta [Populus euphratica]
 ref|XP_010999761.1| PREDICTED: shaggy-related protein kinase eta [Populus euphratica]
 ref|XP_010999762.1| PREDICTED: shaggy-related protein kinase eta [Populus euphratica]
Length=380

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM+  V +GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MAEDKEMTTRVADGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT  +ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTNNNELFLNLVMEYVP  119



>ref|XP_003546036.1| PREDICTED: shaggy-related protein kinase eta-like [Glycine max]
Length=380

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS++V  G++++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MTEDKEMSSSVTNGDDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTSTDELFLNLVMEYVP  119



>gb|ABK95578.1| unknown [Populus trichocarpa]
Length=380

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM+  V +GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MAEDKEMTTRVADGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT  +ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTNNNELFLNLVMEYVP  119



>ref|XP_010925615.1| PREDICTED: shaggy-related protein kinase eta-like [Elaeis guineensis]
Length=403

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 111/121 (92%), Gaps = 2/121 (2%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEM  DKE  A+VVEGN   TGHIISTTIGGKNGE KRTI+YMAERVVGTGSFG+VFQAK
Sbjct  24   PEMAEDKE--ASVVEGNGPATGHIISTTIGGKNGESKRTISYMAERVVGTGSFGVVFQAK  81

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT RDELFLNLVMEYV
Sbjct  82   CLETGETVAIKKVLQDRRYKNRELQLMRSMDHPNVISLKHCFFSTTNRDELFLNLVMEYV  141

Query  617  P  619
            P
Sbjct  142  P  142



>gb|KDO77890.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=374

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVP  113



>ref|XP_006449528.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
 gb|ESR62768.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
Length=374

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSKNELFLNLVMEYVP  113



>ref|XP_010915474.1| PREDICTED: shaggy-related protein kinase eta-like [Elaeis guineensis]
Length=403

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 111/121 (92%), Gaps = 2/121 (2%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEM  DKE  A+V+EGN  VTGHIISTTIGGKNGE KRTI+YMAERVVGTGSFGIVFQAK
Sbjct  24   PEMAEDKE--ASVIEGNGPVTGHIISTTIGGKNGEAKRTISYMAERVVGTGSFGIVFQAK  81

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGE VAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT RDELFLNLVMEYV
Sbjct  82   CLETGEIVAIKKVLQDRRYKNRELQLMRSMDHPNVISLKHCFFSTTNRDELFLNLVMEYV  141

Query  617  P  619
            P
Sbjct  142  P  142



>emb|CDX99437.1| BnaC01g11150D [Brassica napus]
Length=381

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 114/120 (95%), Gaps = 1/120 (1%)
 Frame = +2

Query  263  METDKEMS-AAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            M  D+EM  AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  1    MADDREMPPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  60

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   LETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  120



>ref|XP_009394192.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 2/120 (2%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            EM  DK+  A+V+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  32   EMAEDKQ--ASVMEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGNGSFGIVFQAKC  89

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+T ETVAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  90   LETRETVAIKKVLQDRRYKNRELQLMRSMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  149



>ref|XP_010496879.1| PREDICTED: shaggy-related protein kinase eta-like [Camelina sativa]
Length=381

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 113/120 (94%), Gaps = 1/120 (1%)
 Frame = +2

Query  263  METDKEMSAAVVEG-NEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            M  DKEM  AVV+G ++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  1    MADDKEMPDAVVDGGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  60

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   LETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  120



>ref|XP_010449479.1| PREDICTED: shaggy-related protein kinase eta [Camelina sativa]
Length=381

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 113/120 (94%), Gaps = 1/120 (1%)
 Frame = +2

Query  263  METDKEMSAAVVEG-NEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            M  DKEM  AVV+G ++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  1    MADDKEMPDAVVDGGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  60

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   LETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  120



>ref|XP_010439822.1| PREDICTED: shaggy-related protein kinase eta-like [Camelina sativa]
Length=381

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 113/120 (94%), Gaps = 1/120 (1%)
 Frame = +2

Query  263  METDKEMSAAVVEG-NEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            M  DKEM  AVV+G ++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  1    MADDKEMPDAVVDGGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  60

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   LETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  120



>ref|XP_004134656.1| PREDICTED: shaggy-related protein kinase eta [Cucumis sativus]
 gb|KGN49313.1| hypothetical protein Csa_6G519650 [Cucumis sativus]
Length=379

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M   KEM   V++GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVF+AKCL
Sbjct  1    MADVKEMPGPVIDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFKAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGE VAIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT +DELFLNLVMEYVP
Sbjct  61   ETGENVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTTKDELFLNLVMEYVP  119



>dbj|BAH57105.1| AT4G18710 [Arabidopsis thaliana]
Length=374

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            M AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  113



>ref|XP_004293965.1| PREDICTED: shaggy-related protein kinase eta [Fragaria vesca 
subsp. vesca]
Length=379

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM+A+VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMAASVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR+MDHPNVI LKHCFFSTT+++ELFLNLVMEYVP
Sbjct  60   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVICLKHCFFSTTSKNELFLNLVMEYVP  118



