BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7439

Length=823
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI32663.3|  unnamed protein product                                280   3e-89   Vitis vinifera
ref|XP_002277802.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     278   4e-87   Vitis vinifera
ref|XP_006363689.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    278   5e-87   Solanum tuberosum [potatoes]
ref|XP_004249606.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    278   7e-87   Solanum lycopersicum
ref|XP_009631491.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    276   2e-86   Nicotiana tomentosiformis
ref|XP_009800368.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    271   1e-84   Nicotiana sylvestris
ref|XP_008442593.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     268   2e-83   
ref|XP_006345671.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    268   4e-83   Solanum tuberosum [potatoes]
ref|XP_004137768.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     266   1e-82   Cucumis sativus [cucumbers]
gb|KDO49817.1|  hypothetical protein CISIN_1g014011mg                   260   2e-82   Citrus sinensis [apfelsine]
ref|XP_007027131.1|  UDP-glucuronic acid decarboxylase 1 isoform 2      261   4e-82   
gb|KDO49816.1|  hypothetical protein CISIN_1g014011mg                   260   8e-82   Citrus sinensis [apfelsine]
gb|KJB16892.1|  hypothetical protein B456_002G253300                    262   9e-82   Gossypium raimondii
gb|KJB16893.1|  hypothetical protein B456_002G253300                    261   1e-81   Gossypium raimondii
gb|KDO49815.1|  hypothetical protein CISIN_1g014011mg                   261   1e-81   Citrus sinensis [apfelsine]
ref|XP_008369838.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    263   3e-81   Malus domestica [apple tree]
ref|XP_010326162.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     261   3e-81   Solanum lycopersicum
ref|XP_007027130.1|  UDP-glucuronic acid decarboxylase 1 isoform 1      263   5e-81   Theobroma cacao [chocolate]
gb|ACI46983.1|  UDP-glucuronic acid decarboxylase 1                     262   5e-81   Gossypium hirsutum [American cotton]
gb|KJB16891.1|  hypothetical protein B456_002G253300                    262   7e-81   Gossypium raimondii
emb|CDP06664.1|  unnamed protein product                                262   1e-80   Coffea canephora [robusta coffee]
gb|KDO49814.1|  hypothetical protein CISIN_1g014011mg                   261   2e-80   Citrus sinensis [apfelsine]
ref|XP_007205215.1|  hypothetical protein PRUPE_ppa005905mg             260   3e-80   
ref|XP_009377117.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    259   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_008241657.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     259   1e-79   Prunus mume [ume]
ref|XP_010047285.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     259   1e-79   Eucalyptus grandis [rose gum]
ref|XP_006480725.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    258   2e-79   Citrus sinensis [apfelsine]
ref|XP_006428995.1|  hypothetical protein CICLE_v10011665mg             258   5e-79   
ref|XP_003542474.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    256   7e-79   Glycine max [soybeans]
gb|EPS72114.1|  hypothetical protein M569_02642                         256   2e-78   Genlisea aurea
gb|KFK34603.1|  hypothetical protein AALP_AA5G167100                    256   2e-78   Arabis alpina [alpine rockcress]
ref|XP_004302799.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     255   2e-78   Fragaria vesca subsp. vesca
ref|XP_003537209.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    254   4e-78   Glycine max [soybeans]
gb|AAT40110.1|  putative UDP-glucuronate decarboxylase 4                253   7e-78   Nicotiana tabacum [American tobacco]
ref|XP_007144481.1|  hypothetical protein PHAVU_007G159700g             254   8e-78   Phaseolus vulgaris [French bean]
ref|XP_010260024.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    254   1e-77   
ref|XP_010684197.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     254   1e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006403678.1|  hypothetical protein EUTSA_v10010296mg             256   1e-77   
gb|EYU38483.1|  hypothetical protein MIMGU_mgv1a006574mg                253   2e-77   Erythranthe guttata [common monkey flower]
ref|XP_009116044.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     252   5e-77   Brassica rapa
ref|XP_008387725.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    252   5e-77   Malus domestica [apple tree]
ref|XP_006373844.1|  hypothetical protein POPTR_0016s08130g             248   6e-77   
