BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7472

Length=650
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794644.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    315   3e-102   Nicotiana sylvestris
ref|XP_006356685.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    314   6e-102   Solanum tuberosum [potatoes]
ref|XP_009608199.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    310   2e-100   Nicotiana tomentosiformis
ref|XP_004241059.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    310   3e-100   Solanum lycopersicum
ref|XP_012074382.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    308   8e-100   Jatropha curcas
gb|ACZ56437.1|  IAA-amino acid hydrolase                                308   1e-99    Populus tomentosa [Chinese white poplar]
ref|XP_008243485.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    306   9e-99    Prunus mume [ume]
ref|XP_002275838.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    305   1e-98    Vitis vinifera
ref|XP_009798014.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    305   1e-98    Nicotiana sylvestris
ref|XP_009603431.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    305   1e-98    Nicotiana tomentosiformis
ref|XP_007204388.1|  hypothetical protein PRUPE_ppa005836mg             305   3e-98    Prunus persica
ref|XP_011043650.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    304   3e-98    Populus euphratica
gb|KDO70553.1|  hypothetical protein CISIN_1g013571mg                   300   5e-98    Citrus sinensis [apfelsine]
ref|XP_002530514.1|  IAA-amino acid hydrolase ILR1 precursor, put...    302   2e-97    
ref|XP_006430119.1|  hypothetical protein CICLE_v10011738mg             302   2e-97    Citrus clementina [clementine]
ref|XP_002322806.1|  hypothetical protein POPTR_0016s07500g             303   5e-97    Populus trichocarpa [western balsam poplar]
ref|XP_006481704.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      301   7e-97    Citrus sinensis [apfelsine]
ref|XP_008387047.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    301   8e-97    
gb|KDO70551.1|  hypothetical protein CISIN_1g013571mg                   301   9e-97    Citrus sinensis [apfelsine]
ref|XP_009798013.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    300   1e-96    Nicotiana sylvestris
ref|XP_010246184.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    299   4e-96    Nelumbo nucifera [Indian lotus]
ref|XP_008243486.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    298   6e-96    Prunus mume [ume]
ref|XP_007027887.1|  Iaa-amino acid hydrolase 4                         297   2e-95    
ref|XP_011094270.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    296   5e-95    Sesamum indicum [beniseed]
ref|XP_006430118.1|  hypothetical protein CICLE_v10013480mg             294   3e-94    
ref|XP_006354111.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    294   4e-94    Solanum tuberosum [potatoes]
ref|XP_006481705.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    293   8e-94    Citrus sinensis [apfelsine]
ref|XP_004136498.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    289   2e-92    Cucumis sativus [cucumbers]
ref|XP_010246176.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    285   6e-91    Nelumbo nucifera [Indian lotus]
ref|XP_010683630.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    284   3e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004305641.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    284   3e-90    Fragaria vesca subsp. vesca
gb|KJB62043.1|  hypothetical protein B456_009G398600                    281   2e-89    Gossypium raimondii
ref|XP_004228647.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    281   2e-89    Solanum lycopersicum
ref|XP_010037298.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    281   3e-89    Eucalyptus grandis [rose gum]
gb|KCW48983.1|  hypothetical protein EUGRSUZ_K02598                     281   3e-89    Eucalyptus grandis [rose gum]
ref|XP_010037299.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    281   4e-89    Eucalyptus grandis [rose gum]
gb|EYU18085.1|  hypothetical protein MIMGU_mgv1a006848mg                280   8e-89    Erythranthe guttata [common monkey flower]
ref|XP_002281507.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      279   2e-88    Vitis vinifera
ref|XP_010093789.1|  IAA-amino acid hydrolase ILR1-like 7               278   3e-88    Morus notabilis
ref|XP_008442881.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    278   4e-88    Cucumis melo [Oriental melon]
ref|XP_008391948.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    278   8e-88    
ref|XP_010683632.1|  PREDICTED: IAA-amino acid hydrolase ILR1           276   2e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010037297.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      276   3e-87    Eucalyptus grandis [rose gum]
ref|XP_002275866.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like      276   4e-87    Vitis vinifera
ref|XP_010037293.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    275   9e-87    Eucalyptus grandis [rose gum]
ref|XP_008243488.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      274   2e-86    Prunus mume [ume]
ref|XP_007027898.1|  Iaa-amino acid hydrolase 4, putative               276   2e-86    
ref|XP_007202069.1|  hypothetical protein PRUPE_ppa005951mg             274   2e-86    Prunus persica
ref|XP_009373052.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      273   3e-86    Pyrus x bretschneideri [bai li]
ref|XP_010943801.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    273   3e-86    
ref|XP_009349375.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      273   3e-86    Pyrus x bretschneideri [bai li]
ref|XP_002308453.2|  IAA-amino acid hydrolase 1 family protein          273   6e-86    
ref|XP_008798874.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    272   1e-85    Phoenix dactylifera
ref|XP_010943800.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    273   1e-85    Elaeis guineensis
ref|XP_004136497.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    271   3e-85    Cucumis sativus [cucumbers]
ref|XP_010039094.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      265   6e-85    Eucalyptus grandis [rose gum]
ref|XP_002308452.1|  IAA-amino acid hydrolase 1 family protein          269   2e-84    Populus trichocarpa [western balsam poplar]
ref|XP_009405312.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    269   2e-84    
ref|XP_012074385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    263   3e-84    Jatropha curcas
ref|XP_004303517.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      268   3e-84    Fragaria vesca subsp. vesca
ref|XP_012074384.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    263   4e-84    
ref|XP_010093788.1|  IAA-amino acid hydrolase                           268   5e-84    Morus notabilis
ref|XP_011046909.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      267   9e-84    Populus euphratica
emb|CBI30348.3|  unnamed protein product                                276   1e-83    Vitis vinifera
ref|XP_008243487.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      266   1e-83    Prunus mume [ume]
ref|XP_007027877.1|  Peptidase M20/M25/M40 family protein isoform 1     266   2e-83    
ref|XP_010463718.1|  PREDICTED: IAA-amino acid hydrolase ILR1 iso...    264   7e-83    
ref|XP_010463717.1|  PREDICTED: IAA-amino acid hydrolase ILR1 iso...    264   2e-82    Camelina sativa [gold-of-pleasure]
gb|EPS72108.1|  hypothetical protein M569_02647                         274   3e-82    Genlisea aurea
ref|XP_010485617.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      263   6e-82    Camelina sativa [gold-of-pleasure]
ref|XP_011046911.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      262   9e-82    Populus euphratica
gb|AFW67044.1|  hypothetical protein ZEAMMB73_649011                    256   1e-81    
ref|XP_010558596.1|  PREDICTED: IAA-amino acid hydrolase ILR1           260   5e-81    Tarenaya hassleriana [spider flower]
ref|XP_006297680.1|  hypothetical protein CARUB_v10013712mg             259   2e-80    Capsella rubella
ref|XP_009373051.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      258   2e-80    Pyrus x bretschneideri [bai li]
ref|NP_001140633.1|  hypothetical protein                               258   2e-80    Zea mays [maize]
ref|XP_002882255.1|  IAA amidohydrolase                                 258   3e-80    
ref|XP_004305642.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      257   5e-80    Fragaria vesca subsp. vesca
gb|AFW67046.1|  hypothetical protein ZEAMMB73_649011                    256   1e-79    
ref|XP_010502342.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      255   5e-79    Camelina sativa [gold-of-pleasure]
tpg|DAA60178.1|  TPA: hypothetical protein ZEAMMB73_012586              251   9e-79    
gb|KFK37687.1|  hypothetical protein AALP_AA3G015600                    253   1e-78    Arabis alpina [alpine rockcress]
gb|EMT05755.1|  IAA-amino acid hydrolase ILR1-like protein 8            254   2e-78    
ref|XP_009414583.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    253   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK97436.2|AF385367_1  IAA amidohydrolase                            253   3e-78    Arabidopsis suecica
dbj|BAK07626.1|  predicted protein                                      253   4e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009349385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like      253   4e-78    Pyrus x bretschneideri [bai li]
ref|XP_008351526.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    252   5e-78    
ref|NP_001142187.1|  hypothetical protein precursor                     252   1e-77    Zea mays [maize]
ref|XP_003560269.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    251   1e-77    Brachypodium distachyon [annual false brome]
ref|XP_003557336.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 7    250   3e-77    Brachypodium distachyon [annual false brome]
gb|KDO37852.1|  hypothetical protein CISIN_1g014449mg                   245   3e-77    Citrus sinensis [apfelsine]
ref|XP_006441276.1|  hypothetical protein CICLE_v10020281mg             246   3e-77    
ref|NP_186937.1|  IAA-amino acid hydrolase ILR1                         250   3e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AAM63645.1|  IAA-amino acid hydrolase (ILR1)                         250   3e-77    Arabidopsis thaliana [mouse-ear cress]
gb|KDO37853.1|  hypothetical protein CISIN_1g014449mg                   245   4e-77    Citrus sinensis [apfelsine]
ref|XP_004981136.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    249   4e-77    
gb|KDO37851.1|  hypothetical protein CISIN_1g014449mg                   245   7e-77    Citrus sinensis [apfelsine]
gb|AAB60293.1|  ILR1                                                    248   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007027878.1|  Peptidase M20/M25/M40 family protein isoform 2     244   3e-76    
ref|XP_006441277.1|  hypothetical protein CICLE_v10020281mg             246   1e-75    Citrus clementina [clementine]
ref|XP_008462603.1|  PREDICTED: IAA-amino acid hydrolase ILR1           246   2e-75    Cucumis melo [Oriental melon]
ref|XP_006478084.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    245   2e-75    Citrus sinensis [apfelsine]
sp|Q851L5.1|ILL3_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    245   2e-75    Oryza sativa Japonica Group [Japonica rice]
gb|EMT31861.1|  IAA-amino acid hydrolase ILR1-like protein 8            248   2e-75    
ref|XP_002459628.1|  hypothetical protein SORBIDRAFT_02g007710          246   2e-75    Sorghum bicolor [broomcorn]
ref|XP_004959131.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    246   2e-75    
gb|KDO37850.1|  hypothetical protein CISIN_1g014449mg                   245   3e-75    Citrus sinensis [apfelsine]
ref|NP_001242296.1|  uncharacterized protein LOC100789607 precursor     244   6e-75    Glycine max [soybeans]
ref|XP_004955916.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    244   8e-75    Setaria italica
ref|XP_004143335.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like      244   8e-75    Cucumis sativus [cucumbers]
ref|XP_006353512.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    244   1e-74    Solanum tuberosum [potatoes]
ref|NP_001148528.1|  IAA-amino acid hydrolase ILR1 precursor            243   1e-74    Zea mays [maize]
dbj|BAK01726.1|  predicted protein                                      243   1e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009624362.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    243   2e-74    Nicotiana tomentosiformis
ref|XP_009147310.1|  PREDICTED: IAA-amino acid hydrolase ILR1           243   2e-74    Brassica rapa
emb|CDY51525.1|  BnaA05g33250D                                          243   2e-74    Brassica napus [oilseed rape]
ref|XP_002459629.1|  hypothetical protein SORBIDRAFT_02g007720          244   2e-74    
emb|CDY28718.1|  BnaCnng06040D                                          243   2e-74    Brassica napus [oilseed rape]
ref|XP_010038477.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    238   3e-74    Eucalyptus grandis [rose gum]
ref|XP_006854741.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    242   4e-74    Amborella trichopoda
gb|EAZ03384.1|  hypothetical protein OsI_25529                          242   4e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_004251653.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    242   7e-74    Solanum lycopersicum
ref|XP_009794201.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    241   1e-73    Nicotiana sylvestris
ref|XP_002269424.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    242   1e-73    Vitis vinifera
ref|XP_006853919.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    241   1e-73    Amborella trichopoda
ref|XP_006438485.1|  hypothetical protein CICLE_v10031540mg             237   2e-73    
ref|XP_002864473.1|  hypothetical protein ARALYDRAFT_495757             241   2e-73    
ref|XP_009414584.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    240   2e-73    
ref|XP_008360585.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    233   9e-73    
ref|XP_004959130.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    239   1e-72    
ref|XP_002466139.1|  hypothetical protein SORBIDRAFT_01g002080          238   1e-72    
ref|XP_010034919.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    238   1e-72    Eucalyptus grandis [rose gum]
ref|XP_002981614.1|  hypothetical protein SELMODRAFT_421067             238   1e-72    Selaginella moellendorffii
gb|ABF55222.1|  auxin conjugate hydrolase                               239   1e-72    Medicago truncatula
ref|XP_002963174.1|  hypothetical protein SELMODRAFT_141529             238   1e-72    Selaginella moellendorffii
ref|NP_001291249.1|  IAA-amino acid hydrolase ILR1-like 3 precursor     238   1e-72    Populus euphratica
ref|XP_002317832.1|  hypothetical protein POPTR_0012s00750g             238   1e-72    Populus trichocarpa [western balsam poplar]
ref|XP_009596700.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    237   2e-72    Nicotiana tomentosiformis
gb|EYU30670.1|  hypothetical protein MIMGU_mgv1a006375mg                238   2e-72    Erythranthe guttata [common monkey flower]
ref|XP_010690089.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    238   2e-72    Beta vulgaris subsp. vulgaris [field beet]
sp|Q8H3C7.2|ILL9_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    238   2e-72    Oryza sativa Japonica Group [Japonica rice]
gb|KDO70555.1|  hypothetical protein CISIN_1g0367561mg                  230   2e-72    Citrus sinensis [apfelsine]
ref|NP_200225.1|  IAA-amino acid hydrolase ILR1-like 3                  237   2e-72    Arabidopsis thaliana [mouse-ear cress]
gb|ACJ84380.1|  unknown                                                 230   3e-72    Medicago truncatula
ref|XP_006347315.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    237   3e-72    Solanum tuberosum [potatoes]
ref|XP_009596693.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    238   3e-72    Nicotiana tomentosiformis
dbj|BAC20816.1|  putative IAA amidohydrolase                            238   3e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007039231.1|  IAA-leucine-resistant-like 3                       237   3e-72    Theobroma cacao [chocolate]
ref|XP_003628629.1|  IAA-amino acid hydrolase ILR1-like protein         237   4e-72    Medicago truncatula
dbj|BAJ92528.1|  predicted protein                                      234   4e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK27232.1|  hypothetical protein AALP_AA8G354700                    237   4e-72    Arabis alpina [alpine rockcress]
gb|AFK39723.1|  unknown                                                 236   4e-72    Medicago truncatula
ref|XP_012072817.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    237   5e-72    Jatropha curcas
ref|XP_003557334.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 9    237   5e-72    Brachypodium distachyon [annual false brome]
gb|AFK43667.1|  unknown                                                 236   5e-72    Lotus japonicus
gb|EMT32322.1|  IAA-amino acid hydrolase ILR1-like protein 4            237   5e-72    
ref|XP_006483777.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    237   7e-72    Citrus sinensis [apfelsine]
gb|KDO82610.1|  hypothetical protein CISIN_1g013395mg                   236   8e-72    Citrus sinensis [apfelsine]
ref|XP_006438487.1|  hypothetical protein CICLE_v10031540mg             236   8e-72    Citrus clementina [clementine]
ref|XP_004241428.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    236   8e-72    
ref|XP_002459630.1|  hypothetical protein SORBIDRAFT_02g007730          236   9e-72    Sorghum bicolor [broomcorn]
ref|XP_002466140.1|  hypothetical protein SORBIDRAFT_01g002090          236   9e-72    Sorghum bicolor [broomcorn]
gb|AET03754.2|  IAA-amino acid hydrolase ILR1-like protein              236   1e-71    Medicago truncatula
ref|XP_003629278.1|  IAA-amino acid hydrolase ILR1-like protein         236   1e-71    
ref|XP_011626860.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    236   1e-71    Amborella trichopoda
ref|XP_007136362.1|  hypothetical protein PHAVU_009G038900g             235   2e-71    Phaseolus vulgaris [French bean]
ref|XP_004955918.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    235   2e-71    Setaria italica
ref|XP_010446503.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    235   2e-71    Camelina sativa [gold-of-pleasure]
gb|ABR16872.1|  unknown                                                 236   2e-71    Picea sitchensis
ref|XP_003530010.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    235   2e-71    
ref|XP_002864304.1|  hypothetical protein ARALYDRAFT_495494             235   2e-71    
ref|XP_010272050.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    235   3e-71    Nelumbo nucifera [Indian lotus]
ref|XP_004146834.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    235   4e-71    Cucumis sativus [cucumbers]
ref|XP_004955917.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    235   4e-71    Setaria italica
gb|KHN11323.1|  IAA-amino acid hydrolase ILR1-like 4                    234   4e-71    Glycine soja [wild soybean]
ref|XP_006281445.1|  hypothetical protein CARUB_v10027523mg             234   5e-71    Capsella rubella
dbj|BAJ90175.1|  predicted protein                                      234   7e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACZ56436.1|  IAA-amino acid hydrolase                                234   7e-71    Populus tomentosa [Chinese white poplar]
gb|AFK46529.1|  unknown                                                 234   8e-71    Lotus japonicus
ref|XP_002266978.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    234   1e-70    Vitis vinifera
ref|NP_001242429.1|  uncharacterized protein LOC100790664 precursor     234   1e-70    Glycine max [soybeans]
emb|CAG32960.1|  putative auxin-amidohydrolase precursor                233   1e-70    Populus tremula x Populus alba [gray poplar]
ref|XP_006343020.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    233   1e-70    Solanum tuberosum [potatoes]
ref|XP_003531633.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    233   1e-70    Glycine max [soybeans]
ref|XP_010103068.1|  IAA-amino acid hydrolase ILR1-like 3               233   1e-70    Morus notabilis
ref|XP_010442989.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    233   1e-70    Camelina sativa [gold-of-pleasure]
ref|XP_011003274.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    233   2e-70    Populus euphratica
ref|XP_009119945.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    233   2e-70    Brassica rapa
ref|NP_001051828.1|  Os03g0836900                                       232   2e-70    
emb|CDY14333.1|  BnaA10g07220D                                          232   2e-70    Brassica napus [oilseed rape]
gb|KDO55919.1|  hypothetical protein CISIN_1g013332mg                   228   2e-70    Citrus sinensis [apfelsine]
ref|XP_009760824.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    231   2e-70    Nicotiana sylvestris
ref|XP_007150548.1|  hypothetical protein PHAVU_005G1617001g            227   3e-70    Phaseolus vulgaris [French bean]
gb|KJB74619.1|  hypothetical protein B456_012G001500                    231   3e-70    Gossypium raimondii
ref|XP_009786385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    232   4e-70    Nicotiana sylvestris
ref|XP_004955914.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    231   4e-70    
gb|KDO55918.1|  hypothetical protein CISIN_1g013332mg                   228   5e-70    Citrus sinensis [apfelsine]
gb|EYU21408.1|  hypothetical protein MIMGU_mgv1a006385mg                232   5e-70    Erythranthe guttata [common monkey flower]
ref|XP_009760823.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    231   6e-70    Nicotiana sylvestris
ref|XP_008447583.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    232   7e-70    Cucumis melo [Oriental melon]
sp|Q8H3C8.1|ILL8_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    231   7e-70    Oryza sativa Japonica Group [Japonica rice]
gb|AFR58665.1|  jasmonoyl-L-isoleucine hydrolase 1                      231   7e-70    Nicotiana attenuata
ref|XP_010093786.1|  IAA-amino acid hydrolase                           231   7e-70    
gb|KJB74614.1|  hypothetical protein B456_012G001500                    231   9e-70    Gossypium raimondii
ref|XP_010482822.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    231   9e-70    Camelina sativa [gold-of-pleasure]
ref|XP_002520216.1|  IAA-amino acid hydrolase ILR1 precursor, put...    231   1e-69    Ricinus communis
emb|CDP04977.1|  unnamed protein product                                227   1e-69    Coffea canephora [robusta coffee]
ref|XP_004509886.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    231   1e-69    Cicer arietinum [garbanzo]
gb|KJB54327.1|  hypothetical protein B456_009G029600                    231   1e-69    Gossypium raimondii
ref|XP_004235624.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    231   1e-69    Solanum lycopersicum
emb|CDY60579.1|  BnaCnng36490D                                          230   1e-69    Brassica napus [oilseed rape]
gb|KDO58673.1|  hypothetical protein CISIN_1g013076mg                   227   2e-69    Citrus sinensis [apfelsine]
ref|XP_006393728.1|  hypothetical protein EUTSA_v10011458mg             231   2e-69    
ref|XP_002283047.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    230   2e-69    Vitis vinifera
ref|XP_004135471.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    231   2e-69    Cucumis sativus [cucumbers]
ref|XP_004502777.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    230   2e-69    Cicer arietinum [garbanzo]
ref|XP_010924947.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    230   2e-69    Elaeis guineensis
ref|XP_007012935.1|  Peptidase M20/M25/M40 family protein isoform 1     230   2e-69    
ref|XP_004510337.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    230   2e-69    
pdb|1XMB|A  Chain A, X-ray Structure Of Iaa-aminoacid Hydrolase F...    229   3e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003530016.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    230   3e-69    
ref|XP_008234625.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    229   3e-69    Prunus mume [ume]
ref|XP_002891660.1|  IAA-alanine resistant 3                            230   3e-69    Arabidopsis lyrata subsp. lyrata
ref|XP_003602410.1|  IAA-amino acid hydrolase ILR1-like protein         229   3e-69    Medicago truncatula
ref|XP_008381545.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    229   4e-69    
ref|XP_007217994.1|  hypothetical protein PRUPE_ppa005643mg             229   4e-69    Prunus persica
gb|KGN51840.1|  hypothetical protein Csa_5G603370                       230   4e-69    Cucumis sativus [cucumbers]
sp|Q8H3C9.1|ILL7_ORYSJ  RecName: Full=IAA-amino acid hydrolase IL...    230   4e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010100519.1|  IAA-amino acid hydrolase ILR1-like 2               229   4e-69    Morus notabilis
gb|KCW82521.1|  hypothetical protein EUGRSUZ_C03922                     228   4e-69    Eucalyptus grandis [rose gum]
ref|XP_010934039.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    224   5e-69    
gb|KDO55915.1|  hypothetical protein CISIN_1g013332mg                   229   5e-69    Citrus sinensis [apfelsine]
ref|NP_200477.1|  IAA-amino acid hydrolase ILR1-like 2                  229   5e-69    Arabidopsis thaliana [mouse-ear cress]
gb|AAL59907.1|  IAA-amino acid hydrolase                                229   5e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007012936.1|  Peptidase M20/M25/M40 family protein isoform 2     226   6e-69    
gb|AAC49016.1|  ILL2                                                    229   6e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546640.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    229   6e-69    Glycine max [soybeans]
ref|XP_007202052.1|  hypothetical protein PRUPE_ppa005751mg             229   6e-69    Prunus persica
ref|XP_010934038.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    224   6e-69    
ref|XP_004509887.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    228   7e-69    Cicer arietinum [garbanzo]
ref|XP_002521309.1|  IAA-amino acid hydrolase ILR1 precursor, put...    228   7e-69    Ricinus communis
gb|KJB65087.1|  hypothetical protein B456_010G080300                    225   7e-69    Gossypium raimondii
ref|XP_010928552.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    229   7e-69    Elaeis guineensis
ref|XP_008242448.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    229   8e-69    Prunus mume [ume]
gb|KDO55917.1|  hypothetical protein CISIN_1g013332mg                   229   8e-69    Citrus sinensis [apfelsine]
ref|NP_001288853.1|  IAA-amino acid hydrolase ILR1-like 6               229   8e-69    Brassica rapa
ref|XP_011009011.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    229   9e-69    Populus euphratica
ref|XP_006475371.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    228   1e-68    Citrus sinensis [apfelsine]
ref|XP_009630468.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    228   1e-68    Nicotiana tomentosiformis
ref|XP_007135596.1|  hypothetical protein PHAVU_010G142700g             228   1e-68    Phaseolus vulgaris [French bean]
gb|KHG23253.1|  IAA-amino acid hydrolase ILR1-like 3                    229   1e-68    Gossypium arboreum [tree cotton]
ref|NP_001169595.1|  uncharacterized protein LOC100383476 precursor     228   1e-68    Zea mays [maize]
ref|XP_010251241.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    227   1e-68    Nelumbo nucifera [Indian lotus]
ref|XP_006378179.1|  hypothetical protein POPTR_0010s04530g             229   1e-68    Populus trichocarpa [western balsam poplar]
gb|KDO55916.1|  hypothetical protein CISIN_1g013332mg                   228   1e-68    Citrus sinensis [apfelsine]
ref|XP_010451352.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    225   1e-68    
ref|XP_006451368.1|  hypothetical protein CICLE_v100084061mg            228   1e-68    Citrus clementina [clementine]
ref|XP_010049575.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    228   1e-68    Eucalyptus grandis [rose gum]
ref|NP_001288981.1|  IAA-amino acid hydrolase ILR1-like 2 precursor     228   2e-68    Brassica rapa
ref|XP_008446258.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    229   2e-68    
ref|XP_012092031.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    228   2e-68    Jatropha curcas
ref|XP_011077949.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    228   2e-68    Sesamum indicum [beniseed]
ref|XP_006658442.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    226   2e-68    
dbj|BAK08232.1|  predicted protein                                      227   2e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010049762.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    228   2e-68    Eucalyptus grandis [rose gum]
ref|XP_003531635.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    227   3e-68    Glycine max [soybeans]
ref|XP_010251233.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    227   3e-68    Nelumbo nucifera [Indian lotus]
gb|ABR17898.1|  unknown                                                 228   3e-68    Picea sitchensis
ref|XP_009351298.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    227   4e-68    Pyrus x bretschneideri [bai li]
ref|XP_003543612.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    227   4e-68    Glycine max [soybeans]
gb|KDO58672.1|  hypothetical protein CISIN_1g013076mg                   227   4e-68    Citrus sinensis [apfelsine]
ref|XP_006426465.1|  hypothetical protein CICLE_v10025591mg             227   4e-68    Citrus clementina [clementine]
gb|KJB77153.1|  hypothetical protein B456_012G123400                    227   4e-68    Gossypium raimondii
ref|XP_009417547.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    227   4e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003597384.1|  IAA-amino acid hydrolase ILR1-like protein         227   5e-68    Medicago truncatula
ref|XP_012069038.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    227   5e-68    Jatropha curcas
gb|EMT32321.1|  IAA-amino acid hydrolase ILR1-like protein 4            226   5e-68    
emb|CBI32084.3|  unnamed protein product                                234   5e-68    Vitis vinifera
gb|KFK36207.1|  hypothetical protein AALP_AA4G091700                    227   6e-68    
ref|XP_010691394.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    226   6e-68    
gb|KJB54330.1|  hypothetical protein B456_009G029600                    226   6e-68    
ref|XP_010536843.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    226   7e-68    
gb|KCW82520.1|  hypothetical protein EUGRSUZ_C03922                     229   8e-68    
ref|XP_006846441.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    225   8e-68    
gb|KHG30726.1|  IAA-amino acid hydrolase ILR1-like 4                    226   9e-68    
ref|XP_010443315.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    226   1e-67    
ref|XP_007135595.1|  hypothetical protein PHAVU_010G142600g             226   1e-67    
ref|XP_003523305.2|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    226   1e-67    
ref|XP_004135685.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    226   1e-67    
ref|XP_010451360.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    226   1e-67    
ref|XP_007012939.1|  Peptidase M20/M25/M40 family protein isoform 5     226   1e-67    
emb|CDY32768.1|  BnaA10g10810D                                          226   1e-67    
gb|KJB54329.1|  hypothetical protein B456_009G029600                    226   1e-67    
ref|XP_007223059.1|  hypothetical protein PRUPE_ppa006982mg             224   1e-67    
ref|XP_010537042.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    225   2e-67    
ref|XP_004307893.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    225   2e-67    
ref|XP_011013030.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    225   2e-67    
ref|XP_009396760.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    225   2e-67    
ref|XP_008806725.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    224   2e-67    
gb|KDO80614.1|  hypothetical protein CISIN_1g011407mg                   222   2e-67    
ref|XP_010934036.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    225   3e-67    
ref|XP_010254871.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    225   3e-67    
ref|XP_002893987.1|  gr1-protein                                        225   3e-67    
gb|KJB65086.1|  hypothetical protein B456_010G080300                    226   3e-67    
ref|XP_012076816.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    224   3e-67    
ref|NP_200476.1|  IAA-amino acid hydrolase ILR1-like 1                  224   4e-67    
ref|XP_002303219.1|  putative auxin-amidohydrolase precursor fami...    224   4e-67    
ref|XP_009351899.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    224   4e-67    
gb|KDO80613.1|  hypothetical protein CISIN_1g011407mg                   223   4e-67    
ref|XP_002269226.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    224   4e-67    
ref|XP_010483143.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    224   4e-67    
ref|XP_004297670.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    224   4e-67    
ref|XP_009400482.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    224   5e-67    
ref|XP_006646253.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    224   5e-67    
ref|XP_006392996.1|  hypothetical protein EUTSA_v10011481mg             220   5e-67    
ref|XP_002891662.1|  hypothetical protein ARALYDRAFT_892161             224   5e-67    
ref|XP_010943795.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    222   6e-67    
ref|XP_010244354.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    224   8e-67    
ref|XP_006401299.1|  hypothetical protein EUTSA_v10013558mg             223   8e-67    
gb|ABB60090.1|  IAA-amino acid hydrolase 3                              223   8e-67    
emb|CAG32961.1|  putative auxin-amidohydrolase precursor                223   9e-67    
ref|XP_006466100.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    224   9e-67    
emb|CDY32874.1|  BnaC09g33210D                                          223   9e-67    
gb|KJB70348.1|  hypothetical protein B456_011G068400                    220   9e-67    
emb|CAA73905.1|  JR3 protein                                            223   1e-66    
ref|NP_175587.1|  IAA-amino acid hydrolase IAR3                         223   1e-66    
ref|NP_175589.1|  IAA-amino acid hydrolase ILR1-like 5                  223   1e-66    
ref|XP_011075876.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    223   1e-66    
ref|XP_008783551.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    223   1e-66    
ref|XP_010268965.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    224   1e-66    
gb|ABK24715.1|  unknown                                                 224   1e-66    
gb|EMT10443.1|  IAA-amino acid hydrolase ILR1-like protein 1            223   2e-66    
gb|ACZ56438.1|  IAA-amino acid hydrolase                                223   2e-66    
ref|NP_175086.1|  IAA-amino acid hydrolase ILR1-like 6                  223   2e-66    
ref|XP_010545642.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    222   2e-66    
ref|XP_006305862.1|  hypothetical protein CARUB_v10010946mg             222   3e-66    
ref|XP_008389584.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    222   3e-66    
gb|AAL47552.1|  IAA-amino acid conjugate hydrolase-like protein         222   3e-66    
ref|XP_010268967.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    223   3e-66    
gb|ABB16358.1|  IAA hydrolase                                           222   3e-66    
ref|XP_011077948.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    222   4e-66    
emb|CAA09330.1|  gr1-protein                                            222   4e-66    
dbj|BAJ94305.1|  predicted protein                                      221   4e-66    
ref|XP_010479683.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    221   4e-66    
ref|XP_006602366.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    221   5e-66    
gb|EPS73983.1|  hypothetical protein M569_00763                         220   5e-66    
ref|XP_010243489.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    222   6e-66    
ref|XP_009360455.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    221   6e-66    
ref|XP_002968548.1|  hypothetical protein SELMODRAFT_409459             220   7e-66    
emb|CDY43926.1|  BnaA05g15360D                                          221   7e-66    
ref|XP_004969012.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    221   7e-66    
ref|NP_001288913.1|  IAA-amino acid hydrolase ILR1-like 4 precursor     221   8e-66    
emb|CDX87841.1|  BnaC06g09030D                                          221   8e-66    
gb|AAU06081.1|  auxin amidohydrolase                                    221   9e-66    
emb|CDX88581.1|  BnaA03g10680D                                          221   9e-66    
emb|CDP00215.1|  unnamed protein product                                221   9e-66    
ref|XP_006307296.1|  hypothetical protein CARUB_v10008915mg             222   1e-65    
ref|XP_008219626.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    221   1e-65    
ref|XP_002515893.1|  IAA-amino acid hydrolase ILR1 precursor, put...    220   1e-65    
ref|XP_009592954.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    221   1e-65    
ref|XP_003597645.1|  IAA-amino acid hydrolase ILR1-like protein         221   1e-65    
ref|XP_011074843.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    221   1e-65    
ref|XP_006472793.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    221   1e-65    
emb|CAN70580.1|  hypothetical protein VITISV_033718                     220   1e-65    
gb|ACJ85027.1|  unknown                                                 215   1e-65    
gb|KDO80612.1|  hypothetical protein CISIN_1g011407mg                   221   1e-65    
ref|NP_001043347.1|  Os01g0560000                                       220   1e-65    
ref|XP_002281321.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    220   1e-65    
ref|XP_010500141.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    221   2e-65    
emb|CDY11910.1|  BnaC03g13360D                                          219   2e-65    
ref|XP_010479046.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    221   2e-65    
gb|KJB70347.1|  hypothetical protein B456_011G068400                    220   2e-65    
ref|XP_010231929.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    220   2e-65    
ref|NP_001142151.1|  hypothetical protein precursor                     220   2e-65    
ref|XP_006408371.1|  hypothetical protein EUTSA_v10021977mg             218   2e-65    
ref|XP_010088385.1|  IAA-amino acid hydrolase ILR1-like 4               220   2e-65    
ref|XP_010044662.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    220   2e-65    
ref|XP_006392998.1|  hypothetical protein EUTSA_v10011481mg             219   2e-65    
gb|KCW86759.1|  hypothetical protein EUGRSUZ_B03368                     220   3e-65    
emb|CDY69786.1|  BnaC06g41050D                                          217   3e-65    
ref|XP_006658443.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    219   3e-65    
ref|XP_008450808.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    219   3e-65    
ref|XP_006355931.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    219   4e-65    
ref|XP_004238716.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    219   4e-65    
ref|XP_010229420.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 3    218   5e-65    
ref|XP_004968975.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    219   5e-65    
ref|XP_010535205.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    219   5e-65    
ref|XP_011072466.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    219   5e-65    
sp|Q84XG9.1|ILL1_ORYSI  RecName: Full=IAA-amino acid hydrolase IL...    219   5e-65    
gb|EYU22976.1|  hypothetical protein MIMGU_mgv1a005140mg                220   7e-65    
ref|XP_010500765.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    219   7e-65    
ref|XP_004290879.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    219   7e-65    
ref|XP_010461441.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    219   7e-65    
ref|XP_010500762.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    218   7e-65    
ref|XP_003532037.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    218   9e-65    
ref|XP_009132189.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    218   1e-64    
ref|XP_010479682.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    218   1e-64    
ref|XP_006307542.1|  hypothetical protein CARUB_v10009165mg             218   1e-64    
emb|CDM83125.1|  unnamed protein product                                218   1e-64    
ref|XP_006351275.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    219   2e-64    
gb|KJB74615.1|  hypothetical protein B456_012G001500                    216   2e-64    
ref|XP_010062569.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    218   2e-64    
ref|XP_007215385.1|  hypothetical protein PRUPE_ppa005752mg             217   2e-64    
gb|EEC81805.1|  hypothetical protein OsI_25528                          216   2e-64    
ref|XP_003580154.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    217   2e-64    
ref|XP_003597644.1|  IAA-amino acid hydrolase ILR1-like protein         217   2e-64    
ref|XP_007024408.1|  Peptidase M20/M25/M40 family protein               217   3e-64    
ref|XP_010462018.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    217   3e-64    
ref|XP_011069524.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    218   3e-64    
emb|CDY22869.1|  BnaA06g02080D                                          216   4e-64    
ref|XP_006846452.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 9    214   4e-64    
ref|XP_009338136.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    217   4e-64    
ref|XP_008466723.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    217   4e-64    
ref|XP_009762344.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    218   4e-64    
ref|XP_008378480.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    218   4e-64    
gb|ACZ56435.1|  IAA-amino acid hydrolase                                217   5e-64    
ref|XP_006434209.1|  hypothetical protein CICLE_v10000964mg             217   5e-64    
emb|CAN61999.1|  hypothetical protein VITISV_007874                     215   6e-64    
ref|XP_008244751.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    216   6e-64    
gb|KJB64484.1|  hypothetical protein B456_010G051100                    213   7e-64    
ref|XP_010462020.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 5    216   8e-64    
ref|XP_010104509.1|  IAA-amino acid hydrolase ILR1-like 6               216   8e-64    
ref|XP_002302231.2|  hypothetical protein POPTR_0002s08300g             216   9e-64    
ref|XP_004249219.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    216   1e-63    
ref|XP_008797895.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    215   1e-63    
gb|EAZ39285.1|  hypothetical protein OsJ_23717                          216   1e-63    
ref|XP_009147731.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    215   1e-63    
emb|CBI19006.3|  unnamed protein product                                216   1e-63    
gb|KFK28293.1|  hypothetical protein AALP_AA8G497500                    215   1e-63    
gb|AFK37903.1|  unknown                                                 215   1e-63    
ref|XP_002284503.2|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    216   1e-63    
emb|CDP03213.1|  unnamed protein product                                210   1e-63    
ref|XP_009414063.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    215   1e-63    
emb|CDM83724.1|  unnamed protein product                                215   1e-63    
ref|XP_008797894.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    215   1e-63    
ref|NP_001044020.1|  Os01g0706900                                       215   1e-63    
gb|EEC71359.1|  hypothetical protein OsI_03451                          215   2e-63    
ref|XP_011027512.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    215   2e-63    
ref|XP_004149796.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    215   2e-63    
ref|XP_004297620.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    214   2e-63    
ref|XP_006838393.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    215   3e-63    
ref|XP_011071286.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    219   3e-63    
gb|EEE55272.1|  hypothetical protein OsJ_03195                          216   3e-63    
ref|XP_010911155.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    214   3e-63    
gb|EYU45331.1|  hypothetical protein MIMGU_mgv1a023576mg                214   4e-63    
ref|XP_007153678.1|  hypothetical protein PHAVU_003G055600g             214   4e-63    
ref|XP_003597649.1|  IAA-amino acid hydrolase ILR1-like protein         214   5e-63    
gb|AES67900.2|  IAA-amino acid hydrolase ILR1-like protein              214   5e-63    
gb|ABF55219.1|  auxin conjugate hydrolase                               214   6e-63    
ref|XP_006478083.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    213   8e-63    
gb|KJB59248.1|  hypothetical protein B456_009G246300                    214   8e-63    
emb|CBI23104.3|  unnamed protein product                                213   1e-62    
gb|KGN47720.1|  hypothetical protein Csa_6G384060                       215   1e-62    
ref|XP_008353108.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 1    211   1e-62    
gb|EPS67015.1|  hypothetical protein M569_07761                         212   1e-62    
emb|CDO97948.1|  unnamed protein product                                211   1e-62    
ref|XP_003602066.1|  IAA-amino acid hydrolase ILR1-like protein         213   2e-62    
ref|XP_010674873.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    214   2e-62    
ref|XP_004976258.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    212   2e-62    
ref|XP_011011908.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    213   2e-62    
ref|XP_010999399.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    213   2e-62    
gb|KJB64483.1|  hypothetical protein B456_010G051100                    213   3e-62    
ref|XP_010063397.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    213   3e-62    
dbj|BAJ99345.1|  predicted protein                                      211   4e-62    
ref|XP_009613546.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    211   5e-62    
ref|XP_009784160.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    211   6e-62    
ref|XP_004969701.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    211   6e-62    
ref|XP_004502492.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    212   7e-62    
ref|XP_009391385.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    211   7e-62    
ref|XP_002438916.1|  hypothetical protein SORBIDRAFT_10g028140          212   8e-62    
ref|XP_007019096.1|  IAA-leucine resistant-like gene 6 isoform 2        207   9e-62    
dbj|BAJ93855.1|  predicted protein                                      209   1e-61    
ref|XP_003597383.1|  IAA-amino acid hydrolase ILR1-like protein         210   1e-61    
ref|XP_002513747.1|  IAA-amino acid hydrolase ILR1 precursor, put...    211   1e-61    
ref|XP_004486799.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    210   2e-61    
ref|NP_001159338.1|  hypothetical protein precursor                     209   2e-61    
ref|NP_001053339.1|  Os04g0521800                                       209   3e-61    
gb|EMT21700.1|  IAA-amino acid hydrolase ILR1-like protein 7            213   3e-61    
ref|XP_008387506.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    209   3e-61    
emb|CBI27959.3|  unnamed protein product                                208   3e-61    
ref|NP_001058422.1|  Os06g0691400                                       210   3e-61    
gb|EMS55264.1|  IAA-amino acid hydrolase ILR1-like 5                    208   3e-61    
gb|EEC81225.1|  hypothetical protein OsI_24268                          210   4e-61    
ref|XP_008655104.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    209   4e-61    
gb|KHN39276.1|  IAA-amino acid hydrolase ILR1-like 4                    207   4e-61    
ref|XP_003526641.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    209   5e-61    
ref|XP_002446800.1|  hypothetical protein SORBIDRAFT_06g022860          207   6e-61    
ref|XP_006652529.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    207   7e-61    
ref|XP_003567041.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 2    207   8e-61    
ref|XP_010906094.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 6    209   1e-60    
ref|XP_006646005.1|  PREDICTED: LOW QUALITY PROTEIN: IAA-amino ac...    207   1e-60    
ref|XP_007019095.1|  IAA-leucine resistant-like gene 6 isoform 1        208   1e-60    
gb|ACG28942.1|  IAA-amino acid hydrolase ILR1-like 6 precursor          208   1e-60    
ref|XP_002458379.1|  hypothetical protein SORBIDRAFT_03g032500          207   2e-60    
ref|XP_008380826.1|  PREDICTED: IAA-amino acid hydrolase ILR1-like 4    207   2e-60    
ref|XP_004486800.1|  PREDICTED: IAA-amino acid hydrolase ILR1-lik...    207   2e-60    
gb|KFK35825.1|  hypothetical protein AALP_AA4G042000                    205   3e-60    
ref|XP_008680979.1|  PREDICTED: uncharacterized protein LOC100191...    207   3e-60    
gb|KHN10633.1|  IAA-amino acid hydrolase ILR1-like 4                    205   3e-60    