>emb|CDY70859.1| BnaAnng35300D [Brassica napus]
Length=374

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            M AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVRLKHCFFSTTSKDELFLNLVMEYVP  113



>ref|XP_008225315.1| PREDICTED: shaggy-related protein kinase eta [Prunus mume]
Length=379

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ++GETVAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT+R+ELFLNLVMEYVP
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSRNELFLNLVMEYVP  118



>emb|CDX78886.1| BnaA01g09530D [Brassica napus]
Length=374

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            M AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVP  113



>ref|XP_007211435.1| hypothetical protein PRUPE_ppa007161mg [Prunus persica]
 gb|EMJ12634.1| hypothetical protein PRUPE_ppa007161mg [Prunus persica]
Length=379

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ++GETVAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT+R+ELFLNLVMEYVP
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSRNELFLNLVMEYVP  118



>emb|CDY64921.1| BnaC07g50210D [Brassica napus]
Length=374

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            M AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPNV+ LKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVRLKHCFFSTTSKDELFLNLVMEYVP  113



>ref|XP_011085977.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Sesamum 
indicum]
Length=382

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEM A V++ N+ VTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKC+
Sbjct  1    MADDKEMHAPVMDRNDTVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCI  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR MDHPNV+SLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRTMDHPNVVSLKHCFFSTTSQNELFLNLVMEYVP  119



>ref|XP_009396521.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 2/121 (2%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P M+ DK+ S  V+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PGMDEDKKTS--VLEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  88

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQD RYKNRELQLMR MDH NVISLKHCFFSTT+RDELFLNLVMEYV
Sbjct  89   CLETGETVAIKKVLQDPRYKNRELQLMRSMDHSNVISLKHCFFSTTSRDELFLNLVMEYV  148

Query  617  P  619
            P
Sbjct  149  P  149



>ref|XP_010538571.1| PREDICTED: shaggy-related protein kinase eta-like isoform X2 
[Tarenaya hassleriana]
Length=374

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL+T ETV
Sbjct  1    MSAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCLETRETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQ+MR+MDHPNVISLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQIMRVMDHPNVISLKHCFFSTTSKDELFLNLVMEYVP  113



>gb|KHN29604.1| Shaggy-related protein kinase eta [Glycine soja]
Length=374

 Score =   213 bits (543),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSTDELFLNLVMEYVP  113



>ref|XP_009351457.1| PREDICTED: shaggy-related protein kinase eta [Pyrus x bretschneideri]
Length=378

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ++GETVAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSKNELFLNLVMEYVP  118



>ref|XP_004233047.1| PREDICTED: shaggy-related protein kinase eta [Solanum lycopersicum]
 ref|XP_006358115.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum tuberosum]
Length=382

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA V++GN+AVTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAPVMDGNDAVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            + GETVAIKKVLQDRRYKNRELQLMR MDH NV+ LKHCF+STT+ +ELFLNLVMEYVP
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTMDHTNVVCLKHCFYSTTSTNELFLNLVMEYVP  119



>ref|XP_008383613.1| PREDICTED: shaggy-related protein kinase eta [Malus domestica]
 ref|XP_008366041.1| PREDICTED: shaggy-related protein kinase eta [Malus domestica]
Length=379

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ++GETVAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSKNELFLNLVMEYVP  118



>ref|XP_008371494.1| PREDICTED: shaggy-related protein kinase eta-like [Malus domestica]
Length=378

 Score =   213 bits (543),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ++GETVAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSKNELFLNLVMEYVP  118



>gb|KHN07046.1| Shaggy-related protein kinase eta [Glycine soja]
Length=374

 Score =   213 bits (543),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPNVISLKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTSTDELFLNLVMEYVP  113



>ref|XP_009352741.1| PREDICTED: shaggy-related protein kinase eta-like [Pyrus x bretschneideri]
Length=379

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ++GETVAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSKNELFLNLVMEYVP  118



>gb|KCW47359.1| hypothetical protein EUGRSUZ_K01144 [Eucalyptus grandis]
Length=378

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  266  ETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLK  445
            ++D+E+S AV E   AVTGHIISTTIGGKNGEPK+T++YMAER++G GSFG+VFQA+CL+
Sbjct  32   DSDREVSPAVYENKNAVTGHIISTTIGGKNGEPKQTLSYMAERIIGNGSFGVVFQARCLE  91

Query  446  TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            TGETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SL+HCFFSTT  DELFLNLVMEYVP
Sbjct  92   TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLRHCFFSTTNNDELFLNLVMEYVP  149



>gb|KJB34900.1| hypothetical protein B456_006G089300 [Gossypium raimondii]
Length=382

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 113/120 (94%), Gaps = 1/120 (1%)
 Frame = +2

Query  263  METDK-EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            M  DK E+SA VV+ N+ VTGH+ISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  1    MADDKQEISAPVVDVNDPVTGHVISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  60

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   LETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  120