ref|XP_004494986.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    251   8e-77   Cicer arietinum [garbanzo]
ref|XP_011007309.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    251   2e-76   Populus euphratica
ref|NP_001078277.1|  UDP-glucuronic acid decarboxylase 1                248   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009341642.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    249   4e-76   Pyrus x bretschneideri [bai li]
ref|XP_009374642.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    249   6e-76   Pyrus x bretschneideri [bai li]
ref|XP_002876209.1|  UDP-glucuronic acid decarboxylase 1                249   8e-76   
ref|XP_010253356.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    249   8e-76   Nelumbo nucifera [Indian lotus]
emb|CDX76206.1|  BnaA04g04700D                                          249   9e-76   
gb|AAX37334.1|  UDP-glucuronic acid decarboxylase 1                     249   1e-75   Populus tomentosa [Chinese white poplar]
ref|XP_002323432.2|  hypothetical protein POPTR_0016s08130g             248   1e-75   Populus trichocarpa [western balsam poplar]
gb|AGK44132.1|  UDP-glucuronate decarboxylase protein 1                 248   1e-75   Populus tomentosa [Chinese white poplar]
gb|AGK44138.1|  UDP-glucuronate decarboxylase protein 1                 248   2e-75   Populus tomentosa [Chinese white poplar]
gb|AGK44124.1|  UDP-glucuronate decarboxylase protein 1                 248   2e-75   Populus tomentosa [Chinese white poplar]
ref|NP_850694.2|  UDP-glucuronic acid decarboxylase 1                   248   3e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AGK44127.1|  UDP-glucuronate decarboxylase protein 1                 247   3e-75   Populus tomentosa [Chinese white poplar]
ref|XP_009139397.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    247   3e-75   Brassica rapa
ref|NP_190920.3|  UDP-glucuronic acid decarboxylase 1                   247   4e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AGK44128.1|  UDP-glucuronate decarboxylase protein 1                 247   4e-75   Populus tomentosa [Chinese white poplar]
gb|AGK44156.1|  UDP-glucuronate decarboxylase protein 1                 247   4e-75   Populus tomentosa [Chinese white poplar]
gb|AGK44153.1|  UDP-glucuronate decarboxylase protein 1                 247   5e-75   Populus tomentosa [Chinese white poplar]
gb|AGK44150.1|  UDP-glucuronate decarboxylase protein 1                 247   5e-75   Populus tomentosa [Chinese white poplar]
gb|AGK44121.1|  UDP-glucuronate decarboxylase protein 1                 246   5e-75   Populus tomentosa [Chinese white poplar]
gb|AGK44157.1|  UDP-glucuronate decarboxylase protein 1                 246   6e-75   Populus tomentosa [Chinese white poplar]
gb|AGK44109.1|  UDP-glucuronate decarboxylase protein 1                 246   6e-75   Populus tomentosa [Chinese white poplar]
gb|AGK44148.1|  UDP-glucuronate decarboxylase protein 1                 246   1e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44117.1|  UDP-glucuronate decarboxylase protein 1                 246   1e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44130.1|  UDP-glucuronate decarboxylase protein 1                 246   1e-74   Populus tomentosa [Chinese white poplar]
ref|XP_010528269.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    246   1e-74   Tarenaya hassleriana [spider flower]
gb|AGK44146.1|  UDP-glucuronate decarboxylase protein 1                 246   1e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44116.1|  UDP-glucuronate decarboxylase protein 1                 245   2e-74   Populus tomentosa [Chinese white poplar]
ref|NP_001190080.1|  UDP-glucuronic acid decarboxylase 1                246   2e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AGK44159.1|  UDP-glucuronate decarboxylase protein 1                 245   2e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44145.1|  UDP-glucuronate decarboxylase protein 1                 245   2e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44143.1|  UDP-glucuronate decarboxylase protein 1                 245   3e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44140.1|  UDP-glucuronate decarboxylase protein 1                 245   3e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44129.1|  UDP-glucuronate decarboxylase protein 1                 244   3e-74   Populus tomentosa [Chinese white poplar]
gb|KEH42335.1|  UDP-glucuronic acid decarboxylase                       245   4e-74   Medicago truncatula