>ref|XP_009794644.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Nicotiana sylvestris]
Length=438

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
                +T LGSET S LTR+LL+SAR+PEF DWL+RVRR +HEYPEL F+EH+TSQLIRNE
Sbjct  25   AADTETHLGSETES-LTRELLESAREPEFLDWLRRVRRRIHEYPELSFQEHQTSQLIRNE  83

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LDSLG+ YSWPVAKTG+V +IGSG QPWFGLRADMDALP+QELV+WE+KSKI+GKMHACG
Sbjct  84   LDSLGVKYSWPVAKTGLVGSIGSGAQPWFGLRADMDALPLQELVDWEYKSKIDGKMHACG  143

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HDAHVTMLLGAARL+QNR++ LKGTVKLVFQPAEEG  GA +M++EGALD F+++FG+HV
Sbjct  144  HDAHVTMLLGAARLIQNRRDKLKGTVKLVFQPAEEGYAGASYMLEEGALDGFKAIFGLHV  203

Query  624  WPGMPVGTI  650
            WP MPVGTI
Sbjct  204  WPFMPVGTI  212



>ref|XP_006356685.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 7-like [Solanum 
tuberosum]
Length=438

 Score =   314 bits (804),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 174/209 (83%), Gaps = 6/209 (3%)
 Frame = +3

Query  39   CVWFALIVAI---SSPWH--CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTL  203
            C+   LI+A+   S P++     + T LGSET   LTR+L++SAR PEF DWL+R RR +
Sbjct  5    CINLTLILALLSTSFPYNSWAVDVDTNLGSET-ELLTRELMESARQPEFLDWLRRTRRKI  63

Query  204  HEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPI  383
            HEYPEL F+E++TSQ IRNELDSLGI Y WPVAKTGVV  IGSG QPWFGLRADMDALPI
Sbjct  64   HEYPELSFQEYQTSQFIRNELDSLGIKYLWPVAKTGVVGTIGSGAQPWFGLRADMDALPI  123

Query  384  QELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGA  563
            QELV+WE KSKI+GKMHACGHDAHVTMLLGAARL+QNR++ LKGT+KLVFQPAEEG  GA
Sbjct  124  QELVDWEFKSKIDGKMHACGHDAHVTMLLGAARLIQNRRDKLKGTIKLVFQPAEEGYAGA  183

Query  564  YHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             +M++EGALD FQ+MFG+HVWP MPVGTI
Sbjct  184  SYMLEEGALDGFQAMFGLHVWPFMPVGTI  212



>ref|XP_009608199.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Nicotiana tomentosiformis]
Length=438

 Score =   310 bits (794),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
                +T LGSET S LTR+LL+SAR PEF DWL+RVRR +HEYPEL F+EH+TSQL+RNE
Sbjct  25   AADTETDLGSETGS-LTRELLESARQPEFLDWLRRVRRRIHEYPELSFQEHQTSQLVRNE  83

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LDSLG+ Y WPVAKTGVV  IGSG QPWFGLRADMDALP+QELV+WE+KSKI+GKMHACG
Sbjct  84   LDSLGVKYMWPVAKTGVVGTIGSGAQPWFGLRADMDALPLQELVDWEYKSKIDGKMHACG  143

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HDAHVTMLLGAARL+QNR++ LKGTVKLVFQPAEEG  GA +M++EGALD F+ +FG+HV
Sbjct  144  HDAHVTMLLGAARLIQNRRDKLKGTVKLVFQPAEEGYAGASYMLEEGALDGFKGIFGLHV  203

Query  624  WPGMPVGTI  650
            WP MPVGTI
Sbjct  204  WPFMPVGTI  212



>ref|XP_004241059.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Solanum lycopersicum]
Length=438

 Score =   310 bits (793),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 171/210 (81%), Gaps = 8/210 (4%)
 Frame = +3

Query  39   CVWFALIVAISS------PWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRT  200
            C+   LI+A+ S       W    + T LGSET   LTR+L++SAR PEF DWL R RR 
Sbjct  5    CINLTLILALLSTSFSYNSW-AVDVDTNLGSET-ELLTRELMESARQPEFLDWLTRTRRR  62

Query  201  LHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALP  380
            +HEYPEL F+E++TSQ IRNELDSLGI Y WPVAKTGVV  IGSG QPWFGLRADMDALP
Sbjct  63   IHEYPELSFQEYQTSQFIRNELDSLGIKYLWPVAKTGVVGTIGSGAQPWFGLRADMDALP  122

Query  381  IQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGG  560
            IQELV+WE KSKI+GKMHACGHDAHVTMLLGAARL+QNR++ LKGT+KLVFQPAEEG  G
Sbjct  123  IQELVDWECKSKIDGKMHACGHDAHVTMLLGAARLIQNRRDKLKGTIKLVFQPAEEGYAG  182

Query  561  AYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            A +M++EGALD FQ+MFG+HVWP MPVGTI
Sbjct  183  ASYMLEEGALDGFQAMFGLHVWPFMPVGTI  212



>ref|XP_012074382.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Jatropha curcas]
 gb|KDP36173.1| hypothetical protein JCGZ_08817 [Jatropha curcas]
Length=434

 Score =   308 bits (790),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            ++ LTR+LL SAR+PEFFDWLK+ RR LHEYPEL FEE+ TSQ+IR+ELDSLGI Y WP+
Sbjct  31   LTSLTRELLKSAREPEFFDWLKQTRRKLHEYPELAFEEYNTSQVIRSELDSLGIEYKWPI  90

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTG+V +IGSG QPWFGLRADMDALPIQELVEWEHKSKING+MHACGHDAHVTMLLGAA
Sbjct  91   AKTGLVGSIGSGVQPWFGLRADMDALPIQELVEWEHKSKINGQMHACGHDAHVTMLLGAA  150

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ +K+ LKGTVKLVFQP EEG  GAYHM+KEGALD+FQ++FG+HV P MPVG+I
Sbjct  151  KLLQRKKDKLKGTVKLVFQPGEEGHAGAYHMLKEGALDNFQAIFGLHVAPDMPVGSI  207



>gb|ACZ56437.1| IAA-amino acid hydrolase [Populus tomentosa]
Length=430

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 169/202 (84%), Gaps = 1/202 (0%)
 Frame = +3

Query  45   WFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELG  224
            W  L + +S+     +L TR  S+ +S LTR+LL+SAR+PEFF+WLKR+RR +HE PEL 
Sbjct  3    WLCLFMILSTCQTTWALDTRSESK-LSHLTRELLESAREPEFFEWLKRIRRRIHEDPELA  61

Query  225  FEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWE  404
            FEEH TSQLIR+ELDSLGI Y WP AKTGVV +IGSG QPWFGLRADMDALPIQE+VEWE
Sbjct  62   FEEHNTSQLIRSELDSLGIEYKWPFAKTGVVGSIGSGLQPWFGLRADMDALPIQEMVEWE  121

Query  405  HKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEG  584
            HKSK NGKMHACGHDAHVTMLLGAA+LL+  K+ LKGTVKLVFQP EE  GGAYHMIKEG
Sbjct  122  HKSKNNGKMHACGHDAHVTMLLGAAKLLERMKDELKGTVKLVFQPGEESYGGAYHMIKEG  181

Query  585  ALDDFQSMFGMHVWPGMPVGTI  650
            ALD+FQ +FG+HV P +PVGT+
Sbjct  182  ALDNFQGIFGLHVAPEIPVGTV  203



>ref|XP_008243485.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Prunus mume]
Length=437

 Score =   306 bits (783),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +SQL R LLDSAR PEFFDWLKRVRR +HE PEL FEEH TSQLIR+ELDSLGI Y+WPV
Sbjct  33   LSQLNRGLLDSARQPEFFDWLKRVRRRIHENPELAFEEHETSQLIRSELDSLGIQYTWPV  92

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTG+VA+IGSG+QPWF LRADMDALPIQELVEWEHKSK +GKMHACGHDAHVTMLLGAA
Sbjct  93   AKTGLVASIGSGSQPWFALRADMDALPIQELVEWEHKSKNSGKMHACGHDAHVTMLLGAA  152

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ++ + +KGT+KLVFQPAEEG GGAYHMIKEGALD+ Q +FG+H+ P MPVGTI
Sbjct  153  KLLQSKSKEIKGTIKLVFQPAEEGHGGAYHMIKEGALDNIQGIFGLHIQPLMPVGTI  209



>ref|XP_002275838.2| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Vitis vinifera]
Length=429

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 169/206 (82%), Gaps = 6/206 (3%)
 Frame = +3

Query  33   FRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEY  212
            F C W  ++ A  S     +++  LGSE        L+D+A++ EFF W++ VRR +HEY
Sbjct  3    FICGWLLMLSAFVS-GTAGAVENGLGSEV-----GLLMDTAKEAEFFGWMRSVRRRIHEY  56

Query  213  PELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQEL  392
            PEL FEEH+TSQ+IR+ELDSLGI YSWPVAKTGVVA+IGSG QPWF LRADMDALPIQEL
Sbjct  57   PELAFEEHKTSQIIRSELDSLGIEYSWPVAKTGVVASIGSGKQPWFSLRADMDALPIQEL  116

Query  393  VEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHM  572
            VEWEHKSK NGKMHACGHDAHVTMLLGAARLLQN+++ LKGTVKLVFQP EEG  GAYH+
Sbjct  117  VEWEHKSKYNGKMHACGHDAHVTMLLGAARLLQNKRDELKGTVKLVFQPGEEGHAGAYHV  176

Query  573  IKEGALDDFQSMFGMHVWPGMPVGTI  650
            +KEGALDDFQ++FG+HV PGMP GT+
Sbjct  177  LKEGALDDFQAIFGLHVSPGMPTGTV  202



>ref|XP_009798014.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X2 [Nicotiana 
sylvestris]
Length=433

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 172/210 (82%), Gaps = 10/210 (5%)
 Frame = +3

Query  30   SFRCVWFALIVAISS---PWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRT  200
            SFR  +F  I+A+ S   P++  ++ T         LTR LL+SAR PEF+DWLKRVRR 
Sbjct  3    SFRTDYFFCILALVSTISPYNSWAVDTE-------SLTRVLLESARQPEFYDWLKRVRRR  55

Query  201  LHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALP  380
            +HEYPEL F+EHRT+QLIR+ELD+LGI Y  PVAKTG+V  IGSG QPWFGLRADMDALP
Sbjct  56   IHEYPELAFQEHRTNQLIRDELDALGIKYLSPVAKTGLVGTIGSGGQPWFGLRADMDALP  115

Query  381  IQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGG  560
            IQELV+WE+KSKI+GKMHACGHDAHVTMLLGAARLLQNR++ LKGTVKLVFQP EEG  G
Sbjct  116  IQELVDWEYKSKIDGKMHACGHDAHVTMLLGAARLLQNRRDKLKGTVKLVFQPGEEGYAG  175

Query  561  AYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            A +M++EGALD+ Q++FGMHVWP MP GTI
Sbjct  176  ASYMLEEGALDEVQAIFGMHVWPYMPTGTI  205



>ref|XP_009603431.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Nicotiana tomentosiformis]
Length=434

 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 171/211 (81%), Gaps = 11/211 (5%)
 Frame = +3

Query  30   SFRCVWFAL----IVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRR  197
            SFR  +F      +V+  SP++  ++ T         LTR+LL+SAR PEF+DWLKRVRR
Sbjct  3    SFRTDYFFFCILALVSTISPYNSWAVDTE-------SLTRELLESARQPEFYDWLKRVRR  55

Query  198  TLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDAL  377
             +HEYPEL F+EHRTSQLIR+ELDSLGI Y  PVAKTG+V  IGSG QPWFGLRADMDAL
Sbjct  56   RIHEYPELAFQEHRTSQLIRDELDSLGIKYLSPVAKTGLVGTIGSGGQPWFGLRADMDAL  115

Query  378  PIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMG  557
            PIQELV+WE+KSKI+GKMHACGHDAHVTMLLGAARLLQNR++ LKGTVKLVFQP EEG  
Sbjct  116  PIQELVDWEYKSKIDGKMHACGHDAHVTMLLGAARLLQNRRDKLKGTVKLVFQPGEEGYA  175

Query  558  GAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GA +M++EGAL+  Q++FGMHVWP MP GTI
Sbjct  176  GASYMLEEGALNGVQAIFGMHVWPYMPTGTI  206



>ref|XP_007204388.1| hypothetical protein PRUPE_ppa005836mg [Prunus persica]
 gb|EMJ05587.1| hypothetical protein PRUPE_ppa005836mg [Prunus persica]
Length=441

 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +SQL R LLDSAR PEFFDWLKRVRR +HE PEL FEEH TSQLIR+ELDSLGI Y+WPV
Sbjct  33   LSQLNRGLLDSARQPEFFDWLKRVRRRIHENPELAFEEHETSQLIRSELDSLGIQYTWPV  92

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTG+VA+IGSG+QPWF LRADMDALPIQELVEWEHKSK  GKMHACGHDAHVTMLLGAA
Sbjct  93   AKTGLVASIGSGSQPWFALRADMDALPIQELVEWEHKSKNPGKMHACGHDAHVTMLLGAA  152

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ++ + +KGT+KLVFQPAEEG GGAYHMIKEGALD+ Q +FG+H+ P MPVGTI
Sbjct  153  KLLQSKSKEIKGTIKLVFQPAEEGHGGAYHMIKEGALDNIQGIFGLHIQPLMPVGTI  209



>ref|XP_011043650.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Populus euphratica]
Length=430

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 169/202 (84%), Gaps = 1/202 (0%)
 Frame = +3

Query  45   WFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELG  224
            W  L++ +S+     +L TR  S+ +S LTR+LL SAR+PEFF+WLKR+RR +HE PEL 
Sbjct  3    WLCLLMILSTCKTTWALDTRSESK-LSHLTRELLQSAREPEFFEWLKRIRRRIHEDPELA  61

Query  225  FEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWE  404
            FEE+ TSQLIR+ELDSLGI Y WP AKTGVV +IGSG QPWFGLRADMDALPIQE+VEWE
Sbjct  62   FEEYNTSQLIRSELDSLGIEYKWPFAKTGVVGSIGSGLQPWFGLRADMDALPIQEMVEWE  121

Query  405  HKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEG  584
            HKSK NGKMHACGHDAHVTMLLGAA+LL+  K+ LKGTVKLVFQP EE  GGAYHM+KEG
Sbjct  122  HKSKNNGKMHACGHDAHVTMLLGAAKLLERMKDELKGTVKLVFQPGEESYGGAYHMLKEG  181

Query  585  ALDDFQSMFGMHVWPGMPVGTI  650
            ALD+FQ +FG+HV P +PVGT+
Sbjct  182  ALDNFQGIFGLHVAPEIPVGTV  203



>gb|KDO70553.1| hypothetical protein CISIN_1g013571mg [Citrus sinensis]
Length=324

 Score =   300 bits (768),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 170/201 (85%), Gaps = 4/201 (2%)
 Frame = +3

Query  60   VAISSPWHC----CSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGF  227
            + +S+ + C       +T+ GSE +S LTR+LLDSAR+PEFF+W++R+RR +HE PELGF
Sbjct  13   IIVSTIFTCNPTWAKKETQSGSEQLSSLTRELLDSAREPEFFEWMRRIRRRIHENPELGF  72

Query  228  EEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEH  407
            EE+ TSQL+R+ELDSLGI Y+WPVAKTG+VA++GSG +PWFGLRA+MDALP+QE+VEWEH
Sbjct  73   EEYETSQLVRSELDSLGIEYTWPVAKTGIVASVGSGGEPWFGLRAEMDALPLQEMVEWEH  132

Query  408  KSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGA  587
            KSK NGKMH CGHD H T+LLGAARLL++R + LKGTVKLVFQP EEG GGAY+MIKEGA
Sbjct  133  KSKNNGKMHGCGHDVHTTILLGAARLLKHRMDRLKGTVKLVFQPGEEGYGGAYYMIKEGA  192

Query  588  LDDFQSMFGMHVWPGMPVGTI  650
            +D FQ MFG+H+ P +P GT+
Sbjct  193  VDKFQGMFGIHISPVLPTGTV  213



>ref|XP_002530514.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF31846.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=438

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 174/212 (82%), Gaps = 4/212 (2%)
 Frame = +3

Query  18   KASASFRCVWFALIVAI-SSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVR  194
            KAS  +   W  L+ A  S+ W    L  R   E +S LTR LL++A++ EFFDWLK++R
Sbjct  3    KASLFYLISWLCLLSAFQSTTW---VLAIRSEPEELSLLTRQLLETAKETEFFDWLKKIR  59

Query  195  RTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDA  374
            R LHEYPE+ FEE+ TSQ+I +EL+SLGI YSWP+AKTG+V +IGSG QPWFGLRADMDA
Sbjct  60   RRLHEYPEVAFEEYNTSQVIISELESLGIDYSWPIAKTGLVGSIGSGLQPWFGLRADMDA  119

Query  375  LPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGM  554
            LPIQEL+EW+HKSK NGKMHACGHDAHVTMLLGAA+LLQ+ KE LKGTVKLVFQPAEEG 
Sbjct  120  LPIQELIEWKHKSKNNGKMHACGHDAHVTMLLGAAKLLQSNKEKLKGTVKLVFQPAEEGH  179

Query  555  GGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             GAYHM+KEGALD+F+++FG+HV P +PVG+I
Sbjct  180  AGAYHMLKEGALDNFKAIFGLHVAPELPVGSI  211



>ref|XP_006430119.1| hypothetical protein CICLE_v10011738mg [Citrus clementina]
 gb|ESR43359.1| hypothetical protein CICLE_v10011738mg [Citrus clementina]
Length=440

 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 170/201 (85%), Gaps = 4/201 (2%)
 Frame = +3

Query  60   VAISSPWHC----CSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGF  227
            + +S+ + C       +T+ GSE +S LTR+LLDSAR+PEFF+W++R+RR +HE PELGF
Sbjct  13   IIVSTIFTCNPTWAKKETQSGSEQLSSLTRELLDSAREPEFFEWMRRIRRRIHENPELGF  72

Query  228  EEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEH  407
            EE+ TSQL+R+ELDSLGI Y+WPVAKTG+VA++GSG +PWFGLRA+MDALPIQE+VEWEH
Sbjct  73   EEYETSQLVRSELDSLGIEYTWPVAKTGIVASVGSGGEPWFGLRAEMDALPIQEMVEWEH  132

Query  408  KSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGA  587
            KSK NGKMH CGHD H T+LLGAARLL++R + LKGTVKLVFQP EEG GGAY+MIKEGA
Sbjct  133  KSKNNGKMHGCGHDVHTTILLGAARLLKHRIDRLKGTVKLVFQPGEEGYGGAYYMIKEGA  192

Query  588  LDDFQSMFGMHVWPGMPVGTI  650
            +D FQ MFG+H+ P +P GTI
Sbjct  193  VDKFQGMFGIHISPVLPTGTI  213



>ref|XP_002322806.1| hypothetical protein POPTR_0016s07500g [Populus trichocarpa]
 gb|EEF04567.1| hypothetical protein POPTR_0016s07500g [Populus trichocarpa]
Length=478

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 169/211 (80%), Gaps = 1/211 (0%)
 Frame = +3

Query  18   KASASFRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRR  197
            K   S    W  L + +S+     +L TR  S+ +  LTR+LL+SAR+PEFF WLKR+RR
Sbjct  42   KIGVSNLMAWLCLFMILSTCQTAWALDTRSESK-LGYLTRELLESAREPEFFGWLKRIRR  100

Query  198  TLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDAL  377
             +HE PEL FEE+ TSQLIR+ELDSLGI Y WP AKTGVV +IGSG QPWFGLRADMDAL
Sbjct  101  RIHEDPELAFEEYNTSQLIRSELDSLGIEYKWPFAKTGVVGSIGSGLQPWFGLRADMDAL  160

Query  378  PIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMG  557
            PIQE+VEWEHKSK NGKMHACGHDAHVTMLLGAA+LL+  K+ LKGTVKLVFQP EE  G
Sbjct  161  PIQEMVEWEHKSKNNGKMHACGHDAHVTMLLGAAKLLERMKDELKGTVKLVFQPGEESYG  220

Query  558  GAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GAYHM+KEGALD+FQ +FG+HV P +PVGT+
Sbjct  221  GAYHMLKEGALDNFQGIFGLHVAPEIPVGTV  251



>ref|XP_006481704.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Citrus sinensis]
Length=440

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 171/201 (85%), Gaps = 4/201 (2%)
 Frame = +3

Query  60   VAISSPWHC----CSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGF  227
            + +S+ + C       +T+ GSE +S LTR+LLDSAR+PEFF+W++R+RR +HE PELGF
Sbjct  13   IIVSTIFTCNPTWAKKETQSGSEQLSSLTRELLDSAREPEFFEWMRRMRRRIHENPELGF  72

Query  228  EEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEH  407
            EE+ TSQL+R+ELDSLGI Y+WPVAKTG+VA++GSG +PWFGLRA+MDALP+QE+VEWEH
Sbjct  73   EEYETSQLVRSELDSLGIEYTWPVAKTGIVASVGSGGEPWFGLRAEMDALPLQEMVEWEH  132

Query  408  KSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGA  587
            KSK NGKMHACGHD H T+LLGAARLL++R + LKGTVKLVFQP EEG GGAY+MIKEGA
Sbjct  133  KSKNNGKMHACGHDFHTTILLGAARLLKHRIDRLKGTVKLVFQPGEEGYGGAYYMIKEGA  192

Query  588  LDDFQSMFGMHVWPGMPVGTI  650
            +D FQ MFG+H+ P +P GTI
Sbjct  193  VDKFQGMFGIHISPVLPTGTI  213



>ref|XP_008387047.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
3 [Malus domestica]
Length=435

 Score =   301 bits (770),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            VSQLTR+L+DSAR+PEFFDWLKRVRRT+HE PEL FEE  TS+LIR+ELDSL IGY+WPV
Sbjct  31   VSQLTRELMDSAREPEFFDWLKRVRRTIHENPELAFEEEETSRLIRSELDSLEIGYTWPV  90

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTG VA+IGSG+QPWF LRADMDALPIQE+VEWEHKSK  G MHACGHDAH TMLLGAA
Sbjct  91   AKTGXVASIGSGSQPWFALRADMDALPIQEMVEWEHKSKNPGXMHACGHDAHATMLLGAA  150

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ + + +KGT+KLVFQPAEEG GGAYHMIKEGALD+ Q + G+H+ P MPVGTI
Sbjct  151  KLLQRKSKEIKGTIKLVFQPAEEGRGGAYHMIKEGALDNIQGILGLHISPEMPVGTI  207



>gb|KDO70551.1| hypothetical protein CISIN_1g013571mg [Citrus sinensis]
Length=440

 Score =   301 bits (770),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 170/201 (85%), Gaps = 4/201 (2%)
 Frame = +3

Query  60   VAISSPWHC----CSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGF  227
            + +S+ + C       +T+ GSE +S LTR+LLDSAR+PEFF+W++R+RR +HE PELGF
Sbjct  13   IIVSTIFTCNPTWAKKETQSGSEQLSSLTRELLDSAREPEFFEWMRRIRRRIHENPELGF  72

Query  228  EEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEH  407
            EE+ TSQL+R+ELDSLGI Y+WPVAKTG+VA++GSG +PWFGLRA+MDALP+QE+VEWEH
Sbjct  73   EEYETSQLVRSELDSLGIEYTWPVAKTGIVASVGSGGEPWFGLRAEMDALPLQEMVEWEH  132

Query  408  KSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGA  587
            KSK NGKMH CGHD H T+LLGAARLL++R + LKGTVKLVFQP EEG GGAY+MIKEGA
Sbjct  133  KSKNNGKMHGCGHDVHTTILLGAARLLKHRMDRLKGTVKLVFQPGEEGYGGAYYMIKEGA  192

Query  588  LDDFQSMFGMHVWPGMPVGTI  650
            +D FQ MFG+H+ P +P GT+
Sbjct  193  VDKFQGMFGIHISPVLPTGTV  213



>ref|XP_009798013.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X1 [Nicotiana 
sylvestris]
Length=435

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 172/212 (81%), Gaps = 12/212 (6%)
 Frame = +3

Query  30   SFRCVWFALIVAISS---PWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRT  200
            SFR  +F  I+A+ S   P++  ++ T         LTR LL+SAR PEF+DWLKRVRR 
Sbjct  3    SFRTDYFFCILALVSTISPYNSWAVDTE-------SLTRVLLESARQPEFYDWLKRVRRR  55

Query  201  LHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALP  380
            +HEYPEL F+EHRT+QLIR+ELD+LGI Y  PVAKTG+V  IGSG QPWFGLRADMDALP
Sbjct  56   IHEYPELAFQEHRTNQLIRDELDALGIKYLSPVAKTGLVGTIGSGGQPWFGLRADMDALP  115

Query  381  IQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKE--SLKGTVKLVFQPAEEGM  554
            IQELV+WE+KSKI+GKMHACGHDAHVTMLLGAARLLQNR++   LKGTVKLVFQP EEG 
Sbjct  116  IQELVDWEYKSKIDGKMHACGHDAHVTMLLGAARLLQNRRDKLKLKGTVKLVFQPGEEGY  175

Query  555  GGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             GA +M++EGALD+ Q++FGMHVWP MP GTI
Sbjct  176  AGASYMLEEGALDEVQAIFGMHVWPYMPTGTI  207



>ref|XP_010246184.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Nelumbo nucifera]
Length=432

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 173/207 (84%), Gaps = 12/207 (6%)
 Frame = +3

Query  39   CVWFALIVAISSPWHCCSLQTRLGSETVSQ---LTRDLLDSARDPEFFDWLKRVRRTLHE  209
            C++ ++++     +H C+L    G+E+ S+   LTR+LL+SAR+P+F DWLK +RR +HE
Sbjct  8    CLFVSVLL-----FHSCAL----GNESTSEIGWLTRELLESAREPQFLDWLKSIRRRIHE  58

Query  210  YPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQE  389
            YPEL FEE++TS+LIR+ELDSLGI YSWPVAKTGVV ++GSG QPWF LRADMDALP+QE
Sbjct  59   YPELAFEEYKTSELIRSELDSLGIAYSWPVAKTGVVGSVGSGQQPWFSLRADMDALPLQE  118

Query  390  LVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYH  569
            LVEWE+KSK NGKMHACGHDAHVTMLLGAA+LLQ +K  LKGTVKLVFQPAEEG  GAYH
Sbjct  119  LVEWEYKSKNNGKMHACGHDAHVTMLLGAAKLLQRQKNELKGTVKLVFQPAEEGRAGAYH  178

Query  570  MIKEGALDDFQSMFGMHVWPGMPVGTI  650
            M++EGALD+  ++FG+HV P +P GTI
Sbjct  179  MLQEGALDNIPAIFGLHVLPSLPSGTI  205



>ref|XP_008243486.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Prunus mume]
Length=438

 Score =   298 bits (764),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +3

Query  84   CCSLQTRLG-SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRN  260
             CS     G S  ++QL+R+LLDSAR PEFFDWLKRVRR +HE PEL FEEH TSQLIR+
Sbjct  21   SCSWDLEAGPSLELNQLSRELLDSARQPEFFDWLKRVRRRIHENPELAFEEHETSQLIRS  80

Query  261  ELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHAC  440
            ELDSLGI Y+WPVAKTG+VA+IGSG QPWF LRADMDALPIQELVEWEHKS+  GKMHAC
Sbjct  81   ELDSLGIQYTWPVAKTGLVASIGSGAQPWFALRADMDALPIQELVEWEHKSRNPGKMHAC  140

Query  441  GHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMH  620
            GHDAHVTMLLGAA+LLQ++ + +KGT+KLVFQP EE   GAYHMIKEGALD+ Q +FG+H
Sbjct  141  GHDAHVTMLLGAAKLLQSKSKEIKGTIKLVFQPGEEEHAGAYHMIKEGALDNIQGIFGLH  200

Query  621  VWPGMPVGTI  650
            + P MPVGTI
Sbjct  201  IQPLMPVGTI  210



>ref|XP_007027887.1| Iaa-amino acid hydrolase 4 [Theobroma cacao]
 gb|EOY08389.1| Iaa-amino acid hydrolase 4 [Theobroma cacao]
Length=433

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 167/204 (82%), Gaps = 3/204 (1%)
 Frame = +3

Query  45   WFALIVAISSPWHCCSLQTRLGSE--TVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPE  218
            WF L+  IS+   C S   +       +S LTR+LLDSA++PEFFDWL+RVRR +HEYPE
Sbjct  3    WFCLLTIISA-LACPSTGDKAAHSRLNLSSLTRELLDSAKEPEFFDWLRRVRRRIHEYPE  61

Query  219  LGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVE  398
            L FEEH TS+LIR+ELDSLGI Y+ P+AKTG+VA++GSG +PWFGLRADMDALPIQEL+E
Sbjct  62   LAFEEHETSELIRSELDSLGIQYTSPLAKTGIVASLGSGVKPWFGLRADMDALPIQELIE  121

Query  399  WEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIK  578
            WEHKSK NGKMHACGHD HVTMLLGAA+LLQ +++ LKGTVKLVFQP EE   GAYH+IK
Sbjct  122  WEHKSKNNGKMHACGHDVHVTMLLGAAKLLQRKRDELKGTVKLVFQPGEESHAGAYHVIK  181

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
            EGA+D  +++FG+HV P MP GT+
Sbjct  182  EGAVDHVEAIFGLHVSPEMPTGTV  205



>ref|XP_011094270.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Sesamum indicum]
Length=436

 Score =   296 bits (758),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 168/202 (83%), Gaps = 8/202 (4%)
 Frame = +3

Query  48   FALIVAISSPWHCC-SLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELG  224
              L+   SSP+H   +LQ    SET   LTR+LL+SARDP+F DWL+RVRR +HEYPEL 
Sbjct  13   LVLLATCSSPYHGAWALQ----SET---LTRELLESARDPDFLDWLRRVRRRIHEYPELA  65

Query  225  FEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWE  404
            F+E  TS+LIR+ELDSLGI Y+WPVAKTGVVA IGSG QPWFGLRADMDALPIQELVEWE
Sbjct  66   FQEELTSELIRSELDSLGIEYAWPVAKTGVVATIGSGAQPWFGLRADMDALPIQELVEWE  125

Query  405  HKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEG  584
            HKSKI+GKMHACGHDAHVTMLLGAA+LLQN ++ LKGTVKLVFQP EEG  GA++MI++G
Sbjct  126  HKSKIDGKMHACGHDAHVTMLLGAAKLLQNNRDKLKGTVKLVFQPGEEGYAGAHYMIQDG  185

Query  585  ALDDFQSMFGMHVWPGMPVGTI  650
            ALD  Q++F +HV P +P G++
Sbjct  186  ALDGVQAIFALHVDPALPTGSL  207



>ref|XP_006430118.1| hypothetical protein CICLE_v10013480mg [Citrus clementina]
 gb|ESR43358.1| hypothetical protein CICLE_v10013480mg [Citrus clementina]
Length=438

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 161/207 (78%), Gaps = 1/207 (0%)
 Frame = +3

Query  33   FRCVWFALIVAISSPWHCCSLQTR-LGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHE  209
            +  +  + I    + W     + R  GSE +S LTR+LL SA +PEFF+W+KR+RR +HE
Sbjct  5    YVLIILSTIFTCHATWAMAKEEIRGAGSERLSSLTRELLGSAGEPEFFEWMKRIRRRIHE  64

Query  210  YPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQE  389
             PEL FEE+   QL+RNEL SLGI Y+WP AKTG+VA +GSG QPWFGLRADMDALPIQE
Sbjct  65   NPELAFEEYEAGQLVRNELASLGIEYTWPFAKTGIVAFVGSGVQPWFGLRADMDALPIQE  124

Query  390  LVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYH  569
            +VEWEHKSK NGKMHACGHD H TMLLGAARLL+ RK+ LKGTVKLVFQP EE  GGAYH
Sbjct  125  MVEWEHKSKNNGKMHACGHDVHTTMLLGAARLLKQRKDRLKGTVKLVFQPGEESYGGAYH  184

Query  570  MIKEGALDDFQSMFGMHVWPGMPVGTI  650
            MIKEGAL+ FQ +FG+HV P +P GTI
Sbjct  185  MIKEGALEKFQGIFGLHVAPELPTGTI  211



>ref|XP_006354111.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3-like [Solanum 
tuberosum]
Length=442

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = +3

Query  33   FRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEY  212
            F C++  L++   S       +T L SET   LT++LL+SA+ PEFFDWLKRVRR +HEY
Sbjct  11   FLCMYILLVLTSFSYNSWAVKETLLRSET-KLLTQELLESAKQPEFFDWLKRVRRRIHEY  69

Query  213  PELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQEL  392
            PEL FEEH+TSQ IR+ELD LGI Y  PVAKTG+V  +GSG+QPWFGLRA+MDALP+QEL
Sbjct  70   PELAFEEHKTSQFIRDELDLLGIEYVSPVAKTGLVGTVGSGHQPWFGLRAEMDALPMQEL  129

Query  393  VEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHM  572
            V+ E+KSKINGKMHACGHDAHVTMLLGAARLLQNR++ LKGTVKLVFQPAEEG  GA +M
Sbjct  130  VDSEYKSKINGKMHACGHDAHVTMLLGAARLLQNRRDKLKGTVKLVFQPAEEGYAGASYM  189

Query  573  IKEGALDDFQSMFGMHVWPGMPVGTI  650
            I+EGALD  +++FGMHVWP +P G I
Sbjct  190  IEEGALDGVKAIFGMHVWPFIPTGII  215



>ref|XP_006481705.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3-like [Citrus 
sinensis]
Length=444

 Score =   293 bits (751),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 161/207 (78%), Gaps = 1/207 (0%)
 Frame = +3

Query  33   FRCVWFALIVAISSPWHCCSLQTR-LGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHE  209
            +  +  + I    + W     + R  GSE +S LTR+LL SA +PEFF+W+KR+RR +HE
Sbjct  11   YVLIILSTIFTCHATWAMAKEEIRGAGSERLSSLTRELLGSAGEPEFFEWMKRIRRRIHE  70

Query  210  YPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQE  389
             PEL F E+   QL+RNEL SLGI Y+WP AKTG+VA++GSG QPWFGLRADMDALPIQE
Sbjct  71   NPELAFAEYEAGQLVRNELASLGIEYTWPFAKTGIVASVGSGVQPWFGLRADMDALPIQE  130

Query  390  LVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYH  569
            +VEWEHKSK NGKMHACGHD H TMLLGAARLL+ RK+ LKGTVKLVFQP EE  GGAYH
Sbjct  131  MVEWEHKSKNNGKMHACGHDVHTTMLLGAARLLKQRKDRLKGTVKLVFQPGEESYGGAYH  190

Query  570  MIKEGALDDFQSMFGMHVWPGMPVGTI  650
            MIKEGAL+ FQ +FG+HV P +P GTI
Sbjct  191  MIKEGALEKFQGIFGLHVAPELPTGTI  217



>ref|XP_004136498.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Cucumis sativus]
 gb|KGN59167.1| hypothetical protein Csa_3G778240 [Cucumis sativus]
Length=433

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 162/208 (78%), Gaps = 12/208 (6%)
 Frame = +3

Query  36   RCVWFALIVAISSPWHCCSLQTRLGSE---TVSQLTRDLLDSARDPEFFDWLKRVRRTLH  206
            R ++F     ISS          LG+E    +S LT +LL+SAR+P+FFDWL R RR LH
Sbjct  7    RALFFIFPFLISSA---------LGTEPPLELSHLTLELLESARNPKFFDWLVRARRKLH  57

Query  207  EYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQ  386
            E PEL FEE  TSQ IR EL+SLGI ++WPVAKTG+VA+IGSG  PWF LRADMDALPIQ
Sbjct  58   ENPELSFEEFETSQFIRTELESLGINFTWPVAKTGIVASIGSGAHPWFALRADMDALPIQ  117

Query  387  ELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAY  566
            E+VEWEHKSK +GKMHACGHDAHVTMLLGAA+LLQ R+  LKGTVKLVFQP EEG  GAY
Sbjct  118  EMVEWEHKSKKDGKMHACGHDAHVTMLLGAAKLLQQRRNELKGTVKLVFQPGEEGRAGAY  177

Query  567  HMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            HM+KEGALD FQ +FG+H+ P +P+GTI
Sbjct  178  HMLKEGALDKFQGIFGLHIIPDLPIGTI  205



>ref|XP_010246176.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Nelumbo nucifera]
Length=430

 Score =   285 bits (730),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 160/185 (86%), Gaps = 3/185 (2%)
 Frame = +3

Query  105  LGSETVSQ---LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSL  275
            LGSE+ S+   LT++LL+SAR+P+FFDWL+RVRR +H+ PEL F+E+ TS+LIR+ELDSL
Sbjct  19   LGSESRSEIGLLTQELLESAREPQFFDWLRRVRRAIHQNPELSFQEYETSELIRSELDSL  78

Query  276  GIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAH  455
            GIGYSWPVAKTGV+ ++GSG QPWF LRADMDALPIQELV+WE KSK NGKMHACGHDAH
Sbjct  79   GIGYSWPVAKTGVIGSVGSGRQPWFSLRADMDALPIQELVDWEFKSKNNGKMHACGHDAH  138

Query  456  VTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGM  635
            VTMLLGAA+LLQ R++ LKGTVKLVFQPAEEG  GAYH++KEG L+  Q++FG+HV P +
Sbjct  139  VTMLLGAAKLLQQRRDELKGTVKLVFQPAEEGQSGAYHILKEGVLEKNQAIFGLHVSPYL  198

Query  636  PVGTI  650
              G I
Sbjct  199  HTGVI  203



>ref|XP_010683630.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Beta vulgaris 
subsp. vulgaris]
Length=432

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 159/193 (82%), Gaps = 0/193 (0%)
 Frame = +3

Query  72   SPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQL  251
            S +H   L    G E+ S L ++LL +AR+PEFFDWLKRVRR +HE PEL FEE  TSQL
Sbjct  19   SEFHGVKLIRVSGFESPSSLGQELLKTARNPEFFDWLKRVRRRIHENPELAFEEFETSQL  78

Query  252  IRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKM  431
            IR+EL+SL I YSWPVAKTG+V +IGSG+ PWF LRADMDALPIQE+VEW +KSK NGKM
Sbjct  79   IRSELESLEIEYSWPVAKTGIVGSIGSGSHPWFALRADMDALPIQEMVEWGNKSKNNGKM  138

Query  432  HACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMF  611
            HACGHD HVTMLLGAA+LLQ +++++KGT+KL+FQPAEEG  GAY MI+EGALDD Q++F
Sbjct  139  HACGHDVHVTMLLGAAKLLQQKRKNMKGTIKLIFQPAEEGRAGAYSMIQEGALDDVQAIF  198

Query  612  GMHVWPGMPVGTI  650
            G+HV P  P+GTI
Sbjct  199  GLHVSPYAPIGTI  211



>ref|XP_004305641.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Fragaria vesca 
subsp. vesca]
Length=440

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = +3

Query  45   WFALIVAISSPWHCCS--LQTRLGS-ETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYP  215
            W  ++V +S+     S  L+   GS   +S+L+++LLDSARDPEFFDWL++VRR +HE P
Sbjct  3    WLHIVVLLSTLAVHVSWGLEGTTGSLPELSKLSQELLDSARDPEFFDWLRKVRRKIHENP  62

Query  216  ELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELV  395
            EL FEE  TS+ IR+ELD LGI Y WPVAKTGVVA+IGSG QP F LRADMDALPIQELV
Sbjct  63   ELAFEEEETSRFIRSELDLLGIEYIWPVAKTGVVASIGSGVQPRFALRADMDALPIQELV  122

Query  396  EWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMI  575
            EWEHKSK  GKMHACGHD HVTMLLGAA+LLQ + + LKGTVKLVFQPAEEG  GAYHM+
Sbjct  123  EWEHKSKNPGKMHACGHDVHVTMLLGAAKLLQLKSKELKGTVKLVFQPAEEGHAGAYHML  182

Query  576  KEGALDDFQSMFGMHVWPGMPVGTI  650
            KEGALD  + +FG+HVWP  P G+I
Sbjct  183  KEGALDGIEGIFGLHVWPEQPTGSI  207



>gb|KJB62043.1| hypothetical protein B456_009G398600 [Gossypium raimondii]
Length=428

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LTR+LL SA++P FFDWLKRVRR +HEYPEL F+EH T +LI +EL+SLGI YSWPVAKT
Sbjct  31   LTRELLHSAKEPAFFDWLKRVRRRIHEYPELAFQEHETGRLIMSELESLGIDYSWPVAKT  90

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            G+VA++GSG +P+FGLRAD+DALPIQELVEWEHKSK  GKMHACGHDAHVTMLLGAA+LL
Sbjct  91   GIVASVGSGLEPYFGLRADIDALPIQELVEWEHKSKKQGKMHACGHDAHVTMLLGAAKLL  150

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            + +++ LKGTVKLVFQP EE   GAYHMIKEGA+D+  ++FG+HV P +P GT+
Sbjct  151  ERKRDELKGTVKLVFQPGEESYAGAYHMIKEGAVDNVHAIFGLHVTPELPTGTV  204