>ref|XP_008794094.1| PREDICTED: shaggy-related protein kinase eta [Phoenix dactylifera]
Length=403

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 110/121 (91%), Gaps = 2/121 (2%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEM  DKE  A+VVEGN   TGHIISTTI GKNGE KRTI+YMAERVVGTGSFGIVFQAK
Sbjct  24   PEMAEDKE--ASVVEGNGPATGHIISTTIVGKNGESKRTISYMAERVVGTGSFGIVFQAK  81

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQDRRYKNRELQLMR MDHPN+ISLKHCFFSTT RDELFLNLVMEY+
Sbjct  82   CLETGETVAIKKVLQDRRYKNRELQLMRSMDHPNLISLKHCFFSTTNRDELFLNLVMEYI  141

Query  617  P  619
            P
Sbjct  142  P  142



>ref|XP_003540409.1| PREDICTED: shaggy-related protein kinase zeta-like [Glycine max]
Length=409

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +2

Query  269  TDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKT  448
            T+KEMSA V +GN+A+TGHIISTTI GKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+T
Sbjct  40   TEKEMSAPVADGNDALTGHIISTTIAGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLET  99

Query  449  GETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            GE VAIKKVLQDRRYKNRELQLMR+MDHPN+ISL + FFSTT+RDELFLNLVMEYVP
Sbjct  100  GEAVAIKKVLQDRRYKNRELQLMRVMDHPNIISLSNYFFSTTSRDELFLNLVMEYVP  156



>gb|EPS63039.1| hypothetical protein M569_11747, partial [Genlisea aurea]
Length=344

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +2

Query  278  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  457
            EMS +  + N+ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQA+CL++GE 
Sbjct  1    EMSVSTADANDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQARCLESGEY  60

Query  458  VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            VAIKKVLQDRRYKNRELQ+MRLMDHPNVISLKHCFFSTT RD+LFLNLVM+YVP
Sbjct  61   VAIKKVLQDRRYKNRELQIMRLMDHPNVISLKHCFFSTTTRDDLFLNLVMDYVP  114



>gb|ACR37222.1| unknown [Zea mays]
Length=136

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +2

Query  293  VVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKK  472
            ++EGN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKK
Sbjct  1    MIEGNDPVTGHIISTTIGGKNGEPKKTISYMAERVVGTGSFGIVFQAKCLETGETVAIKK  60

Query  473  VLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            VLQD+RYKNRELQ+MR MDH N +SLKHCFFSTT+RDELFLNLVME+VP
Sbjct  61   VLQDKRYKNRELQIMRSMDHCNAVSLKHCFFSTTSRDELFLNLVMEFVP  109



>ref|XP_006594815.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X1 
[Glycine max]
Length=417

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +   +KEMSA V +GN+A+TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  33   DASAEKEMSAPVADGNDALTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE VAIKKVLQDRRYKNRELQLMR+MDHPN+I+L + FFSTT+RDELFLNLVMEYVP
Sbjct  93   LETGEAVAIKKVLQDRRYKNRELQLMRMMDHPNIITLSNYFFSTTSRDELFLNLVMEYVP  152



>gb|EYU28104.1| hypothetical protein MIMGU_mgv1a008133mg [Erythranthe guttata]
Length=383

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 113/120 (94%), Gaps = 1/120 (1%)
 Frame = +2

Query  263  METDKEMSAA-VVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            M  DKEMSAA +++GN A  GHIISTTIGGKNGEPK+T++YMAERVVGTGSFG+VFQAKC
Sbjct  1    MADDKEMSAAPIMDGNGASIGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGVVFQAKC  60

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ++TGE+VAIKKVLQDRRYKNRELQLMR MDHPNV+SLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  61   IETGESVAIKKVLQDRRYKNRELQLMRTMDHPNVVSLKHCFFSTTSKNELFLNLVMEYVP  120



>ref|XP_010035873.1| PREDICTED: shaggy-related protein kinase eta-like [Eucalyptus 
grandis]
 gb|KCW47357.1| hypothetical protein EUGRSUZ_K01144 [Eucalyptus grandis]
Length=410

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  266  ETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLK  445
            ++D+E+S AV E   AVTGHIISTTIGGKNGEPK+T++YMAER++G GSFG+VFQA+CL+
Sbjct  32   DSDREVSPAVYENKNAVTGHIISTTIGGKNGEPKQTLSYMAERIIGNGSFGVVFQARCLE  91

Query  446  TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            TGETVAIKKVLQDRRYKNRELQLMRLMDHPNV+SL+HCFFSTT  DELFLNLVMEYVP
Sbjct  92   TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLRHCFFSTTNNDELFLNLVMEYVP  149



>gb|ACJ83284.1| unknown [Medicago truncatula]
Length=172

 Score =   204 bits (520),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  D+EM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  35   KIRDDREMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  94

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  95   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  154



>dbj|BAJ91341.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96026.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  290  AVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIK  469
            A  EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIK
Sbjct  31   ARTEGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIK  90