>ref|XP_004228647.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Solanum lycopersicum]
Length=439

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = +3

Query  69   SSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQ  248
            S P++  S++  L       L  +L +SA+ PEFF+WLKRVRR +HEYPEL FEE++TSQ
Sbjct  21   SFPYNSWSVEETLLRSETELLAHELFESAKQPEFFNWLKRVRRRIHEYPELAFEEYKTSQ  80

Query  249  LIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGK  428
            LIR+ELD +GI Y  PVAKTG+V  +GSG+QP FGLRADMDALP+QELV+ E+KSKINGK
Sbjct  81   LIRDELDLMGIEYVSPVAKTGLVGIVGSGHQPSFGLRADMDALPMQELVDSEYKSKINGK  140

Query  429  MHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSM  608
            MHACGHDAHVTMLLGAARLLQNR++ LKGTVKLVFQPAEEG  GA +MI+EGALD  +++
Sbjct  141  MHACGHDAHVTMLLGAARLLQNRRDKLKGTVKLVFQPAEEGYAGASYMIEEGALDGVKAI  200

Query  609  FGMHVWPGMPVGTI  650
            FGMHVWP  P G I
Sbjct  201  FGMHVWPFTPTGII  214



>ref|XP_010037298.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
 gb|KCW48984.1| hypothetical protein EUGRSUZ_K02598 [Eucalyptus grandis]
Length=441

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +S L R LL +AR+PEFF WL+ VRR +HE PEL F+EH TS+L+R+ELD+LGI Y WPV
Sbjct  39   LSSLGRQLLAAAREPEFFGWLRSVRRRIHERPELAFQEHETSRLVRSELDALGIKYKWPV  98

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            A+TGVVA+IGSG+QPWF LRADMDALP+QELVEWEHKSK +GKMHACGHDAH TMLLGAA
Sbjct  99   AETGVVASIGSGDQPWFALRADMDALPVQELVEWEHKSKNDGKMHACGHDAHTTMLLGAA  158

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            RLL ++K+SLKGT+KLVFQP EEG  GAYHM++EGALD FQ++FG+HV P +  G++
Sbjct  159  RLLSSKKDSLKGTIKLVFQPGEEGRAGAYHMLREGALDQFQAIFGLHVLPLLETGSV  215



>gb|KCW48983.1| hypothetical protein EUGRSUZ_K02598 [Eucalyptus grandis]
Length=440

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +S L R+LL +AR+PEFF WL+ VRR +HE PEL F+EH TS+L+R+ELD+LGI Y WPV
Sbjct  38   LSSLGRELLAAAREPEFFGWLRSVRRRIHERPELAFQEHETSRLVRSELDALGIEYKWPV  97

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            A+TGVVA+IGSG+QPWF LRADMDALP+QELVEWEHKSK +GKMHACGHDAH TMLLGAA
Sbjct  98   AETGVVASIGSGDQPWFALRADMDALPVQELVEWEHKSKNDGKMHACGHDAHTTMLLGAA  157

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            RLL  +K SLKGT+KLVFQP EEG  GAYHM++EGALD FQ++FG+HV P M  G++
Sbjct  158  RLLSGKKHSLKGTIKLVFQPGEEGRAGAYHMLREGALDQFQAIFGLHVLPLMETGSV  214



>ref|XP_010037299.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Eucalyptus grandis]
 gb|KCW48985.1| hypothetical protein EUGRSUZ_K02598 [Eucalyptus grandis]
Length=440

 Score =   281 bits (719),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +S L R+LL +AR+PEFF WL+ VRR +HE PEL F+EH TS+L+R+ELD+LGI Y WPV
Sbjct  38   LSSLGRELLAAAREPEFFGWLRSVRRRIHERPELAFQEHETSRLVRSELDALGIEYKWPV  97

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            A+TGVVA+IGSG+QPWF LRADMDALP+QELVEWEHKSK +GKMHACGHDAH TMLLGAA
Sbjct  98   AETGVVASIGSGDQPWFALRADMDALPVQELVEWEHKSKNDGKMHACGHDAHTTMLLGAA  157

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            RLL  +K SLKGT+KLVFQP EEG  GAYHM++EGALD FQ++FG+HV P M  G++
Sbjct  158  RLLSGKKHSLKGTIKLVFQPGEEGRAGAYHMLREGALDQFQAIFGLHVLPLMETGSV  214



>gb|EYU18085.1| hypothetical protein MIMGU_mgv1a006848mg [Erythranthe guttata]
Length=429

 Score =   280 bits (716),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +3

Query  123  SQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVA  302
            S L R+LL+SA D EF  WL+ VRR +HEYPEL FEE RTSQLIR+ELDSLGI Y WPVA
Sbjct  30   SALARELLESASDSEFSGWLRSVRRRIHEYPELSFEERRTSQLIRSELDSLGIEYVWPVA  89

Query  303  KTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAAR  482
            +TGVVA +GSG QPWF LRADMDALP+QELVEWEHKSKI+GKMH+CGHDAHVTMLLGAA+
Sbjct  90   ETGVVATVGSGAQPWFALRADMDALPMQELVEWEHKSKIDGKMHSCGHDAHVTMLLGAAK  149

Query  483  LLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LLQ  ++ LKGTVKL+FQP EEG  GAY+MIKEGALD  Q++FG+HV P +P GT+
Sbjct  150  LLQKNRDKLKGTVKLIFQPGEEGHAGAYYMIKEGALDGVQAIFGLHVDPMIPTGTV  205



>ref|XP_002281507.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Vitis vinifera]
Length=438

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            L+R+LL+SAR+ EFF+W++ VRR +H+YPELGFEEH+TS+LIR EL+SLGIGY WPVAKT
Sbjct  33   LSRELLESAREREFFEWMRGVRRKIHQYPELGFEEHKTSELIRAELNSLGIGYKWPVAKT  92

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            GVVA+IGSG+QP F LRADMDALP+QELVEWE+KSKI GKMHACGHD+HV MLLGAA+LL
Sbjct  93   GVVASIGSGDQPTFALRADMDALPLQELVEWEYKSKIEGKMHACGHDSHVAMLLGAAKLL  152

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            Q ++  LKGTVKLVFQP EEG  GAYHM+KEGAL+D + M G+HV P +P G I
Sbjct  153  QAKRGMLKGTVKLVFQPGEEGYAGAYHMLKEGALEDVKGMLGLHVIPTVPTGGI  206



>ref|XP_010093789.1| IAA-amino acid hydrolase ILR1-like 7 [Morus notabilis]
 gb|EXB54622.1| IAA-amino acid hydrolase ILR1-like 7 [Morus notabilis]
Length=435

 Score =   278 bits (712),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 154/184 (84%), Gaps = 2/184 (1%)
 Frame = +3

Query  99   TRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLG  278
            T  GSE ++QLTR+LLDSA  PEF  WL+RVRR +HE PEL FEE  TSQL+R+ELDSLG
Sbjct  29   TPTGSEELTQLTRELLDSASQPEFSAWLRRVRRKIHENPELAFEEFETSQLVRSELDSLG  88

Query  279  IGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHV  458
            + Y+WPVA+TGVVA++GSG QPWF LRADMDA  IQELVEWEHKSK +GKMHACGHDAHV
Sbjct  89   VEYTWPVAETGVVASVGSGAQPWFALRADMDA--IQELVEWEHKSKNHGKMHACGHDAHV  146

Query  459  TMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMP  638
            TMLLGAA+LLQ+R   LKGTVKLVFQPAEEG  GAYH+++E ALD  +++FG+HV P M 
Sbjct  147  TMLLGAAKLLQSRSNQLKGTVKLVFQPAEEGRAGAYHVLQESALDKVKAIFGLHVSPEMA  206

Query  639  VGTI  650
             GTI
Sbjct  207  TGTI  210



>ref|XP_008442881.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Cucumis melo]
Length=433

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +S+LTRDLL+SARDPEFF+WL R RR LHE PEL FEE  TS+ IR EL+S+GI ++WPV
Sbjct  29   LSRLTRDLLESARDPEFFEWLVRTRRKLHENPELAFEEFETSEFIRTELESVGINFNWPV  88

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTG+VA++GSG  PWF LRADMDALPIQE+VEWEHKSK +GKMHACGHD HVTMLLGAA
Sbjct  89   AKTGIVASVGSGAHPWFALRADMDALPIQEMVEWEHKSKKDGKMHACGHDVHVTMLLGAA  148

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ R+  LKGTVKLVFQP EEG GGAYHM+KEGA+++ + +FG+HV   M +G I
Sbjct  149  KLLQQRRNELKGTVKLVFQPGEEGRGGAYHMVKEGAIENVKGIFGLHVAQDMTLGAI  205



>ref|XP_008391948.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
[Malus domestica]
Length=436

 Score =   278 bits (710),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = +3

Query  81   HCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRN  260
            H C+    L  E+   LT++LL SAR+PEFF+W++ +RR +H+YPELGF+EHRTS+L+R 
Sbjct  23   HSCAAGDGLELES---LTQELLASAREPEFFEWMRGLRRRIHQYPELGFQEHRTSELVRT  79

Query  261  ELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHAC  440
            ELDSLG+GY WPVAKTGVVA IGSG++P F LRADMDALP+QELV+WE+KSK++GKMHAC
Sbjct  80   ELDSLGVGYKWPVAKTGVVAYIGSGSKPVFALRADMDALPLQELVDWEYKSKVDGKMHAC  139

Query  441  GHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMH  620
            GHD+HV MLLGAA+LLQN+K+ LKGTVKLVFQP EEG  GAYHM+K+  L+D  ++  +H
Sbjct  140  GHDSHVAMLLGAAKLLQNKKDXLKGTVKLVFQPGEEGYAGAYHMLKDDVLNDIDAILSIH  199

Query  621  VWPGMPVGTI  650
            V+P +P G I
Sbjct  200  VFPSVPTGAI  209



>ref|XP_010683632.1| PREDICTED: IAA-amino acid hydrolase ILR1 [Beta vulgaris subsp. 
vulgaris]
Length=442

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 161/206 (78%), Gaps = 6/206 (3%)
 Frame = +3

Query  36   RCVWFA-LIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEY  212
            +C   + L++ ++      SL + L S     LTRDLLD+A+ PE F+W+KRVRRT+H+ 
Sbjct  13   KCFLLSSLLIIVTHISRANSLDSGLES-----LTRDLLDAAKQPELFEWMKRVRRTIHQN  67

Query  213  PELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQEL  392
            PELGFEEH TSQLIR+ELDSLGI Y WPVAKTG++A+IGSG +P F LRADMDAL +QE+
Sbjct  68   PELGFEEHHTSQLIRSELDSLGIEYVWPVAKTGIIASIGSGRKPVFALRADMDALALQEM  127

Query  393  VEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHM  572
            ++WE+KSK +GKMHACGHD HV MLLGAA+LLQ RK+ LKGTVKLVFQP EEG  GAYHM
Sbjct  128  IDWEYKSKNDGKMHACGHDTHVAMLLGAAKLLQARKDQLKGTVKLVFQPGEEGYAGAYHM  187

Query  573  IKEGALDDFQSMFGMHVWPGMPVGTI  650
            +KEG LDD  ++  +HV P +P G+I
Sbjct  188  LKEGPLDDVDAIISLHVLPSLPTGSI  213



>ref|XP_010037297.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Eucalyptus grandis]
 gb|KCW48981.1| hypothetical protein EUGRSUZ_K02596 [Eucalyptus grandis]
Length=447

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +3

Query  84   CCSLQTRLGSET-VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRN  260
            C S    L SE  +  LTRDLL+SA+DPEFF W++ +RR +HE+PELGFEEHRTSQLIR+
Sbjct  18   CGSCAGELKSEPELRSLTRDLLESAKDPEFFRWMRDIRRRIHEHPELGFEEHRTSQLIRD  77

Query  261  ELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHAC  440
            ELDSLGI Y WPVAKTGVVA +GSG +P F LRADMDALP+QELVEWEHKSKI+GKMHAC
Sbjct  78   ELDSLGIQYKWPVAKTGVVAFMGSGEKPVFALRADMDALPLQELVEWEHKSKIDGKMHAC  137

Query  441  GHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMH  620
            GHD HV MLLGAA+LL+ R+  +KGT+KLVFQP EEG  GAY+M+++G LDD   +  +H
Sbjct  138  GHDTHVAMLLGAAKLLKERENQIKGTIKLVFQPGEEGHSGAYYMLQDGVLDDLDGILSIH  197

Query  621  VWPGMPVGTI  650
            V P +P G I
Sbjct  198  VLPNVPTGFI  207



>ref|XP_002275866.2| PREDICTED: IAA-amino acid hydrolase ILR1-like [Vitis vinifera]
Length=440

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 163/209 (78%), Gaps = 5/209 (2%)
 Frame = +3

Query  33   FRCVWFALIV---AISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTL  203
               +W+ L+V      S W     QTR G E + +L R+LL+SAR+ +  +W++ VRR++
Sbjct  1    MESIWWYLMVWTLLYQSTW-AVETQTRTGWE-MERLGRELLESAREADLLEWIRGVRRSI  58

Query  204  HEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPI  383
            HEYPELGFEE+RTSQLIR+EL+SLGI Y WPVAKTGVVA IGSG QP F LRADMDALP+
Sbjct  59   HEYPELGFEEYRTSQLIRDELNSLGIRYEWPVAKTGVVATIGSGAQPIFALRADMDALPL  118

Query  384  QELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGA  563
            QELVEWEH+SKI+GKMHACGHD HV MLLGAARLLQ ++E LKGTVKLVFQP EEG  GA
Sbjct  119  QELVEWEHRSKIDGKMHACGHDLHVAMLLGAARLLQGKREILKGTVKLVFQPGEEGYAGA  178

Query  564  YHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            YHM++ GALD+  ++FG+HV P +  G I
Sbjct  179  YHMLQHGALDNINAIFGLHVMPSILTGMI  207



>ref|XP_010037293.1| PREDICTED: IAA-amino acid hydrolase ILR1-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010037294.1| PREDICTED: IAA-amino acid hydrolase ILR1-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW48976.1| hypothetical protein EUGRSUZ_K02589 [Eucalyptus grandis]
Length=435

 Score =   275 bits (703),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 152/188 (81%), Gaps = 1/188 (1%)
 Frame = +3

Query  84   CCSLQTRLGSE-TVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRN  260
            C S    L SE  +  LT+DLL+SA+ PEFF W++ +RR +HEYPELGFEEHRTSQLIR+
Sbjct  17   CGSCAAELKSEPQLRPLTQDLLESAKGPEFFRWMRDIRRRIHEYPELGFEEHRTSQLIRD  76

Query  261  ELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHAC  440
            ELDSLGI Y WPVAKTGVVA +GSG +P F LRADMDALP+QELVEWEHKSKI+GKMHAC
Sbjct  77   ELDSLGIKYKWPVAKTGVVAFMGSGEKPVFALRADMDALPLQELVEWEHKSKIDGKMHAC  136

Query  441  GHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMH  620
            GHD HV MLLGAA+LL+ R+ ++KGTVKLVFQP EEG  GAY+M+++G LDD   +  +H
Sbjct  137  GHDTHVAMLLGAAKLLKEREHTIKGTVKLVFQPGEEGYSGAYYMLQDGVLDDLDGILSIH  196

Query  621  VWPGMPVG  644
            V P +P G
Sbjct  197  VLPTVPTG  204



>ref|XP_008243488.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Prunus mume]
Length=435

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LTR+LL++ARDPEFF+W++ +RR +H++PELGFEEHRTS+L+R+ELDSLGI Y WPVAKT
Sbjct  34   LTRELLEAARDPEFFEWMRGLRRRIHQHPELGFEEHRTSELVRSELDSLGIKYKWPVAKT  93

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            GVVA+IGSG++P F LRADMDALP+QELV+WE+KSKI+GKMHACGHD+HV MLLGAA+LL
Sbjct  94   GVVASIGSGSKPVFALRADMDALPLQELVDWEYKSKIDGKMHACGHDSHVAMLLGAAKLL  153

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            Q++++ LKGTVKLVFQP EEG  GAYHM+++G L+D  ++  +HV P +P G +
Sbjct  154  QDKRDMLKGTVKLVFQPGEEGYAGAYHMLQDGVLNDIDTILSLHVLPSVPTGAV  207



>ref|XP_007027898.1| Iaa-amino acid hydrolase 4, putative [Theobroma cacao]
 gb|EOY08400.1| Iaa-amino acid hydrolase 4, putative [Theobroma cacao]
Length=506

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 155/187 (83%), Gaps = 1/187 (1%)
 Frame = +3

Query  90   SLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELD  269
            +L+T  G E +  LT++LL+SAR P FF+W++ VRR +HEYPELGFEEH+TSQ+IR ELD
Sbjct  91   ALETPSGIE-LEPLTQELLESARKPVFFEWMREVRRKIHEYPELGFEEHKTSQVIRTELD  149

Query  270  SLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHD  449
            SLGI Y WPVAKTGVVA IGSG +P F LRADMD LPI+ELV+WEHKSK++GKMHACGHD
Sbjct  150  SLGISYKWPVAKTGVVATIGSGAKPVFSLRADMDGLPIKELVKWEHKSKVDGKMHACGHD  209

Query  450  AHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWP  629
            +HV M+LGAA+LLQ +++ LKGTVKLVFQP EEG  GAYHM+++G+LDD  ++F +HV P
Sbjct  210  SHVAMVLGAAKLLQAKRDELKGTVKLVFQPGEEGYAGAYHMLQDGSLDDIDAIFALHVLP  269

Query  630  GMPVGTI  650
              P G +
Sbjct  270  AYPSGIL  276



>ref|XP_007202069.1| hypothetical protein PRUPE_ppa005951mg [Prunus persica]
 gb|EMJ03268.1| hypothetical protein PRUPE_ppa005951mg [Prunus persica]
Length=435

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LTR+LL++ARDPEFF+W++ +RR +H++PELGFEEHRTS+L+R+ELDSLGI Y WPVAKT
Sbjct  34   LTRELLEAARDPEFFEWMRGLRRRIHQHPELGFEEHRTSELVRSELDSLGIEYKWPVAKT  93

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            GVVA+IGSG++P F LRADMDALP+QELV+WE+KSKI+GKMHACGHD+HV MLLGAA+LL
Sbjct  94   GVVASIGSGSKPVFALRADMDALPLQELVDWEYKSKIDGKMHACGHDSHVAMLLGAAKLL  153

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            Q++++ LKGTVKLVFQP EEG  GAYHM+++G L+D  ++  +HV P +P G +
Sbjct  154  QDKRDMLKGTVKLVFQPGEEGYAGAYHMLQDGVLNDIDTILSLHVLPSVPTGAV  207



>ref|XP_009373052.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Pyrus x bretschneideri]
Length=436

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 157/190 (83%), Gaps = 3/190 (2%)
 Frame = +3

Query  81   HCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRN  260
            H C+     G   +  LT++LL SAR+PEFF+W++ +R  +H+YPELGF+EHRTS+L+R 
Sbjct  23   HSCAAG---GGPELESLTQELLASAREPEFFEWMRGLRWRIHQYPELGFQEHRTSELVRT  79

Query  261  ELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHAC  440
            ELDSLG+GY WPVAKTGVVA+IGSG++P F LRADMDALP+QELV+WE+KSK++GKMHAC
Sbjct  80   ELDSLGVGYKWPVAKTGVVASIGSGSKPVFALRADMDALPLQELVDWEYKSKVDGKMHAC  139

Query  441  GHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMH  620
            GHD+HV MLLGAA+LLQN+K+ LKGTVKLVFQP EEG  GAYHM+K+  L+D  ++  +H
Sbjct  140  GHDSHVAMLLGAAKLLQNKKDLLKGTVKLVFQPGEEGYAGAYHMLKDDVLNDIDAILSIH  199

Query  621  VWPGMPVGTI  650
            V+P +P G I
Sbjct  200  VFPSVPTGAI  209



>ref|XP_010943801.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 7 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 164/203 (81%), Gaps = 4/203 (2%)
 Frame = +3

Query  42   VWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPEL  221
            ++F+L+ +     H  S  ++  S  +    R+LL+SAR+PEFFDW+  +RR +H++PEL
Sbjct  32   LFFSLLTST----HLSSCASQNPSTEIGISPRELLESAREPEFFDWMTSIRRRIHQHPEL  87

Query  222  GFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEW  401
            GFEE++TS+LIR+ELD+LGI YSWPVAKTG+VA++GSG  P F LRADMDALP+QELV+W
Sbjct  88   GFEEYKTSELIRSELDALGIEYSWPVAKTGIVASVGSGASPLFALRADMDALPLQELVDW  147

Query  402  EHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKE  581
            E++SK +GKMHACGHDAHVTMLLGAARLLQ+ +  LKGTVKL+FQP EEG  GAYHM++E
Sbjct  148  EYRSKQSGKMHACGHDAHVTMLLGAARLLQHCENKLKGTVKLIFQPGEEGRAGAYHMLQE  207

Query  582  GALDDFQSMFGMHVWPGMPVGTI  650
            GAL+D Q++FG+HV P +  G I
Sbjct  208  GALEDVQAIFGIHVEPSLSTGAI  230



>ref|XP_009349375.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Pyrus x bretschneideri]
 ref|XP_009349685.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Pyrus x bretschneideri]
Length=436

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 157/190 (83%), Gaps = 3/190 (2%)
 Frame = +3

Query  81   HCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRN  260
            H C+     G   +  LT++LL SAR+PEFF+W++ +R  +H+YPELGF+EHRTS+L+R 
Sbjct  23   HSCAAG---GGPELESLTQELLASAREPEFFEWMRGLRWRIHQYPELGFQEHRTSELVRT  79

Query  261  ELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHAC  440
            ELDSLG+GY WPVAKTGVVA+IGSG++P F LRADMDALP+QELV+WE+KSK++GKMHAC
Sbjct  80   ELDSLGVGYKWPVAKTGVVASIGSGSKPVFALRADMDALPLQELVDWEYKSKVDGKMHAC  139

Query  441  GHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMH  620
            GHD+HV MLLGAA+LLQN+K+ LKGTVKLVFQP EEG  GAYHM+K+  L+D  ++  +H
Sbjct  140  GHDSHVAMLLGAAKLLQNKKDLLKGTVKLVFQPGEEGYAGAYHMLKDDVLNDIDAILSIH  199

Query  621  VWPGMPVGTI  650
            V+P +P G I
Sbjct  200  VFPSVPTGAI  209



>ref|XP_002308453.2| IAA-amino acid hydrolase 1 family protein [Populus trichocarpa]
 gb|EEE91976.2| IAA-amino acid hydrolase 1 family protein [Populus trichocarpa]
Length=441

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 161/205 (79%), Gaps = 4/205 (2%)
 Frame = +3

Query  39   CVWFALIVAISSPWHCCSLQTRLGSETVSQ-LTRDLLDSARDPEFFDWLKRVRRTLHEYP  215
              WF L V      +  SL  + G E   Q L+R+LL +AR+P+FF+W++ +RR +HEYP
Sbjct  4    ITWFLLSVLF---LYQQSLAFQAGQELGLQFLSRELLAAAREPDFFEWVRGIRRRIHEYP  60

Query  216  ELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELV  395
            ELGFEE+RTS++IR+ELD LGI Y WPVAKTGVVA +GSG +P F LRADMDALP+QE V
Sbjct  61   ELGFEEYRTSEIIRSELDLLGIDYKWPVAKTGVVATVGSGQEPVFALRADMDALPLQEEV  120

Query  396  EWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMI  575
            EWEHKSKI+GKMHACGHD+HV MLLGAA+LLQ ++E+LKGTVKLVFQP EEG  GAYHM+
Sbjct  121  EWEHKSKIDGKMHACGHDSHVAMLLGAAKLLQAKRETLKGTVKLVFQPGEEGYAGAYHML  180

Query  576  KEGALDDFQSMFGMHVWPGMPVGTI  650
            ++G LDD +++  +HV P +P G I
Sbjct  181  QDGCLDDVEAILSIHVIPSVPTGAI  205



>ref|XP_008798874.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Phoenix dactylifera]
Length=439

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = +3

Query  135  RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGV  314
            R+LL+SAR+PEFFDW+  +RR +H++PELGFEE++TS+LIR+ELD+LGI YSWPVAKTG+
Sbjct  42   RELLESAREPEFFDWMTSIRRRIHQHPELGFEEYKTSELIRSELDALGIEYSWPVAKTGI  101

Query  315  VAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQN  494
            VA++GSG  P F LRADMDALP+QELV+WE++SK +GKMHACGHDAHVTMLLGAARLLQ+
Sbjct  102  VASVGSGASPLFALRADMDALPLQELVDWEYRSKQSGKMHACGHDAHVTMLLGAARLLQH  161

Query  495  RKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             K  LKGTVKLVFQPAEEG  GAYHM++EGAL+D Q++F +HV P +  G I
Sbjct  162  HKNKLKGTVKLVFQPAEEGQAGAYHMLQEGALEDVQAIFCIHVEPSLSTGAI  213



>ref|XP_010943800.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X1 [Elaeis 
guineensis]
Length=456

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 164/203 (81%), Gaps = 4/203 (2%)
 Frame = +3

Query  42   VWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPEL  221
            ++F+L+ +     H  S  ++  S  +    R+LL+SAR+PEFFDW+  +RR +H++PEL
Sbjct  32   LFFSLLTST----HLSSCASQNPSTEIGISPRELLESAREPEFFDWMTSIRRRIHQHPEL  87

Query  222  GFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEW  401
            GFEE++TS+LIR+ELD+LGI YSWPVAKTG+VA++GSG  P F LRADMDALP+QELV+W
Sbjct  88   GFEEYKTSELIRSELDALGIEYSWPVAKTGIVASVGSGASPLFALRADMDALPLQELVDW  147

Query  402  EHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKE  581
            E++SK +GKMHACGHDAHVTMLLGAARLLQ+ +  LKGTVKL+FQP EEG  GAYHM++E
Sbjct  148  EYRSKQSGKMHACGHDAHVTMLLGAARLLQHCENKLKGTVKLIFQPGEEGRAGAYHMLQE  207

Query  582  GALDDFQSMFGMHVWPGMPVGTI  650
            GAL+D Q++FG+HV P +  G I
Sbjct  208  GALEDVQAIFGIHVEPSLSTGAI  230



>ref|XP_004136497.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Cucumis sativus]
 gb|KGN59166.1| hypothetical protein Csa_3G778230 [Cucumis sativus]
Length=435

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +S+LTR+LL+SARDPEFF+WL + RR LHE PEL FEE  TS+ IR EL+S+GI ++WP+
Sbjct  29   LSRLTRELLESARDPEFFEWLVKARRKLHENPELAFEEFETSEFIRTELESVGINFNWPL  88

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTG+VA++GSG  PWF LRADMDALPIQE+VEWEHKSK +GKMHACGHD HVTMLLGAA
Sbjct  89   AKTGIVASVGSGAHPWFALRADMDALPIQEMVEWEHKSKKDGKMHACGHDVHVTMLLGAA  148

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ R+  LKGTVKLVFQP EEG GGAY+M+KEGA+++ + +FG+HV   M +G I
Sbjct  149  KLLQQRRNELKGTVKLVFQPGEEGRGGAYYMVKEGAIENVKGIFGLHVAQDMTLGAI  205



>ref|XP_010039094.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Eucalyptus grandis]
Length=279

 Score =   265 bits (677),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  LT+DLL+SA+DPEFF W++ +RR +HE+ ELGFEEHRTSQLIR+ELDSLGI Y WPV
Sbjct  30   LKSLTQDLLESAKDPEFFRWMRDIRRRIHEHLELGFEEHRTSQLIRDELDSLGIKYKWPV  89

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA +GSG +P F LRADMDALP+QELVEWEHKSKI+GKMHACGHD+HV MLLGAA
Sbjct  90   AKTGVVAFMGSGKKPVFALRADMDALPLQELVEWEHKSKIDGKMHACGHDSHVAMLLGAA  149

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVG  644
            +LL+ R+  +KGT+KLVFQP EEG  GAY+M+++G L+D   +  +HV P +P G
Sbjct  150  KLLKERENQIKGTIKLVFQPGEEGYSGAYYMLQDGVLNDLDGILSIHVLPHVPTG  204



>ref|XP_002308452.1| IAA-amino acid hydrolase 1 family protein [Populus trichocarpa]
 gb|EEE91975.1| IAA-amino acid hydrolase 1 family protein [Populus trichocarpa]
Length=440

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 155/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  90   SLQTRLGSETVSQ-LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNEL  266
            SL  + G E   Q LTR+LL +AR+ +FF+W++ +RR +HEYPELGFEE+RTS++IR+EL
Sbjct  17   SLAFQTGQELGLQFLTRELLAAAREADFFEWVRGIRRRIHEYPELGFEEYRTSEIIRSEL  76

Query  267  DSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGH  446
            + LGI Y WPVAKTGVVA IGSG +P FGLRADMDALPIQE VEWEHKSKI+GKMHACGH
Sbjct  77   ELLGIDYKWPVAKTGVVATIGSGQKPVFGLRADMDALPIQEEVEWEHKSKIDGKMHACGH  136

Query  447  DAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVW  626
            D+HV MLLGAA+LLQ ++++LKGTVKLVFQP EEG  GAYHM+++G LDD  ++  +HV 
Sbjct  137  DSHVAMLLGAAKLLQAKRDTLKGTVKLVFQPGEEGYCGAYHMLQDGCLDDIDAILSIHVI  196

Query  627  PGMPVGTI  650
            P +P G I
Sbjct  197  PSVPTGAI  204



>ref|XP_009405312.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Musa acuminata 
subsp. malaccensis]
Length=440

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  135  RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGV  314
            R+LL+SAR PEFFDWL  +RR +H++PEL FEE+ TS+LIR+ELD+LG+ Y+WPVAKTG+
Sbjct  42   RELLESARAPEFFDWLTTIRRRIHQHPELAFEEYGTSELIRSELDALGVEYTWPVAKTGI  101

Query  315  VAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQN  494
            VA+IGSG  P F LRADMDALP+QELV WE+KSK +GKMHACGHDAHVTMLLGAA+LLQ+
Sbjct  102  VASIGSGAGPVFALRADMDALPLQELVNWEYKSKESGKMHACGHDAHVTMLLGAAKLLQH  161

Query  495  RKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +K  LKGTVKLVFQP EEG  GAYHM++EG LDD +++F MHV P +P G I
Sbjct  162  QKSELKGTVKLVFQPGEEGYAGAYHMLQEGTLDDVEAIFAMHVQPSLPTGHI  213



>ref|XP_012074385.1| PREDICTED: IAA-amino acid hydrolase ILR1-like isoform X2 [Jatropha 
curcas]
 ref|XP_012074386.1| PREDICTED: IAA-amino acid hydrolase ILR1-like isoform X2 [Jatropha 
curcas]
Length=277

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  153  ARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGS  332
            AR+ +F +W+K +RR +HE+PELGFEEHRTSQLIR ELDSLGI Y WPVAKTGVVA+IGS
Sbjct  46   AREVKFLEWIKGIRRRIHEHPELGFEEHRTSQLIRTELDSLGIKYKWPVAKTGVVASIGS  105

Query  333  GNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLK  512
            G +P F LRADMDALP+QELVEWEH+SKI+G+MHACGHD+HV+MLLGAA+LLQ ++  +K
Sbjct  106  GEKPVFALRADMDALPLQELVEWEHQSKIDGRMHACGHDSHVSMLLGAAKLLQQKRNEIK  165

Query  513  GTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GTVKLVFQP EEG  GAYHM+++G LDD +++F +HV P +P G I
Sbjct  166  GTVKLVFQPGEEGYAGAYHMLQDGVLDDVKAIFMLHVLPSIPTGVI  211



>ref|XP_004303517.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Fragaria vesca 
subsp. vesca]
Length=434

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LTR+LL+SA++PEFF+W+  VRR +H+YPE GFEE+RTS+LIR+ELDSLGI Y+WPVA+T
Sbjct  34   LTRELLESAKEPEFFEWMIGVRRRIHQYPETGFEEYRTSELIRSELDSLGIKYTWPVAET  93

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            G+VA+IGSG++P F +RADMDALPIQE VEWE KSKI+GKMHACGHDAHV MLLGAA++L
Sbjct  94   GIVASIGSGSKPVFAIRADMDALPIQEQVEWEFKSKIDGKMHACGHDAHVAMLLGAAKIL  153

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            Q+R++ LKGTVKLVFQP EEG  GA+HM++ G LDD  ++F +HV P +P G I
Sbjct  154  QSRRDVLKGTVKLVFQPGEEGFSGAHHMLRHGILDDIDAIFFIHVVPDLPTGVI  207



>ref|XP_012074384.1| PREDICTED: IAA-amino acid hydrolase ILR1-like isoform X1 [Jatropha 
curcas]
 gb|KDP36174.1| hypothetical protein JCGZ_08818 [Jatropha curcas]
Length=282

 Score =   263 bits (672),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  153  ARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGS  332
            AR+ +F +W+K +RR +HE+PELGFEEHRTSQLIR ELDSLGI Y WPVAKTGVVA+IGS
Sbjct  46   AREVKFLEWIKGIRRRIHEHPELGFEEHRTSQLIRTELDSLGIKYKWPVAKTGVVASIGS  105

Query  333  GNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLK  512
            G +P F LRADMDALP+QELVEWEH+SKI+G+MHACGHD+HV+MLLGAA+LLQ ++  +K
Sbjct  106  GEKPVFALRADMDALPLQELVEWEHQSKIDGRMHACGHDSHVSMLLGAAKLLQQKRNEIK  165

Query  513  GTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GTVKLVFQP EEG  GAYHM+++G LDD +++F +HV P +P G I
Sbjct  166  GTVKLVFQPGEEGYAGAYHMLQDGVLDDVKAIFMLHVLPSIPTGVI  211



>ref|XP_010093788.1| IAA-amino acid hydrolase [Morus notabilis]
 gb|EXB54621.1| IAA-amino acid hydrolase [Morus notabilis]
Length=445

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            L+R+LL SAR+PEFF+W++ VRR +H+YPELGF+E  TSQL+R+ELDSLGI Y+WPVA+T
Sbjct  43   LSRELLKSAREPEFFEWMRGVRRRIHQYPELGFQEQATSQLVRSELDSLGIQYTWPVAET  102

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            G+VA+IGSG++P F LRADMDALP+QELVEWE KSKI+GKMHACGHD+HV MLLGAA+LL
Sbjct  103  GIVASIGSGSEPVFALRADMDALPLQELVEWEFKSKIDGKMHACGHDSHVAMLLGAAKLL  162

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKE-GALDDFQSMFGMHVWPGMPVGTI  650
             N+K+ LKGT+KLVFQP EEG  GAYHM++  GALDD   +F +HV P  P G I
Sbjct  163  HNKKDELKGTIKLVFQPGEEGYAGAYHMLQHPGALDDLDGIFFIHVLPSYPTGVI  217



>ref|XP_011046909.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Populus euphratica]
Length=441

 Score =   267 bits (683),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 159/203 (78%), Gaps = 4/203 (2%)
 Frame = +3

Query  45   WFALIVAISSPWHCCSLQTRLGSETVSQ-LTRDLLDSARDPEFFDWLKRVRRTLHEYPEL  221
            WF L V      +  SL  + G E   Q LTR+LL +AR+P+FF+W++ +RR +HEYPEL
Sbjct  6    WFLLSVLF---LYQQSLAFQAGQELGLQFLTRELLAAAREPDFFEWVRGIRRRIHEYPEL  62

Query  222  GFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEW  401
            GFEE+RTS++IR+ELD LGI Y WPVAKTGVVA +GSG +P F LRADMDALP+QE VEW
Sbjct  63   GFEEYRTSEIIRSELDLLGIDYKWPVAKTGVVATVGSGQKPVFALRADMDALPLQEEVEW  122

Query  402  EHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKE  581
            EHKSKI+G MHACGHD+HV MLLGAA+LLQ ++E+LKGTVKLVFQP EEG  GAYHM+++
Sbjct  123  EHKSKIDGMMHACGHDSHVAMLLGAAKLLQAKRETLKGTVKLVFQPGEEGYAGAYHMLQD  182

Query  582  GALDDFQSMFGMHVWPGMPVGTI  650
            G LDD +++  +HV P +  G I
Sbjct  183  GCLDDVEAILSIHVIPSVRTGAI  205



>emb|CBI30348.3| unnamed protein product [Vitis vinifera]
Length=814

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 164/209 (78%), Gaps = 2/209 (1%)
 Frame = +3

Query  24   SASFRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTL  203
            +A +  V  + +   +S W     QTR G E + +L R+LL+SAR+ +  +W++ VRR++
Sbjct  365  AAFYAAVAISYLDDHASTW-AVETQTRTGWE-MERLGRELLESAREADLLEWIRGVRRSI  422

Query  204  HEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPI  383
            HEYPELGFEE+RTSQLIR+EL+SLGI Y WPVAKTGVVA IGSG QP F LRADMDALP+
Sbjct  423  HEYPELGFEEYRTSQLIRDELNSLGIRYEWPVAKTGVVATIGSGAQPIFALRADMDALPL  482

Query  384  QELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGA  563
            QELVEWEH+SKI+GKMHACGHD HV MLLGAARLLQ ++E LKGTVKLVFQP EEG  GA
Sbjct  483  QELVEWEHRSKIDGKMHACGHDLHVAMLLGAARLLQGKREILKGTVKLVFQPGEEGYAGA  542

Query  564  YHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            YHM++ GALD+  ++FG+HV P +  G I
Sbjct  543  YHMLQHGALDNINAIFGLHVMPSILTGMI  571


 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  180  LKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLR  359
            ++ VRR +H+YPELGFEEH+TS+LIR EL+SLGIGY WPVAKTGVVA+IGSG+QP F LR
Sbjct  1    MRGVRRKIHQYPELGFEEHKTSELIRAELNSLGIGYKWPVAKTGVVASIGSGDQPTFALR  60

Query  360  ADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQP  539
            ADMDALP+QELVEWE+KSKI GKMHACGHD+HV MLLGAA+LLQ ++  LKGTVKLVFQP
Sbjct  61   ADMDALPLQELVEWEYKSKIEGKMHACGHDSHVAMLLGAAKLLQAKRGMLKGTVKLVFQP  120

Query  540  AEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             EEG  GAYHM+KEGAL+D + M G+HV P +P G I
Sbjct  121  GEEGYAGAYHMLKEGALEDVKGMLGLHVIPTVPTGGI  157



>ref|XP_008243487.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Prunus mume]
Length=435

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = +3

Query  39   CVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPE  218
            C++ + I+  S        ++ L S+ +  LTR LL SA++ EFF+W++ VRR +H+YPE
Sbjct  7    CLFLSTILGHSRAVEPS--ESELPSQELEFLTRGLLGSAKEAEFFEWMRGVRRRIHQYPE  64

Query  219  LGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVE  398
            LGFEEHRTSQLIR+ELDSLGI Y+WPVAKTGVVA+IGSG++P F LRADMDALP+QE VE
Sbjct  65   LGFEEHRTSQLIRSELDSLGIEYAWPVAKTGVVASIGSGSRPVFALRADMDALPLQEQVE  124

Query  399  WEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIK  578
            WE KSKI+GKMHACGHD+HV MLLGAA+LLQ++++ LKGTVKL+FQP EEG  GA+HM++
Sbjct  125  WEFKSKIDGKMHACGHDSHVAMLLGAAKLLQSKRDILKGTVKLIFQPGEEGYAGAHHMLQ  184

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
             G L+D  + F +HV P +  G I
Sbjct  185  HGVLNDVDAFFFIHVTPSLRTGVI  208



>ref|XP_007027877.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
 gb|EOY08379.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
Length=432

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 158/202 (78%), Gaps = 1/202 (0%)
 Frame = +3

Query  45   WFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELG  224
            +F+  V  +  +   +L+TR GSE        L  SAR PEFF+W++ +RR +HE+PELG
Sbjct  6    FFSCFVVSTIIFQAMALETRPGSELELLSQELLE-SARQPEFFEWMRGIRRRIHEHPELG  64

Query  225  FEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWE  404
            FEEH+T++LIRNELDSLGI Y WPVAKTGVV +IGSG  P FGLRADMDALP+QELVEW+
Sbjct  65   FEEHKTNELIRNELDSLGISYKWPVAKTGVVGSIGSGANPVFGLRADMDALPLQELVEWK  124

Query  405  HKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEG  584
            HKSK++GKMHACGHD+HV MLLGAA+LLQ+R++ LKGTVKLVFQP EEG  GAY+M+++ 
Sbjct  125  HKSKVDGKMHACGHDSHVAMLLGAAKLLQSRRDLLKGTVKLVFQPGEEGYSGAYYMLQDE  184

Query  585  ALDDFQSMFGMHVWPGMPVGTI  650
             LDD  ++  +HV P +P G I
Sbjct  185  VLDDIDAILSIHVLPSVPTGAI  206



>ref|XP_010463718.1| PREDICTED: IAA-amino acid hydrolase ILR1 isoform X2 [Camelina 
sativa]
Length=406

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 156/206 (76%), Gaps = 6/206 (3%)
 Frame = +3

Query  33   FRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEY  212
            +  V F  I+ +SS     S     G E+   L R +L+SA+DPEFF+W++ +RRT+HE 
Sbjct  7    YSVVTFFFILLLSS---ARSYDYGSGLES---LARGMLESAKDPEFFEWMRGIRRTIHEN  60

Query  213  PELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQEL  392
            PE GF+E +TSQL+R+ELDSLG+ Y WPVAKTGVVA IGSG++P FGLRADMDALP+QEL
Sbjct  61   PETGFQEFKTSQLVRDELDSLGVKYKWPVAKTGVVAWIGSGSKPVFGLRADMDALPLQEL  120

Query  393  VEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHM  572
            VEWE KSK++GKMHACGHD HV MLLGAARLLQ  K  +KGTVKLVFQP EEG GGAY M
Sbjct  121  VEWESKSKVDGKMHACGHDTHVAMLLGAARLLQTSKHLIKGTVKLVFQPGEEGYGGAYEM  180

Query  573  IKEGALDDFQSMFGMHVWPGMPVGTI  650
            +K+  LDD   +  +HV+P +P G I
Sbjct  181  LKDEILDDLDGILSVHVFPSIPSGGI  206



>ref|XP_010463717.1| PREDICTED: IAA-amino acid hydrolase ILR1 isoform X1 [Camelina 
sativa]
Length=440

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 156/206 (76%), Gaps = 6/206 (3%)
 Frame = +3

Query  33   FRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEY  212
            +  V F  I+ +SS     S     G E+   L R +L+SA+DPEFF+W++ +RRT+HE 
Sbjct  7    YSVVTFFFILLLSS---ARSYDYGSGLES---LARGMLESAKDPEFFEWMRGIRRTIHEN  60

Query  213  PELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQEL  392
            PE GF+E +TSQL+R+ELDSLG+ Y WPVAKTGVVA IGSG++P FGLRADMDALP+QEL
Sbjct  61   PETGFQEFKTSQLVRDELDSLGVKYKWPVAKTGVVAWIGSGSKPVFGLRADMDALPLQEL  120

Query  393  VEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHM  572
            VEWE KSK++GKMHACGHD HV MLLGAARLLQ  K  +KGTVKLVFQP EEG GGAY M
Sbjct  121  VEWESKSKVDGKMHACGHDTHVAMLLGAARLLQTSKHLIKGTVKLVFQPGEEGYGGAYEM  180

Query  573  IKEGALDDFQSMFGMHVWPGMPVGTI  650
            +K+  LDD   +  +HV+P +P G I
Sbjct  181  LKDEILDDLDGILSVHVFPSIPSGGI  206



>gb|EPS72108.1| hypothetical protein M569_02647 [Genlisea aurea]
Length=893

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            S    +L R LL+SA D EFF WL+ VRR +HE+PELGFEEH+TS+ IRNEL+S+GI Y 
Sbjct  480  SPIADELARQLLESASDAEFFTWLRTVRRRIHEHPELGFEEHQTSRFIRNELESIGIEYQ  539

Query  291  WPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLL  470
            WP+A+TG+VAA+GSG+QPWFGLRADMDALPIQELV+WEHKSK++GKMHACGHDAHVTMLL
Sbjct  540  WPLAQTGIVAAVGSGDQPWFGLRADMDALPIQELVDWEHKSKVDGKMHACGHDAHVTMLL  599

Query  471  GAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GAA+LLQ  ++  KG+VKL+FQPAEEG  GA HMI +GALD  +++FG+HV P   VG+I
Sbjct  600  GAAKLLQRNRDKFKGSVKLLFQPAEEGKCGASHMIADGALDGVRAIFGLHVDPLSQVGSI  659



>ref|XP_010485617.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Camelina sativa]
Length=440

 Score =   263 bits (671),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  L R +L+SA+DPEFF W++ +RR++HE+PE GF+E +TSQL+R+ELDSLG+ Y WPV
Sbjct  30   LESLARGMLESAKDPEFFQWMRGIRRSIHEHPETGFQEFKTSQLVRDELDSLGVKYKWPV  89

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA IGSG++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV MLLGAA
Sbjct  90   AKTGVVAWIGSGSKPIFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAA  149

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            RLL +RK  +KGTVKLVFQP EEG GGAY M+K+  LDD   +  +HV+P +P G I
Sbjct  150  RLLHSRKHLIKGTVKLVFQPGEEGYGGAYEMLKDEILDDLDGILSVHVFPSIPSGGI  206



>ref|XP_011046911.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Populus euphratica]
Length=440

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 153/188 (81%), Gaps = 1/188 (1%)
 Frame = +3

Query  90   SLQTRLGSETVSQ-LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNEL  266
            SL  + G E   Q LT +LL +AR+ +FF+W++ +RR +HEYPELGFEE+RTS++IR+EL
Sbjct  17   SLAFQTGQELGLQFLTHELLAAARESDFFEWVRGIRRRIHEYPELGFEEYRTSEIIRSEL  76

Query  267  DSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGH  446
            + LGI Y WPVAKTGVVA IGSG +P FGLRADMDALP+QE VEWEHKSKI+G MHACGH
Sbjct  77   ELLGIHYRWPVAKTGVVATIGSGQKPVFGLRADMDALPMQEEVEWEHKSKIDGMMHACGH  136

Query  447  DAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVW  626
            D+HV MLLGAA+LLQ ++++LKGTVKLVFQP EEG  GAYHM+++G LDD  ++  +HV 
Sbjct  137  DSHVAMLLGAAKLLQAKRDTLKGTVKLVFQPGEEGFCGAYHMLQDGCLDDIDAILSIHVI  196

Query  627  PGMPVGTI  650
            P +P G I
Sbjct  197  PSVPTGAI  204



>gb|AFW67044.1| hypothetical protein ZEAMMB73_649011 [Zea mays]
Length=271

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            L R+LLD+AR+PEF +W + VRR +H++PEL F+EHRTS L+R ELD++G+ Y+WPVA+T
Sbjct  7    LARELLDAAREPEFAEWQRGVRRRIHQHPELAFQEHRTSALVRAELDAIGVPYAWPVAQT  66

Query  309  GVVAAI-GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARL  485
            GVVA I G    P F LRADMDALPIQE+VEWE KSK +GKMHACGHDAHV MLLGAARL
Sbjct  67   GVVATITGPAAGPVFALRADMDALPIQEMVEWEFKSKEDGKMHACGHDAHVAMLLGAARL  126

Query  486  LQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LQ+R++ LKGTVKLVFQPAEEG  GAYH++KEG LD+ Q++FG+HV   +PVG +
Sbjct  127  LQSRRDDLKGTVKLVFQPAEEGHAGAYHVLKEGVLDNVQAIFGVHVDTALPVGLV  181



>ref|XP_010558596.1| PREDICTED: IAA-amino acid hydrolase ILR1 [Tarenaya hassleriana]
Length=436

 Score =   260 bits (664),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 149/194 (77%), Gaps = 0/194 (0%)
 Frame = +3

Query  69   SSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQ  248
            S PW+             + L   LL+SA++PEFF+W++ +RR +HE PELGFEE +TSQ
Sbjct  16   SVPWYSTRGGDPGSGSGHASLAGGLLESAKEPEFFEWMRGLRRRIHENPELGFEEFKTSQ  75

Query  249  LIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGK  428
            L+R+ELDSLG+ Y WPVAKTGVVA IGSG++P FGLRADMDALP+QELVEW  KSKI+GK
Sbjct  76   LVRDELDSLGVKYKWPVAKTGVVAWIGSGSKPVFGLRADMDALPLQELVEWGSKSKIDGK  135

Query  429  MHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSM  608
            MHACGHD HV MLLGAA+LLQ+R+  LKGTVKLVFQP EEG  GAYHM+++G LDD   +
Sbjct  136  MHACGHDTHVAMLLGAAKLLQSRRHQLKGTVKLVFQPGEEGYAGAYHMLQDGILDDLDGI  195

Query  609  FGMHVWPGMPVGTI  650
              +HV P +P G I
Sbjct  196  LSIHVLPTLPSGGI  209



>ref|XP_006297680.1| hypothetical protein CARUB_v10013712mg [Capsella rubella]
 gb|EOA30578.1| hypothetical protein CARUB_v10013712mg [Capsella rubella]
Length=443

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  L R +L+SA+DPEFF+W++ +RR +HE+PE GF+E  TSQL+R+ELDSLG+ Y WPV
Sbjct  33   LESLARGMLESAKDPEFFEWMRGIRRRIHEHPETGFQEFNTSQLVRDELDSLGVMYKWPV  92

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA IGSG++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV MLLGAA
Sbjct  93   AKTGVVAWIGSGSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAA  152

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ RK  +KGTVKLVFQP EEG  GAY M+K+  LDD   +  +HV+P +P G I
Sbjct  153  KLLQTRKHLIKGTVKLVFQPGEEGYAGAYEMLKDEILDDLDGILSVHVFPSIPSGGI  209



>ref|XP_009373051.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Pyrus x bretschneideri]
Length=434

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +3

Query  150  SARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIG  329
            SA++ EFF+W+  VRR +H+YPE GFEEHRTSQLIR ELDSLGI Y+WPVAKTGVVA++G
Sbjct  38   SAKEAEFFEWMTGVRRRIHQYPETGFEEHRTSQLIRTELDSLGIEYTWPVAKTGVVASVG  97

Query  330  SGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESL  509
            SG++P F LRADMDALP+QE VEWE KSKI+GKMHACGHD+HV MLLGAA+LL ++++ L
Sbjct  98   SGSKPVFALRADMDALPLQEQVEWEFKSKIDGKMHACGHDSHVAMLLGAAKLLHSKRDIL  157

Query  510  KGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            KGTVKLVFQP EEG  GAYHM+++G L+D  ++F +HV P +P G I
Sbjct  158  KGTVKLVFQPGEEGYAGAYHMLQDGILNDIDAIFFIHVMPSLPTGVI  204



>ref|NP_001140633.1| hypothetical protein [Zea mays]
 gb|ACF84219.1| unknown [Zea mays]
 gb|AFW67045.1| hypothetical protein ZEAMMB73_649011 [Zea mays]
Length=408

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            L R+LLD+AR+PEF +W + VRR +H++PEL F+EHRTS L+R ELD++G+ Y+WPVA+T
Sbjct  7    LARELLDAAREPEFAEWQRGVRRRIHQHPELAFQEHRTSALVRAELDAIGVPYAWPVAQT  66

Query  309  GVVAAI-GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARL  485
            GVVA I G    P F LRADMDALPIQE+VEWE KSK +GKMHACGHDAHV MLLGAARL
Sbjct  67   GVVATITGPAAGPVFALRADMDALPIQEMVEWEFKSKEDGKMHACGHDAHVAMLLGAARL  126

Query  486  LQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LQ+R++ LKGTVKLVFQPAEEG  GAYH++KEG LD+ Q++FG+HV   +PVG +
Sbjct  127  LQSRRDDLKGTVKLVFQPAEEGHAGAYHVLKEGVLDNVQAIFGVHVDTALPVGLV  181



>ref|XP_002882255.1| IAA amidohydrolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58514.1| IAA amidohydrolase [Arabidopsis lyrata subsp. lyrata]
Length=442

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  L R +LDSA+DPEFF+W++ +RR +HE PE GF+E +TSQL+R+EL SLG+ Y +PV
Sbjct  32   LESLARGMLDSAKDPEFFEWMRGIRRKIHENPETGFQEFKTSQLVRDELGSLGVKYKYPV  91

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA IGSG+ P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV MLLGAA
Sbjct  92   AKTGVVAWIGSGSMPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAA  151

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQNRK  +KGTVKLVFQP EEG  GAY M+K+  LDD   +  +HV+P +P G I
Sbjct  152  KLLQNRKHLIKGTVKLVFQPGEEGYAGAYEMLKDEILDDLDGILSVHVFPSIPSGGI  208



>ref|XP_004305642.1| PREDICTED: IAA-amino acid hydrolase ILR1-like, partial [Fragaria 
vesca subsp. vesca]
Length=434

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LT +L   AR+PEFF W+  +RR +H+YPELGF+EH+TS+LIR+ELD LG+ Y WPVAKT
Sbjct  17   LTSELKKLAREPEFFKWMIGLRRRIHQYPELGFQEHKTSELIRSELDLLGVKYKWPVAKT  76

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            GVV +IG+G++P F LRADM ALP+QELVEWE KSKI+GKMHACGHDAHV MLLGAA+LL
Sbjct  77   GVVVSIGTGSKPVFALRADMGALPLQELVEWEFKSKIDGKMHACGHDAHVAMLLGAAKLL  136

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            Q +++ LKGTVKLVFQP EEG  GAYHM+++G LDD   +  +HV+P +P GTI
Sbjct  137  QEKRDILKGTVKLVFQPGEEGYAGAYHMLQDGVLDDIDGICPLHVYPHIPTGTI  190



>gb|AFW67046.1| hypothetical protein ZEAMMB73_649011 [Zea mays]
Length=420

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = +3

Query  135  RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGV  314
            R+LLD+AR+PEF +W + VRR +H++PEL F+EHRTS L+R ELD++G+ Y+WPVA+TGV
Sbjct  21   RELLDAAREPEFAEWQRGVRRRIHQHPELAFQEHRTSALVRAELDAIGVPYAWPVAQTGV  80

Query  315  VAAI-GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQ  491
            VA I G    P F LRADMDALPIQE+VEWE KSK +GKMHACGHDAHV MLLGAARLLQ
Sbjct  81   VATITGPAAGPVFALRADMDALPIQEMVEWEFKSKEDGKMHACGHDAHVAMLLGAARLLQ  140

Query  492  NRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +R++ LKGTVKLVFQPAEEG  GAYH++KEG LD+ Q++FG+HV   +PVG +
Sbjct  141  SRRDDLKGTVKLVFQPAEEGHAGAYHVLKEGVLDNVQAIFGVHVDTALPVGLV  193



>ref|XP_010502342.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Camelina sativa]
Length=451

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  L R +L+SA+DPEFF+W++ +RR +HE+PE GF+E +TSQL+R+ELDSLG+ Y WPV
Sbjct  30   LESLARGMLESAKDPEFFEWMRGIRRRIHEHPETGFQEFKTSQLVRDELDSLGVEYKWPV  89

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA IGS ++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV MLLGAA
Sbjct  90   AKTGVVAWIGSDSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAA  149

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LL + K  +KGTVKLVFQP EEG GGAY M+K+  LDD   +  +HV+P +P G I
Sbjct  150  KLLHSSKHLIKGTVKLVFQPGEEGYGGAYEMLKDEILDDLDGILSVHVFPSIPSGGI  206



>tpg|DAA60178.1| TPA: hypothetical protein ZEAMMB73_012586 [Zea mays]
Length=345

 Score =   251 bits (642),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = +3

Query  126  QLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAK  305
             L   LL +AR P F  WL+ +RR +HE PEL F+EHRTS+L+R+ELD++G+ Y+WPVA+
Sbjct  31   SLGDSLLGAARAPGFAAWLRGLRRRIHERPELAFQEHRTSELVRDELDAIGVPYAWPVAQ  90

Query  306  TGVVAAIGSGNQ-PWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAAR  482
            TGVVA I  G+  P   LRADMDALP+QELV+WEHKSK +GKMHACGHDAH TMLLGAA+
Sbjct  91   TGVVATIAGGSDGPVVALRADMDALPLQELVDWEHKSKESGKMHACGHDAHTTMLLGAAK  150

Query  483  LLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LL  RK+ LKGTVKLVFQP EEG GGAYH+++EG LDD  ++FG+HV PG+PVGT+
Sbjct  151  LLHARKDDLKGTVKLVFQPGEEGYGGAYHVLREGVLDDVSAIFGLHVDPGLPVGTV  206



>gb|KFK37687.1| hypothetical protein AALP_AA3G015600 [Arabis alpina]
Length=404

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  141  LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVA  320
            +LDSA++PEFF W++ +RR +HE PE GF+E +TSQL+R+ELDSLG+ Y WPVAKTGVVA
Sbjct  1    MLDSAKEPEFFQWMRGIRRKIHENPETGFQEFKTSQLVRDELDSLGVKYKWPVAKTGVVA  60

Query  321  AIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRK  500
             IGSG++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV MLLGAA+LLQ+R+
Sbjct  61   WIGSGSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAAKLLQSRQ  120

Query  501  ESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              +KGTVKLVFQP EEG  GAY M+K+  LDD   +  +HV P +P G I
Sbjct  121  HLIKGTVKLVFQPGEEGYAGAYEMLKDEILDDLDGILSVHVLPSIPSGGI  170



>gb|EMT05755.1| IAA-amino acid hydrolase ILR1-like protein 8 [Aegilops tauschii]
Length=446

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 148/182 (81%), Gaps = 2/182 (1%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            S T ++L  DLL +AR P F  WL+ +RR +H+ PEL F+EHRTS+L+R ELD+LGI Y 
Sbjct  24   SATTTRLGADLLGAARAPPFESWLRGLRRRIHQRPELAFQEHRTSELVRAELDALGIPYV  83

Query  291  WPVAKTGVVAAI--GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTM  464
            WPVA+TGVVA I  G G+ P   LRADMDALP+QELV+WE+KS  NGKMHACGHDAHVTM
Sbjct  84   WPVAQTGVVATIAGGGGSGPVVALRADMDALPLQELVDWEYKSLENGKMHACGHDAHVTM  143

Query  465  LLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVG  644
            LLGAA+LLQ+RKE LKGTVKLVFQPAEEG  GAY++++EG L+D  ++FG+HV+P +PVG
Sbjct  144  LLGAAKLLQSRKEDLKGTVKLVFQPAEEGYAGAYYILEEGVLNDVSAIFGLHVFPHLPVG  203

Query  645  TI  650
             +
Sbjct  204  VV  205



>ref|XP_009414583.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=434

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            +LL+SAR+PEFFDWL  +RR +H++PEL FEE++TS+LIR+ELD+LGI Y+WP++ TG+V
Sbjct  38   ELLESAREPEFFDWLTAIRRRIHQHPELAFEEYKTSELIRSELDALGIEYAWPISGTGIV  97

Query  318  AAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNR  497
            A++GSG  P F LRADMDALP+QELV+WE+KSK++GKMHACGHDAHVTMLLGAA+LLQ+R
Sbjct  98   ASVGSGGGPVFSLRADMDALPLQELVDWEYKSKVSGKMHACGHDAHVTMLLGAAKLLQHR  157

Query  498  KESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            K +LKGTVKLVFQPAEE   GAYHM++ GA+D  +++F +HV   +  G I
Sbjct  158  KNTLKGTVKLVFQPAEERGAGAYHMLQSGAIDGVEAIFTLHVDSRLTTGAI  208



>gb|AAK97436.2|AF385367_1 IAA amidohydrolase [Arabidopsis suecica]
 gb|AAL77061.1|AF468012_1 IAA-amino acid hydrolase [Arabidopsis suecica]
Length=442

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  L R +L SA+DPEFF+W++ +RR +HE PE GF+E +TSQL+R+ELDSLG+ Y +PV
Sbjct  32   LESLARGMLHSAKDPEFFEWMRGIRRKIHENPETGFQEFKTSQLVRDELDSLGVKYKYPV  91

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA IGSG++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV MLLGAA
Sbjct  92   AKTGVVAWIGSGSKPVFGLRADMDALPLQELVEWESKSKVHGKMHACGHDTHVAMLLGAA  151

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ  K  +KGTVKLVFQP EEG  GAY M+K+  LDD   +  +HV+P +P G I
Sbjct  152  KLLQTTKHLIKGTVKLVFQPGEEGYAGAYEMLKDEILDDLDGILSVHVFPSIPSGGI  208



>dbj|BAK07626.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 151/205 (74%), Gaps = 3/205 (1%)
 Frame = +3

Query  45   WFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELG  224
            WF+  +          L T   + T ++L  DLL +AR P F  WL+ +RR +H+ PEL 
Sbjct  3    WFSTHLVALFLLFSSHLVTPSSAATTTRLGADLLGAARAPPFHSWLRGLRRRIHQRPELA  62

Query  225  FEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQ---PWFGLRADMDALPIQELV  395
            F+EHRTS+L+R ELD+LGI Y WPVA TGVVA I  G     P   LRADMDALP+QELV
Sbjct  63   FQEHRTSELVRAELDALGIPYVWPVAHTGVVATISGGGGGSGPVVALRADMDALPLQELV  122

Query  396  EWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMI  575
            EWE+KS  NGKMHACGHDAHVTMLLGAA+LLQ+RKE+LKGTVKLVFQPAEEG  GAY+M+
Sbjct  123  EWEYKSLENGKMHACGHDAHVTMLLGAAKLLQSRKENLKGTVKLVFQPAEEGYAGAYYML  182

Query  576  KEGALDDFQSMFGMHVWPGMPVGTI  650
            +EG LDD  ++FG+HV+P  PVG +
Sbjct  183  EEGVLDDVSAIFGLHVFPHFPVGVV  207



>ref|XP_009349385.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Pyrus x bretschneideri]
 ref|XP_009349679.1| PREDICTED: IAA-amino acid hydrolase ILR1-like [Pyrus x bretschneideri]
Length=434

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  150  SARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIG  329
            SA++ EFF W+  VRR +H+YPE GF+EHRTSQLIR EL+SLGI Y+WPVAKTGVVA++G
Sbjct  38   SAKEAEFFAWMTGVRRRIHQYPETGFQEHRTSQLIRTELESLGIEYTWPVAKTGVVASVG  97

Query  330  SGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESL  509
            SG++P F LRADMDALP+QE VEWE KSKI+GKMHACGHD+HV MLLGAA+LL ++++ L
Sbjct  98   SGSKPVFALRADMDALPLQEQVEWEFKSKIDGKMHACGHDSHVAMLLGAAKLLHSKRDIL  157

Query  510  KGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            KGTVKLVFQP EEG  GAYHM++ G L+D  ++F +HV P +P G I
Sbjct  158  KGTVKLVFQPGEEGYAGAYHMLQHGILNDIDAIFFIHVVPSLPTGVI  204



>ref|XP_008351526.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
[Malus domestica]
Length=436

 Score =   252 bits (644),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 152/199 (76%), Gaps = 10/199 (5%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLD--------SARDPEFFDWLKRVRRTLHEYPELGFEEHR  239
            C  +QT LG    S+ +   L+        SA++ EFF+W++ VRR +H+YPE+GFEEHR
Sbjct  8    CLLMQTILGQSWASETSETELELLTRELLASAKEAEFFEWMRGVRRRIHQYPEIGFEEHR  67

Query  240  TSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKI  419
            TSQLIR ELD+LGI Y+WPVAKTGVVA+IGSG++P F LRADMDALP+QE VEWE KSKI
Sbjct  68   TSQLIRTELDTLGIEYTWPVAKTGVVASIGSGSKPVFALRADMDALPLQEQVEWEFKSKI  127

Query  420  NGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDF  599
             GKMHACGHD+HV MLLGA +LLQ++++ LKGTVKLVFQP EE   GAYHM++ G L+D 
Sbjct  128  EGKMHACGHDSHVAMLLGAVKLLQSKRDILKGTVKLVFQPGEEVYAGAYHMLQHGILNDI  187

Query  600  QSMFGMHVWPG--MPVGTI  650
             ++F +HV P   +P G I
Sbjct  188  DAIFFIHVMPSLQLPTGVI  206



>ref|NP_001142187.1| hypothetical protein precursor [Zea mays]
 gb|ACF87845.1| unknown [Zea mays]
 tpg|DAA60177.1| TPA: hypothetical protein ZEAMMB73_012586 [Zea mays]
Length=442

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            L   LL +AR P F  WL+ +RR +HE PEL F+EHRTS+L+R+ELD++G+ Y+WPVA+T
Sbjct  32   LGDSLLGAARAPGFAAWLRGLRRRIHERPELAFQEHRTSELVRDELDAIGVPYAWPVAQT  91

Query  309  GVVAAIGSGNQ-PWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARL  485
            GVVA I  G+  P   LRADMDALP+QELV+WEHKSK +GKMHACGHDAH TMLLGAA+L
Sbjct  92   GVVATIAGGSDGPVVALRADMDALPLQELVDWEHKSKESGKMHACGHDAHTTMLLGAAKL  151

Query  486  LQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            L  RK+ LKGTVKLVFQP EEG GGAYH+++EG LDD  ++FG+HV PG+PVGT+
Sbjct  152  LHARKDDLKGTVKLVFQPGEEGYGGAYHVLREGVLDDVSAIFGLHVDPGLPVGTV  206



>ref|XP_003560269.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Brachypodium 
distachyon]
Length=405

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = +3

Query  135  RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGV  314
            +DLLD AR P F  W++ +RR +H++PEL F+EHRTS L+R ELD++GI Y+WPVA+TGV
Sbjct  8    KDLLDEARAPGFAGWVRGLRRRIHQHPELAFQEHRTSALVRAELDAIGIAYAWPVARTGV  67

Query  315  VAAI----GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAAR  482
            VA I    G+G+ P F LRADMDALPIQE+VEWE KS+ +GKMHACGHDAHV MLLGAA+
Sbjct  68   VATIAGRGGAGSGPVFALRADMDALPIQEMVEWEFKSQEDGKMHACGHDAHVAMLLGAAK  127

Query  483  LLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LLQ+RK+ LKGTVKLVFQPAEEG  G YH+++EG LDD  ++F +H+ P +PVGT+
Sbjct  128  LLQSRKDDLKGTVKLVFQPAEEGHAGGYHVLQEGVLDDVDAIFAVHIDPCLPVGTV  183



>ref|XP_003557336.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 7 [Brachypodium 
distachyon]
Length=425

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = +3

Query  135  RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGV  314
            RDLL +AR P F  WL+ VRR +H++PEL FEEHRTS+L+R ELD++G+ Y+WPVAKTGV
Sbjct  26   RDLLSAARAPGFAAWLRGVRRRIHQHPELAFEEHRTSELVRAELDAIGVSYAWPVAKTGV  85

Query  315  VAAI-GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQ  491
            VA I G    P   LRADMDALP+QELVEWE+KS+ +GKMHACGHDAH TMLLGAA+LLQ
Sbjct  86   VATIAGPRAGPVVALRADMDALPLQELVEWEYKSQESGKMHACGHDAHTTMLLGAAKLLQ  145

Query  492  NRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +RKE +KGTVKLVFQPAEEG  GA+H+++EG LDD  ++FG+HV P + VG +
Sbjct  146  SRKEDIKGTVKLVFQPAEEGFAGAHHVLEEGVLDDVSAIFGLHVDPSLQVGVV  198



>gb|KDO37852.1| hypothetical protein CISIN_1g014449mg [Citrus sinensis]
Length=260

 Score =   245 bits (625),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LT  ++ SA+  +  DWL  VRR +HE PEL FEEH TS LIR ELD LGI Y++PVAKT
Sbjct  25   LTNQVMISAQQDK--DWLVSVRRQIHENPELLFEEHNTSALIRRELDKLGIPYAYPVAKT  82

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            G+VA IGSG++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHD H TMLLGAA+L+
Sbjct  83   GIVAQIGSGSRPVVVLRADMDALPLQELVEWEHKSKIDGKMHACGHDVHTTMLLGAAKLI  142

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              RK+ LKGTV+++FQPAEEG  GA+HMIKEGAL D +++FGMH+  G+P G+I
Sbjct  143  HQRKDKLKGTVRILFQPAEEGGAGAFHMIKEGALGDSEAIFGMHIDVGIPTGSI  196



>ref|XP_006441276.1| hypothetical protein CICLE_v10020281mg [Citrus clementina]
 gb|ESR54516.1| hypothetical protein CICLE_v10020281mg [Citrus clementina]
Length=302

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LT  ++ SA+  +  DWL  VRR +HE PEL FEEH TS LIR ELD LGI Y++PVAKT
Sbjct  25   LTNQVMISAQQDK--DWLVSVRRQIHENPELQFEEHNTSALIRRELDKLGIPYAYPVAKT  82

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            G+VA IGSG++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHD H TMLLGAA+L+
Sbjct  83   GIVAQIGSGSRPVVVLRADMDALPLQELVEWEHKSKIDGKMHACGHDVHTTMLLGAAKLI  142

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              RK+ LKGTV+++FQPAEEG  GA+HMIKEGAL D +++FGMH+  G+P G+I
Sbjct  143  HQRKDKLKGTVRILFQPAEEGGAGAFHMIKEGALGDSEAIFGMHIDVGIPTGSI  196



>ref|NP_186937.1| IAA-amino acid hydrolase ILR1 [Arabidopsis thaliana]
 sp|P54968.2|ILR1_ARATH RecName: Full=IAA-amino acid hydrolase ILR1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF26972.1|AC018363_17 IAA-amino acid hydrolase (ILR1) [Arabidopsis thaliana]
 gb|AAK96831.1| IAA-amino acid hydrolase (ILR1) [Arabidopsis thaliana]
 gb|AAM10061.1| IAA-amino acid hydrolase (ILR1) [Arabidopsis thaliana]
 gb|AEE73872.1| IAA-amino acid hydrolase ILR1 [Arabidopsis thaliana]
Length=442

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  L R +L SA+DPEFF+W++ +RR +HE PE GF+E +TSQL+R+ELDSLG+ Y +PV
Sbjct  32   LESLARGMLHSAKDPEFFEWMRGIRRKIHENPETGFQEFKTSQLVRDELDSLGVKYKYPV  91

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA IGS ++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV MLLGAA
Sbjct  92   AKTGVVAWIGSCSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAA  151

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ  K  +KGTVKLVFQP EEG  GAY M+K+  LDD   +  +HV+P +P G I
Sbjct  152  KLLQTTKHLIKGTVKLVFQPGEEGYAGAYEMLKDEILDDLDGILSVHVFPSIPSGGI  208



>gb|AAM63645.1| IAA-amino acid hydrolase (ILR1) [Arabidopsis thaliana]
Length=442

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  L R +L SA+DPEFF+W++ +RR +HE PE GF+E +TSQL+R+ELDSLG+ Y +PV
Sbjct  32   LESLARGMLHSAKDPEFFEWMRGIRRKIHENPETGFQEFKTSQLVRDELDSLGVKYKYPV  91

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA IGS ++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV MLLGAA
Sbjct  92   AKTGVVAWIGSCSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAA  151

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ  K  +KGTVKLVFQP EEG  GAY M+K+  LDD   +  +HV+P +P G I
Sbjct  152  KLLQTTKHLIKGTVKLVFQPGEEGYAGAYEMLKDEILDDLDGILSVHVFPSIPSGGI  208



>gb|KDO37853.1| hypothetical protein CISIN_1g014449mg [Citrus sinensis]
Length=276

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LT  ++ SA+  +  DWL  VRR +HE PEL FEEH TS LIR ELD LGI Y++PVAKT
Sbjct  25   LTNQVMISAQQDK--DWLVSVRRQIHENPELLFEEHNTSALIRRELDKLGIPYAYPVAKT  82

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            G+VA IGSG++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHD H TMLLGAA+L+
Sbjct  83   GIVAQIGSGSRPVVVLRADMDALPLQELVEWEHKSKIDGKMHACGHDVHTTMLLGAAKLI  142

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              RK+ LKGTV+++FQPAEEG  GA+HMIKEGAL D +++FGMH+  G+P G+I
Sbjct  143  HQRKDKLKGTVRILFQPAEEGGAGAFHMIKEGALGDSEAIFGMHIDVGIPTGSI  196



>ref|XP_004981136.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3-like [Setaria 
italica]
Length=418

 Score =   249 bits (636),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 140/179 (78%), Gaps = 5/179 (3%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            L R+LLD+AR P F +W  RVRR +H++PEL FEEHRTS+L+R EL ++G+ Y WPVA+T
Sbjct  7    LARELLDAARAPGFVEWQLRVRRQIHQHPELAFEEHRTSELVRAELRAVGVPYIWPVART  66

Query  309  GVVAAIGSGNQPW-----FGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLG  473
            GVVA I            F LRADMDALPIQE+VEWE KSK +GKMHACGHDAHV MLLG
Sbjct  67   GVVATIAGPAAAAGEGPVFALRADMDALPIQEMVEWEFKSKEDGKMHACGHDAHVAMLLG  126

Query  474  AARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            AARLLQ+RK  LKGTVKLVFQPAEE   GAYH++KEG LDD Q++FG+HV  GM VGT+
Sbjct  127  AARLLQSRKNDLKGTVKLVFQPAEESHAGAYHVLKEGVLDDVQAIFGLHVDTGMTVGTV  185



>gb|KDO37851.1| hypothetical protein CISIN_1g014449mg [Citrus sinensis]
Length=302

 Score =   245 bits (626),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LT  ++ SA+  +  DWL  VRR +HE PEL FEEH TS LIR ELD LGI Y++PVAKT
Sbjct  25   LTNQVMISAQQDK--DWLVSVRRQIHENPELLFEEHNTSALIRRELDKLGIPYAYPVAKT  82

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            G+VA IGSG++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHD H TMLLGAA+L+
Sbjct  83   GIVAQIGSGSRPVVVLRADMDALPLQELVEWEHKSKIDGKMHACGHDVHTTMLLGAAKLI  142

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              RK+ LKGTV+++FQPAEEG  GA+HMIKEGAL D +++FGMH+  G+P G+I
Sbjct  143  HQRKDKLKGTVRILFQPAEEGGAGAFHMIKEGALGDSEAIFGMHIDVGIPTGSI  196



>gb|AAB60293.1| ILR1 [Arabidopsis thaliana]
Length=442

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  L R +L SA+DPEFF+W++ +RR +HE PE GF+E +TSQL+R+ELDSLG+ Y +PV
Sbjct  32   LESLARGMLHSAKDPEFFEWMRGIRRKIHENPETGFQEFKTSQLVRDELDSLGVKYKYPV  91

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA IGS ++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD +V MLLGAA
Sbjct  92   AKTGVVAWIGSCSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTYVAMLLGAA  151

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ  K  +KGTVKLVFQP EEG  GAY M+K+  LDD   +  +HV+P +P G I
Sbjct  152  KLLQTTKHLIKGTVKLVFQPGEEGYAGAYEMLKDEILDDLDGILSVHVFPSIPSGGI  208



>ref|XP_007027878.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 gb|EOY08380.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
Length=337

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  180  LKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLR  359
            ++ +RR +HE+PELGFEEH+T++LIRNELDSLGI Y WPVAKTGVV +IGSG  P FGLR
Sbjct  1    MRGIRRRIHEHPELGFEEHKTNELIRNELDSLGISYKWPVAKTGVVGSIGSGANPVFGLR  60

Query  360  ADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQP  539
            ADMDALP+QELVEW+HKSK++GKMHACGHD+HV MLLGAA+LLQ+R++ LKGTVKLVFQP
Sbjct  61   ADMDALPLQELVEWKHKSKVDGKMHACGHDSHVAMLLGAAKLLQSRRDLLKGTVKLVFQP  120

Query  540  AEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             EEG  GAY+M+++  LDD  ++  +HV P +P G I
Sbjct  121  GEEGYSGAYYMLQDEVLDDIDAILSIHVLPSVPTGAI  157



>ref|XP_006441277.1| hypothetical protein CICLE_v10020281mg [Citrus clementina]
 gb|ESR54517.1| hypothetical protein CICLE_v10020281mg [Citrus clementina]
Length=424

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LT  ++ SA+  +  DWL  VRR +HE PEL FEEH TS LIR ELD LGI Y++PVAKT
Sbjct  25   LTNQVMISAQQDK--DWLVSVRRQIHENPELQFEEHNTSALIRRELDKLGIPYAYPVAKT  82

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            G+VA IGSG++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHD H TMLLGAA+L+
Sbjct  83   GIVAQIGSGSRPVVVLRADMDALPLQELVEWEHKSKIDGKMHACGHDVHTTMLLGAAKLI  142

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              RK+ LKGTV+++FQPAEEG  GA+HMIKEGAL D +++FGMH+  G+P G+I
Sbjct  143  HQRKDKLKGTVRILFQPAEEGGAGAFHMIKEGALGDSEAIFGMHIDVGIPTGSI  196



>ref|XP_008462603.1| PREDICTED: IAA-amino acid hydrolase ILR1 [Cucumis melo]
Length=440

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 145/186 (78%), Gaps = 7/186 (4%)
 Frame = +3

Query  108  GSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGY  287
            GSE +  LT+  LD AR+ EF +W+K VRR +HEYPELGFEE++TSQL+R+ELDSLGI Y
Sbjct  34   GSE-LDSLTQSFLDLAREREFMEWIKGVRRRIHEYPELGFEEYKTSQLVRSELDSLGISY  92

Query  288  SWPVAKTGVVAAI-----GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDA  452
             WPVAKTGVVA+I      S + P FGLRADMDALP+QELVEW+ KSK+ GKMHACGHD+
Sbjct  93   RWPVAKTGVVASITGDSVSSSSTPVFGLRADMDALPLQELVEWKFKSKVEGKMHACGHDS  152

Query  453  HVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPG  632
            HV M+LGAARLLQ+ +E LKGTVKLVFQP EE   GAY M+K+ ALD    +F +HV P 
Sbjct  153  HVAMVLGAARLLQSIREKLKGTVKLVFQPGEE-CNGAYQMLKDDALDGIDGIFALHVQPS  211

Query  633  MPVGTI  650
            +P G I
Sbjct  212  LPTGVI  217



>ref|XP_006478084.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3-like [Citrus 
sinensis]
Length=424

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LT  ++ SA+  +  DWL  VRR +HE PEL FEEH TS LIR ELD LGI Y++PVAKT
Sbjct  25   LTNQVMISAQQDK--DWLVSVRRQIHENPELLFEEHNTSALIRRELDKLGIPYAYPVAKT  82

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            G+VA IGSG++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHD H TMLLGAA+LL
Sbjct  83   GIVAQIGSGSRPVVALRADMDALPLQELVEWEHKSKIDGKMHACGHDVHTTMLLGAAKLL  142

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              RK+ L+GTV+++FQPAEEG  GA+HMIKEGAL D +++FGMH+  G+P G+I
Sbjct  143  HQRKDKLEGTVRILFQPAEEGGAGAFHMIKEGALGDSEAIFGMHIDVGIPTGSI  196



>sp|Q851L5.1|ILL3_ORYSJ RecName: Full=IAA-amino acid hydrolase ILR1-like 3; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAO41148.1| putative IAA amidohydrolase [Oryza sativa Japonica Group]
 gb|AAR88567.1| putative amidohydrolase [Oryza sativa Japonica Group]
 gb|ABF99768.1| amidohydrolase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAY92489.1| hypothetical protein OsI_14226 [Oryza sativa Indica Group]
Length=417

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 143/184 (78%), Gaps = 2/184 (1%)
 Frame = +3

Query  105  LGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIG  284
            + +   + L R+LL++AR PEF  WL+ +RR +H++PEL F+EHRTS L+R ELD+LG+ 
Sbjct  1    MSTTAATTLGRELLEAARAPEFAGWLRGLRRRIHQHPELAFQEHRTSALVRAELDALGVA  60

Query  285  YSWPVAKTGVVAAI--GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHV  458
            Y WPVA+TGVVA +   +G  P FGLRADMDALPIQE+VEWE KS  +GKMHACGHD HV
Sbjct  61   YVWPVAQTGVVATVVGAAGPGPVFGLRADMDALPIQEMVEWEFKSLEDGKMHACGHDVHV  120

Query  459  TMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMP  638
             MLLGAA+LLQ+R++   G VKLVFQPAEEG  G Y++++EGA+DD Q +FGMHV  G+P
Sbjct  121  AMLLGAAKLLQSRRDHFNGKVKLVFQPAEEGYAGGYYVLEEGAVDDVQGIFGMHVDAGLP  180

Query  639  VGTI  650
             G +
Sbjct  181  AGVV  184



>gb|EMT31861.1| IAA-amino acid hydrolase ILR1-like protein 8 [Aegilops tauschii]
Length=529

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 148/183 (81%), Gaps = 3/183 (2%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            S T ++L  DLL +AR P F  WL+ +RR +H+ PEL F+EHRTS+L+R ELD+LGI Y 
Sbjct  126  SATTTRLGADLLGAARAPPFESWLRGLRRRIHQRPELAFQEHRTSELVRAELDALGIPYV  185

Query  291  WPVAKTGVVAAI---GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVT  461
            WPVA+TGVVA I   G G+ P   LRADMDALP+QELV+WE+KS  +GKMHACGHDAHVT
Sbjct  186  WPVAQTGVVATIIGGGGGSGPVVALRADMDALPLQELVDWEYKSLESGKMHACGHDAHVT  245

Query  462  MLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPV  641
            MLLGAA+LLQ+RKE LKGTVKLVFQPAEEG  GAY+++KEG LDD  ++FG+HV+P +PV
Sbjct  246  MLLGAAKLLQSRKEDLKGTVKLVFQPAEEGYAGAYYILKEGVLDDVSAIFGLHVFPHLPV  305

Query  642  GTI  650
            G +
Sbjct  306  GVV  308



>ref|XP_002459628.1| hypothetical protein SORBIDRAFT_02g007710 [Sorghum bicolor]
 gb|EER96149.1| hypothetical protein SORBIDRAFT_02g007710 [Sorghum bicolor]
Length=449

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = +3

Query  153  ARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAI--  326
            AR P F +WL+ VRR +HE PEL F+EHRTS+L+R ELD++G+ Y+WPVA+TGVVA I  
Sbjct  54   ARAPGFAEWLRGVRRRIHERPELAFQEHRTSELVRAELDAIGVPYTWPVAQTGVVATIVG  113

Query  327  -GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKE  503
              + + P   LRADMDALP+QELV+WEHKS+ +GKMHACGHDAH TMLLGAAR+LQ+RK 
Sbjct  114  AAAADGPVVALRADMDALPVQELVDWEHKSQESGKMHACGHDAHTTMLLGAARILQDRKN  173

Query  504  SLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             LKGTVKL+FQPAEEG GGAY++++EG LDD  ++FG+HV P +PVG +
Sbjct  174  DLKGTVKLIFQPAEEGQGGAYYVLQEGVLDDVSAIFGLHVDPALPVGVV  222