Query  470  KVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            KVLQDRRYKNRELQLMR MDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  91   KVLQDRRYKNRELQLMRSMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  140



>gb|KJB68372.1| hypothetical protein B456_010G241600 [Gossypium raimondii]
Length=375

 Score =   211 bits (537),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MS  VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSTPVVDRNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT ++ELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTTKNELFLNLVMEYVP  113



>gb|AGK41245.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41247.1| SHAGGY-like kinase [Triticum aestivum]
Length=400

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +2

Query  290  AVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIK  469
            A  EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIK
Sbjct  31   ARTEGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIK  90

Query  470  KVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            KVLQDRRYKNRELQLMR MDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  91   KVLQDRRYKNRELQLMRSMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  140



>ref|XP_003565257.1| PREDICTED: shaggy-related protein kinase eta-like [Brachypodium 
distachyon]
Length=399

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  299  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  478
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVL
Sbjct  33   EGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVL  92

Query  479  QDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            QDRRYKNRELQLMR MDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  93   QDRRYKNRELQLMRSMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  139



>ref|XP_010518816.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Tarenaya 
hassleriana]
Length=374

 Score =   211 bits (536),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MS AVV+G++ VTGHIISTTIGGKNGEPK+T++YMAE VVGTGSFGIVF+AKCL+TGETV
Sbjct  1    MSDAVVDGHDQVTGHIISTTIGGKNGEPKQTMSYMAESVVGTGSFGIVFRAKCLETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT++DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSKDELFLNLVMEYVP  113



>gb|EMT19129.1| Shaggy-related protein kinase iota [Aegilops tauschii]
Length=378

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  299  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  478
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVL
Sbjct  12   EGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVL  71

Query  479  QDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            QDRRYKNRELQLMR MDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  72   QDRRYKNRELQLMRSMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  118



>gb|KHN28622.1| Shaggy-related protein kinase eta [Glycine soja]
Length=374

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MS++V  G++++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSSSVTNGDDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTSTDELFLNLVMEYVP  113



>gb|AGJ93555.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41244.1| SHAGGY-like kinase [Triticum aestivum]
Length=401

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  299  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  478
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVL
Sbjct  35   EGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVL  94

Query  479  QDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            QDRRYKNRELQLMR MDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  95   QDRRYKNRELQLMRSMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  141



>ref|XP_006594547.1| PREDICTED: shaggy-related protein kinase eta-like isoform X2 
[Glycine max]
 ref|XP_006594548.1| PREDICTED: shaggy-related protein kinase eta-like isoform X3 
[Glycine max]
Length=374

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MS++V  G++++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSSSVTNGDDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR++DHPNVISLKHCFFSTT+ DELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFSTTSTDELFLNLVMEYVP  113



>emb|CDM82043.1| unnamed protein product [Triticum aestivum]
Length=391

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  299  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  478
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVL
Sbjct  25   EGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVL  84

Query  479  QDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            QDRRYKNRELQLMR MDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  85   QDRRYKNRELQLMRSMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  131



>gb|AGJ93554.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41243.1| SHAGGY-like kinase [Triticum aestivum]
Length=400

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +2

Query  299  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  478
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVL
Sbjct  34   EGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVL  93

Query  479  QDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            QDRRYKNRELQLMR MDHPNV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  94   QDRRYKNRELQLMRSMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVP  140



>ref|XP_009380485.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            PEM    +  A+V++GN+ +TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  24   PEMVDADKQEASVIQGNQPLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  83

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            CL+TGETVAIKKVLQD RYKNRELQLMRLM HPNVISLKHCFFSTT +DELFLNLVM++V
Sbjct  84   CLETGETVAIKKVLQDIRYKNRELQLMRLMGHPNVISLKHCFFSTTNKDELFLNLVMDFV  143

Query  617  P  619
            P
Sbjct  144  P  144



>ref|XP_006367136.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum tuberosum]
Length=382

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA V++ N  VTGHIISTTIGGKNGEPK+T++YMAER+VGTGSFG+VFQAKCL
Sbjct  1    MADDKEMSAPVMDVNGGVTGHIISTTIGGKNGEPKQTVSYMAERIVGTGSFGVVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            + GETVAIKKVLQDRRYKNRELQLMR MD+PNV+SLKHCF+STT+++ELFLNLVMEYVP
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTMDNPNVVSLKHCFYSTTSKNELFLNLVMEYVP  119



>ref|XP_009770234.1| PREDICTED: shaggy-related protein kinase eta-like [Nicotiana 
sylvestris]
Length=384

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA V++ N AVTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MADDKEMSAPVMDVNGAVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGVVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            + GETVAIKKVLQDRRYKNRELQLMR MDH NV+ LKHCF+STT+++ELFLNLVMEYVP
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTMDHSNVVCLKHCFYSTTSKNELFLNLVMEYVP  119



>ref|XP_004234083.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Solanum 
lycopersicum]
Length=382