>ref|XP_004959131.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 8-like [Setaria 
italica]
Length=442

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 143/173 (83%), Gaps = 2/173 (1%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            DLL +ARDP F +W++ +RR +H +PEL F+EHRTS+L+R ELD+LG+ Y+WPVA+TGVV
Sbjct  44   DLLGTARDPGFAEWMRGLRRRIHRHPELAFQEHRTSELVRAELDALGLSYAWPVARTGVV  103

Query  318  AAIGSGNQ--PWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQ  491
            A I  G    P   LRADMDALP+QE+V+WE+KS+ +GKMHACGHDAHVTMLLGAARLLQ
Sbjct  104  ATIAGGGGAGPVVALRADMDALPVQEMVDWEYKSQEDGKMHACGHDAHVTMLLGAARLLQ  163

Query  492  NRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +RK+ LKGT+KLVFQPAEEG  GAY ++KEG L++  ++FG+HV P +PVG +
Sbjct  164  SRKDDLKGTIKLVFQPAEEGYAGAYFVLKEGVLENVSAIFGLHVIPDLPVGVV  216



>gb|KDO37850.1| hypothetical protein CISIN_1g014449mg [Citrus sinensis]
Length=424

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            LT  ++ SA+  +  DWL  VRR +HE PEL FEEH TS LIR ELD LGI Y++PVAKT
Sbjct  25   LTNQVMISAQQDK--DWLVSVRRQIHENPELLFEEHNTSALIRRELDKLGIPYAYPVAKT  82

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            G+VA IGSG++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHD H TMLLGAA+L+
Sbjct  83   GIVAQIGSGSRPVVVLRADMDALPLQELVEWEHKSKIDGKMHACGHDVHTTMLLGAAKLI  142

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              RK+ LKGTV+++FQPAEEG  GA+HMIKEGAL D +++FGMH+  G+P G+I
Sbjct  143  HQRKDKLKGTVRILFQPAEEGGAGAFHMIKEGALGDSEAIFGMHIDVGIPTGSI  196



>ref|NP_001242296.1| uncharacterized protein LOC100789607 precursor [Glycine max]
 gb|ACU21355.1| unknown [Glycine max]
Length=431

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            +++ +QL+ + L+ A+ PE FDW+ ++RR +HE PELG+EE  TS+LIR ELD LGI Y 
Sbjct  26   TDSSNQLSTNFLEIAKKPEVFDWMVKIRRKIHENPELGYEEFETSKLIREELDKLGIPYK  85

Query  291  WPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLL  470
            +PVA TGV+  IG+G  P+  LRADMDALP+QE+VEWEHKSK+ GKMHACGHDAHVTMLL
Sbjct  86   YPVAVTGVIGFIGTGKSPFVALRADMDALPVQEMVEWEHKSKVPGKMHACGHDAHVTMLL  145

Query  471  GAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGT  647
            GAA +L+  ++ ++GTV LVFQPAEEG GGA  +++EGAL++  ++FG+HV P +PVGT
Sbjct  146  GAANILKQHEKEIQGTVVLVFQPAEEGGGGAKKILEEGALENVTAIFGLHVVPLIPVGT  204



>ref|XP_004955916.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 7-like [Setaria 
italica]
Length=457

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            DLL +AR P F  WL+ VRR +HE PEL F+EHRTS+LIR ELD++G+ Y+WPVA+TGVV
Sbjct  45   DLLGTARAPGFAAWLRGVRRRIHERPELAFQEHRTSELIRAELDAIGVPYAWPVAQTGVV  104

Query  318  AAIGSGNQ----PWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARL  485
            A I  G      P   LRADMDALP+QELV+WEHKSK +GKMHACGHDAH TMLLGAA+L
Sbjct  105  ATIAGGGGGGDGPVVALRADMDALPLQELVDWEHKSKESGKMHACGHDAHTTMLLGAAKL  164

Query  486  LQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            L +RK+ LKGTVKLVFQPAEEG  GA+H+++EG LDD  ++FG+HV P +PVG +
Sbjct  165  LHSRKDDLKGTVKLVFQPAEEGYAGAFHVLREGVLDDVSAIFGLHVDPSLPVGAV  219



>ref|XP_004143335.2| PREDICTED: IAA-amino acid hydrolase ILR1-like [Cucumis sativus]
 gb|KGN48287.1| hypothetical protein Csa_6G454350 [Cucumis sativus]
Length=441

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 156/219 (71%), Gaps = 8/219 (4%)
 Frame = +3

Query  12   AMKASASFRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRV  191
            A     SF+ + + ++  I+  W   + +       +  LT+ LL  AR+ EF +W+K V
Sbjct  2    AAGGGTSFKSLCWMIVFGIAL-WRPAAGENGGDGSELHSLTQSLLGLAREREFMEWIKGV  60

Query  192  RRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAI------GSGNQPWFG  353
            RR +HEYPELGFEE++TSQL+R+ELDSLGI Y WPVAKTGVVA+I       S + P FG
Sbjct  61   RRRIHEYPELGFEEYKTSQLVRSELDSLGISYRWPVAKTGVVASIRGDSVSSSSSTPVFG  120

Query  354  LRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVF  533
            LRADMDALP+QELVEWE KSK+ GKMHACGHD+HV M+LGAARLLQ+ +E LKGTVKLVF
Sbjct  121  LRADMDALPLQELVEWEFKSKVEGKMHACGHDSHVAMVLGAARLLQSIREKLKGTVKLVF  180

Query  534  QPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            QPAEE   GAY M+K+ ALD    +F +HV P +P G I
Sbjct  181  QPAEE-CNGAYQMLKDDALDGIDGIFALHVQPSLPTGVI  218



>ref|XP_006353512.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Solanum 
tuberosum]
Length=446

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
              S+ + L  E  + ++ + L+ A+ PE FDW+ R+RRT+HE PELGFEE  TS+LIRNE
Sbjct  21   TLSISSFLNKEEFANISVNFLNLAKRPELFDWIVRIRRTIHENPELGFEEFETSKLIRNE  80

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LD +GI Y +PVA TGVV  IG+G  P+  LRADMDAL +QE V+W+HKSKI GKMHACG
Sbjct  81   LDKMGIFYKYPVAVTGVVGFIGTGKPPFVALRADMDALAMQEEVDWKHKSKIPGKMHACG  140

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HDAHV MLLGAA++LQ +++ L+GTV LVFQPAEEG GGA  M++ G LD+  ++FG+HV
Sbjct  141  HDAHVAMLLGAAKILQEKRDDLQGTVLLVFQPAEEGGGGAKKMLESGILDNVDAIFGLHV  200

Query  624  WPGMPVGTI  650
             P  P+GT+
Sbjct  201  SPRSPIGTV  209



>ref|NP_001148528.1| IAA-amino acid hydrolase ILR1 precursor [Zea mays]
 gb|ACG31850.1| IAA-amino acid hydrolase ILR1 precursor [Zea mays]
 gb|AFW70626.1| IAA-amino acid hydrolase ILR1 [Zea mays]
Length=434

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 152/212 (72%), Gaps = 2/212 (1%)
 Frame = +3

Query  15   MKASASFRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVR  194
            M A AS   + F + +A++ P+   S +       V    + LL+ AR P F  WL+ VR
Sbjct  1    MAAFAS--AILFTVHLALAFPFRLSSAEAPPLLGAVVGEQQPLLEEARTPRFVTWLRGVR  58

Query  195  RTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDA  374
            R +H+ PEL F+EHRTS+L+R ELD++G+ Y WPVA+TGVVA I     P   LRADMDA
Sbjct  59   RRIHQRPELAFQEHRTSELVRAELDAIGVPYRWPVAQTGVVATIAGSAGPTVALRADMDA  118

Query  375  LPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGM  554
            LP+QE+V+W +KS+ +GKMHACGHDAH TMLLGAA+LLQ RK  LKG VKLVFQP+EEG 
Sbjct  119  LPVQEMVDWAYKSQESGKMHACGHDAHTTMLLGAAKLLQARKGDLKGAVKLVFQPSEEGY  178

Query  555  GGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GGAY++++EGALD   ++FG+HV P +PVG +
Sbjct  179  GGAYYVLQEGALDGVSAIFGLHVDPALPVGVV  210



>dbj|BAK01726.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  177  WLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGL  356
            WL+ VRR +H+ PEL F+EHRTS+L+R ELD++G+ Y+WPVA+TGVVA IGSG  P   L
Sbjct  53   WLRGVRRRIHQRPELAFQEHRTSELVRRELDAIGVPYAWPVARTGVVATIGSGAGPVVAL  112

Query  357  RADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQ  536
            RADMDALP+QELV+WE+KS  +GKMHACGHDAH  MLLGAA+LLQ+RKE LKGTVKLVFQ
Sbjct  113  RADMDALPVQELVDWEYKSLEDGKMHACGHDAHTAMLLGAAKLLQSRKEDLKGTVKLVFQ  172

Query  537  PAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            PAEEG GGAY++++EG LDD  ++FG+HV P +PVG +
Sbjct  173  PAEEGSGGAYYILEEGVLDDVSAIFGLHVDPALPVGVV  210



>ref|XP_009624362.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana tomentosiformis]
Length=445

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 149/202 (74%), Gaps = 3/202 (1%)
 Frame = +3

Query  45   WFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELG  224
            +F+L   +++P    SL   L  E ++ ++ + L+ A+  + FDW+ ++RRT+HE PELG
Sbjct  10   FFSLCTYLATPTLSDSL---LNKEELANISTNFLNLAKRTDLFDWMVKIRRTIHENPELG  66

Query  225  FEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWE  404
            FEE  TS+LIRNELD +GI Y +PVA TGVV  IG+G  P+  LRADMDALP+QE VEWE
Sbjct  67   FEEFETSKLIRNELDKMGIYYEYPVAVTGVVGFIGTGKSPFVALRADMDALPLQEEVEWE  126

Query  405  HKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEG  584
            HKSKI GKMHACGHDAH+ MLLGAA++LQ R   L+GT+ LVFQPAEEG GGA  M++ G
Sbjct  127  HKSKIPGKMHACGHDAHIAMLLGAAKILQERSTELQGTILLVFQPAEEGGGGAKKMLESG  186

Query  585  ALDDFQSMFGMHVWPGMPVGTI  650
             LD+  ++FG+H+    P+GT+
Sbjct  187  ILDNVDAIFGLHISATCPIGTV  208



>ref|XP_009147310.1| PREDICTED: IAA-amino acid hydrolase ILR1 [Brassica rapa]
Length=437

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  L+R +LDSA++PEFF+W++ +RR +HE PE GF+E +TSQLIR+ELD LG+ Y WPV
Sbjct  29   IESLSRGMLDSAKEPEFFEWMRGIRRRIHENPETGFQEFKTSQLIRDELDLLGVKYKWPV  88

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA IGSG++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV MLLGAA
Sbjct  89   AKTGVVAWIGSGSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAA  148

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ+RK  +KGTVKLVFQP EEG GGA  M+K+  LDD   +  +HV+P +P G I
Sbjct  149  KLLQSRKHLIKGTVKLVFQPGEEGYGGAIEMLKDDILDDLDGILSVHVFPTIPSGGI  205



>emb|CDY51525.1| BnaA05g33250D [Brassica napus]
Length=440

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  120  VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPV  299
            +  L+R +LDSA++PEFF+W++ +RR +HE PE GF+E +TSQLIR+ELD LG+ Y WPV
Sbjct  32   IESLSRGMLDSAKEPEFFEWMRGIRRRIHENPETGFQEFKTSQLIRDELDLLGVKYKWPV  91

Query  300  AKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            AKTGVVA IGSG++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV MLLGAA
Sbjct  92   AKTGVVAWIGSGSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHVAMLLGAA  151

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ+RK  +KGTVKLVFQP EEG GGA  M+K+  LDD   +  +HV+P +P G I
Sbjct  152  KLLQSRKHLIKGTVKLVFQPGEEGYGGAIEMLKDDILDDLDGILSVHVFPTIPSGGI  208



>ref|XP_002459629.1| hypothetical protein SORBIDRAFT_02g007720 [Sorghum bicolor]
 gb|EER96150.1| hypothetical protein SORBIDRAFT_02g007720 [Sorghum bicolor]
Length=464

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 140/174 (80%), Gaps = 4/174 (2%)
 Frame = +3

Query  141  LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVA  320
            LL +AR P F  W++ +RR +H++PEL F+EHRTS+L+R ELD LG+ Y+WPVA+TGVVA
Sbjct  44   LLSAARAPGFAAWMRGLRRRIHQHPELAFQEHRTSELVRAELDKLGVPYAWPVARTGVVA  103

Query  321  AI----GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
             I    G G      LRADMDALP+QE+V+WE+KSK +GKMHACGHDAHVTMLLGAA+LL
Sbjct  104  TITGGRGVGRPVVVALRADMDALPVQEMVDWEYKSKEDGKMHACGHDAHVTMLLGAAKLL  163

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            Q+RK+ LKGT+KLVFQPAEEG  GAY ++KEG LDD  ++FG+HV P +PVG +
Sbjct  164  QSRKDDLKGTIKLVFQPAEEGYAGAYFVVKEGDLDDVSAIFGLHVIPELPVGVV  217



>emb|CDY28718.1| BnaCnng06040D [Brassica napus]
Length=436

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 149/184 (81%), Gaps = 1/184 (1%)
 Frame = +3

Query  102  RLGSET-VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLG  278
            R GS + +  L+R +LDSA++PEFF+W++ +RR +HE PE GF+E +TSQLIR+ELD LG
Sbjct  21   RYGSGSGLESLSRGMLDSAKEPEFFEWMRGIRRRIHENPETGFQEFKTSQLIRDELDLLG  80

Query  279  IGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHV  458
            + Y WPVAKTGVVA IGSG++P FGLRADMDALP+QELVEWE KSK++GKMHACGHD HV
Sbjct  81   VKYKWPVAKTGVVAWIGSGSKPVFGLRADMDALPLQELVEWESKSKVDGKMHACGHDTHV  140

Query  459  TMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMP  638
             MLLGAA+LLQ+RK  +KGTVKLVFQP EEG GGA  M+K+  LDD   +  +HV+P +P
Sbjct  141  AMLLGAAKLLQSRKHLIKGTVKLVFQPGEEGYGGAIEMLKDDILDDLDGILSVHVFPTIP  200

Query  639  VGTI  650
             G I
Sbjct  201  SGGI  204



>ref|XP_010038477.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5, partial [Eucalyptus 
grandis]
Length=301

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            +LL SA+  +   WL  VRR +HEYPEL FEEH TS L+R ELD LGI YS+P+A TGVV
Sbjct  36   ELLGSAKRDQ--PWLTSVRRRIHEYPELRFEEHNTSALVRAELDRLGIPYSYPLAGTGVV  93

Query  318  AAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNR  497
            A +GSG++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHDAH TMLLGAA+LL  R
Sbjct  94   AVVGSGSRPVVALRADMDALPLQELVEWEHKSKIDGKMHACGHDAHTTMLLGAAKLLNQR  153

Query  498  KESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            K+ LKGTV+L+FQPAEEG  GA HMIKEGAL D +++F MH     P GTI
Sbjct  154  KDELKGTVRLIFQPAEEGGAGASHMIKEGALGDAEAIFAMHNDYTTPTGTI  204



>ref|XP_006854741.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Amborella trichopoda]
 gb|ERN16208.1| hypothetical protein AMTR_s00030p00245020 [Amborella trichopoda]
Length=438

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = +3

Query  78   WHCCSLQTRLGSETVSQLT-RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLI  254
            +  CS    L     + +  +  L+ AR+ E F+W+KRVRR +H  PEL F E++TS+ I
Sbjct  20   YPLCSATPHLSVSNEAAIDYQGFLNWAREDELFEWIKRVRRHIHMNPELAFNEYKTSKFI  79

Query  255  RNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMH  434
            R ELD +GI YSWP AKTG+VA IGSG +P   LRADMDALPIQELV+WE+KS+++GKMH
Sbjct  80   REELDEMGIEYSWPYAKTGIVATIGSGGRPILALRADMDALPIQELVDWEYKSRLDGKMH  139

Query  435  ACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFG  614
            ACGHDAHVTM+LGAA+LLQ  K+ LKGTVKLVFQPAEEG  GAYHMI+EGA+++ +++FG
Sbjct  140  ACGHDAHVTMVLGAAKLLQKAKDQLKGTVKLVFQPAEEGGAGAYHMIQEGAIENIEAIFG  199

Query  615  MHVWPGMPVGTI  650
            +HV   +  G I
Sbjct  200  LHVDNQLRTGAI  211



>gb|EAZ03384.1| hypothetical protein OsI_25529 [Oryza sativa Indica Group]
Length=439

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 134/169 (79%), Gaps = 4/169 (2%)
 Frame = +3

Query  156  RDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAI---  326
            R+P   +WL+ VRR +H +PEL FEE RTS+L+R ELD++G+ Y WPVA+TGVVA I   
Sbjct  44   REPGMAEWLRGVRRRIHRHPELAFEEVRTSELVRAELDAIGVPYQWPVARTGVVATIAAG  103

Query  327  -GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKE  503
             G G+ P   LRADMDALP+QELV+WEHKS+ NGKMHACGHDAH  MLLGAA+LLQ RK 
Sbjct  104  SGGGDGPVVALRADMDALPVQELVDWEHKSQENGKMHACGHDAHTAMLLGAAKLLQKRKN  163

Query  504  SLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             LKGTVKLVFQPAEEG  GAY++++EG LDD  +MFGMHV P +PVG +
Sbjct  164  ELKGTVKLVFQPAEEGSAGAYYVLQEGVLDDVSAMFGMHVDPALPVGVV  212



>ref|XP_004251653.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Solanum lycopersicum]
Length=446

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +3

Query  90   SLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELD  269
            S+ + L  E ++ ++ + L+ A+ PE FDW+ R+RRT+HE PELGFEE  TS+LIRNELD
Sbjct  23   SISSILNKEELANISVNFLNLAKRPELFDWIVRIRRTIHENPELGFEEFETSKLIRNELD  82

Query  270  SLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHD  449
             +GI Y +PVA TGVV   G+G  P+  LRADMDAL +QE V+WEHKSKI GKMHACGHD
Sbjct  83   KMGIFYKYPVAVTGVVGFSGTGKPPFVALRADMDALAMQEEVDWEHKSKIPGKMHACGHD  142

Query  450  AHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWP  629
            AHV MLLGAA++LQ +++ L+GTV LVFQPAEEG GGA  M++ G LD+  ++FG+H+ P
Sbjct  143  AHVAMLLGAAKILQEQRDILQGTVLLVFQPAEEGGGGAKKMLESGILDNVDAIFGLHISP  202

Query  630  GMPVGTI  650
              P+GT+
Sbjct  203  MSPIGTV  209



>ref|XP_009794201.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana sylvestris]
Length=445

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 149/201 (74%), Gaps = 3/201 (1%)
 Frame = +3

Query  48   FALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGF  227
            F L   +++P    SL   L  + ++ ++ + L+ A+  + FDW+ ++RRT+HE PELGF
Sbjct  11   FTLCTYLATPTLSDSL---LNKDELASISANFLNLAKRTDLFDWMVKIRRTIHENPELGF  67

Query  228  EEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEH  407
            EE  TS+LIRNELD +GI Y +PVA TGVV  IG+G  P+  LRADMDALP+QE VEWEH
Sbjct  68   EEFETSKLIRNELDKMGIYYKYPVAVTGVVGFIGTGKSPFVALRADMDALPMQEEVEWEH  127

Query  408  KSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGA  587
            KSKI GKMHACGHDAHV MLLGAAR+LQ +++ L+GTV LVFQPAEEG GGA  M++ G 
Sbjct  128  KSKIPGKMHACGHDAHVAMLLGAARILQEQRDYLQGTVLLVFQPAEEGGGGAKKMLESGV  187

Query  588  LDDFQSMFGMHVWPGMPVGTI  650
            LD+  ++FG+H+    P+GT+
Sbjct  188  LDNVDAIFGLHISAVHPIGTV  208



>ref|XP_002269424.2| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera]
Length=477

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 157/218 (72%), Gaps = 7/218 (3%)
 Frame = +3

Query  9    AAMKASASFRCVWFALIVAISSPW-HCCSLQTRLGSETV---SQLTRDLLDSARDPEFFD  176
            +AM+    F  V+   +++I++P+  C SLQ  L S T    S +   +   A DP   +
Sbjct  32   SAMEVPRPFLIVF---LISIANPFCSCLSLQPSLNSFTPYWNSSVKDHITGVANDPFTVN  88

Query  177  WLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGL  356
            W+KR+RR +HE PEL +EE  TS +IR EL+ LG+GY WPVA+TGVVA IGSG+ P+  L
Sbjct  89   WMKRIRREIHENPELAYEEFATSAVIRRELEELGVGYRWPVARTGVVATIGSGSPPFVAL  148

Query  357  RADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQ  536
            RADMDALPIQE+VEWEHKSK++GKMHACGHDAHV MLLGAA++LQ  ++ L+GTV L+FQ
Sbjct  149  RADMDALPIQEMVEWEHKSKVDGKMHACGHDAHVAMLLGAAKILQEIRDELQGTVVLIFQ  208

Query  537  PAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            PAEE   GA  MI+EG L++ +++FG+H   G P GT+
Sbjct  209  PAEERGVGAKDMIQEGVLENIEAIFGIHTVHGYPTGTV  246



>ref|XP_006853919.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 isoform X2 [Amborella 
trichopoda]
 gb|ERN15386.1| hypothetical protein AMTR_s00036p00189900 [Amborella trichopoda]
Length=445

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = +3

Query  123  SQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVA  302
            ++   D+L  A+ PE  +WL+ +RR++HE+PELGFEE  TS+L+R +LD LG+ Y WPVA
Sbjct  28   AETPTDILQRAKQPEMLEWLRHIRRSIHEHPELGFEEFETSKLVRRKLDELGVQYKWPVA  87

Query  303  KTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAAR  482
             TGVV  IGSG  P+  +RADMDALPI+E VEWEHKSKI GKMHACGHDAH+TMLLGAA+
Sbjct  88   VTGVVGFIGSGRPPFVAIRADMDALPIEEAVEWEHKSKIPGKMHACGHDAHITMLLGAAK  147

Query  483  LLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LQ RK+ L+GTV L+FQPAEEG GGA  MI+ GAL++ +++FGMHV P + +G +
Sbjct  148  ILQERKDDLQGTVVLLFQPAEEGGGGAKKMIEAGALENVEAIFGMHVVPDIHIGAV  203



>ref|XP_006438485.1| hypothetical protein CICLE_v10031540mg [Citrus clementina]
 gb|ESR51725.1| hypothetical protein CICLE_v10031540mg [Citrus clementina]
 gb|KDO82612.1| hypothetical protein CISIN_1g013395mg [Citrus sinensis]
Length=323

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 147/204 (72%), Gaps = 2/204 (1%)
 Frame = +3

Query  39   CVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPE  218
             ++ +L   +SS     + QT       S +   +++ A D +  +W+K++RR +HE PE
Sbjct  17   TIFASLNFLLSSNEKSLNFQTSKSQN--SSIKSRIIELANDQDTVNWMKKMRRQIHENPE  74

Query  219  LGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVE  398
            L +EE  TS+LIR ELD LGI Y WPVAKTGVVA +GSG+ P+  LRADMDALPIQELVE
Sbjct  75   LAYEEFETSELIRRELDQLGIAYRWPVAKTGVVATVGSGSPPFVALRADMDALPIQELVE  134

Query  399  WEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIK  578
            WEHKSKI+GKMHACGHDAHV MLLGAA++LQ  +E+LKGTV L+FQPAEE   GA  MI+
Sbjct  135  WEHKSKIDGKMHACGHDAHVAMLLGAAKILQEMRETLKGTVVLIFQPAEERGTGAKDMIQ  194

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
            EG L++ +++FG+H+    P G +
Sbjct  195  EGVLENVEAIFGLHLVHKYPTGVV  218



>ref|XP_002864473.1| hypothetical protein ARALYDRAFT_495757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40732.1| hypothetical protein ARALYDRAFT_495757 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 6/187 (3%)
 Frame = +3

Query  102  RLGSET------VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
            R+ SE+      VSQ+ ++LL+SA+ P+ FDW+ R+RR +HE PELG+EE  TS+LIR+E
Sbjct  16   RVSSESSWIAGDVSQIQKNLLESAKSPDVFDWMVRIRRKIHENPELGYEEFETSKLIRSE  75

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LD LGI Y +PVA TG++  IG+G  P+  LRADMDALPIQE VEWEHKSKI GKMHACG
Sbjct  76   LDLLGIKYRYPVAITGIIGYIGTGEPPFVALRADMDALPIQEAVEWEHKSKIPGKMHACG  135

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HD HV MLLGAA++LQ  +  L+GTV L+FQPAEEG+ GA  M +EGAL + +++FG+H+
Sbjct  136  HDGHVAMLLGAAKILQEHRHDLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHL  195

Query  624  WPGMPVG  644
             P  P G
Sbjct  196  SPRTPFG  202



>ref|XP_009414584.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=430

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 143/171 (84%), Gaps = 4/171 (2%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            +LL+SAR+PEFFDWL  +RR +H++PEL FEE++TS+LIR+ELD+LGI Y+WP++ TG+V
Sbjct  38   ELLESAREPEFFDWLTAIRRRIHQHPELAFEEYKTSELIRSELDALGIEYAWPISGTGIV  97

Query  318  AAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNR  497
            A++GSG  P F LRADMDALP+QELV+WE+KSK++GKMHACGHDAHVTMLLGAA+LLQ+R
Sbjct  98   ASVGSGGGPVFSLRADMDALPLQELVDWEYKSKVSGKMHACGHDAHVTMLLGAAKLLQHR  157

Query  498  KESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
                K T+KLVFQPAEE   GAYHM++ GA+D  +++F +HV   +  G I
Sbjct  158  ----KNTLKLVFQPAEERGAGAYHMLQSGAIDGVEAIFTLHVDSRLTTGAI  204



>ref|XP_008360585.1| PREDICTED: LOW QUALITY PROTEIN: IAA-amino acid hydrolase ILR1-like 
[Malus domestica]
Length=261

 Score =   233 bits (595),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 134/167 (80%), Gaps = 5/167 (3%)
 Frame = +3

Query  150  SARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIG  329
            SA++ EFF+W++ VRR +H+YPE+GF EHRTSQLIR ELD+LGI Y+WPVAKTGV     
Sbjct  38   SAKEAEFFEWMRGVRRRIHQYPEIGFXEHRTSQLIRTELDTLGIVYTWPVAKTGV-----  92

Query  330  SGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESL  509
             G++P F L ADMDALP+QE VEWE KSKI+G+MHACGHD+HV MLLGAA+LLQ++++ L
Sbjct  93   XGSKPVFALMADMDALPLQEQVEWEFKSKIDGEMHACGHDSHVAMLLGAAKLLQSKRDIL  152

Query  510  KGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            KGTVKLVFQP EE   GAYHM+  G L+D  ++F +HV P +P G I
Sbjct  153  KGTVKLVFQPGEEVYAGAYHMLLHGILNDIDAIFFIHVMPSLPTGVI  199



>ref|XP_004959130.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 7-like [Setaria 
italica]
Length=453

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 139/173 (80%), Gaps = 3/173 (2%)
 Frame = +3

Query  141  LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVA  320
            LL  AR P F  WL+ VRR +H+ PEL F+EHRTS+L+R+ELD++G+ Y WPVA+TGVVA
Sbjct  55   LLADARAPGFAAWLRGVRRRIHQRPELAFQEHRTSELVRSELDAIGVPYRWPVAQTGVVA  114

Query  321  AI---GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQ  491
             I   G    P   LRADMDALP+QELV+WE+KS+ NGKMHACGHDAH TMLLGAA+LLQ
Sbjct  115  TIVGGGGAATPVVALRADMDALPLQELVDWEYKSQENGKMHACGHDAHTTMLLGAAKLLQ  174

Query  492  NRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            + K+  KGT+KLVFQPAEEG GGAY++++EG+LDD  ++FG+HV P +P+G +
Sbjct  175  DCKDDFKGTIKLVFQPAEEGYGGAYYILQEGSLDDVSAIFGLHVNPDVPLGVV  227



>ref|XP_002466139.1| hypothetical protein SORBIDRAFT_01g002080 [Sorghum bicolor]
 gb|EER93137.1| hypothetical protein SORBIDRAFT_01g002080 [Sorghum bicolor]
Length=403

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 135/166 (81%), Gaps = 1/166 (1%)
 Frame = +3

Query  156  RDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAI-GS  332
            R PEF +W   VRR +H++PEL F+EHRTS L+R ELD+LG+ Y+WPVA+TGVVA + G+
Sbjct  17   RAPEFAEWQLGVRRRIHQHPELAFQEHRTSALVRAELDALGVPYAWPVARTGVVATVAGA  76

Query  333  GNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLK  512
             + P F LRADMDALP+QELVEWE KSK +GKMHACGHDAHV MLLGAARLLQ+R++  K
Sbjct  77   ASGPVFALRADMDALPLQELVEWEFKSKEDGKMHACGHDAHVAMLLGAARLLQSRRDLFK  136

Query  513  GTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GTVKLVFQPAEEG  G Y+++KEG LDD  ++F +HV   +PVGT+
Sbjct  137  GTVKLVFQPAEEGHAGGYYVLKEGVLDDVHTIFAVHVDTALPVGTV  182



>ref|XP_010034919.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Eucalyptus grandis]
 gb|KCW46122.1| hypothetical protein EUGRSUZ_K00046 [Eucalyptus grandis]
Length=432

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            +LL SA+  +   WL  VRR +HEYPEL FEEH TS L+R ELD LGI YS+P+A TGVV
Sbjct  36   ELLGSAKRDQ--PWLTSVRRRIHEYPELRFEEHNTSALVRAELDRLGIPYSYPLAGTGVV  93

Query  318  AAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNR  497
            A +GSG++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHDAH TMLLGAA+LL  R
Sbjct  94   AVVGSGSRPVVALRADMDALPLQELVEWEHKSKIDGKMHACGHDAHTTMLLGAAKLLNQR  153

Query  498  KESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            K+ LKGTV+L+FQPAEEG  GA HMIKEGAL D +++F MH     P GTI
Sbjct  154  KDELKGTVRLIFQPAEEGGAGASHMIKEGALGDAEAIFAMHNDYTTPTGTI  204



>ref|XP_002981614.1| hypothetical protein SELMODRAFT_421067 [Selaginella moellendorffii]
 gb|EFJ17429.1| hypothetical protein SELMODRAFT_421067 [Selaginella moellendorffii]
Length=405

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            ++L++A DP   +W++ VRR +H  PELGFEEH+TS LIR ELD +GI Y WPVAKTGVV
Sbjct  7    EILEAANDPGTVEWVRSVRRCIHRNPELGFEEHQTSALIRRELDGMGIPYRWPVAKTGVV  66

Query  318  AAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNR  497
            A IGSG++P   LRADMD LPIQE+VEWEHKS+++GKMHACGHDAH+ MLLGAAR+L  R
Sbjct  67   ATIGSGDRPIVALRADMDGLPIQEMVEWEHKSQVDGKMHACGHDAHLAMLLGAARILSQR  126

Query  498  KESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +  LKGTV L+FQPAEEG  GA  M+++GAL D +++FG+HV P  P G I
Sbjct  127  RHLLKGTVLLLFQPAEEGKAGAQVMVQDGALGDAEAIFGLHVAPEAPTGII  177



>gb|ABF55222.1| auxin conjugate hydrolase [Medicago truncatula]
 gb|KEH18272.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=447

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 150/212 (71%), Gaps = 5/212 (2%)
 Frame = +3

Query  15   MKASASFRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVR  194
            M +S  F C  F +I+      H  +    L S T +    + LDSA++PE +DW+  +R
Sbjct  1    MSSSFKFICYHFFIII-----LHVFAATQILSSSTHNSSFNNFLDSAKNPEVYDWMINIR  55

Query  195  RTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDA  374
            R +HE PELG+EE  TS+LIR ELD L I Y +PVA TGV+  IG+G  P+  LRADMDA
Sbjct  56   RKIHENPELGYEEFETSELIRTELDKLSIPYKYPVAITGVIGFIGTGLSPFVALRADMDA  115

Query  375  LPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGM  554
            L +QE+VEWEH+SK+ GKMHACGHDAHVTMLLGAA++L+  ++ ++GT+ LVFQPAEEG 
Sbjct  116  LSMQEMVEWEHRSKVPGKMHACGHDAHVTMLLGAAKILKQHEKEIQGTIVLVFQPAEEGG  175

Query  555  GGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GGA  ++  GAL++  ++FG+H+ P +P+G +
Sbjct  176  GGAKKILDAGALENVTAIFGLHIVPDLPIGEV  207



>ref|XP_002963174.1| hypothetical protein SELMODRAFT_141529 [Selaginella moellendorffii]
 gb|EFJ35045.1| hypothetical protein SELMODRAFT_141529 [Selaginella moellendorffii]
Length=405

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            ++L++A DP   +W++ VRR +H  PELGFEEH+TS LIR ELD +GI Y WPVAKTGVV
Sbjct  7    EILEAANDPGTVEWVRSVRRCIHRNPELGFEEHQTSALIRRELDGMGIPYRWPVAKTGVV  66

Query  318  AAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNR  497
            A IGSG++P   LRADMD LPIQE+VEWEHKS+++GKMHACGHDAH+ MLLGAAR+L  R
Sbjct  67   ATIGSGDRPIVALRADMDGLPIQEMVEWEHKSQVDGKMHACGHDAHLAMLLGAARILSRR  126

Query  498  KESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +  LKGTV L+FQPAEEG  GA  M+++GAL D +++FG+HV P  P G I
Sbjct  127  RHLLKGTVLLLFQPAEEGKAGAQVMVQDGALGDAEAIFGLHVAPEAPTGII  177



>ref|NP_001291249.1| IAA-amino acid hydrolase ILR1-like 3 precursor [Populus euphratica]
 emb|CAG32959.1| putative auxin-amidohydrolase precursor [Populus euphratica]
Length=431

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 133/170 (78%), Gaps = 3/170 (2%)
 Frame = +3

Query  141  LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVA  320
            L  S RD    DWL  +RR +H+ PEL FEEH TS LIR+ELD L I Y++P+AKTG+VA
Sbjct  36   LNSSQRDK---DWLITIRRQIHQNPELRFEEHNTSALIRSELDKLAIAYTYPLAKTGIVA  92

Query  321  AIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRK  500
             IGSG+ P   LRADMDALP+QELVEWEHKSK+NGKMH CGHDAH TMLLGAA+LL  RK
Sbjct  93   QIGSGSPPVVALRADMDALPLQELVEWEHKSKVNGKMHGCGHDAHTTMLLGAAKLLNERK  152

Query  501  ESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              LKGTV+L+FQPAEEG  GA HMIK+GAL D +++FGMHV   +P GTI
Sbjct  153  HLLKGTVRLLFQPAEEGGAGASHMIKDGALGDAEAIFGMHVNYKIPTGTI  202



>ref|XP_002317832.1| hypothetical protein POPTR_0012s00750g [Populus trichocarpa]
 gb|ABK95339.1| unknown [Populus trichocarpa]
 gb|EEE96052.1| hypothetical protein POPTR_0012s00750g [Populus trichocarpa]
Length=432

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 133/170 (78%), Gaps = 3/170 (2%)
 Frame = +3

Query  141  LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVA  320
            L  S RD    DWL  +RR +HE PEL FEEH TS LIR+ELD L I Y++P+AKTG+VA
Sbjct  37   LSSSQRDK---DWLITIRRQIHENPELRFEEHNTSALIRSELDKLAISYTYPLAKTGIVA  93

Query  321  AIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRK  500
             IGSG+ P   LRADMDALP+QELVEWEHKSK++GKMH CGHDAH TMLLGAA+LL  RK
Sbjct  94   QIGSGSPPVVALRADMDALPLQELVEWEHKSKVDGKMHGCGHDAHTTMLLGAAKLLNERK  153

Query  501  ESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              LKGTV+L+FQPAEEG  GA HMIK+GAL D +++FGMHV   +P GTI
Sbjct  154  HLLKGTVRLLFQPAEEGGAGASHMIKDGALGDAEAIFGMHVNYKIPTGTI  203



>ref|XP_009596700.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X2 [Nicotiana 
tomentosiformis]
Length=395

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 144/204 (71%), Gaps = 3/204 (1%)
 Frame = +3

Query  39   CVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPE  218
            C  F L + +S       L +  GS    +  + +L SA +    DWL  +RR +HEYPE
Sbjct  10   CSHFPLFLPLSILCFIL-LHSIQGSYFDQEYGKQVLSSAIEDN--DWLVSIRRKIHEYPE  66

Query  219  LGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVE  398
            L F+E+ TS LIR ELD LGI Y +P AKTG+VA IG+G+ P   LRADMDALP+QELVE
Sbjct  67   LRFQEYNTSALIRTELDKLGIYYEYPFAKTGLVAQIGTGSPPVVALRADMDALPLQELVE  126

Query  399  WEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIK  578
            WEHKSK+ GKMH CGHDAH TMLLGAA+LL  RK+ L GTV+LVFQPAEEG  GAYHMIK
Sbjct  127  WEHKSKVAGKMHGCGHDAHTTMLLGAAKLLNERKDKLNGTVRLVFQPAEEGGAGAYHMIK  186

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
            EGAL D +++FGMHV    P G+I
Sbjct  187  EGALGDAEAIFGMHVDFKRPTGSI  210



>gb|EYU30670.1| hypothetical protein MIMGU_mgv1a006375mg [Erythranthe guttata]
Length=446

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 143/199 (72%), Gaps = 3/199 (2%)
 Frame = +3

Query  54   LIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEE  233
             I+ IS P    +  ++ GS   S++  + L SA+ PE FD++ ++RRTLHE PELGFEE
Sbjct  14   FILLISHPTISAAFSSKQGS---SEIPSEFLKSAKTPEIFDYMVKIRRTLHENPELGFEE  70

Query  234  HRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKS  413
              TS+LIRNELD +GI Y  P+A TGVV  IG+GN P+  +RADMDAL +QE VEWEHKS
Sbjct  71   FETSKLIRNELDRMGIPYKHPIAVTGVVGYIGTGNPPFVAIRADMDALAMQEAVEWEHKS  130

Query  414  KINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALD  593
            K+ GKMHACGHDAHV MLLGAA++LQ     L+GTV LVFQPAEEG GGA  M  EG L+
Sbjct  131  KVPGKMHACGHDAHVAMLLGAAKILQEHYSHLEGTVMLVFQPAEEGGGGAKKMRDEGILE  190

Query  594  DFQSMFGMHVWPGMPVGTI  650
            +  ++FG+HV    PVG +
Sbjct  191  NVDAIFGLHVSSRYPVGVV  209



>ref|XP_010690089.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Beta vulgaris 
subsp. vulgaris]
Length=450

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 145/205 (71%), Gaps = 1/205 (0%)
 Frame = +3

Query  39   CVWFALIVAISSPWHCCS-LQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYP  215
            CV+F L   +  P    S  +    S  + ++ +  L+  +  E FDW+  +RR LHE P
Sbjct  8    CVFFTLQCFLFKPLLSDSDSELFFNSNELQEIPKYFLNQTQKAEVFDWMVNIRRKLHENP  67

Query  216  ELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELV  395
            ELGFEE  TS++IR ELD LGI Y +P+A TGV+  IG+GN P+  LRADMDALPI+E+V
Sbjct  68   ELGFEEFETSRVIREELDKLGISYKYPLAVTGVLGFIGTGNPPFVALRADMDALPIEEMV  127

Query  396  EWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMI  575
            EWEHKSK+ GKMHACGHDAHV MLLGAAR+LQ  +  L+GTV LVFQP EEG GGA  MI
Sbjct  128  EWEHKSKVPGKMHACGHDAHVAMLLGAARILQENQHKLQGTVVLVFQPGEEGYGGAKKMI  187

Query  576  KEGALDDFQSMFGMHVWPGMPVGTI  650
            + GAL++ +++F +HV  G+PVG +
Sbjct  188  EAGALENVEAIFALHVNSGLPVGQV  212



>sp|Q8H3C7.2|ILL9_ORYSJ RecName: Full=IAA-amino acid hydrolase ILR1-like 9; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=440

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 132/168 (79%), Gaps = 3/168 (2%)
 Frame = +3

Query  156  RDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSG  335
            R+P   +WL+ VRR +H +PEL FEE RTS+L+R ELD++G+ Y WPVA+TGVVA I  G
Sbjct  44   REPGMAEWLRGVRRRIHRHPELAFEEVRTSELVRAELDAIGVPYQWPVARTGVVATIAGG  103

Query  336  NQ---PWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKES  506
                 P   LRADMDALP+QELV+WEHKS+ NGKMHACGHDAH  MLLGAA+LLQ RK  
Sbjct  104  GGGDGPVVALRADMDALPVQELVDWEHKSQENGKMHACGHDAHTAMLLGAAKLLQKRKNE  163

Query  507  LKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LKGTVKLVFQPAEEG  GAY++++EG LDD  +MFGMHV P +PVG +
Sbjct  164  LKGTVKLVFQPAEEGSAGAYYVLQEGVLDDVSAMFGMHVDPALPVGVV  211



>gb|KDO70555.1| hypothetical protein CISIN_1g0367561mg, partial [Citrus sinensis]
Length=196

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  246  QLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKING  425
            QL+RNEL SLGI Y+WP AKTG+VA++GSG QPWFGLRADMDALPIQE+VEWEHKSK NG
Sbjct  3    QLVRNELASLGIEYTWPFAKTGIVASVGSGVQPWFGLRADMDALPIQEMVEWEHKSKNNG  62

Query  426  KMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQS  605
            KMHACGHD H TMLLGAARLL+ RK+ LKGTVKLVFQP EE  GGAYHMIKEGAL+ FQ 
Sbjct  63   KMHACGHDVHTTMLLGAARLLKQRKDRLKGTVKLVFQPGEESYGGAYHMIKEGALEKFQG  122

Query  606  MFGMHVWPGMPVGTI  650
            +FG+HV P +P GTI
Sbjct  123  IFGLHVAPELPTGTI  137



>ref|NP_200225.1| IAA-amino acid hydrolase ILR1-like 3 [Arabidopsis thaliana]
 sp|O81641.1|ILL3_ARATH RecName: Full=IAA-amino acid hydrolase ILR1-like 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC31939.1| IAA-amino acid hydrolase homolog ILL3 [Arabidopsis thaliana]
 dbj|BAB11576.1| IAA-amino acid hydrolase homolog ILL3 [Arabidopsis thaliana]
 gb|AED96456.1| IAA-amino acid hydrolase ILR1-like 3 [Arabidopsis thaliana]
Length=428

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +3

Query  174  DWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFG  353
            +WL  VRR +HE PEL FE H+TS LIR ELD LG+ YS+PVAKTG+VA IGSG  P   
Sbjct  39   EWLVSVRRQIHENPELLFELHKTSALIRRELDELGVSYSYPVAKTGIVAQIGSGYPPVVA  98

Query  354  LRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVF  533
            LRADMDALP+QELVEW+HKSKI+GKMHACGHD+H TMLLGAA+LL  RK  L GTV+L+F
Sbjct  99   LRADMDALPLQELVEWDHKSKIDGKMHACGHDSHTTMLLGAAKLLSKRKRMLNGTVRLLF  158

Query  534  QPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            QPAEEG  GA+HMIKEGAL D +++FGMHV  G+P G +
Sbjct  159  QPAEEGGAGAFHMIKEGALGDSEAIFGMHVHTGLPTGEL  197



>gb|ACJ84380.1| unknown [Medicago truncatula]
Length=207

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 148/212 (70%), Gaps = 5/212 (2%)
 Frame = +3

Query  15   MKASASFRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVR  194
            M +S  F C  F +I+      H  +      S T +    + LDSA++PE +DW+  +R
Sbjct  1    MSSSFKFICYHFFIII-----LHVFAATQIFSSSTHNSSFNNFLDSAKNPEVYDWMINIR  55

Query  195  RTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDA  374
            R +HE PELG+EE  TS+LIR ELD L I Y +PVA TGV+  IG+G  P+  LRADMDA
Sbjct  56   RKIHENPELGYEEFETSELIRTELDKLSIPYKYPVAITGVIGFIGTGLSPFVALRADMDA  115

Query  375  LPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGM  554
            L +QE+VEWEH+SK+ GKMHACGHDAHVTMLLGAA++L+  ++ ++GT+ LVFQPAEEG 
Sbjct  116  LSMQEMVEWEHRSKVPGKMHACGHDAHVTMLLGAAKILKQHEKEIQGTIVLVFQPAEEGG  175

Query  555  GGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GGA  ++  GAL++  ++FG+H+ P + + ++
Sbjct  176  GGAKKILDAGALENVTAIFGLHIVPDLQLVSV  207



>ref|XP_006347315.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5-like [Solanum 
tuberosum]
Length=430

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 135/181 (75%), Gaps = 2/181 (1%)
 Frame = +3

Query  108  GSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGY  287
            GS    +  + +L SA   +  DWL  +RR +HEYPEL FEE+ TS LIR+ELD LG+ Y
Sbjct  24   GSYFDQEFVKQILSSASKDK--DWLVSIRRKIHEYPELRFEEYNTSALIRSELDKLGVYY  81

Query  288  SWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTML  467
             +P AKTG+VA IG+G+ P   LRADMDALP+QELVEWEHKSKINGKMH CGHDAH TML
Sbjct  82   EYPFAKTGIVAQIGNGSPPVVALRADMDALPLQELVEWEHKSKINGKMHGCGHDAHTTML  141

Query  468  LGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGT  647
            LGAA+LL  RK+ L GTV+LVFQPAEEG  GA HMIKEGAL D + +FGMHV    P G 
Sbjct  142  LGAAKLLNERKDKLNGTVRLVFQPAEEGGAGANHMIKEGALGDAEVIFGMHVDFKRPTGG  201

Query  648  I  650
            I
Sbjct  202  I  202



>ref|XP_009596693.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=438

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 144/204 (71%), Gaps = 3/204 (1%)
 Frame = +3

Query  39   CVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPE  218
            C  F L + +S       L +  GS    +  + +L SA +    DWL  +RR +HEYPE
Sbjct  10   CSHFPLFLPLSILCFIL-LHSIQGSYFDQEYGKQVLSSAIEDN--DWLVSIRRKIHEYPE  66

Query  219  LGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVE  398
            L F+E+ TS LIR ELD LGI Y +P AKTG+VA IG+G+ P   LRADMDALP+QELVE
Sbjct  67   LRFQEYNTSALIRTELDKLGIYYEYPFAKTGLVAQIGTGSPPVVALRADMDALPLQELVE  126

Query  399  WEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIK  578
            WEHKSK+ GKMH CGHDAH TMLLGAA+LL  RK+ L GTV+LVFQPAEEG  GAYHMIK
Sbjct  127  WEHKSKVAGKMHGCGHDAHTTMLLGAAKLLNERKDKLNGTVRLVFQPAEEGGAGAYHMIK  186

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
            EGAL D +++FGMHV    P G+I
Sbjct  187  EGALGDAEAIFGMHVDFKRPTGSI  210



>dbj|BAC20816.1| putative IAA amidohydrolase [Oryza sativa Japonica Group]
Length=438

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 132/168 (79%), Gaps = 3/168 (2%)
 Frame = +3

Query  156  RDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSG  335
            R+P   +WL+ VRR +H +PEL FEE RTS+L+R ELD++G+ Y WPVA+TGVVA I  G
Sbjct  44   REPGMAEWLRGVRRRIHRHPELAFEEVRTSELVRAELDAIGVPYQWPVARTGVVATIAGG  103

Query  336  NQ---PWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKES  506
                 P   LRADMDALP+QELV+WEHKS+ NGKMHACGHDAH  MLLGAA+LLQ RK  
Sbjct  104  GGGDGPVVALRADMDALPVQELVDWEHKSQENGKMHACGHDAHTAMLLGAAKLLQKRKNE  163

Query  507  LKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LKGTVKLVFQPAEEG  GAY++++EG LDD  +MFGMHV P +PVG +
Sbjct  164  LKGTVKLVFQPAEEGSAGAYYVLQEGVLDDVSAMFGMHVDPALPVGVV  211



>ref|XP_007039231.1| IAA-leucine-resistant-like 3 [Theobroma cacao]
 gb|EOY23732.1| IAA-leucine-resistant-like 3 [Theobroma cacao]
Length=435

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 140/178 (79%), Gaps = 3/178 (2%)
 Frame = +3

Query  120  VSQLTRD-LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWP  296
            + Q  RD LL SA+  +  DWL  +RR +HE PEL F+EH TS LIR +LD +GI YS+P
Sbjct  29   LDQDYRDQLLSSAQKDK--DWLVSIRRQIHENPELCFQEHNTSALIRQQLDQIGIPYSYP  86

Query  297  VAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGA  476
            +A TG+VA IGSG++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHDAH TMLLGA
Sbjct  87   IAGTGIVAQIGSGSKPVVALRADMDALPLQELVEWEHKSKIDGKMHACGHDAHTTMLLGA  146

Query  477  ARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            A+LL  RK+ LKGT +L+FQPAEEG  GA HMI+EGAL D +++FGMH+  G P G+I
Sbjct  147  AKLLNQRKDRLKGTARLLFQPAEEGGAGASHMIREGALGDAEAIFGMHIDNGSPTGSI  204



>ref|XP_003628629.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|AET03105.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=433

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 137/188 (73%), Gaps = 7/188 (4%)
 Frame = +3

Query  87   CSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNEL  266
            CS QT       S L   +L+ A +P    W+K++RR +HEYPELG+EE RTS +IR EL
Sbjct  28   CSNQT-------SSLKNQILEVANNPNTVKWMKQIRREIHEYPELGYEEFRTSSVIRREL  80

Query  267  DSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGH  446
            D LGI Y WPVAKTGVVA IGSG  P+  LRADMDALPIQELV+W+HKSK++GKMHAC H
Sbjct  81   DKLGISYQWPVAKTGVVAKIGSGFPPFVALRADMDALPIQELVDWDHKSKVDGKMHACAH  140

Query  447  DAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVW  626
            DAHV MLLGAA++LQ  K  LK TV L+FQPAEE   GA  MI+E  L+D +++FG+H+ 
Sbjct  141  DAHVAMLLGAAKILQEMKNKLKATVVLIFQPAEEKGIGARDMIQENVLEDVEAIFGLHLA  200

Query  627  PGMPVGTI  650
               P+G +
Sbjct  201  TQYPLGVV  208



>dbj|BAJ92528.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            D LD+A    F  WL+ VRR +H+YPEL F E+RTS L+R ELD++G+ YSWPVA+TGVV
Sbjct  31   DFLDAAHASGFAAWLRSVRRRIHQYPELAFHEYRTSSLVRAELDTIGVSYSWPVAQTGVV  90

Query  318  AAI-GSGNQ-PWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQ  491
            A I GSG   P   LRADMDALP+QELV+ E+KS+ +GKMHACGHDAH +MLLGAA+LL 
Sbjct  91   ATIVGSGGAGPVVALRADMDALPLQELVDSEYKSQESGKMHACGHDAHTSMLLGAAKLLH  150

Query  492  NRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            + K+ +KGTVKLVFQPAEEG  GAYH+++EG LDD  ++FG+HV P +PVGT+
Sbjct  151  SWKDYIKGTVKLVFQPAEEGYAGAYHVLEEGVLDDVSAIFGLHVDPSLPVGTV  203



>gb|KFK27232.1| hypothetical protein AALP_AA8G354700 [Arabis alpina]
Length=438

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = +3

Query  102  RLGSE----TVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELD  269
            R+ SE    T   +  + L+SA++PE FDW+ R+RR LHE PELGFEE  TS+LIR+ELD
Sbjct  18   RVSSESPLTTGGDVKNNFLESAKNPEVFDWMVRIRRKLHENPELGFEEFETSKLIRSELD  77

Query  270  SLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHD  449
             LG+ Y +PVA TGV+  IG+G  P+  LRADMDAL IQE VEWEHKSKI GKMHACGHD
Sbjct  78   LLGVKYRYPVAITGVIGYIGTGEPPFVALRADMDALLIQEAVEWEHKSKIPGKMHACGHD  137

Query  450  AHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWP  629
             HVTMLLGAA++LQ  +  L+GTV L+FQPAEEG+GGA  M++EGAL + +++FG+H+  
Sbjct  138  GHVTMLLGAAKMLQEHRHELQGTVVLIFQPAEEGLGGAKKMVEEGALKNVEAIFGIHLSN  197

Query  630  GMPVG  644
             +P G
Sbjct  198  RIPFG  202



>gb|AFK39723.1| unknown [Medicago truncatula]
Length=391

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = +3

Query  90   SLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELD  269
            + QT+  S   S L  ++L+ A  P    W+K +RR +HEYPEL +EE +TS +IR ELD
Sbjct  29   TYQTKECSNQTSSLKSEILELANTPNTVKWMKNIRREIHEYPELAYEEFKTSSVIRRELD  88

Query  270  SLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHD  449
             LG+ Y WPVAKTGVVA +GSG  P+  LRADMDALPIQELV+W+HKSK++GKMHAC HD
Sbjct  89   KLGVVYQWPVAKTGVVAKVGSGFAPFVALRADMDALPIQELVDWDHKSKVDGKMHACAHD  148

Query  450  AHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWP  629
            AHV MLLGAA++LQ  K+ LKGTV L+FQPAEE   GA  MI+E  L+D +++FG+H+  
Sbjct  149  AHVAMLLGAAKILQEMKDKLKGTVVLIFQPAEEKGTGAKDMIQENVLEDVEAIFGLHLAS  208

Query  630  GMPVGTI  650
              P+G +
Sbjct  209  LYPLGVV  215



>ref|XP_012072817.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Jatropha curcas]
 gb|KDP37575.1| hypothetical protein JCGZ_08266 [Jatropha curcas]
Length=438

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 135/172 (78%), Gaps = 2/172 (1%)
 Frame = +3

Query  135  RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGV  314
            + +L SA+  +  DWL  +RR +H+ PEL FEEH TS LIR+ELD LGI Y +PVAKTGV
Sbjct  33   QQILSSAQQDK--DWLVSIRRQIHQNPELRFEEHNTSALIRSELDRLGIPYEYPVAKTGV  90

Query  315  VAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQN  494
            VA IG G++P   LRADMDALP+QELVEWEHKSKI+GKMHACGHDAH TMLLGAARLL  
Sbjct  91   VAKIGYGSRPAVALRADMDALPLQELVEWEHKSKIDGKMHACGHDAHTTMLLGAARLLNQ  150

Query  495  RKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            RK  LKGTV+L+FQPAEEG  GA HMIKEGAL + +++F MH+   +P G I
Sbjct  151  RKHKLKGTVRLLFQPAEEGGAGASHMIKEGALGNAEAIFSMHISTQLPTGKI  202



>ref|XP_003557334.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 9 [Brachypodium 
distachyon]
Length=436

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = +3

Query  141  LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVA  320
            LL +AR P   +WL+ VRR +H  PEL F+EHRTS+L+R EL+++G+ Y+WPVA+TGVVA
Sbjct  37   LLGAARAPGVTEWLRGVRRRIHRRPELAFQEHRTSELVRAELEAIGVSYAWPVARTGVVA  96

Query  321  AIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRK  500
             IGSG  P   LRADMDALP+QELV+WE+KS+ NGKMHACGHDAH  MLLGAA+LLQ+RK
Sbjct  97   TIGSGGAPVVALRADMDALPLQELVDWEYKSQENGKMHACGHDAHTAMLLGAAKLLQSRK  156

Query  501  ESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            + LKGTVKLVFQPAEEG GGAY++++EGAL D  ++FG+HV P +PVG +
Sbjct  157  DDLKGTVKLVFQPAEEGNGGAYYVLEEGALHDASAIFGLHVDPALPVGVV  206



>gb|AFK43667.1| unknown [Lotus japonicus]
Length=426

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
            C +L   +  E      + +L +A   +  DWL +VRR +HE+PELGFEEH TS LIR+E
Sbjct  15   CVNLSALVWCEGDDDYAKAILSAANKDK--DWLVQVRREIHEHPELGFEEHNTSALIRSE  72

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LD LGI Y++PVAKTG+VA IGSG++P   +RADMDALP+QELVEWEHKSKI+G+MHACG
Sbjct  73   LDKLGITYTYPVAKTGIVAQIGSGSRPIIAIRADMDALPLQELVEWEHKSKIDGRMHACG  132

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HDAH TMLLGAA+LL  R++ L+GTV+L+FQPAEEG  GA  +IKEG L D +++F +H+
Sbjct  133  HDAHTTMLLGAAKLLHQRQDKLQGTVRLIFQPAEEGARGASQVIKEGVLQDTEAIFAVHI  192

Query  624  WPGMPVGTI  650
                P G I
Sbjct  193  DAETPTGAI  201



>gb|EMT32322.1| IAA-amino acid hydrolase ILR1-like protein 4 [Aegilops tauschii]
Length=446

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = +3

Query  69   SSPWHCCSLQTRLGSETVSQLTR---DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHR  239
            S+ +  C  + R    TV  +      LL+ AR PEF  W+  VRR +H++PEL F+EHR
Sbjct  22   SAKFISCPPRLRPARYTVIPMVTAAAQLLEEARAPEFAAWMLGVRRRIHQHPELAFQEHR  81

Query  240  TSQLIRNELDSLGIGYSWPVAKTGVVAAIGS--GNQPWFGLRADMDALPIQELVEWEHKS  413
            TS L+R ELD++G+ Y+WPVA+TG VA   S  G  P F LRADMDALPIQE+VEWE KS
Sbjct  82   TSALVRAELDAIGVPYAWPVARTGGVATTASTHGPGPVFALRADMDALPIQEMVEWELKS  141

Query  414  KINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALD  593
            K +GKMHACGHDAH  MLLGAARLL++RK+ LKGTVKLVFQPAEEG  G YH+++EG LD
Sbjct  142  KEDGKMHACGHDAHTAMLLGAARLLRSRKDHLKGTVKLVFQPAEEGHAGGYHVLQEGVLD  201

Query  594  DFQSMFGMHVWPGMPVGTI  650
            D  ++F +H+   +PVGT+
Sbjct  202  DVDAIFAVHIDTHLPVGTV  220



>ref|XP_006483777.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1-like [Citrus 
sinensis]
Length=444

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 147/204 (72%), Gaps = 2/204 (1%)
 Frame = +3

Query  39   CVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPE  218
             ++ +L   +SS     + QT       S +   +++ A D +  +W+K++RR +HE PE
Sbjct  17   TIFASLNFLLSSNEKSLNFQTSKSQN--SSIKSRIIELANDQDTVNWMKKMRRQIHENPE  74

Query  219  LGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVE  398
            L +EE  TS+LIR ELD LGI Y WPVAKTGVVA +GSG+ P+  LRADMDALPIQELVE
Sbjct  75   LAYEEFETSELIRRELDQLGIAYRWPVAKTGVVATVGSGSPPFVALRADMDALPIQELVE  134

Query  399  WEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIK  578
            WEHKSKI+GKMHACGHDAHV MLLGAA++LQ  +E+LKGTV L+FQPAEE   GA  MI+
Sbjct  135  WEHKSKIDGKMHACGHDAHVAMLLGAAKILQEMRETLKGTVVLIFQPAEERGTGAKDMIQ  194

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
            EG L++ +++FG+H+    P G +
Sbjct  195  EGVLENVEAIFGLHLVHKYPTGVV  218



>gb|KDO82610.1| hypothetical protein CISIN_1g013395mg [Citrus sinensis]
Length=444

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 147/204 (72%), Gaps = 2/204 (1%)
 Frame = +3

Query  39   CVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPE  218
             ++ +L   +SS     + QT       S +   +++ A D +  +W+K++RR +HE PE
Sbjct  17   TIFASLNFLLSSNEKSLNFQTSKSQN--SSIKSRIIELANDQDTVNWMKKMRRQIHENPE  74

Query  219  LGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVE  398
            L +EE  TS+LIR ELD LGI Y WPVAKTGVVA +GSG+ P+  LRADMDALPIQELVE
Sbjct  75   LAYEEFETSELIRRELDQLGIAYRWPVAKTGVVATVGSGSPPFVALRADMDALPIQELVE  134

Query  399  WEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIK  578
            WEHKSKI+GKMHACGHDAHV MLLGAA++LQ  +E+LKGTV L+FQPAEE   GA  MI+
Sbjct  135  WEHKSKIDGKMHACGHDAHVAMLLGAAKILQEMRETLKGTVVLIFQPAEERGTGAKDMIQ  194

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
            EG L++ +++FG+H+    P G +
Sbjct  195  EGVLENVEAIFGLHLVHKYPTGVV  218



>ref|XP_006438487.1| hypothetical protein CICLE_v10031540mg [Citrus clementina]
 gb|ESR51727.1| hypothetical protein CICLE_v10031540mg [Citrus clementina]
Length=444

 Score =   236 bits (603),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 147/204 (72%), Gaps = 2/204 (1%)
 Frame = +3

Query  39   CVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPE  218
             ++ +L   +SS     + QT       S +   +++ A D +  +W+K++RR +HE PE
Sbjct  17   TIFASLNFLLSSNEKSLNFQTSKSQN--SSIKSRIIELANDQDTVNWMKKMRRQIHENPE  74

Query  219  LGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVE  398
            L +EE  TS+LIR ELD LGI Y WPVAKTGVVA +GSG+ P+  LRADMDALPIQELVE
Sbjct  75   LAYEEFETSELIRRELDQLGIAYRWPVAKTGVVATVGSGSPPFVALRADMDALPIQELVE  134

Query  399  WEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIK  578
            WEHKSKI+GKMHACGHDAHV MLLGAA++LQ  +E+LKGTV L+FQPAEE   GA  MI+
Sbjct  135  WEHKSKIDGKMHACGHDAHVAMLLGAAKILQEMRETLKGTVVLIFQPAEERGTGAKDMIQ  194

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
            EG L++ +++FG+H+    P G +
Sbjct  195  EGVLENVEAIFGLHLVHKYPTGVV  218



>ref|XP_004241428.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Solanum lycopersicum]
Length=430

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 133/175 (76%), Gaps = 2/175 (1%)
 Frame = +3

Query  126  QLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAK  305
            +  + +L SA   +  DWL  +RR +HEYPEL FEE+ TS LIR+ELD LG+ Y +P AK
Sbjct  30   EFVKQILSSASKDK--DWLVSIRRKIHEYPELRFEEYNTSALIRSELDKLGVYYEYPFAK  87

Query  306  TGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARL  485
            TG+VA IG+G+ P   LRADMDALP+QELVEWEHKSKINGKMH CGHDAH TMLLGAA+L
Sbjct  88   TGIVARIGNGSPPVVALRADMDALPMQELVEWEHKSKINGKMHGCGHDAHTTMLLGAAKL  147

Query  486  LQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            L  RK+ L GTV+LVFQPAEEG  GA HMIKEGAL D + +FGMHV    P G I
Sbjct  148  LNERKDKLNGTVRLVFQPAEEGGAGANHMIKEGALGDAEVIFGMHVDFKRPTGGI  202



>ref|XP_002459630.1| hypothetical protein SORBIDRAFT_02g007730 [Sorghum bicolor]
 gb|EER96151.1| hypothetical protein SORBIDRAFT_02g007730 [Sorghum bicolor]
Length=446

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 141/182 (77%), Gaps = 6/182 (3%)
 Frame = +3

Query  123  SQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVA  302
            S L  DLL +A  P F  WL+ +RR +HE PEL F+EHRTS+L+R ELD++G+ Y+WPVA
Sbjct  38   SSLGDDLLGAAGAPGFAAWLRGLRRRIHERPELAFQEHRTSELVRAELDAIGVPYAWPVA  97

Query  303  KTGVVAAIGSG------NQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTM  464
            +TGVVA I  G      + P   LRADMDALP+QELV+WEHKSK +GKMHACGHDAH TM
Sbjct  98   QTGVVATIAPGGGGRASDGPVVALRADMDALPLQELVDWEHKSKESGKMHACGHDAHTTM  157

Query  465  LLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVG  644
            LLGAA+LL  RK+ LKGTV+L+FQP EEG  GAYH+IKEG LDD  ++FG+HV P +PVG
Sbjct  158  LLGAAKLLHARKDDLKGTVRLIFQPGEEGHAGAYHVIKEGVLDDVSAIFGLHVDPRLPVG  217

Query  645  TI  650
            T+
Sbjct  218  TV  219



>ref|XP_002466140.1| hypothetical protein SORBIDRAFT_01g002090 [Sorghum bicolor]
 gb|EER93138.1| hypothetical protein SORBIDRAFT_01g002090 [Sorghum bicolor]
Length=417

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 138/177 (78%), Gaps = 3/177 (2%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            L R+LLD AR P F +W + VRR +H++PEL F+EHRTS L+R ELD++G+ Y WPVA+T
Sbjct  7    LARELLDEARAPGFAEWQRGVRRRIHQHPELAFQEHRTSALVRAELDAIGVPYVWPVAQT  66

Query  309  GVVAAIGSGNQPWFG---LRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            GVVA I            LRADMDALPIQE+VEWE KSK +GKMHACGHDAHV MLLGAA
Sbjct  67   GVVATIAGPAAAGGAVFALRADMDALPIQEMVEWEFKSKEDGKMHACGHDAHVAMLLGAA  126

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ+R+ +LKGTVKLVFQPAEEG  G YH++KEG LDD Q++F +HV  G+PVG +
Sbjct  127  KLLQSRRRNLKGTVKLVFQPAEEGHAGGYHVLKEGVLDDVQAIFAVHVDTGLPVGLV  183



>gb|AET03754.2| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=425

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 138/188 (73%), Gaps = 0/188 (0%)
 Frame = +3

Query  87   CSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNEL  266
             + QT+  S   S L  ++L+ A  P    W+K +RR +HEYPEL +EE +TS +IR EL
Sbjct  28   TTYQTKECSNQTSSLKSEILELANTPNTVKWMKNIRREIHEYPELAYEEFKTSSVIRREL  87

Query  267  DSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGH  446
            D LG+ Y WPVAKTGVVA +GSG  P+  LRADMDALPIQELV+W+HKSK++GKMHAC H
Sbjct  88   DKLGVVYQWPVAKTGVVAKVGSGFAPFVALRADMDALPIQELVDWDHKSKVDGKMHACAH  147

Query  447  DAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVW  626
            DAHV MLLGAA++LQ  K+ LKGTV L+FQPAEE   GA  MI+E  L+D +++FG+H+ 
Sbjct  148  DAHVAMLLGAAKILQEMKDKLKGTVVLIFQPAEEKGTGAKDMIQENVLEDVEAIFGLHLA  207

Query  627  PGMPVGTI  650
               P+G +
Sbjct  208  SLYPLGVV  215



>ref|XP_003629278.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=424

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 138/188 (73%), Gaps = 0/188 (0%)
 Frame = +3

Query  87   CSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNEL  266
             + QT+  S   S L  ++L+ A  P    W+K +RR +HEYPEL +EE +TS +IR EL
Sbjct  27   TTYQTKECSNQTSSLKSEILELANTPNTVKWMKNIRREIHEYPELAYEEFKTSSVIRREL  86

Query  267  DSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGH  446
            D LG+ Y WPVAKTGVVA +GSG  P+  LRADMDALPIQELV+W+HKSK++GKMHAC H
Sbjct  87   DKLGVVYQWPVAKTGVVAKVGSGFAPFVALRADMDALPIQELVDWDHKSKVDGKMHACAH  146

Query  447  DAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVW  626
            DAHV MLLGAA++LQ  K+ LKGTV L+FQPAEE   GA  MI+E  L+D +++FG+H+ 
Sbjct  147  DAHVAMLLGAAKILQEMKDKLKGTVVLIFQPAEEKGTGAKDMIQENVLEDVEAIFGLHLA  206

Query  627  PGMPVGTI  650
               P+G +
Sbjct  207  SLYPLGVV  214



>ref|XP_011626860.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 isoform X1 [Amborella 
trichopoda]
Length=448

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 140/179 (78%), Gaps = 3/179 (2%)
 Frame = +3

Query  123  SQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVA  302
            ++   D+L  A+ PE  +WL+ +RR++HE+PELGFEE  TS+L+R +LD LG+ Y WPVA
Sbjct  28   AETPTDILQRAKQPEMLEWLRHIRRSIHEHPELGFEEFETSKLVRRKLDELGVQYKWPVA  87

Query  303  KTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAAR  482
             TGVV  IGSG  P+  +RADMDALPI+E VEWEHKSKI GKMHACGHDAH+TMLLGAA+
Sbjct  88   VTGVVGFIGSGRPPFVAIRADMDALPIEEAVEWEHKSKIPGKMHACGHDAHITMLLGAAK  147

Query  483  LLQNRKESL---KGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LQ RK+ L   +GTV L+FQPAEEG GGA  MI+ GAL++ +++FGMHV P + +G +
Sbjct  148  ILQERKDDLQLQQGTVVLLFQPAEEGGGGAKKMIEAGALENVEAIFGMHVVPDIHIGAV  206



>ref|XP_007136362.1| hypothetical protein PHAVU_009G038900g [Phaseolus vulgaris]
 gb|ESW08356.1| hypothetical protein PHAVU_009G038900g [Phaseolus vulgaris]
Length=428

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = +3

Query  54   LIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEE  233
            LI AIS      S  T  G E      +++LD+A+  +  +WL  VRR +HE+PEL F+E
Sbjct  5    LIAAISLLGVFLSSSTVFGYEEDEVYAKEILDAAQKEK--EWLVSVRRQIHEHPELAFQE  62

Query  234  HRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKS  413
            H TS LIR +L  LGI Y++PVAKTGVVA +GSG++P   +RADMDALP+QELVEWEHKS
Sbjct  63   HNTSSLIRAQLHKLGIPYTYPVAKTGVVAQLGSGSRPIIAIRADMDALPMQELVEWEHKS  122

Query  414  KINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALD  593
            KI+G+MHACGHDAH TMLLGAA+LL  R++ L+GTV+L+FQPAEEG  GA  MIKEG L 
Sbjct  123  KIDGRMHACGHDAHTTMLLGAAKLLSQRQDKLQGTVRLIFQPAEEGARGASQMIKEGVLQ  182

Query  594  DFQSMFGMHVWPGMPVGTI  650
            D +++F +H+    P G I
Sbjct  183  DAEAIFSLHIDATTPTGAI  201



>ref|XP_004955918.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 9-like isoform 
X2 [Setaria italica]
Length=434

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = +3

Query  123  SQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVA  302
            + L  +LL  AR P F  WL+ VRR +H+ PEL F+E+RTS+L+R ELD++G+ Y WPVA
Sbjct  30   TPLAGELLAEARAPGFAAWLRGVRRRIHQRPELAFQEYRTSELVRAELDAIGVPYRWPVA  89

Query  303  KTGVVAAIGSG---NQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLG  473
            +TGVVA I  G   N P   LRADMDALP+QELV+WE+KS+  GKMHACGHDAH  MLLG
Sbjct  90   QTGVVATIVGGAGDNGPIVALRADMDALPVQELVDWEYKSQEKGKMHACGHDAHTAMLLG  149

Query  474  AARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            AA++LQ+ K  LKGTVK VFQPAEEG GGAY++++EG LDD  ++FG+HV P +PVG +
Sbjct  150  AAKILQDHKSDLKGTVKFVFQPAEEGQGGAYYILQEGLLDDVSAIFGLHVDPVLPVGVV  208



>ref|XP_010446503.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Camelina sativa]
Length=433

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 0/159 (0%)
 Frame = +3

Query  174  DWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFG  353
            DWL  VRR +HE PEL FE H+TS LIR ELD LG+ YS+PVAKTG+VA IGSG+ P   
Sbjct  42   DWLVSVRRQIHENPELLFELHKTSALIRRELDELGVSYSYPVAKTGIVAQIGSGSPPVVA  101

Query  354  LRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVF  533
            LRADMDALP+QELVEW+HKSKI+GKMHACGHD+H TMLLGAA+LL  RK  LKGTV+L+F
Sbjct  102  LRADMDALPLQELVEWDHKSKIDGKMHACGHDSHTTMLLGAAKLLSKRKNKLKGTVRLLF  161

Query  534  QPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            QPAEEG  GA++MIK+GAL + +++FGMH+   +P G +
Sbjct  162  QPAEEGGAGAFYMIKDGALGESEAIFGMHIDTDLPTGEV  200



>gb|ABR16872.1| unknown [Picea sitchensis]
Length=456

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = +3

Query  114  ETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSW  293
            E+     + LL  A+  E F+WLK +RR +H  PEL FEE  TS+LIR+ELD++G+ Y W
Sbjct  50   ESAVTEAQGLLKDAKGEETFEWLKSIRRRIHRNPELKFEEFNTSKLIRDELDAMGVHYEW  109

Query  294  PVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLG  473
            P A+TGVVA IGSG  P   LRADMDALP+QELV+WEHKS   GKMHACGHDAHVTMLLG
Sbjct  110  PFAQTGVVATIGSGTAPVVALRADMDALPLQELVDWEHKSVNIGKMHACGHDAHVTMLLG  169

Query  474  AARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            AA+LL   K+ L+GTV+L+FQPAEEG  GA HMI+EGAL D +++F MHV PG+  G I
Sbjct  170  AAKLLHKHKDKLQGTVRLIFQPAEEGGAGAAHMIREGALGDAEAIFAMHVTPGLSTGAI  228



>ref|XP_003530010.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=441

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 150/209 (72%), Gaps = 8/209 (4%)
 Frame = +3

Query  30   SFRCVWFALIVAI--SSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTL  203
            SF+  WF L +    S+     SL     +++ +QL+ + L+ A+ PE FDW+ ++RR +
Sbjct  3    SFKT-WFNLFIIFLASAATPIFSL-----TDSPNQLSTNFLEIAKKPEVFDWMVKIRRKI  56

Query  204  HEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPI  383
            HE PELG+EE  TS+LIR ELD LG+ Y  PVA TG++  IG+G  P+  +R DMDALPI
Sbjct  57   HENPELGYEEFETSKLIREELDKLGVPYKHPVAVTGIIGFIGTGKSPFVAIRTDMDALPI  116

Query  384  QELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGA  563
            QE+VEWEHKSK+ GKMHACGHDAHV MLLGAA++L+  ++ L+GTV LVFQPAEEG  GA
Sbjct  117  QEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKILKQHEKQLQGTVVLVFQPAEEGGAGA  176

Query  564  YHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              ++  GALD+  ++FG+HV P +PVG +
Sbjct  177  KKILDAGALDNVTAIFGLHVTPDIPVGEV  205



>ref|XP_002864304.1| hypothetical protein ARALYDRAFT_495494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40563.1| hypothetical protein ARALYDRAFT_495494 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 135/175 (77%), Gaps = 2/175 (1%)
 Frame = +3

Query  126  QLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAK  305
            + +R LL  A   +  +WL  +RR +HE PEL FE H+TS LIR ELD LG+ YS+PVAK
Sbjct  26   EYSRQLLTEALGDK--EWLVSIRRQIHENPELLFELHKTSALIRRELDELGVSYSYPVAK  83

Query  306  TGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARL  485
            TG+VA IGSG  P   LRADMDALP+QELVEW+HKSKI+GKMHACGHD+H TMLLGAA+L
Sbjct  84   TGIVAQIGSGYPPVVALRADMDALPLQELVEWDHKSKIDGKMHACGHDSHTTMLLGAAKL  143

Query  486  LQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            L  RK    GTV+L+FQPAEEG  GA+HMIKEGAL D +++FGMHV  G+P G +
Sbjct  144  LSKRKRMYNGTVRLLFQPAEEGGAGAFHMIKEGALGDSEAIFGMHVHTGLPTGEL  198



>ref|XP_010272050.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 2 [Nelumbo nucifera]
Length=439

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 145/201 (72%), Gaps = 2/201 (1%)
 Frame = +3

Query  54   LIVAISSPWHCCSLQ--TRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGF  227
            +  A S+   C   Q    LGSE    +  +++  +  P+  +WLK++RR +HE+PEL +
Sbjct  13   IFAACSNQQPCLGKQGFDSLGSEGNPSIRDEIIRLSNAPDTVNWLKKIRRKIHEHPELAY  72

Query  228  EEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEH  407
            EE+ TS+LIR+ELD +GI Y WPVAKTGVVA IGSG+ P+  LRADMDALPIQE+VEWEH
Sbjct  73   EEYETSKLIRSELDQMGIEYRWPVAKTGVVATIGSGSPPFVALRADMDALPIQEMVEWEH  132

Query  408  KSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGA  587
            KSK+ GKMHACGHDAHVTMLLGAA++LQ  + +LKGTV L+FQPAEE   GA  M +EGA
Sbjct  133  KSKVAGKMHACGHDAHVTMLLGAAKILQELRTTLKGTVVLIFQPAEERGDGALKMAEEGA  192

Query  588  LDDFQSMFGMHVWPGMPVGTI  650
            L + +++F MH     P G +
Sbjct  193  LRNVEAIFAMHTVYQYPTGVV  213



>ref|XP_004146834.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Cucumis sativus]
 gb|KGN59844.1| hypothetical protein Csa_3G850490 [Cucumis sativus]
Length=449

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 145/208 (70%), Gaps = 1/208 (0%)
 Frame = +3

Query  27   ASFRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLH  206
            AS R + + LI  +       S  + L S    ++ +  L  A++ E FDW+  +RR +H
Sbjct  6    ASLRWISWILIAHLFVSTFVHSDSSSL-SNNPQEIPKKFLQFAKESELFDWMVGIRRKIH  64

Query  207  EYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQ  386
            E PELGFEE  TS+LIR ELD LGI Y +PVA TGV+  +GSG  P+  +RADMDALP+Q
Sbjct  65   ENPELGFEEFETSKLIRTELDKLGISYKYPVASTGVIGFVGSGQPPFVAIRADMDALPMQ  124

Query  387  ELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAY  566
            ELVEWEHKSK+ GKMHACGHDAHV M+LGAA++LQ   E LKGTV LVFQPAEEG GGA 
Sbjct  125  ELVEWEHKSKVPGKMHACGHDAHVAMVLGAAKILQKHSEELKGTVVLVFQPAEEGGGGAM  184

Query  567  HMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             +I+ G LD+  ++FG+H+   +P+G +
Sbjct  185  KIIEAGVLDNVNAIFGLHIVHNIPIGKV  212



>ref|XP_004955917.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 9-like isoform 
X1 [Setaria italica]
Length=458

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 137/179 (77%), Gaps = 5/179 (3%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            L  DLL +AR P F  WL+ VRR +HE PEL F+EHRTS+L+R ELD++G+ Y WPVA+T
Sbjct  54   LGGDLLGTARAPGFATWLRGVRRRIHERPELAFQEHRTSELVRAELDAIGVPYVWPVAQT  113

Query  309  GVVAAIGSGNQ-----PWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLG  473
            GVVA I  G       P   LRADMDALP+QELV+WE+KS+  GKMHACGHDAH  MLLG
Sbjct  114  GVVATIAGGGGGGGDGPVVALRADMDALPLQELVDWEYKSQEKGKMHACGHDAHTAMLLG  173

Query  474  AARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            AA++LQ+ K  LKGTVK VFQPAEEG GGAY++++EG LDD  ++FG+HV P +PVG +
Sbjct  174  AAKILQDHKSDLKGTVKFVFQPAEEGQGGAYYILQEGLLDDVSAIFGLHVDPVLPVGVV  232



>gb|KHN11323.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=444

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            +++ +QL+ + L++A+ PE FDW+ ++RR +HE PELG+EE  TS+LIR ELD LGI Y 
Sbjct  26   TDSSNQLSTNYLENAKKPEVFDWMVKIRRKIHENPELGYEEFETSKLIREELDKLGISYK  85

Query  291  WPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLL  470
             PVA TGV+  IG+G+ P+  +R DMDALPIQE+VEWEHKSK+ GKMHAC HDAHV MLL
Sbjct  86   HPVAVTGVIGYIGTGSSPFVAIRTDMDALPIQEMVEWEHKSKVPGKMHACAHDAHVAMLL  145

Query  471  GAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GAA++L+  ++ L+GT+ LVFQPAEEG  GA  ++  GALD+  ++FG+HV P +PVG +
Sbjct  146  GAAKILKQHEKQLQGTIVLVFQPAEEGGAGAKKILDTGALDNVIAIFGLHVKPEIPVGEV  205



>ref|XP_006281445.1| hypothetical protein CARUB_v10027523mg [Capsella rubella]
 gb|EOA14343.1| hypothetical protein CARUB_v10027523mg [Capsella rubella]
Length=441

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 145/209 (69%), Gaps = 9/209 (4%)
 Frame = +3

Query  24   SASFRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTL  203
            S +F+ V   L V+  SPW             V+Q     L+ AR PE FD + R+RR +
Sbjct  10   SLTFQLVSLLLRVSSESPWITGD---------VTQTPMKYLELARSPEVFDSMVRIRRKI  60

Query  204  HEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPI  383
            HE PELG+EE  TS+LIR+ELD +G+ Y +PVA TGV+  IGSG  P+  LRADMDALPI
Sbjct  61   HENPELGYEEFETSKLIRSELDLIGVKYRYPVAITGVIGYIGSGEPPFVALRADMDALPI  120

Query  384  QELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGA  563
            QE VEWEH+SKI GKMHACGHD HV MLLGAA++LQ  +  L+GTV L+FQPAEEG+ GA
Sbjct  121  QEAVEWEHRSKIPGKMHACGHDGHVAMLLGAAKILQKHRHDLQGTVVLIFQPAEEGLRGA  180

Query  564  YHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              MI+EGAL + +++FG+H+   +P G +
Sbjct  181  KKMIEEGALKNVEAIFGIHLTNRIPFGKV  209



>dbj|BAJ90175.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92705.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   234 bits (596),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            D LD+A    F  WL+ VRR +H+YPEL F E+RTS L+R ELD++G+ YSWPVA+TGVV
Sbjct  31   DFLDAAHASGFAAWLRSVRRRIHQYPELAFHEYRTSSLVRAELDTIGVSYSWPVAQTGVV  90

Query  318  AAI-GSGNQ-PWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQ  491
            A I GSG   P   LRADMDALP+QELV+ E+KS+ +GKMHACGHDAH +MLLGAA+LL 
Sbjct  91   ATIVGSGGAGPVVALRADMDALPLQELVDSEYKSQESGKMHACGHDAHTSMLLGAAKLLH  150

Query  492  NRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            + K+ +KGTVKLVFQPAEEG  GAYH+++EG LDD  ++FG+HV P +PVGT+
Sbjct  151  SWKDYIKGTVKLVFQPAEEGYAGAYHVLEEGVLDDVSAIFGLHVDPSLPVGTV  203



>gb|ACZ56436.1| IAA-amino acid hydrolase [Populus tomentosa]
Length=432

 Score =   234 bits (596),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +3

Query  141  LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVA  320
            L  S RD E   WL  + R +HE PEL FEEH TS LIR+ELD L I Y++P+AKTG+VA
Sbjct  37   LSSSQRDKE---WLITITRQIHENPELRFEEHNTSALIRSELDKLAISYTYPLAKTGIVA  93