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA V++ N  VTGHIISTTIGGKNGEPK+T++YMAER+VGTGSFG+VFQAKCL
Sbjct  1    MADDKEMSAPVMDVNGGVTGHIISTTIGGKNGEPKQTVSYMAERIVGTGSFGVVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            + GETVAIKKVLQDRRYKNRELQLMR MD+PNV+SLKHCF+STT+++ELFLNLVMEYVP
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTMDNPNVVSLKHCFYSTTSKNELFLNLVMEYVP  119



>gb|AFW76550.1| putative glycogen synthase kinase family protein [Zea mays]
Length=218

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEG-NEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQA  433
            P    D++  A ++ G ++AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFG+VFQA
Sbjct  21   PRASADEKHVATIIAGGSDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGVVFQA  80

Query  434  KCLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEY  613
            KC++TGETVAIKKVLQD+RYKNRELQ+MR +DH NVISLKHCFFSTT+RDELFLNLVME+
Sbjct  81   KCIETGETVAIKKVLQDKRYKNRELQIMRSIDHCNVISLKHCFFSTTSRDELFLNLVMEF  140

Query  614  VP  619
            VP
Sbjct  141  VP  142



>gb|EYU43326.1| hypothetical protein MIMGU_mgv1a008172mg [Erythranthe guttata]
Length=382

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMS  V++  +AVTGHIISTTIGGKNGEPK+T+TYMAERVVGTGSFGIVFQAKC+
Sbjct  1    MADDKEMSVPVMDRKDAVTGHIISTTIGGKNGEPKQTVTYMAERVVGTGSFGIVFQAKCI  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNREL+LMR MDH NV+SLKHCF+STT+++ELFLNL+MEYVP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELELMRTMDHSNVVSLKHCFYSTTSQNELFLNLIMEYVP  119



>gb|ERM98330.1| hypothetical protein AMTR_s00170p00028260 [Amborella trichopoda]
Length=355

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  +KE+SA+VVEG +  TGHIIS TIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MADEKEVSASVVEGTDTETGHIISITIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR MDHPNV+SLKHCF+ST +++EL+LNLVME+VP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRCMDHPNVVSLKHCFYSTASQNELYLNLVMEFVP  119



>ref|XP_004965568.1| PREDICTED: shaggy-related protein kinase zeta-like [Setaria italica]
Length=402

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  436
            P    D++  A V+ GN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFG+VFQAK
Sbjct  21   PRASADEKHVATVMGGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGVVFQAK  80

Query  437  CLKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYV  616
            C++TGETVAIKKVLQD+RYKNRELQ+MR +DH NVISLKHCFFSTT+RDELFLNLVME+V
Sbjct  81   CIETGETVAIKKVLQDKRYKNRELQIMRSIDHCNVISLKHCFFSTTSRDELFLNLVMEFV  140

Query  617  P  619
            P
Sbjct  141  P  141



>gb|AEQ94156.1| shaggy-related protein kinase [Elaeis guineensis]
Length=216

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  DKE+ A V++GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIRDDKEVEATVIDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  152



>ref|XP_002873682.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49941.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  93

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  153



>emb|CAB87631.1| protein kinase MSK-3-like [Arabidopsis thaliana]
Length=408

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  93

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  153



>ref|XP_010453592.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  35   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  94

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  95   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  154



>ref|XP_006594816.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X2 
[Glycine max]
Length=378

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSA V +GN+A+TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSAPVADGNDALTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR+MDHPN+I+L + FFSTT+RDELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRMMDHPNIITLSNYFFSTTSRDELFLNLVMEYVP  113



>ref|XP_006833052.2| PREDICTED: shaggy-related protein kinase zeta [Amborella trichopoda]
Length=374

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  +KE+SA+VVEG +  TGHIIS TIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MADEKEVSASVVEGTDTETGHIISITIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            +TGETVAIKKVLQDRRYKNRELQLMR MDHPNV+SLKHCF+ST +++EL+LNLVME+VP
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRCMDHPNVVSLKHCFYSTASQNELYLNLVMEFVP  119



>ref|XP_010492276.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
 ref|XP_010492277.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
Length=411

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  35   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  94

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  95   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  154



>ref|NP_196968.2| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
 sp|Q8VZD5.1|KSG5_ARATH RecName: Full=Shaggy-related protein kinase epsilon; AltName: 
Full=ASK-epsilon [Arabidopsis thaliana]
 gb|AAL57679.1| AT5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AAQ65089.1| At5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AED92057.1| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
Length=410

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  93

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  153



>ref|XP_010420109.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  35   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  94

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  95   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  154



>ref|XP_010231609.1| PREDICTED: shaggy-related protein kinase eta [Brachypodium distachyon]
Length=403

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  287  AAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAI  466
            A   E N+A+TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETVAI
Sbjct  33   APYAEANDAMTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAI  92

Query  467  KKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            KKVLQDRRYKNRELQLMR ++HPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  93   KKVLQDRRYKNRELQLMRSINHPNVISLKHCFFSTTSRDELFLNLVMEYVP  143



>ref|XP_006399977.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
 gb|ESQ41430.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
Length=409