Query  321  AIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRK  500
             IGSG+ P   LRADMDALP+QELVEWEHKSK++GKMH CGHDAH TMLLGAA LL  RK
Sbjct  94   QIGSGSPPVVALRADMDALPLQELVEWEHKSKVDGKMHGCGHDAHTTMLLGAANLLNERK  153

Query  501  ESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              LKGTV+L+FQPAEEG  GA HMIK+GAL D +++FGMHV   +P GTI
Sbjct  154  HLLKGTVRLLFQPAEEGGAGASHMIKDGALGDAEAIFGMHVNYKIPTGTI  203



>gb|AFK46529.1| unknown [Lotus japonicus]
Length=447

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 148/206 (72%), Gaps = 3/206 (1%)
 Frame = +3

Query  36   RCV-WFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEY  212
            +C  +F +I+ + +     SL     S T +QL  + LD+A+ PEFFDW+ ++RR +H++
Sbjct  5    KCFHFFIIILQVFAAIAIFSLAD--SSLTQNQLFTNFLDTAKKPEFFDWMVKIRRKIHQF  62

Query  213  PELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQEL  392
            PEL +EE  TS++IR ELD LGI Y  PVA TGV+  IG+G  P+  +RADMDALPIQEL
Sbjct  63   PELRYEEFETSKVIRTELDKLGIPYKHPVAVTGVIGFIGTGKSPFVAIRADMDALPIQEL  122

Query  393  VEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHM  572
            VEWEH S++ GKMHACGHDAH TMLLGAA++L+  ++ + GTV LVFQP EEG  GA  +
Sbjct  123  VEWEHMSQVPGKMHACGHDAHTTMLLGAAKILKQHEQEINGTVVLVFQPGEEGGAGAKKI  182

Query  573  IKEGALDDFQSMFGMHVWPGMPVGTI  650
            ++ GAL +  ++FG+HV P +PVG +
Sbjct  183  LESGALKNVSAIFGLHVLPTLPVGEV  208



>ref|XP_002266978.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Vitis vinifera]
Length=445

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 142/195 (73%), Gaps = 4/195 (2%)
 Frame = +3

Query  78   WHCCSLQTRLGSETV----SQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTS  245
            + C +LQ  L S T+    S     +   A DP   +W+KR+RR +HE PEL +EE  TS
Sbjct  20   FSCLNLQYSLNSLTLPHRNSSSKEHITGLANDPITVNWMKRIRREIHENPELAYEEFATS  79

Query  246  QLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKING  425
             LIR EL+ LGIGY WP+A TGVVA IGSG+QP+  LR+DMDALPIQE+VEWEHKSK++G
Sbjct  80   ALIRRELEQLGIGYRWPIAGTGVVATIGSGSQPFVALRSDMDALPIQEMVEWEHKSKVDG  139

Query  426  KMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQS  605
            KMHACGHDAHV MLLGAA++LQ  ++ L GTV L+FQPAEE   GA  MI+EGAL++ ++
Sbjct  140  KMHACGHDAHVAMLLGAAKILQEIRDELPGTVVLIFQPAEERGVGAKAMIQEGALENVEA  199

Query  606  MFGMHVWPGMPVGTI  650
            +FG+H     P GT+
Sbjct  200  IFGVHAVIEYPTGTV  214



>ref|NP_001242429.1| uncharacterized protein LOC100790664 precursor [Glycine max]
 gb|ACU20016.1| unknown [Glycine max]
Length=444

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            +++ +QL+ + L++A+ PE FDW+ ++RR +HE PELG+EE  TS+LIR ELD LGI Y 
Sbjct  26   TDSSNQLSTNYLENAKKPEVFDWMVKIRRKIHENPELGYEEFETSKLIREELDKLGISYK  85

Query  291  WPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLL  470
             PVA TGV+  IG+G+ P+  +R DMDALPIQE+VEWEHKSK+ GKMHAC HDAHV MLL
Sbjct  86   HPVAVTGVIGYIGTGSSPFVAIRTDMDALPIQEMVEWEHKSKVPGKMHACAHDAHVAMLL  145

Query  471  GAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GAA +L+  ++ L+GT+ LVFQPAEEG  GA  ++  GALD+  ++FG+HV P +PVG +
Sbjct  146  GAAEILKQHEKQLQGTIVLVFQPAEEGGAGAKKILDTGALDNVIAIFGLHVKPEIPVGEV  205



>emb|CAG32960.1| putative auxin-amidohydrolase precursor [Populus tremula x Populus 
alba]
Length=432

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = +3

Query  141  LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVA  320
            L  S RD    DWL  +RR +HE PEL FEEH TS LIR+ELD L I Y++P+AKTG+VA
Sbjct  37   LSSSQRDK---DWLITIRRQIHENPELRFEEHNTSALIRSELDKLAISYTYPLAKTGIVA  93

Query  321  AIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRK  500
             IGSG+ P   LRADMDALP+QELV WEHKSK++GKMH CGHDAH TMLLGAA LL  RK
Sbjct  94   QIGSGSPPVVALRADMDALPLQELVVWEHKSKVDGKMHGCGHDAHTTMLLGAAELLNERK  153

Query  501  ESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
              LKGTV+L+FQPAEEG  GA HMIK+GAL D +++FGMHV   +P GTI
Sbjct  154  HLLKGTVRLLFQPAEEGGAGASHMIKDGALGDAEAVFGMHVNYKIPTGTI  203



>ref|XP_006343020.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Solanum 
tuberosum]
Length=445

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 145/205 (71%), Gaps = 1/205 (0%)
 Frame = +3

Query  36   RCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYP  215
            R V+  LI    SP    S  ++L S  +S++    LD A+  E FDW+  VRR +HE P
Sbjct  5    RWVFLILIFVSFSPIPIFS-DSQLRSGELSEIPSKFLDFAKKSEVFDWMMGVRRRIHENP  63

Query  216  ELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELV  395
            ELG+EE  TS+LIR ELD+LGI Y +P A TG+V  IGSG  P+  +RADMDALP+QE+V
Sbjct  64   ELGYEELETSKLIREELDNLGIQYKYPFANTGIVGFIGSGKPPFVAIRADMDALPMQEMV  123

Query  396  EWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMI  575
            +WEHKS+  GKMHACGHDAHV MLLGAA++L   +  LKGTV LVFQPAEEG GGA  MI
Sbjct  124  DWEHKSRNPGKMHACGHDAHVAMLLGAAKILLEHQNILKGTVALVFQPAEEGGGGAKKMI  183

Query  576  KEGALDDFQSMFGMHVWPGMPVGTI  650
              GAL++ +++FG+HV P  P+G +
Sbjct  184  DAGALENVEAIFGLHVHPNFPLGKV  208



>ref|XP_003531633.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
 gb|KHN11319.1| IAA-amino acid hydrolase ILR1-like 4 [Glycine soja]
Length=442

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 139/182 (76%), Gaps = 0/182 (0%)
 Frame = +3

Query  105  LGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIG  284
            L +++  QL  + LD+A+ PE FDW+ R+RR +HE PELG+EE  TS+LIR ELD L I 
Sbjct  24   LLADSSEQLPTNFLDAAKKPEVFDWMVRIRRKIHENPELGYEEFETSKLIREELDKLRIP  83

Query  285  YSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTM  464
            Y  PVA TGV+  IG+   P+  +RADMDALP+QE+VEWEHKSK+ GKMHACGHDAHVTM
Sbjct  84   YKHPVAITGVIGFIGTKRSPFVAIRADMDALPMQEMVEWEHKSKVPGKMHACGHDAHVTM  143

Query  465  LLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVG  644
            LLGAA++L+  ++ ++GTV LVFQPAEEG GGA  ++  GAL++  ++FG+HV P  P+G
Sbjct  144  LLGAAKILKQHEKEIQGTVVLVFQPAEEGGGGAKKILDAGALENVAAIFGLHVTPNFPIG  203

Query  645  TI  650
             +
Sbjct  204  EV  205



>ref|XP_010103068.1| IAA-amino acid hydrolase ILR1-like 3 [Morus notabilis]
 gb|EXB94717.1| IAA-amino acid hydrolase ILR1-like 3 [Morus notabilis]
Length=433

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 140/182 (77%), Gaps = 1/182 (1%)
 Frame = +3

Query  105  LGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIG  284
            L S+  S+  + +L +A+  +   WL  +RR +HEYPEL F+EH TS L+R +LD LGI 
Sbjct  25   LCSQDQSRYAKHILHTAQQRDK-PWLLSIRRRIHEYPELKFQEHNTSALLRAQLDQLGIS  83

Query  285  YSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTM  464
            YS+P+AKTG+VA IG+G+ P   LRADMDALP+QELVEWEHKSK++GKMH CGHDAH TM
Sbjct  84   YSYPLAKTGIVAQIGTGSPPVVALRADMDALPLQELVEWEHKSKVDGKMHGCGHDAHTTM  143

Query  465  LLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVG  644
            LLGAA+LL  RK+ LKGTV+L+FQP EEG  GA HMIKEGAL D +++FGMHV    P G
Sbjct  144  LLGAAKLLTERKDKLKGTVRLLFQPGEEGGAGASHMIKEGALGDAEAVFGMHVDFETPTG  203

Query  645  TI  650
            +I
Sbjct  204  SI  205



>ref|XP_010442989.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Camelina sativa]
Length=432

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +3

Query  174  DWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFG  353
            DWL  VRR +HE PEL FE H TS LIR ELD LG+ YS+PVAKTG+VA IGSG+ P   
Sbjct  40   DWLVSVRRQIHENPELLFELHETSALIRRELDELGVSYSYPVAKTGIVAQIGSGSPPVVA  99

Query  354  LRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVF  533
            LRADMDALP+QELVEW+HKSKI+GKMHACGHD+H TMLLGAA+LL  RK  LKGTV+L+F
Sbjct  100  LRADMDALPMQELVEWDHKSKIDGKMHACGHDSHTTMLLGAAKLLSKRKHKLKGTVRLLF  159

Query  534  QPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            QPAEEG  GA++MIK+GAL + +++FGMH+   +P G +
Sbjct  160  QPAEEGGAGAFYMIKDGALGESEAIFGMHIDTDLPTGEV  198



>ref|XP_011003274.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Populus euphratica]
Length=437

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = +3

Query  174  DWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFG  353
            DWL  +RR +HE PEL FEE+ TS LIR ELD LGI Y++PVAKTG+VA IGSG+ P   
Sbjct  45   DWLITIRRQIHENPELRFEEYNTSALIRRELDKLGISYTYPVAKTGIVAQIGSGSPPVVA  104

Query  354  LRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVF  533
            LRADMDALP+QELVEWEHKSK++GKMH CGHDAH  MLLGAA+LL  RK  LKGTV+L+F
Sbjct  105  LRADMDALPLQELVEWEHKSKVDGKMHGCGHDAHTAMLLGAAKLLNERKHMLKGTVRLLF  164

Query  534  QPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            QPAEE   GA HMIKEGAL D +++FGMH+   +P GTI
Sbjct  165  QPAEERGAGASHMIKEGALGDAEAIFGMHIDYTIPTGTI  203



>ref|XP_009119945.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Brassica rapa]
Length=428

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 135/172 (78%), Gaps = 3/172 (2%)
 Frame = +3

Query  135  RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGV  314
            R LL++  D    DWL  VRR +HE PEL +E H+TS LIR ELD LG+ YS+PVA+TG+
Sbjct  34   RLLLEAEADK---DWLVSVRRQIHENPELLYELHQTSALIRRELDQLGVSYSYPVAQTGI  90

Query  315  VAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQN  494
            VA IGSG+ P   LRADMDALP+QELVEW+HKSKI GKMHACGHD+H TMLLGAA+LL  
Sbjct  91   VAQIGSGSPPVVALRADMDALPLQELVEWDHKSKIQGKMHACGHDSHTTMLLGAAKLLTK  150

Query  495  RKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            RK  LKGTV+L+FQPAEEG  GA+ MIKEGAL + +++FGMHV  G+P G +
Sbjct  151  RKLMLKGTVRLLFQPAEEGGAGAFQMIKEGALGESEAIFGMHVHHGLPTGQV  202



>ref|NP_001051828.1| Os03g0836900 [Oryza sativa Japonica Group]
 sp|Q851L6.1|ILL4_ORYSJ RecName: Full=IAA-amino acid hydrolase ILR1-like 4; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAO41146.1| putative IAA amidohydrolase [Oryza sativa Japonica Group]
 gb|ABF99769.1| IAA-amino acid hydrolase 1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13742.1| Os03g0836900 [Oryza sativa Japonica Group]
 gb|EAY92490.1| hypothetical protein OsI_14227 [Oryza sativa Indica Group]
Length=414

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 138/178 (78%), Gaps = 3/178 (2%)
 Frame = +3

Query  123  SQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVA  302
            + L R+LL++AR PEF  WL+ +RR +H++PEL F+EHRTS L+R ELD+LG+ Y WP+A
Sbjct  3    TTLGRELLEAARAPEFAGWLRGLRRRIHQHPELAFQEHRTSALVRAELDALGVAYVWPIA  62

Query  303  KTGVVAAIG--SGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGA  476
            +TGVVA +   +G  P F LRADMDALPIQE+VEWE KS  +GKMHACGHDAHV MLL A
Sbjct  63   QTGVVATVAGAAGPGPVFALRADMDALPIQEMVEWEFKSLEDGKMHACGHDAHVAMLLVA  122

Query  477  ARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            A+LLQ+R++   G VKLVFQPAE G GG YH++KEG LDD Q++F +HV   +P G +
Sbjct  123  AKLLQSRRDHFNGKVKLVFQPAEGGAGG-YHVLKEGVLDDTQTIFAVHVATDLPAGVV  179



>emb|CDY14333.1| BnaA10g07220D [Brassica napus]
Length=427

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 135/172 (78%), Gaps = 3/172 (2%)
 Frame = +3

Query  135  RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGV  314
            R LL++  D    DWL  VRR +HE PEL +E H+TS LIR ELD LG+ YS+PVA+TG+
Sbjct  33   RLLLEAEADK---DWLVSVRRQIHENPELLYELHQTSALIRRELDQLGVSYSYPVAQTGI  89

Query  315  VAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQN  494
            VA IGSG+ P   LRADMDALP+QELVEW+HKSKI GKMHACGHD+H TMLLGAA+LL  
Sbjct  90   VAQIGSGSPPVVALRADMDALPLQELVEWDHKSKIQGKMHACGHDSHTTMLLGAAKLLTK  149

Query  495  RKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            RK  LKGTV+L+FQPAEEG  GA+ MIKEGAL + +++FGMHV  G+P G +
Sbjct  150  RKLMLKGTVRLLFQPAEEGGAGAFQMIKEGALGESEAIFGMHVHHGLPTGQV  201



>gb|KDO55919.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
 gb|KDO55920.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
 gb|KDO55921.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=288

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 136/189 (72%), Gaps = 0/189 (0%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
              S    L  E ++Q+    LD A+ PE F W+  +RR +HE PELGF+E  TS+LIR E
Sbjct  20   SISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIHENPELGFQEFETSKLIRAE  79

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LD +GI Y +PVA TGVV  IG+G  P+  LRADMDAL ++E VEWEHKSK+ GKMHACG
Sbjct  80   LDQMGIPYKFPVAVTGVVGYIGTGQPPFVALRADMDALAMEESVEWEHKSKVPGKMHACG  139

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HDAHV MLLGAA++LQ  +  +KGT+ LVFQPAEEG GGA  M+  GAL++ +++FG+HV
Sbjct  140  HDAHVAMLLGAAKMLQVFRHEIKGTIVLVFQPAEEGGGGAKKMLDAGALENVEAIFGLHV  199

Query  624  WPGMPVGTI  650
                PVGT+
Sbjct  200  SSLFPVGTV  208



>ref|XP_009760824.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 137/187 (73%), Gaps = 3/187 (2%)
 Frame = +3

Query  90   SLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELD  269
            S+Q + GS    +  + +L SA   +  DWL  +RR +HEYPEL F+E+ TS LIR ELD
Sbjct  23   SIQVQ-GSYFDQEYGKQVLSSAIQDK--DWLVSIRRIIHEYPELRFQEYNTSALIRTELD  79

Query  270  SLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHD  449
             LGI Y +P AKTG+VA IGS + P   LRADMDALP+QELVEWEHKSK+ GKMH CGHD
Sbjct  80   KLGIYYEYPFAKTGLVALIGSSSPPVVALRADMDALPLQELVEWEHKSKVTGKMHGCGHD  139

Query  450  AHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWP  629
            AH  MLLGAA+LL  RK+ L GTV+LVFQPAEEG  GAYHMI EGAL D +++FGMHV  
Sbjct  140  AHTAMLLGAAKLLNERKDKLNGTVRLVFQPAEEGGAGAYHMINEGALGDAEAIFGMHVDF  199

Query  630  GMPVGTI  650
              P G+I
Sbjct  200  KRPTGSI  206



>ref|XP_007150548.1| hypothetical protein PHAVU_005G1617001g, partial [Phaseolus vulgaris]
 gb|ESW22542.1| hypothetical protein PHAVU_005G1617001g, partial [Phaseolus vulgaris]
Length=266

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 135/185 (73%), Gaps = 2/185 (1%)
 Frame = +3

Query  96   QTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSL  275
            ++   S  +S  T   LD A+DP  FDW+  +RR +HE PELG+EE  TS+LIR ELD L
Sbjct  25   ESSFSSNAIS--TTKFLDLAKDPRLFDWMVGIRRKIHENPELGYEEFETSELIRVELDKL  82

Query  276  GIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAH  455
            GI Y +PVA TGV+  IG+G  P+  LRADMDALP+QE+VEWEHKSK+ GKMHACGHDAH
Sbjct  83   GISYKYPVAVTGVIGFIGTGFFPFVALRADMDALPMQEMVEWEHKSKVPGKMHACGHDAH  142

Query  456  VTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGM  635
            V MLLGAA++L+  +  ++GTV LVFQPAEEG  GA  ++  G L++  ++FG+H+ P  
Sbjct  143  VAMLLGAAKILKEHENEIQGTVVLVFQPAEEGGAGAKKILDAGVLENISAIFGLHITPTF  202

Query  636  PVGTI  650
            P+G +
Sbjct  203  PIGEV  207



>gb|KJB74619.1| hypothetical protein B456_012G001500 [Gossypium raimondii]
Length=385

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 134/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  141  LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVA  320
            LL SA+  +  DWL  +RR +HE PEL F+EH TS LIR  LD LGI YS+P AKTG+VA
Sbjct  30   LLSSAQQEK--DWLVSIRRQIHENPELLFQEHNTSALIRQHLDQLGIPYSYPFAKTGIVA  87

Query  321  AIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRK  500
             IGSG++P   LRAD+DALP+QELV+WEH+SKI+GKMHACGHDAH TMLLGAA+LL  RK
Sbjct  88   QIGSGSKPIVALRADIDALPLQELVDWEHRSKIDGKMHACGHDAHTTMLLGAAKLLNQRK  147

Query  501  ESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            + LKGTV+L+FQPAEEG  GA HMIKEGAL D +++FGMH+      G+I
Sbjct  148  DRLKGTVRLLFQPAEEGGAGASHMIKEGALGDAEAIFGMHIDYSTLTGSI  197



>ref|XP_009786385.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana sylvestris]
Length=441

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = +3

Query  117  TVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWP  296
            ++S++  + L+ A+  E FDW+  VRR +HE PELG+EE  TS+LIR ELD LGI Y +P
Sbjct  26   SLSEIPINFLNFAKKAEVFDWIVGVRRRIHENPELGYEEFETSKLIREELDKLGISYKYP  85

Query  297  VAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGA  476
             A TGVV  IGSG  P+  +RADMDALP+QE+V+WEHKSK  GKMHACGHDAH+ MLLGA
Sbjct  86   FATTGVVGFIGSGKSPFVAIRADMDALPMQEMVDWEHKSKNAGKMHACGHDAHIAMLLGA  145

Query  477  ARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            A++LQ  ++ LKGTV LVFQPAEEG GGA  MI  GAL++ +++FG+HV P  P+G +
Sbjct  146  AKILQEHRDILKGTVALVFQPAEEGGGGAKKMIDAGALENIEAIFGLHVNPQFPLGKV  203



>ref|XP_004955914.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 9-like [Setaria 
italica]
Length=426

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 6/177 (3%)
 Frame = +3

Query  123  SQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVA  302
            + L  +LL  AR P F  WL+ VRR +H++PEL F+E+RTS     ELD++G+ Y WPVA
Sbjct  29   TPLAGELLAEARSPGFAAWLRGVRRRIHQWPELAFQEYRTS-----ELDAIGVPYRWPVA  83

Query  303  KTGVVAAI-GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAA  479
            +TGVVA I G G  P   LRADMDALP++ELV+WE+KS+ + KMHACGHDAH TMLLGAA
Sbjct  84   QTGVVATIVGGGAAPVVALRADMDALPVEELVDWEYKSQESVKMHACGHDAHTTMLLGAA  143

Query  480  RLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +LLQ+RK  LKGTVKLVFQPAEEG GGAY++++EG+LDD  ++FG+HV PG+P+G +
Sbjct  144  KLLQDRKGDLKGTVKLVFQPAEEGYGGAYYILEEGSLDDVSAIFGLHVSPGLPLGVV  200



>gb|KDO55918.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=326

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 136/189 (72%), Gaps = 0/189 (0%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
              S    L  E ++Q+    LD A+ PE F W+  +RR +HE PELGF+E  TS+LIR E
Sbjct  20   SISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIHENPELGFQEFETSKLIRAE  79

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LD +GI Y +PVA TGVV  IG+G  P+  LRADMDAL ++E VEWEHKSK+ GKMHACG
Sbjct  80   LDQMGIPYKFPVAVTGVVGYIGTGQPPFVALRADMDALAMEESVEWEHKSKVPGKMHACG  139

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HDAHV MLLGAA++LQ  +  +KGT+ LVFQPAEEG GGA  M+  GAL++ +++FG+HV
Sbjct  140  HDAHVAMLLGAAKMLQVFRHEIKGTIVLVFQPAEEGGGGAKKMLDAGALENVEAIFGLHV  199

Query  624  WPGMPVGTI  650
                PVGT+
Sbjct  200  SSLFPVGTV  208



>gb|EYU21408.1| hypothetical protein MIMGU_mgv1a006385mg [Erythranthe guttata]
Length=446

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 146/201 (73%), Gaps = 3/201 (1%)
 Frame = +3

Query  48   FALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGF  227
            F L + +S P    S ++ L  E +S++ R+ L  AR  E FDW+  VRR +HE PELG+
Sbjct  11   FVLFLFLSKP---ISSESDLSPEELSEIPRNFLSFARKAEIFDWMVGVRRKIHENPELGY  67

Query  228  EEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEH  407
            EE  TS+LIR ELD +GI Y +P+A TGV+  IGSG  P+  +RADMDAL +QE+VEW+H
Sbjct  68   EEFETSKLIRQELDQMGIPYKYPLAVTGVLGFIGSGEPPFVAIRADMDALLLQEMVEWDH  127

Query  408  KSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGA  587
            KSK +GKMHACGHDAHV MLLGAA++LQ  +  LKGTV L FQPAEEG GGA  MI++GA
Sbjct  128  KSKNDGKMHACGHDAHVAMLLGAAKILQENRHLLKGTVVLFFQPAEEGYGGAKKMIEDGA  187

Query  588  LDDFQSMFGMHVWPGMPVGTI  650
            L+  +++FG+HV   +P+G +
Sbjct  188  LEKVEAIFGIHVDTLLPLGEV  208



>ref|XP_009760823.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 isoform X1 [Nicotiana 
sylvestris]
Length=434

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 137/187 (73%), Gaps = 3/187 (2%)
 Frame = +3

Query  90   SLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELD  269
            S+Q + GS    +  + +L SA   +  DWL  +RR +HEYPEL F+E+ TS LIR ELD
Sbjct  23   SIQVQ-GSYFDQEYGKQVLSSAIQDK--DWLVSIRRIIHEYPELRFQEYNTSALIRTELD  79

Query  270  SLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHD  449
             LGI Y +P AKTG+VA IGS + P   LRADMDALP+QELVEWEHKSK+ GKMH CGHD
Sbjct  80   KLGIYYEYPFAKTGLVALIGSSSPPVVALRADMDALPLQELVEWEHKSKVTGKMHGCGHD  139

Query  450  AHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWP  629
            AH  MLLGAA+LL  RK+ L GTV+LVFQPAEEG  GAYHMI EGAL D +++FGMHV  
Sbjct  140  AHTAMLLGAAKLLNERKDKLNGTVRLVFQPAEEGGAGAYHMINEGALGDAEAIFGMHVDF  199

Query  630  GMPVGTI  650
              P G+I
Sbjct  200  KRPTGSI  206



>ref|XP_008447583.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Cucumis melo]
Length=449

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +3

Query  126  QLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAK  305
            ++ +  L  A++ E FDW+  +RR +HE PELGFEE  TS+LIR ELD LGI Y +PVA 
Sbjct  38   EIPKRFLQFAKESELFDWMVGIRRKIHENPELGFEEFETSKLIRTELDKLGISYKYPVAS  97

Query  306  TGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARL  485
            TGV+  +GSG  P+  +RADMDALP+QELVEWEHKSK+ GKMHACGHDAHV M+LGAA++
Sbjct  98   TGVIGFVGSGQPPFVAIRADMDALPMQELVEWEHKSKVPGKMHACGHDAHVAMVLGAAKI  157

Query  486  LQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LQ   E LKGTV LVFQPAEEG GGA  +I+ G LD+  ++FG+H+   +P+G +
Sbjct  158  LQKHSEELKGTVVLVFQPAEEGGGGAMKIIEAGVLDNVNAIFGLHIVHNIPLGKV  212



>sp|Q8H3C8.1|ILL8_ORYSJ RecName: Full=IAA-amino acid hydrolase ILR1-like 8; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAC20815.1| putative IAA amidohydrolase [Oryza sativa Japonica Group]
Length=444

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 140/186 (75%), Gaps = 2/186 (1%)
 Frame = +3

Query  99   TRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLG  278
            T   S  +  L  DLL +A    F  WL  +RR +H+ PEL F+E RTS+L+R ELD++G
Sbjct  30   TTAASPALKALGEDLLAAAGAAGFAGWLSGLRRRIHQRPELAFQEVRTSELVRAELDAIG  89

Query  279  IGYSWPVAKTGVVAAI--GSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDA  452
            + Y+WPVA+TGVVA I  G+G  P   LRADMDALP+QELV+WE KS+  GKMHACGHDA
Sbjct  90   VPYAWPVARTGVVATIDGGAGAGPVVALRADMDALPLQELVDWEFKSQEKGKMHACGHDA  149

Query  453  HVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPG  632
            HVTMLLGAA+LLQ+RK+ LKGT+KLVFQPAEEG  GAYH+++ G LDD   +FG+HV P 
Sbjct  150  HVTMLLGAAKLLQSRKDELKGTIKLVFQPAEEGHAGAYHVLESGLLDDVSVIFGLHVIPN  209

Query  633  MPVGTI  650
            +PVG +
Sbjct  210  LPVGVV  215



>gb|AFR58665.1| jasmonoyl-L-isoleucine hydrolase 1 [Nicotiana attenuata]
Length=441

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = +3

Query  117  TVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWP  296
            ++S++  + L+ A+  E FDW+  VRR +HE PELG+EE  TS++IR ELD LGI Y +P
Sbjct  26   SLSEIPINFLNFAKKAEVFDWIVGVRRRIHENPELGYEEFETSKIIREELDKLGISYKYP  85

Query  297  VAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGA  476
             A TG+V  +GSG  P+  +RADMDALP+QE+V+WEHKSK  GKMHACGHDAHV MLLGA
Sbjct  86   FATTGIVGFVGSGKSPFVAIRADMDALPMQEMVDWEHKSKNAGKMHACGHDAHVAMLLGA  145

Query  477  ARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            A++LQ  ++ LKGTV LVFQPAEEG GGA  MI  GAL++ +S+FG+HV P  P+G +
Sbjct  146  AKILQEHRDILKGTVALVFQPAEEGGGGAKKMIDAGALENIESIFGLHVNPQFPLGKV  203



>ref|XP_010093786.1| IAA-amino acid hydrolase [Morus notabilis]
 gb|EXB54619.1| IAA-amino acid hydrolase [Morus notabilis]
Length=412

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 128/169 (76%), Gaps = 19/169 (11%)
 Frame = +3

Query  144  LDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAA  323
            +DSA++ EFF+W+  VRR +H+YPELGFEEH+TSQLIR ELDSLGI Y WPVAKTG+VA 
Sbjct  35   MDSAKEAEFFEWMIGVRRRIHQYPELGFEEHKTSQLIRTELDSLGIRYKWPVAKTGIVAT  94

Query  324  IGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKE  503
            IGSG++P F LRADMDALP+QELVEWE+KSK++GKMHACGHD+H                
Sbjct  95   IGSGSKPVFALRADMDALPVQELVEWEYKSKVDGKMHACGHDSH----------------  138

Query  504  SLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
               GTVKLVFQP EEG  GAYHM+K+G LDD  ++  +HV P +P G I
Sbjct  139  ---GTVKLVFQPGEEGYAGAYHMLKDGVLDDIGAILSIHVLPSVPSGAI  184



>gb|KJB74614.1| hypothetical protein B456_012G001500 [Gossypium raimondii]
Length=428

 Score =   231 bits (588),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 134/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  141  LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVA  320
            LL SA+  +  DWL  +RR +HE PEL F+EH TS LIR  LD LGI YS+P AKTG+VA
Sbjct  30   LLSSAQQEK--DWLVSIRRQIHENPELLFQEHNTSALIRQHLDQLGIPYSYPFAKTGIVA  87

Query  321  AIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRK  500
             IGSG++P   LRAD+DALP+QELV+WEH+SKI+GKMHACGHDAH TMLLGAA+LL  RK
Sbjct  88   QIGSGSKPIVALRADIDALPLQELVDWEHRSKIDGKMHACGHDAHTTMLLGAAKLLNQRK  147

Query  501  ESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            + LKGTV+L+FQPAEEG  GA HMIKEGAL D +++FGMH+      G+I
Sbjct  148  DRLKGTVRLLFQPAEEGGAGASHMIKEGALGDAEAIFGMHIDYSTLTGSI  197



>ref|XP_010482822.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 3 [Camelina sativa]
Length=435

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +3

Query  174  DWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFG  353
            DWL  VRR LHE PEL FE H+TS LIR ELD L + YS+PVAKTG+VA IGSG+ P   
Sbjct  44   DWLVSVRRQLHENPELLFELHKTSALIRRELDELEVSYSYPVAKTGIVAQIGSGSPPVVA  103

Query  354  LRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVF  533
            LRADMDALP+QEL EW+HKSKI+GKMHACGHD+H TMLLGAA+LL  RK  LKGTV+L+F
Sbjct  104  LRADMDALPMQELAEWDHKSKIDGKMHACGHDSHTTMLLGAAKLLSKRKHKLKGTVRLLF  163

Query  534  QPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            QPAEEG  GA++MIK+GAL + +++FGMHV   +P G +
Sbjct  164  QPAEEGGAGAFYMIKDGALGESEAIFGMHVDTELPTGEV  202



>ref|XP_002520216.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF42271.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=454

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 150/206 (73%), Gaps = 6/206 (3%)
 Frame = +3

Query  45   WFALIVAISSPWH---CCSLQTRLGSETVSQLTRDL-LDSARDPEFFDWLKRVRRTLHEY  212
            +++   +  SP H     SL+T +  + VS   +DL L+ A D E  +W+K+VRR +H+ 
Sbjct  22   FYSYSFSFQSPTHESSSDSLKTAVLLKNVS--VKDLILELANDQETVNWMKKVRRKIHQN  79

Query  213  PELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQEL  392
            PEL FEE+ TS+LIR+ELD LG+ Y WPVA TGVVA IGSG+ P+  LRADMDALPIQEL
Sbjct  80   PELAFEEYETSKLIRDELDQLGVAYKWPVATTGVVATIGSGSPPFVALRADMDALPIQEL  139

Query  393  VEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHM  572
              WE+KSK++GKMHACGHD HV MLLGAA++LQ  +++L+GTV L+FQPAEE   GA  M
Sbjct  140  TGWEYKSKVDGKMHACGHDGHVAMLLGAAKILQELRDTLQGTVILIFQPAEEQGLGAKSM  199

Query  573  IKEGALDDFQSMFGMHVWPGMPVGTI  650
            ++EG LD+ +++FG+HV    P G +
Sbjct  200  VEEGVLDNVEAVFGVHVVQKYPTGVV  225



>emb|CDP04977.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 133/175 (76%), Gaps = 2/175 (1%)
 Frame = +3

Query  126  QLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAK  305
            +    +L+SA+  +  DWL  VRR +HE PEL FEE+ TS LIR+ELD LGI Y +P A+
Sbjct  31   EYANQVLESAKMHK--DWLVSVRRKIHENPELKFEEYNTSALIRSELDKLGIFYEYPFAQ  88

Query  306  TGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARL  485
            TG+VA IGSG  P   LRADMDALP+QELVEW+HKSK+ GKMH CGHDAH TMLLGAA+L
Sbjct  89   TGLVALIGSGTSPVVALRADMDALPVQELVEWKHKSKVEGKMHGCGHDAHTTMLLGAAKL  148

Query  486  LQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            L  RK  LKGTV+L+FQPAEEG GGA +MIKEGAL   +++FGMH+   +P G I
Sbjct  149  LNERKHYLKGTVRLLFQPAEEGGGGAAYMIKEGALGSAKAIFGMHIDYELPTGAI  203



>ref|XP_004509886.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 7-like [Cicer arietinum]
Length=440

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 130/180 (72%), Gaps = 0/180 (0%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            S   S L   +L+ A  P    W+K +RR +HEYPEL +EE +TS +IR ELD LG+ Y 
Sbjct  35   SNQTSSLKNQILELANTPNMLKWMKSIRREIHEYPELAYEEFKTSSVIRRELDKLGVVYQ  94

Query  291  WPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLL  470
            WPVAKTGVVA IGSG  P+  LRADMDALPIQELV+W+HKSK++GKMHAC HDAH  MLL
Sbjct  95   WPVAKTGVVAKIGSGFPPFVALRADMDALPIQELVDWDHKSKVDGKMHACAHDAHSAMLL  154

Query  471  GAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            G A++LQ  K+ LK TV L+FQPAEE   GA  M+ E  LDD +++FG+H+ P  P+G +
Sbjct  155  GGAKILQEMKDKLKATVVLIFQPAEERGVGAKDMVAENVLDDVEAIFGLHLMPEYPLGVV  214



>gb|KJB54327.1| hypothetical protein B456_009G029600 [Gossypium raimondii]
Length=444

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 142/208 (68%), Gaps = 1/208 (0%)
 Frame = +3

Query  27   ASFRCVWFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLH  206
            A  + ++   I+    P    S  + L  E  +Q+  D LD A+ PE  DW+  +RR +H
Sbjct  2    AFLKLIFLIFILHSFMPIPISSTPS-LNKEVFAQIRPDFLDFAKKPEIMDWMVGIRRKIH  60

Query  207  EYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQ  386
            E PELG+EE  TS+LIR ELD +GI Y +PVA TGVV  IG+G  P+  LRADMDAL ++
Sbjct  61   ENPELGYEEFETSKLIRAELDLMGIPYKYPVAVTGVVGYIGTGKPPFVALRADMDALAME  120

Query  387  ELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAY  566
            ELVEWEHKSK+ GKMHACGHDAHV MLLGAA++LQ  +  L+GT+ L+FQPAEEG GGA 
Sbjct  121  ELVEWEHKSKVPGKMHACGHDAHVAMLLGAAKMLQEHRNDLQGTIVLIFQPAEEGGGGAK  180

Query  567  HMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             M+  GALD+  ++F +HV    P+G +
Sbjct  181  KMLDAGALDNVDAIFALHVSTKFPIGVL  208



>ref|XP_004235624.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Solanum lycopersicum]
Length=445

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = +3

Query  48   FALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGF  227
            F +++ +S         ++L S  +  +    LD A+  E FDW+  VRR +HE PELG+
Sbjct  8    FLILIFVSFATIPIFSDSQLSSGELPDIPVKFLDFAKKSEVFDWMVEVRRRIHENPELGY  67

Query  228  EEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEH  407
            EE  TS+LIR ELD++GI Y +P A TG+V  IGSG+ P+ G+RADMDALP+QE+V+WEH
Sbjct  68   EELETSKLIREELDNMGIQYKYPFANTGIVGFIGSGDPPFVGIRADMDALPMQEMVDWEH  127

Query  408  KSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGA  587
            KS+  GKMHACGHDAH+ MLLGAA++L   +  LKGTV LVFQPAEEG GGA  MI+ GA
Sbjct  128  KSRNPGKMHACGHDAHIAMLLGAAKILLQHQNILKGTVALVFQPAEEGGGGAKKMIEAGA  187

Query  588  LDDFQSMFGMHVWPGMPVGTI  650
            L++ +++FG+HV P  P+G +
Sbjct  188  LENVEAIFGLHVHPNFPLGKV  208



>emb|CDY60579.1| BnaCnng36490D [Brassica napus]
Length=429

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 134/172 (78%), Gaps = 3/172 (2%)
 Frame = +3

Query  135  RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGV  314
            R LL++  D    DWL  VRR +HE PEL +E H+TS LIR ELD LG+ Y++PVAKTG+
Sbjct  30   RLLLEAQADK---DWLVSVRRQIHENPELLYELHQTSALIRRELDQLGVSYTYPVAKTGI  86

Query  315  VAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQN  494
            VA IGSG+ P   LRADMDALP+QELVEW+HKSKI GKMHACGHD+H TMLLGAA+LL  
Sbjct  87   VAQIGSGSPPVVALRADMDALPLQELVEWDHKSKIEGKMHACGHDSHTTMLLGAAKLLTK  146

Query  495  RKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            RK  L GTV+L+FQPAEEG  GA+ M+KEGAL + +++FGMHV  G+P G +
Sbjct  147  RKHMLNGTVRLLFQPAEEGGAGAFQMMKEGALGESEAIFGMHVHHGLPTGQV  198



>gb|KDO58673.1| hypothetical protein CISIN_1g013076mg [Citrus sinensis]
Length=316

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 153/216 (71%), Gaps = 7/216 (3%)
 Frame = +3

Query  15   MKASASF-RCVWFALIVAISSPWHCCSLQTRLGSET---VSQLTRDLLDSARDPEFFDWL  182
            M  + SF + V+   ++ + +P   C ++   GS +   +S + + LL+ A+  E   W+
Sbjct  1    MGGAMSFSKWVFVVFVLHLLNP---CPVRFSYGSSSSNGLSDIPKKLLNFAKRQELVGWM  57

Query  183  KRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRA  362
              +RR +H+ PELG++E  TSQLIR+ELD +GI Y  PVA TGVV  IG+G  P+  LRA
Sbjct  58   IGIRRKIHQNPELGYQEFETSQLIRSELDKMGIKYKHPVAVTGVVGFIGTGEPPFVALRA  117

Query  363  DMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPA  542
            DMD+LP+QE+VEWE+KSKI GKMHACGHD HVTMLLGAA++LQ  +E LKGTV LVFQPA
Sbjct  118  DMDSLPLQEMVEWEYKSKIPGKMHACGHDGHVTMLLGAAKILQEHREELKGTVVLVFQPA  177

Query  543  EEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            EEG GGA+ +++ G L+   ++FG+HV P +P+G +
Sbjct  178  EEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEV  213



>ref|XP_006393728.1| hypothetical protein EUTSA_v10011458mg [Eutrema salsugineum]
 gb|ESQ31014.1| hypothetical protein EUTSA_v10011458mg [Eutrema salsugineum]
Length=461

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 142/190 (75%), Gaps = 4/190 (2%)
 Frame = +3

Query  93   LQTRLGSET----VSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRN  260
            L +R+GS+         + ++L  A +PE   WLKRVRRT+HE PEL FEE+ TS+L+R 
Sbjct  53   LPSRVGSDECRVWTQACSEEILRLAYEPENVAWLKRVRRTIHENPELAFEEYETSRLVRT  112

Query  261  ELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHAC  440
            ELD LGI Y +P+AKTG+ A IGSG  P+  +RADMDALPIQELVEW+HKSK+ GKMHAC
Sbjct  113  ELDRLGIQYRYPLAKTGIRAWIGSGGPPFVAVRADMDALPIQELVEWKHKSKVAGKMHAC  172

Query  441  GHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMH  620
            GHDAHVTMLLGAA +L++R+  LKGTV L+FQPAEE   GA  MI++GALDD +++F +H
Sbjct  173  GHDAHVTMLLGAAHILKSREHLLKGTVVLLFQPAEEAGNGAKKMIEDGALDDVEAIFAVH  232

Query  621  VWPGMPVGTI  650
            V    P G I
Sbjct  233  VSHDHPTGVI  242



>ref|XP_002283047.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Vitis vinifera]
Length=439

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  114  ETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSW  293
            E ++Q++ D LD AR+PE  +W+  +RR +HE PELGFEE  TS+LIR ELD + I Y +
Sbjct  26   ERLAQISADFLDYAREPEISEWMVGIRRIIHENPELGFEEFETSKLIRTELDKMDIPYRF  85