 Score =   209 bits (532),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  33   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  152



>gb|AEQ94143.1| putative Glycogen synthase kinase 3 [Elaeis guineensis]
Length=231

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  DKE+ A V++GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIRDDKEVEATVIDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  152



>gb|EEE54080.1| hypothetical protein OsJ_00810 [Oryza sativa Japonica Group]
Length=407

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/106 (92%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = +2

Query  302  GNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVLQ  481
            G +AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVLQ
Sbjct  39   GGDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQ  98

Query  482  DRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            DRRYKNRELQLMR M+HPNVI LKHCFFSTT+RDELFLNLVMEYVP
Sbjct  99   DRRYKNRELQLMRAMEHPNVICLKHCFFSTTSRDELFLNLVMEYVP  144



>gb|AGJ98224.1| BIN2-like protein PSK9 [Petunia x hybrida]
Length=376

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            MSA V++ N+AVTGHIISTTIGGKNG+PK+T++YMAERVVGTGSFG+VFQAKCL+ GETV
Sbjct  1    MSAPVMDVNDAVTGHIISTTIGGKNGQPKQTVSYMAERVVGTGSFGVVFQAKCLENGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR MDHPNV+SLKHCF+STT+++ELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRTMDHPNVVSLKHCFYSTTSKNELFLNLVMEYVP  113



>gb|KJB45482.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=275

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  31   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  90

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV++LKHCFFSTT +DEL+LNLV+EYVP
Sbjct  91   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEKDELYLNLVLEYVP  150



>ref|XP_011085978.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Sesamum 
indicum]
Length=376

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +2

Query  281  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  460
            M A V++ N+ VTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MHAPVMDRNDTVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  461  AIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            AIKKVLQDRRYKNRELQLMR MDHPNV+SLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  61   AIKKVLQDRRYKNRELQLMRTMDHPNVVSLKHCFFSTTSQNELFLNLVMEYVP  113



>ref|XP_006287860.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287861.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287862.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20758.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20759.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20760.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
Length=410

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  93

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +D+L+LNLV+EYVP
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDDLYLNLVLEYVP  153



>dbj|BAA92966.1| putative shaggy-like kinase dzeta [Oryza sativa Japonica Group]
Length=407

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/106 (92%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = +2

Query  302  GNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVLQ  481
            G +AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVLQ
Sbjct  42   GGDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQ  101

Query  482  DRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            DRRYKNRELQLMR M+HPNVI LKHCFFSTT+RDELFLNLVMEYVP
Sbjct  102  DRRYKNRELQLMRAMEHPNVICLKHCFFSTTSRDELFLNLVMEYVP  147



>ref|XP_008345980.1| PREDICTED: shaggy-related protein kinase eta [Malus domestica]
Length=379

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 110/114 (96%), Gaps = 1/114 (1%)
 Frame = +2

Query  278  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  457
            E SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL++GET
Sbjct  7    EXSAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLESGET  65

Query  458  VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            VAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT+++ELFLNLVMEYVP
Sbjct  66   VAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFSTTSKNELFLNLVMEYVP  119



>gb|EEC70138.1| hypothetical protein OsI_00828 [Oryza sativa Indica Group]
Length=404

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/106 (92%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = +2

Query  302  GNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVLQ  481
            G +AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVLQ
Sbjct  39   GGDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQ  98

Query  482  DRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            DRRYKNRELQLMR M+HPNVI LKHCFFSTT+RDELFLNLVMEYVP
Sbjct  99   DRRYKNRELQLMRAMEHPNVICLKHCFFSTTSRDELFLNLVMEYVP  144



>emb|CDX70574.1| BnaC03g06580D [Brassica napus]
Length=409

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGK+G+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  33   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKDGQPKQTISYMAERVVGQGSFGIVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  152



>emb|CDX78587.1| BnaA03g04990D [Brassica napus]
Length=410

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGK+G+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKDGQPKQTISYMAERVVGQGSFGIVFQAKC  93

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  153



>ref|XP_009131419.1| PREDICTED: shaggy-related protein kinase epsilon [Brassica rapa]
Length=410

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGK+G+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKDGQPKQTISYMAERVVGQGSFGIVFQAKC  93

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  153



>ref|XP_009151155.1| PREDICTED: shaggy-related protein kinase alpha [Brassica rapa]
 emb|CDX88238.1| BnaA06g28290D [Brassica napus]
Length=403

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  27   KIRDDKEMEATVVDGNSTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGVVFQAKC  86

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  87   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  146



>ref|XP_009588662.1| PREDICTED: shaggy-related protein kinase eta-like [Nicotiana 
tomentosiformis]
Length=384

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  263  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  442
            M  DKEMSA V++ N AVTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MADDKEMSAPVMDVNGAVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGVVFQAKCL  60

Query  443  KTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            + GETVAIKKVLQDRRYKNRELQLMR M+H NV+ LKHCF+STT+++ELFLNLVMEYVP
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTMEHLNVVCLKHCFYSTTSKNELFLNLVMEYVP  119