Query  294  PVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLG  473
            PVA TGVV  IG+G  P+  +RADMDALP+QE VEWEHKSKI GKMHACGHDAHV MLLG
Sbjct  86   PVAVTGVVGFIGTGEPPFVAIRADMDALPMQEGVEWEHKSKIPGKMHACGHDAHVAMLLG  145

Query  474  AARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            AA++LQ  +  L+GTV LVFQPAEE  GGA  M++ G L++  ++FG+HV P +P+G++
Sbjct  146  AAKMLQKHRHDLQGTVVLVFQPAEERDGGAKKMLETGILENIDAIFGLHVSPRVPIGSV  204



>ref|XP_004135471.2| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Cucumis sativus]
Length=448

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 142/208 (68%), Gaps = 2/208 (1%)
 Frame = +3

Query  33   FRCVWFALIVAIS--SPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLH  206
            F  ++  L  +++  SP    +    L +   S LT  ++D A  P   +W+K +RR +H
Sbjct  9    FISIFLPLTFSLNLESPDLHGTTSISLPTNHTSSLTHQIIDLANHPTAVNWMKTIRRKIH  68

Query  207  EYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQ  386
            E PEL FEE  TS+LIR ELD+L + Y WPVA TGVVA +GSG+ P+  LRADMDALPI+
Sbjct  69   ENPELAFEEFETSRLIRQELDNLRVSYRWPVAGTGVVAFVGSGSPPFVALRADMDALPIE  128

Query  387  ELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAY  566
            ELVEWEHKSK+ GKMHAC HDAHV MLLGA ++L   +  L+GTV LVFQPAEE  GGA 
Sbjct  129  ELVEWEHKSKVEGKMHACSHDAHVAMLLGATKILNQLRHKLQGTVVLVFQPAEEKGGGAK  188

Query  567  HMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             MI EGALD  +++FG+HV    PVG +
Sbjct  189  DMINEGALDGVEAIFGLHVVHEYPVGVV  216



>ref|XP_004502777.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502778.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5-like isoform 
X2 [Cicer arietinum]
Length=426

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 143/192 (74%), Gaps = 5/192 (3%)
 Frame = +3

Query  84   CCSLQTRLGSETVS---QLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLI  254
            C SL T +  E      +  +++L SA++ +  DWL  VRR +H++PEL F+EH TS LI
Sbjct  13   CTSLSTIVRCERDKDHHRYAQEILSSAQNEK--DWLVSVRREIHQHPELAFQEHNTSALI  70

Query  255  RNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMH  434
            R EL  LGI Y++PVAKTG+VA +GSG+ P   +RAD+DALP+QELVEWE+KSKI+G+MH
Sbjct  71   RRELHKLGIPYTYPVAKTGIVAQLGSGSPPIIAIRADIDALPLQELVEWEYKSKIDGRMH  130

Query  435  ACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFG  614
            ACGHDAH TMLLGAA+LL  RK+ LKGTV+L+FQPAEEG  GA  MI+EGAL D Q++F 
Sbjct  131  ACGHDAHATMLLGAAKLLNLRKDKLKGTVRLIFQPAEEGARGASQMIQEGALQDVQAIFA  190

Query  615  MHVWPGMPVGTI  650
            +H+    P G I
Sbjct  191  VHIDAMTPTGAI  202



>ref|XP_010924947.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Elaeis guineensis]
Length=437

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 145/202 (72%), Gaps = 7/202 (3%)
 Frame = +3

Query  45   WFALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELG  224
            W AL+       H  SL + + + + S      L  A++ EF DW+  +RR +HE PELG
Sbjct  6    WVALV-------HFVSLLSSVLTCSSSPDPAGFLQRAKESEFLDWMVGIRRRIHENPELG  58

Query  225  FEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWE  404
            +EE +TS+LIR EL+++GI Y +P+A TGVV  +G+GN P+  LRADMDALP+QE VEWE
Sbjct  59   YEEFKTSELIRRELEAMGIAYKYPIAVTGVVGFVGTGNAPFVALRADMDALPMQENVEWE  118

Query  405  HKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEG  584
            HKSK+ GKMHACGHDAHV MLLGAA++LQ  ++ L+GTV L+FQPAEEG GGA  MI+ G
Sbjct  119  HKSKVPGKMHACGHDAHVAMLLGAAKILQEHRDELQGTVVLLFQPAEEGGGGAQKMIEAG  178

Query  585  ALDDFQSMFGMHVWPGMPVGTI  650
            A+++  ++FG H+   +PVG +
Sbjct  179  AVENVDAIFGFHIASDLPVGVV  200



>ref|XP_007012935.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
 gb|EOY30554.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
Length=444

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 143/201 (71%), Gaps = 3/201 (1%)
 Frame = +3

Query  48   FALIVAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGF  227
            F+L  ++ +P    S    L  E ++Q+  + L+ A+ PE  DW+  +RR +HE PELGF
Sbjct  11   FSLYSSMPTP---ISSNPSLNKEALAQIPINFLEFAKKPEILDWMVGLRRKIHENPELGF  67

Query  228  EEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEH  407
            EE+ TS+LIR ELD +GI Y +PVA TGV+  IG+G  P+  LRADMDAL ++ELVEWEH
Sbjct  68   EEYETSKLIRAELDQMGIPYKYPVAVTGVIGYIGTGQPPFVALRADMDALAMEELVEWEH  127

Query  408  KSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGA  587
            KSK+ GKMHACGHDAHV MLLGAA++LQ  +  L+GT+ LVFQPAEEG GGA  M+  GA
Sbjct  128  KSKVPGKMHACGHDAHVAMLLGAAKMLQEHQNDLQGTIVLVFQPAEEGGGGAKKMLDAGA  187

Query  588  LDDFQSMFGMHVWPGMPVGTI  650
            L++  ++F +HV    PVG +
Sbjct  188  LENVDAIFALHVSSRFPVGVV  208



>ref|XP_004510337.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Cicer arietinum]
Length=442

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 135/172 (78%), Gaps = 0/172 (0%)
 Frame = +3

Query  135  RDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGV  314
             + L+SA+ PE FDW+  +RR +HE PELG++E  TS+LIR+ELD LGI Y  PVA TGV
Sbjct  32   NNFLESAKSPEVFDWMISIRRKIHENPELGYQEFETSELIRSELDKLGISYKHPVAVTGV  91

Query  315  VAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQN  494
            +  IG+G  P+  LRADMDAL +QE+VEWEHKSK+ GKMHACGHDAHVTMLLGAA++L+ 
Sbjct  92   IGFIGNGMSPFVALRADMDALAMQEMVEWEHKSKVPGKMHACGHDAHVTMLLGAAKILKE  151

Query  495  RKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             ++ ++GTV LVFQPAEEG GGA  ++  GAL++  ++FG+H+ P +P+G +
Sbjct  152  HEKEIQGTVVLVFQPAEEGGGGAKKIVDAGALENVTAIFGLHIAPELPIGEV  203



>pdb|1XMB|A Chain A, X-ray Structure Of Iaa-aminoacid Hydrolase From Arabidopsis 
Thaliana Gene At5g56660
 pdb|2Q43|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Iaa-Aminoacid Hydrolase From Arabidopsis Thaliana Gene At5g56660
Length=418

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            +E  SQ+   LL+ A+ PE FDW+ ++RR +HE PELG+EE  TS+LIR+EL+ +GI Y 
Sbjct  7    AEDTSQIQTKLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYR  66

Query  291  WPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLL  470
            +PVA TGV+  IG+G  P+  LRADMDALPIQE VEWEHKSKI GKMHACGHD HVTMLL
Sbjct  67   YPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLL  126

Query  471  GAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVG  644
            GAA++L   +  L+GTV L+FQPAEEG+ GA  M +EGAL + +++FG+H+   +P G
Sbjct  127  GAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFG  184



>ref|XP_003530016.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=442

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = +3

Query  45   WFALIVAISSPWHCCSLQTRLG-SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPEL  221
            WF L +     +H  +       +++ +Q++ + LD+   PE FDW+ ++RR +HE PEL
Sbjct  6    WFNLFII----FHVLAATPIFSLTDSSNQVSTNFLDNTNKPEVFDWMVKIRRKIHENPEL  61

Query  222  GFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEW  401
             +EE  TS+LIR ELD LGI Y +PVA TGV+  IG+G+ P+  +RADMDALPIQE+VEW
Sbjct  62   RYEEVETSKLIREELDKLGIPYKYPVAITGVIGYIGTGSSPFVAIRADMDALPIQEMVEW  121

Query  402  EHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKE  581
            +HKSK+ GKMHACGHDAHVTMLLGAA +L+  ++ ++GTV LVFQPAEEG  GA  ++  
Sbjct  122  DHKSKVPGKMHACGHDAHVTMLLGAANILKQHEKEIQGTVVLVFQPAEEGGAGAKKILDA  181

Query  582  GALDDFQSMFGMHVWPGMPVG  644
            GAL++  ++F +HV P +P+G
Sbjct  182  GALENVTAIFALHVMPDIPLG  202



>ref|XP_008234625.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Prunus mume]
Length=434

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 136/176 (77%), Gaps = 2/176 (1%)
 Frame = +3

Query  123  SQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVA  302
            +   +++L +A+  +   WL  +RR +HE PEL FEE+ TS L+R ELD LGI Y++P+A
Sbjct  33   TNYAKEILSAAQQDK--QWLVSIRRQIHENPELRFEEYNTSALLRRELDQLGITYTYPIA  90

Query  303  KTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAAR  482
            KTG+VA IGSG+ P   LRADMDAL +QELVEWEHKSK++GKMH CGHDAH TMLLGAA+
Sbjct  91   KTGIVAQIGSGSSPVVALRADMDALSLQELVEWEHKSKVDGKMHGCGHDAHTTMLLGAAK  150

Query  483  LLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LL  RK+ LKGTV+L+FQPAEEG  GA  MIK GAL + +++FGMHV  G+P GTI
Sbjct  151  LLNQRKDKLKGTVRLIFQPAEEGGAGASEMIKGGALGEAEAIFGMHVAYGIPTGTI  206



>ref|XP_002891660.1| IAA-alanine resistant 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67919.1| IAA-alanine resistant 3 [Arabidopsis lyrata subsp. lyrata]
Length=440

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 148/207 (71%), Gaps = 7/207 (3%)
 Frame = +3

Query  33   FRCVWFALIVAISSP-WHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHE  209
            F+ V F LI+ + +P    CS      S  +SQ+    L  A+  +FFDW+ R+RR +HE
Sbjct  4    FKWVSFVLILHLLNPSLISCS------SNGLSQIPSKFLTLAKSNDFFDWMVRIRRRIHE  57

Query  210  YPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQE  389
             PELG+EE  TS+L+R EL+ +G+ + +PVA TGVV  +G+G  P+  LRADMDALPIQE
Sbjct  58   NPELGYEEVETSKLVRAELEKMGVSFKYPVAVTGVVGYVGTGQAPFVALRADMDALPIQE  117

Query  390  LVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYH  569
            +VEWEHKSK+ GKMHACGHDAH TMLLGAA+LL+  +E L+GTV LVFQPAEEG GGA  
Sbjct  118  MVEWEHKSKVPGKMHACGHDAHTTMLLGAAKLLKEHEEELQGTVILVFQPAEEGGGGAKK  177

Query  570  MIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +++ G L++  ++FG+HV   + +G +
Sbjct  178  IVEAGVLENVSAIFGLHVTNQLALGQV  204



>ref|XP_003602410.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
 gb|ABF55221.1| auxin conjugate hydrolase [Medicago truncatula]
 gb|AES72661.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=420

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 141/189 (75%), Gaps = 5/189 (3%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
            C SL T +  +  +Q   ++L SA+  +  DWL  VRR +H++PEL F+EH TS LIR+E
Sbjct  13   CTSLCTVVKCDAYAQ---EILSSAQKEK--DWLVSVRREIHQHPELAFQEHNTSALIRSE  67

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LD LGI Y++PVAKTG+VA IGSG+ P   +RAD+D LP+QELVEWE+KSKI+G+MHACG
Sbjct  68   LDKLGIPYTYPVAKTGIVAQIGSGSSPIIAIRADIDGLPLQELVEWEYKSKIDGRMHACG  127

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HDAH TMLLGAA+LL  RK+ LKGTV+L+FQPAEEG  GA  MIK+G L D +++F +H+
Sbjct  128  HDAHATMLLGAAKLLNQRKDKLKGTVRLLFQPAEEGARGASQMIKDGVLQDVEAIFAVHI  187

Query  624  WPGMPVGTI  650
                  G I
Sbjct  188  DATTSTGAI  196



>ref|XP_008381545.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 [Malus domestica]
Length=435

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 139/181 (77%), Gaps = 2/181 (1%)
 Frame = +3

Query  108  GSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGY  287
            G+   ++  ++LL +A+  +  +WL  +RR +HE PEL F+EH TS L+R ELD LGI Y
Sbjct  27   GAPDQTRYAKELLSAAQQDK--NWLISIRRQIHENPELKFQEHNTSALLRRELDRLGIPY  84

Query  288  SWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTML  467
            ++P+A+TG+VA IGSG+ P   LRADMDALP+QELVEWEHKSK++GKMH CGHDAH TML
Sbjct  85   NYPIAQTGIVAEIGSGSSPVVALRADMDALPLQELVEWEHKSKVDGKMHGCGHDAHTTML  144

Query  468  LGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGT  647
            LGAA+LL  RK+ LKGTV+L+FQP EEG  GA  MIK GAL + +++FGMHV   +P GT
Sbjct  145  LGAAKLLNQRKDKLKGTVRLIFQPGEEGGAGASKMIKGGALGEAEAIFGMHVDYTIPTGT  204

Query  648  I  650
            +
Sbjct  205  V  205



>ref|XP_007217994.1| hypothetical protein PRUPE_ppa005643mg [Prunus persica]
 gb|EMJ19193.1| hypothetical protein PRUPE_ppa005643mg [Prunus persica]
Length=450

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 136/176 (77%), Gaps = 2/176 (1%)
 Frame = +3

Query  123  SQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVA  302
            +   +++L +A+  +   WL  +RR +HE PEL FEE+ TS L+R ELD LGI Y++P+A
Sbjct  49   TNYAKEILSAAQQDK--QWLVSIRRQIHENPELRFEEYNTSALLRRELDQLGITYTYPIA  106

Query  303  KTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAAR  482
            KTG+VA IGSG+ P   LRADMDAL +QELVEWEHKSK++GKMH CGHDAH TMLLGAA+
Sbjct  107  KTGIVAQIGSGSSPVVALRADMDALSLQELVEWEHKSKVDGKMHGCGHDAHTTMLLGAAK  166

Query  483  LLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LL  RK+ LKGTV+L+FQPAEEG  GA  MIK GAL + +++FGMHV  G+P GTI
Sbjct  167  LLNQRKDKLKGTVRLIFQPAEEGGAGASEMIKGGALGEAEAIFGMHVAYGIPTGTI  222



>gb|KGN51840.1| hypothetical protein Csa_5G603370 [Cucumis sativus]
Length=482

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 142/208 (68%), Gaps = 2/208 (1%)
 Frame = +3

Query  33   FRCVWFALIVAIS--SPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLH  206
            F  ++  L  +++  SP    +    L +   S LT  ++D A  P   +W+K +RR +H
Sbjct  43   FISIFLPLTFSLNLESPDLHGTTSISLPTNHTSSLTHQIIDLANHPTAVNWMKTIRRKIH  102

Query  207  EYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQ  386
            E PEL FEE  TS+LIR ELD+L + Y WPVA TGVVA +GSG+ P+  LRADMDALPI+
Sbjct  103  ENPELAFEEFETSRLIRQELDNLRVSYRWPVAGTGVVAFVGSGSPPFVALRADMDALPIE  162

Query  387  ELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAY  566
            ELVEWEHKSK+ GKMHAC HDAHV MLLGA ++L   +  L+GTV LVFQPAEE  GGA 
Sbjct  163  ELVEWEHKSKVEGKMHACSHDAHVAMLLGATKILNQLRHKLQGTVVLVFQPAEEKGGGAK  222

Query  567  HMIKEGALDDFQSMFGMHVWPGMPVGTI  650
             MI EGALD  +++FG+HV    PVG +
Sbjct  223  DMINEGALDGVEAIFGLHVVHEYPVGVV  250



>sp|Q8H3C9.1|ILL7_ORYSJ RecName: Full=IAA-amino acid hydrolase ILR1-like 7; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAC20814.1| putative IAA amidohydrolase [Oryza sativa Japonica Group]
Length=455

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = +3

Query  138  DLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVV  317
            +LL +AR P F  WL+ +RR++H +PEL FEE RTS+L+R ELD++G+ Y WPVA+TGVV
Sbjct  52   ELLSAARAPGFAAWLRGLRRSIHRHPELAFEEVRTSELVRAELDAIGVPYEWPVARTGVV  111

Query  318  AAIGSGNQ----PWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARL  485
            A I  G+       F LRADMDALP+QELV+WEHKS+ +GKMHACGHDAH TMLLGAA+L
Sbjct  112  ATIAGGDGAGAGTVFALRADMDALPLQELVDWEHKSEESGKMHACGHDAHTTMLLGAAKL  171

Query  486  LQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            LQ++K+ LKGTVKLVFQPAEEG  GA ++++EG LDD  ++FG+HV P + VGT+
Sbjct  172  LQSQKDDLKGTVKLVFQPAEEGYAGARYVLQEGVLDDVSAIFGLHVDPRIQVGTV  226



>ref|XP_010100519.1| IAA-amino acid hydrolase ILR1-like 2 [Morus notabilis]
 gb|EXB82653.1| IAA-amino acid hydrolase ILR1-like 2 [Morus notabilis]
Length=445

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = +3

Query  42   VWFALIVAISSPWHCCSLQTRLGSETVSQ--LTRD-LLDSARDPEFFDWLKRVRRTLHEY  212
            + F + + +S  +  C+ +    S +  Q    RD ++  A DP    W+K +RR +HE 
Sbjct  10   ISFTIPLCVSLIFQTCAGEKWFSSSSDYQHLSVRDQIVGLANDPNTVKWMKSIRRRIHEN  69

Query  213  PELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQEL  392
            PEL F+E +TS+LIR+ELD LG+ Y WPVA+TGVVA IG+G+ P+  LRADMDALPIQEL
Sbjct  70   PELAFQEFQTSELIRHELDRLGVSYRWPVARTGVVATIGTGSPPFVALRADMDALPIQEL  129

Query  393  VEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHM  572
            VEWEHKSK +G+MHACGHD HVTMLLGAA++L+  ++ L+GTV L+FQPAEE   GA  M
Sbjct  130  VEWEHKSKKDGEMHACGHDVHVTMLLGAAKILKELRDLLQGTVVLLFQPAEERGFGAKDM  189

Query  573  IKEGALDDFQSMFGMHVWPGMPVGTI  650
            IKEGALD  +++ G+HV P  P G +
Sbjct  190  IKEGALDGVEAILGLHVSPDFPTGVV  215



>gb|KCW82521.1| hypothetical protein EUGRSUZ_C03922 [Eucalyptus grandis]
Length=411

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = +3

Query  42   VWFALIVAISSPWHC-CSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPE  218
            V   LI  +  P  C CS +  L  E ++++  + L+ A+ PE  D++  +RR +HEYPE
Sbjct  92   VLLLLIPCLFIPRSCLCSSRLGLTPEELARIPVEFLNLAQKPEIVDYMVGIRRRIHEYPE  151

Query  219  LGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVE  398
            LGFEE  TS+L+R+ELD +GI Y  P+A TGVV  IG+G  P+  +RADMDAL ++E VE
Sbjct  152  LGFEEFETSKLVRSELDRMGIQYKHPLAVTGVVGYIGTGKPPFVAIRADMDALEMEESVE  211

Query  399  WEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIK  578
            WEHKSK+ GKMHACGHD HV MLLGAA+LLQ R + L+GTV LVFQPAEEG GGA  MI 
Sbjct  212  WEHKSKVPGKMHACGHDGHVAMLLGAAKLLQGRLDELQGTVVLVFQPAEEGGGGAKKMID  271

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
            +GAL++  ++FG+H+    P+G +
Sbjct  272  DGALENVDAIFGLHLSVKFPIGAV  295



>ref|XP_010934039.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 isoform X4 [Elaeis 
guineensis]
Length=275

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +3

Query  174  DWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFG  353
            +WL  +RR +HE+PEL F+EH TS LIR++LD LGI YS+P A TGVVA +GS + P   
Sbjct  56   EWLVAIRRGIHEHPELRFQEHNTSALIRSQLDRLGIPYSFPFAGTGVVAQVGSSSPPIVA  115

Query  354  LRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVF  533
            LRADMDALP+QE+VEWEHKSK++G MHACGHDAHV MLLGAA+LL  RK +LKGTV+L+F
Sbjct  116  LRADMDALPLQEMVEWEHKSKVDGVMHACGHDAHVAMLLGAAKLLNQRKHNLKGTVRLLF  175

Query  534  QPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            QPAEEG  GA+HMI +GAL   +++FGMHV  G+P G++
Sbjct  176  QPAEEGGAGAFHMINDGALGGAEAIFGMHVNYGLPTGSM  214



>gb|KDO55915.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=423

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 136/189 (72%), Gaps = 0/189 (0%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
              S    L  E ++Q+    LD A+ PE F W+  +RR +HE PELGF+E  TS+LIR E
Sbjct  20   SISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIHENPELGFQEFETSKLIRAE  79

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LD +GI Y +PVA TGVV  IG+G  P+  LRADMDAL ++E VEWEHKSK+ GKMHACG
Sbjct  80   LDQMGIPYKFPVAVTGVVGYIGTGQPPFVALRADMDALAMEESVEWEHKSKVPGKMHACG  139

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HDAHV MLLGAA++LQ  +  +KGT+ LVFQPAEEG GGA  M+  GAL++ +++FG+HV
Sbjct  140  HDAHVAMLLGAAKMLQVFRHEIKGTIVLVFQPAEEGGGGAKKMLDAGALENVEAIFGLHV  199

Query  624  WPGMPVGTI  650
                PVGT+
Sbjct  200  SSLFPVGTV  208



>ref|NP_200477.1| IAA-amino acid hydrolase ILR1-like 2 [Arabidopsis thaliana]
 sp|P54970.2|ILL2_ARATH RecName: Full=IAA-amino acid hydrolase ILR1-like 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC04866.1| IAA-amino acid hydrolase [Arabidopsis thaliana]
 dbj|BAB09884.1| IAA-amino acid hydrolase [Arabidopsis thaliana]
 gb|AAW38995.1| At5g56660 [Arabidopsis thaliana]
 gb|AED96793.1| IAA-amino acid hydrolase ILR1-like 2 [Arabidopsis thaliana]
Length=439

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            +E  SQ+   LL+ A+ PE FDW+ ++RR +HE PELG+EE  TS+LIR+EL+ +GI Y 
Sbjct  28   AEDTSQIQTKLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYR  87

Query  291  WPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLL  470
            +PVA TGV+  IG+G  P+  LRADMDALPIQE VEWEHKSKI GKMHACGHD HVTMLL
Sbjct  88   YPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLL  147

Query  471  GAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVG  644
            GAA++L   +  L+GTV L+FQPAEEG+ GA  M +EGAL + +++FG+H+   +P G
Sbjct  148  GAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFG  205



>gb|AAL59907.1| IAA-amino acid hydrolase [Arabidopsis thaliana]
Length=439

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            +E  SQ+   LL+ A+ PE FDW+ ++RR +HE PELG+EE  TS+LIR+EL+ +GI Y 
Sbjct  28   AEDTSQIQTKLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYR  87

Query  291  WPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLL  470
            +PVA TGV+  IG+G  P+  LRADMDALPIQE VEWEHKSKI GKMHACGHD HVTMLL
Sbjct  88   YPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLL  147

Query  471  GAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVG  644
            GAA++L   +  L+GTV L+FQPAEEG+ GA  M +EGAL + +++FG+H+   +P G
Sbjct  148  GAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFG  205



>ref|XP_007012936.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 ref|XP_007012937.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 ref|XP_007012938.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 gb|EOY30555.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 gb|EOY30556.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 gb|EOY30557.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
Length=330

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 143/204 (70%), Gaps = 2/204 (1%)
 Frame = +3

Query  45   WFALIVAI-SSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPEL  221
            W  LI ++ SS     S    L  E ++Q+  + L+ A+ PE  DW+  +RR +HE PEL
Sbjct  6    WVFLIFSLYSSMPTPISSNPSLNKEALAQIPINFLEFAKKPEILDWMVGLRRKIHENPEL  65

Query  222  GFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEW  401
            GFEE+ TS+LIR ELD +GI Y +PVA TGV+  IG+G  P+  LRADMDAL ++ELVEW
Sbjct  66   GFEEYETSKLIRAELDQMGIPYKYPVAVTGVIGYIGTGQPPFVALRADMDALAMEELVEW  125

Query  402  EHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESL-KGTVKLVFQPAEEGMGGAYHMIK  578
            EHKSK+ GKMHACGHDAHV MLLGAA++LQ  +  L +GT+ LVFQPAEEG GGA  M+ 
Sbjct  126  EHKSKVPGKMHACGHDAHVAMLLGAAKMLQEHQNDLQQGTIVLVFQPAEEGGGGAKKMLD  185

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
             GAL++  ++F +HV    PVG +
Sbjct  186  AGALENVDAIFALHVSSRFPVGVV  209



>gb|AAC49016.1| ILL2 [Arabidopsis thaliana]
Length=439

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            +E  SQ+   LL+ A+ PE FDW+ ++RR +HE PELG+EE  TS+LIR+EL+ +GI Y 
Sbjct  28   AEDTSQIQTKLLEFAKSPEVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYR  87

Query  291  WPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLL  470
            +PVA TGV+  IG+G  P+  LRADMDALPIQE VEWEHKSKI GKMHACGHD HVTMLL
Sbjct  88   YPVAITGVIGYIGTGEPPFVALRADMDALPIQEGVEWEHKSKIPGKMHACGHDGHVTMLL  147

Query  471  GAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVG  644
            GAA++L   +  L+GTV L+FQPAEEG+ GA  M +EGAL + +++FG+H+   +P G
Sbjct  148  GAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFG  205



>ref|XP_003546640.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Glycine 
max]
Length=444

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 132/174 (76%), Gaps = 0/174 (0%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            +T   LD A+DP  FDW+  +RR +HE PELG+EE  TS+LIR ELD LGI Y +PVA T
Sbjct  34   VTTKFLDLAKDPLVFDWMIGIRRKIHENPELGYEEFETSKLIRTELDKLGISYKYPVAVT  93

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            GVV  IG+G  P+  LRADMDALP+QE+VEWEHKSK+ GKMHACGHDAHV MLLGAA++L
Sbjct  94   GVVGFIGTGLPPFVALRADMDALPLQEMVEWEHKSKVPGKMHACGHDAHVAMLLGAAKIL  153

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +  +  ++GTV LVFQPAEEG GGA  ++  G L++  ++FG+H+ P  P+G +
Sbjct  154  KRHENEIRGTVVLVFQPAEEGGGGAKKILDAGVLENISAIFGLHIVPTYPIGEV  207



>ref|XP_007202052.1| hypothetical protein PRUPE_ppa005751mg [Prunus persica]
 gb|EMJ03251.1| hypothetical protein PRUPE_ppa005751mg [Prunus persica]
Length=445

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 144/206 (70%), Gaps = 3/206 (1%)
 Frame = +3

Query  39   CVWFALI--VAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEY  212
            C W +LI  V +  P    S  + L  E V+Q+    LD A+  E FD++  VRR +HE 
Sbjct  4    CKWVSLIFIVVVIMPLLISSDHS-LSPEEVAQIPVKFLDHAKRQELFDFMVGVRRKIHEN  62

Query  213  PELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQEL  392
            PELGFEE  TS+LIR ELD +GI Y +P+A+TG+V  IG+G  P+  +RADMDAL +QE 
Sbjct  63   PELGFEEFETSKLIRAELDQMGIPYKYPLAETGIVGFIGTGGPPFVAIRADMDALAMQES  122

Query  393  VEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHM  572
            VEWEHKSK+ GKMHACGHDAHV MLLGAA++LQ     L+GTV LVFQPAEEG GGA  M
Sbjct  123  VEWEHKSKVPGKMHACGHDAHVAMLLGAAKILQEHHHELQGTVVLVFQPAEEGGGGAKKM  182

Query  573  IKEGALDDFQSMFGMHVWPGMPVGTI  650
            + EGAL+   ++FG+HV    P+G++
Sbjct  183  LDEGALEHVGAIFGLHVAADYPIGSV  208



>ref|XP_010934038.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 5 isoform X3 [Elaeis 
guineensis]
Length=298

 Score =   224 bits (572),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +3

Query  174  DWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFG  353
            +WL  +RR +HE+PEL F+EH TS LIR++LD LGI YS+P A TGVVA +GS + P   
Sbjct  56   EWLVAIRRGIHEHPELRFQEHNTSALIRSQLDRLGIPYSFPFAGTGVVAQVGSSSPPIVA  115

Query  354  LRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVF  533
            LRADMDALP+QE+VEWEHKSK++G MHACGHDAHV MLLGAA+LL  RK +LKGTV+L+F
Sbjct  116  LRADMDALPLQEMVEWEHKSKVDGVMHACGHDAHVAMLLGAAKLLNQRKHNLKGTVRLLF  175

Query  534  QPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            QPAEEG  GA+HMI +GAL   +++FGMHV  G+P G++
Sbjct  176  QPAEEGGAGAFHMINDGALGGAEAIFGMHVNYGLPTGSM  214



>ref|XP_004509887.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 6-like [Cicer arietinum]
Length=427

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 131/180 (73%), Gaps = 0/180 (0%)
 Frame = +3

Query  111  SETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYS  290
            S   S L   +L+ A  P    W+K +RR +HEYPEL +EE +TS +IR ELD+LG+ Y 
Sbjct  35   SNQTSSLKNQILELANTPNMLKWMKSIRREIHEYPELAYEEFKTSSVIRRELDNLGVVYQ  94

Query  291  WPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLL  470
            WPVAKTGVVA IGSG  P+  +RADMDALPIQELV+W+HKSK++GKMHAC HDAH  MLL
Sbjct  95   WPVAKTGVVAKIGSGFPPFVAIRADMDALPIQELVDWDHKSKVDGKMHACAHDAHSAMLL  154

Query  471  GAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            GAA++LQ  K  LKGTV L+FQPAEE   GA  MI E  L+D +++FG+H+    P+G +
Sbjct  155  GAAKILQEMKNKLKGTVVLIFQPAEERGVGAKDMIAENVLEDVEAIFGLHLVTQYPLGVV  214



>ref|XP_002521309.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
 gb|EEF41083.1| IAA-amino acid hydrolase ILR1 precursor, putative [Ricinus communis]
Length=431

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = +3

Query  108  GSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGY  287
            GS+  S + + L  + +D    DWL  +RR +HE PELGFEEH TS +IR ELD   I Y
Sbjct  26   GSDDGSYMQQILSSAQQDK---DWLVSIRRQIHENPELGFEEHNTSAIIRRELDKHDIPY  82

Query  288  SWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTML  467
             +PVAKTGVVA IGSG++P   LRADMDALP+QELV+WEH SKI GKMH CGHDAH TML
Sbjct  83   RYPVAKTGVVAQIGSGSRPVVALRADMDALPLQELVQWEHMSKIEGKMHGCGHDAHTTML  142

Query  468  LGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGT  647
            LGAA+LL  RK  LKGTV+L+FQPAEEG  GA HMIKEGAL D +++F MH+   +  G+
Sbjct  143  LGAAKLLNQRKHKLKGTVRLLFQPAEEGGAGASHMIKEGALGDAEAIFAMHIGSHLSTGS  202

Query  648  I  650
            I
Sbjct  203  I  203



>gb|KJB65087.1| hypothetical protein B456_010G080300 [Gossypium raimondii]
Length=319

 Score =   225 bits (574),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 142/204 (70%), Gaps = 3/204 (1%)
 Frame = +3

Query  45   WFALIVAISS--PWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPE  218
            W  LI  + S  P    S    L  E + Q+  + L+ ++ PE  DW+  +RR +HE  E
Sbjct  6    WVLLIFTLHSFMPTPISS-NLSLNKEALPQIPLNFLEFSKKPEIMDWMVNIRRKIHENRE  64

Query  219  LGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVE  398
            LG+EE  TS+LIR ELD +GI Y +P+A TGVV  IG+G  P+  LRADMDAL ++ELVE
Sbjct  65   LGYEEFETSKLIRAELDLMGIPYKYPIAATGVVGYIGTGKPPFVALRADMDALAMEELVE  124

Query  399  WEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIK  578
            WEHKSK+ GKMHACGHDAHV MLLGAA++LQ+ +  L+GTV L+FQPAEEG GGA  M+ 
Sbjct  125  WEHKSKVPGKMHACGHDAHVAMLLGAAKMLQHNQNDLQGTVVLIFQPAEEGGGGAKIMLD  184

Query  579  EGALDDFQSMFGMHVWPGMPVGTI  650
            EGALD+  ++F +HV   +P+G +
Sbjct  185  EGALDNVDAIFALHVTARVPIGMV  208



>ref|XP_010928552.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 1 [Elaeis guineensis]
Length=472

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +3

Query  174  DWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFG  353
            DWL++VRR +HEYPEL  EE +TS+LIR ELD +G+ Y WP+A TGVVA IG+G  P   
Sbjct  76   DWLRKVRREIHEYPELAHEELQTSELIRRELDLMGVKYRWPIAGTGVVATIGTGLPPSVA  135

Query  354  LRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVF  533
            LRADMDALPIQELVEWEHKSKI+GKMHACGHDAHV+MLLGAA++LQ+ KE+L+GTV L+F
Sbjct  136  LRADMDALPIQELVEWEHKSKIDGKMHACGHDAHVSMLLGAAKILQDIKETLQGTVVLIF  195

Query  534  QPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            QPAEE   GA  MI+EGAL D +++F MHV    P G +
Sbjct  196  QPAEERGVGAVQMIEEGALKDVEAIFSMHVSYAYPTGVV  234



>ref|XP_008242448.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Prunus mume]
Length=445

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 144/206 (70%), Gaps = 3/206 (1%)
 Frame = +3

Query  39   CVWFALI--VAISSPWHCCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEY  212
            C W +LI  V +  P    S  + L  E V+Q+    LD A+  E FD++  VRR +HE 
Sbjct  4    CKWVSLIFIVLVIMPLLISSDHS-LSPEEVAQIPVKFLDHAKRQELFDFMVGVRRKIHEN  62

Query  213  PELGFEEHRTSQLIRNELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQEL  392
            PELGFEE  TS+LIR ELD +GI Y +P+A+TG+V  IG+G  P+  +RADMDAL +QE 
Sbjct  63   PELGFEEFETSKLIRAELDQMGIPYKYPLAETGIVGFIGTGGPPFVAIRADMDALAMQES  122

Query  393  VEWEHKSKINGKMHACGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHM  572
            VEWEHKSK+ GKMHACGHDAHV MLLGAA++LQ     L+GTV LVFQPAEEG GGA  M
Sbjct  123  VEWEHKSKVPGKMHACGHDAHVAMLLGAAKILQEHHHELQGTVVLVFQPAEEGGGGAKKM  182

Query  573  IKEGALDDFQSMFGMHVWPGMPVGTI  650
            + EGAL+   ++FG+HV    P+G++
Sbjct  183  LDEGALEHVGAIFGLHVAADYPIGSV  208



>gb|KDO55917.1| hypothetical protein CISIN_1g013332mg [Citrus sinensis]
Length=443

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 136/189 (72%), Gaps = 0/189 (0%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
              S    L  E ++Q+    LD A+ PE F W+  +RR +HE PELGF+E  TS+LIR E
Sbjct  20   SISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIHENPELGFQEFETSKLIRAE  79

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LD +GI Y +PVA TGVV  IG+G  P+  LRADMDAL ++E VEWEHKSK+ GKMHACG
Sbjct  80   LDQMGIPYKFPVAVTGVVGYIGTGQPPFVALRADMDALAMEESVEWEHKSKVPGKMHACG  139

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HDAHV MLLGAA++LQ  +  +KGT+ LVFQPAEEG GGA  M+  GAL++ +++FG+HV
Sbjct  140  HDAHVAMLLGAAKMLQVFRHEIKGTIVLVFQPAEEGGGGAKKMLDAGALENVEAIFGLHV  199

Query  624  WPGMPVGTI  650
                PVGT+
Sbjct  200  SSLFPVGTV  208



>ref|NP_001288853.1| IAA-amino acid hydrolase ILR1-like 6 [Brassica rapa]
 gb|ABB60093.1| IAA-amino acid hydrolase 6 [Brassica rapa]
 emb|CDY14979.1| BnaA10g08770D [Brassica napus]
Length=461

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 144/191 (75%), Gaps = 4/191 (2%)
 Frame = +3

Query  90   SLQTRLGSETV---SQLTRD-LLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIR  257
            S+ +R+GS+     +Q+  D +L  A +PE   WLKRVRRT+HE PEL FEE+ TS+L+R
Sbjct  52   SIPSRVGSDECRLWTQVCSDEILRLAHEPENVAWLKRVRRTIHENPELAFEEYETSRLVR  111

Query  258  NELDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHA  437
             ELD LGI Y +P+AKTG+ A IGSG  P+  +RADMDALPIQE VEW+HKSK+ GKMHA
Sbjct  112  TELDRLGIRYKYPLAKTGIRAWIGSGGPPFVAVRADMDALPIQEAVEWKHKSKVAGKMHA  171

Query  438  CGHDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGM  617
            CGHDAHVTMLLGAA++L+ R+  LKGTV L+FQPAEE   GA  MI++GALDD +++F +
Sbjct  172  CGHDAHVTMLLGAAQILKCREHLLKGTVILLFQPAEEAGNGAKKMIEDGALDDVEAIFAV  231

Query  618  HVWPGMPVGTI  650
            HV    P G I
Sbjct  232  HVSHEHPTGVI  242



>ref|XP_011009011.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Populus euphratica]
Length=456

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = +3

Query  129  LTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWPVAKT  308
            L   +++ A DP   DW+K++RR +HE PEL FEE  TS+LIR +LD +GI Y WPVA+T
Sbjct  53   LKERIVELANDPHTVDWMKKIRRQIHENPELAFEEFETSKLIRQQLDQMGIAYRWPVART  112

Query  309  GVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGAARLL  488
            GVVA +GSG+ P+  LRADMDALPIQE+VEWEHKSK++GKMHACGHDAH  MLLGAAR+L
Sbjct  113  GVVATLGSGSSPYVALRADMDALPIQEMVEWEHKSKVDGKMHACGHDAHAAMLLGAARIL  172

Query  489  QNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            +  +++L+GTV L+FQPAEE   G   MI EG LD+  ++FG+H     P G +
Sbjct  173  KQLQDTLQGTVVLIFQPAEEQGQGGKDMIAEGVLDNVDAIFGLHTVHRYPTGVV  226



>ref|XP_006475371.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4-like [Citrus 
sinensis]
Length=443

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 136/189 (72%), Gaps = 0/189 (0%)
 Frame = +3

Query  84   CCSLQTRLGSETVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNE  263
              S    L  E ++Q+    LD A+ PE F W+  +RR +HE PELGF+E  TS+LIR E
Sbjct  20   SISSDVSLSPEELTQIPVKFLDFAKKPEIFYWMVNIRRKIHENPELGFQEFETSKLIRAE  79

Query  264  LDSLGIGYSWPVAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACG  443
            LD +GI Y +PVA TGVV  IG+G  P+  LRADMDAL ++E VEWEHKSK+ GKMHACG
Sbjct  80   LDQMGIPYKFPVAVTGVVGYIGTGQPPFVALRADMDALAMEESVEWEHKSKVPGKMHACG  139

Query  444  HDAHVTMLLGAARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHV  623
            HDAHV MLLGAA++LQ  +  +KGT+ LVFQPAEEG GGA  M+  GAL++ +++FG+HV
Sbjct  140  HDAHVAMLLGAAKMLQVFRHEIKGTIVLVFQPAEEGGGGAKKMLDAGALENVEAIFGLHV  199

Query  624  WPGMPVGTI  650
                PVGT+
Sbjct  200  SSLFPVGTV  208



>ref|XP_009630468.1| PREDICTED: IAA-amino acid hydrolase ILR1-like 4 [Nicotiana tomentosiformis]
Length=441

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = +3

Query  117  TVSQLTRDLLDSARDPEFFDWLKRVRRTLHEYPELGFEEHRTSQLIRNELDSLGIGYSWP  296
            ++S++  + L+ A+  E FDW+  VRR +HE PELG+EE  TS+LIR ELD LGI Y +P
Sbjct  26   SLSEIPINFLNFAKKAEVFDWIVGVRRRIHENPELGYEEFETSKLIREELDKLGISYKYP  85

Query  297  VAKTGVVAAIGSGNQPWFGLRADMDALPIQELVEWEHKSKINGKMHACGHDAHVTMLLGA  476
             A TGVV  IGSG  P+  +RADMDALP+QE+V+W HKSK  GKMHACGHDAHV MLLGA
Sbjct  86   FATTGVVGFIGSGKPPFVAIRADMDALPMQEMVDWAHKSKNAGKMHACGHDAHVAMLLGA  145

Query  477  ARLLQNRKESLKGTVKLVFQPAEEGMGGAYHMIKEGALDDFQSMFGMHVWPGMPVGTI  650
            A++LQ   + LKGTV LVFQPAEEG GGA  MI  GAL++ +++FG+HV P  P+G +
Sbjct  146  AKILQEHPDILKGTVALVFQPAEEGGGGAKKMIDAGALENIEAIFGLHVNPQFPLGKV  203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1026237057824