>gb|KDO66115.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=243

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  272  DKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTG  451
            +KEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFGIVFQAKCL+TG
Sbjct  57   EKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETG  116

Query  452  ETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+E+VP
Sbjct  117  ETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEFVP  172



>gb|ACG33869.1| shaggy-related protein kinase eta [Zea mays]
Length=412

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +2

Query  272  DKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTG  451
            D + + +++EG++ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TG
Sbjct  36   DAKHAGSMIEGSDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETG  95

Query  452  ETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ETVAIKKVLQD+RYKNRELQ+MR MDH NV+SLKHCFFSTT+RDELFLNLVME+VP
Sbjct  96   ETVAIKKVLQDKRYKNRELQIMRSMDHCNVVSLKHCFFSTTSRDELFLNLVMEFVP  151



>ref|NP_001130511.1| uncharacterized protein LOC100191610 [Zea mays]
 gb|ACF78757.1| unknown [Zea mays]
 gb|ACF84377.1| unknown [Zea mays]
 gb|ACF87812.1| unknown [Zea mays]
 gb|ACG36869.1| shaggy-related protein kinase eta [Zea mays]
 gb|AFW65991.1| putative glycogen synthase kinase family protein [Zea mays]
Length=412

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +2

Query  272  DKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTG  451
            D + + +++EG++ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TG
Sbjct  36   DAKHAGSMIEGSDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETG  95

Query  452  ETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ETVAIKKVLQD+RYKNRELQ+MR MDH NV+SLKHCFFSTT+RDELFLNLVME+VP
Sbjct  96   ETVAIKKVLQDKRYKNRELQIMRSMDHCNVVSLKHCFFSTTSRDELFLNLVMEFVP  151



>gb|KDO66112.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66113.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66114.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=244

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  272  DKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTG  451
            +KEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFGIVFQAKCL+TG
Sbjct  57   EKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETG  116

Query  452  ETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            ETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+E+VP
Sbjct  117  ETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEFVP  172



>ref|XP_010546768.1| PREDICTED: shaggy-related protein kinase alpha [Tarenaya hassleriana]
Length=399

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  DKEM A VV+GN   TGHII TTIGGKNG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  23   KIRDDKEMEATVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKC  82

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  83   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  142



>ref|XP_006647108.1| PREDICTED: shaggy-related protein kinase zeta-like [Oryza brachyantha]
Length=383

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = +2

Query  287  AAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAI  466
            A+++EG++ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAI
Sbjct  12   ASLIEGSDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAI  71

Query  467  KKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            KKVLQD+RYKNRELQ+MR MDH NV+SLKHCFFSTT+RDELFLNLVME+VP
Sbjct  72   KKVLQDKRYKNRELQIMRSMDHCNVVSLKHCFFSTTSRDELFLNLVMEFVP  122



>emb|CDX80585.1| BnaC07g28590D [Brassica napus]
Length=402

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  26   KIRDDKEMEATVVDGNSTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  85

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  86   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  145



>ref|XP_002453590.1| hypothetical protein SORBIDRAFT_04g008580 [Sorghum bicolor]
 gb|EES06566.1| hypothetical protein SORBIDRAFT_04g008580 [Sorghum bicolor]
Length=417

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  269  TDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKT  448
             D + + +++EG++ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+T
Sbjct  40   ADAKHAGSMIEGSDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLET  99

Query  449  GETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            GETVAIKKVLQD+RYKNRELQ+MR MDH NV+SLKHCFFSTT+RDELFLNLVME+VP
Sbjct  100  GETVAIKKVLQDKRYKNRELQIMRSMDHCNVVSLKHCFFSTTSRDELFLNLVMEFVP  156



>ref|XP_011003165.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
 ref|XP_011003166.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KISDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGLVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  152



>ref|XP_002302794.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
 gb|EEE82067.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
Length=409

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KISDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGLVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  152



>gb|AGJ93556.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGJ93557.1| SHAGGY-like kinase [Triticum aestivum]
Length=402

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  287  AAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAI  466
            A   EGN+A+TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETVAI
Sbjct  32   APYAEGNDAMTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAI  91

Query  467  KKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            KKVLQDRRYKNRELQLMR M H NV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  92   KKVLQDRRYKNRELQLMRSMIHSNVVSLKHCFFSTTSRDELFLNLVMEYVP  142



>gb|EMS65432.1| Shaggy-related protein kinase iota [Triticum urartu]
Length=406

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  266  ETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLK  445
            +  ++  A   EGN+A+TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+
Sbjct  29   QKQQDGEAPYAEGNDAMTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLE  88

Query  446  TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            TGETVAIKKVLQDRRYKNRELQLMR M H NV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  89   TGETVAIKKVLQDRRYKNRELQLMRSMIHSNVVSLKHCFFSTTSRDELFLNLVMEYVP  146



>ref|XP_010550142.1| PREDICTED: shaggy-related protein kinase epsilon [Tarenaya hassleriana]
Length=409

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  33   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE VAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  93   LETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVP  152



>gb|AFW80358.1| putative glycogen synthase kinase family protein [Zea mays]
Length=318

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  299  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  478
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGET AIKKVL
Sbjct  40   EGGDTVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETFAIKKVL  99

Query  479  QDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            QDRRYKNRELQLMR M+HPNVI LKHCFFSTT+RDELFLNLVME+VP
Sbjct  100  QDRRYKNRELQLMRAMEHPNVICLKHCFFSTTSRDELFLNLVMEFVP  146



>gb|AGK41246.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41248.1| SHAGGY-like kinase [Triticum aestivum]
Length=402

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +2

Query  287  AAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAI  466
            A   EGN+A+TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETVAI
Sbjct  32   APYAEGNDAMTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAI  91

Query  467  KKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            KKVLQDRRYKNRELQLMR M H NV+SLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  92   KKVLQDRRYKNRELQLMRSMIHSNVVSLKHCFFSTTSRDELFLNLVMEYVP  142



>gb|AFM94293.1| glycogen synthase kinase [Oncidium hybrid cultivar]
Length=372

 Score =   206 bits (523),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  269  TDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKT  448
              ++  A+++EG + VTGHIISTTIGGKNGEPK+TI+YMAERVVG GSFGIVFQAKCL+T
Sbjct  2    AQEKQEASLLEGTDPVTGHIISTTIGGKNGEPKQTISYMAERVVGNGSFGIVFQAKCLET  61

Query  449  GETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            GE VAIKKV QD+RYKNRELQLMR MDHPNVISLKHCFFSTT+RDELFLNLVMEYVP
Sbjct  62   GEAVAIKKVSQDKRYKNRELQLMRSMDHPNVISLKHCFFSTTSRDELFLNLVMEYVP  118



>ref|NP_001046390.1| Os02g0236200 [Oryza sativa Japonica Group]
 dbj|BAD27595.1| putative Shaggy-related protein kinase dzeta (ASK-dzeta) [Oryza 
sativa Japonica Group]
 dbj|BAF08304.1| Os02g0236200 [Oryza sativa Japonica Group]
Length=401

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = +2

Query  287  AAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAI  466
            A+++EG++ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAI
Sbjct  43   ASLMEGSDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAI  102

Query  467  KKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            KKVLQD+RYKNRELQ+MR MDH NV+SLKHCFFSTT+RDELFLNLVME+VP
Sbjct  103  KKVLQDKRYKNRELQIMRSMDHCNVVSLKHCFFSTTSRDELFLNLVMEFVP  153



>ref|NP_001149135.1| shaggy-related protein kinase eta [Zea mays]
 gb|ACG34332.1| shaggy-related protein kinase eta [Zea mays]
 gb|ACL53875.1| unknown [Zea mays]
 tpg|DAA52908.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=400

 Score =   206 bits (525),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  299  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  478
            EG +AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGET AIKKVL
Sbjct  36   EGGDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETFAIKKVL  95

Query  479  QDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            QDRRYKNRELQLMR M+HPNVI LKHCFFSTT+RDELFLNLVME+VP
Sbjct  96   QDRRYKNRELQLMRAMEHPNVICLKHCFFSTTSRDELFLNLVMEFVP  142



>gb|EYU34726.1| hypothetical protein MIMGU_mgv1a007335mg [Erythranthe guttata]
Length=407

 Score =   206 bits (525),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  266  ETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLK  445
            + +KEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKCL+
Sbjct  34   KVEKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLE  93

Query  446  TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  94   TGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVP  151



>gb|KDO86865.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=296

 Score =   203 bits (516),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  DKEM A VV+GN    GHII TTIGGKNG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  27   KIRDDKEMEATVVDGNGTEAGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKC  86

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGE VAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  87   LETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  146



>gb|KDO45354.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=353

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAER+VG GSFG+VFQAKC
Sbjct  33   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERIVGQGSFGVVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQD+RYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVP  152



>ref|XP_002454973.1| hypothetical protein SORBIDRAFT_03g002380 [Sorghum bicolor]
 gb|EES00093.1| hypothetical protein SORBIDRAFT_03g002380 [Sorghum bicolor]
Length=404

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/107 (91%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  299  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  478
            EG +AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGET AIKKVL
Sbjct  38   EGGDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETFAIKKVL  97

Query  479  QDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            QDRRYKNRELQLMR M+HPNVI LKHCFFSTT+RDELFLNLVME+VP
Sbjct  98   QDRRYKNRELQLMRAMEHPNVICLKHCFFSTTSRDELFLNLVMEFVP  144



>ref|XP_006299606.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
 gb|EOA32504.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
Length=409

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  260  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  439
            +++ DKEM A +V GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  33   KIQDDKEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGIVFQAKC  92

Query  440  LKTGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFSTTARDELFLNLVMEYVP  619
            L+TGETVAIKKVLQDRRYKNRELQ MRL+DHPNV+SLKHCFFSTT +DEL+LNLV+EYVP
Sbjct  93   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVP  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 885656638944