gb|AGK44125.1|  UDP-glucuronate decarboxylase protein 1                 244   4e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44133.1|  UDP-glucuronate decarboxylase protein 1                 244   4e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44158.1|  UDP-glucuronate decarboxylase protein 1                 244   5e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44122.1|  UDP-glucuronate decarboxylase protein 1                 244   7e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44155.1|  UDP-glucuronate decarboxylase protein 1                 243   9e-74   Populus tomentosa [Chinese white poplar]
gb|AGK44137.1|  UDP-glucuronate decarboxylase protein 1                 243   1e-73   Populus tomentosa [Chinese white poplar]
gb|AGK44131.1|  UDP-glucuronate decarboxylase protein 1                 243   1e-73   Populus tomentosa [Chinese white poplar]
gb|AGK44144.1|  UDP-glucuronate decarboxylase protein 1                 243   1e-73   Populus tomentosa [Chinese white poplar]
gb|AGK44142.1|  UDP-glucuronate decarboxylase protein 1                 243   2e-73   Populus tomentosa [Chinese white poplar]
gb|AGK44119.1|  UDP-glucuronate decarboxylase protein 1                 243   2e-73   Populus tomentosa [Chinese white poplar]
ref|XP_010427004.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    243   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010504116.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     243   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009602593.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    243   2e-73   Nicotiana tomentosiformis
ref|XP_012074855.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     243   2e-73   Jatropha curcas
gb|AGK44136.1|  UDP-glucuronate decarboxylase protein 1                 242   3e-73   Populus tomentosa [Chinese white poplar]
gb|AGK44147.1|  UDP-glucuronate decarboxylase protein 1                 242   4e-73   Populus tomentosa [Chinese white poplar]
gb|AGK44134.1|  UDP-glucuronate decarboxylase protein 1                 242   4e-73   Populus tomentosa [Chinese white poplar]
ref|XP_011077418.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    242   4e-73   Sesamum indicum [beniseed]
gb|AGK44135.1|  UDP-glucuronate decarboxylase protein 1                 241   5e-73   Populus tomentosa [Chinese white poplar]
ref|XP_009783145.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    241   5e-73   Nicotiana sylvestris
ref|XP_006293145.1|  hypothetical protein CARUB_v10019457mg             243   5e-73   
emb|CDY30862.1|  BnaC04g27170D                                          240   1e-72   Brassica napus [oilseed rape]
ref|XP_010530427.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     240   2e-72   Tarenaya hassleriana [spider flower]
gb|ERN12219.1|  hypothetical protein AMTR_s00034p00191920               233   2e-72   Amborella trichopoda
gb|KJB62548.1|  hypothetical protein B456_009G422900                    234   4e-71   Gossypium raimondii
gb|KHG08310.1|  UDP-glucuronic acid decarboxylase 1                     232   8e-71   Gossypium arboreum [tree cotton]
ref|XP_011019255.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    236   9e-71   Populus euphratica
ref|XP_011625643.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    233   1e-70   Amborella trichopoda
ref|XP_011625642.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    233   4e-70   
ref|XP_006850637.2|  PREDICTED: UDP-glucuronic acid decarboxylase...    233   8e-70   Amborella trichopoda
ref|XP_002309433.2|  hypothetical protein POPTR_0006s23050g             233   8e-70   
gb|KJB62551.1|  hypothetical protein B456_009G422900                    233   1e-69   Gossypium raimondii
gb|AGK44105.1|  UDP-glucuronate decarboxylase protein 4                 233   1e-69   Populus tomentosa [Chinese white poplar]
gb|KJB62549.1|  hypothetical protein B456_009G422900                    233   1e-69   Gossypium raimondii
gb|EYU41667.1|  hypothetical protein MIMGU_mgv1a006632mg                233   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_010097372.1|  UDP-glucuronic acid decarboxylase 1                233   1e-69   
gb|KJB62552.1|  hypothetical protein B456_009G422900                    234   2e-69   Gossypium raimondii
ref|XP_011094795.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     228   1e-67   Sesamum indicum [beniseed]
gb|ABK24329.1|  unknown                                                 225   9e-67   Picea sitchensis
emb|CDY67354.1|  BnaA09g54730D                                          222   9e-66   Brassica napus [oilseed rape]
emb|CDX73548.1|  BnaC08g24550D                                          221   2e-65   
ref|XP_003591521.1|  UDP-glucuronic acid decarboxylase                  208   3e-60   
ref|XP_011011221.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    207   4e-60   Populus euphratica
ref|XP_007144320.1|  hypothetical protein PHAVU_007G146300g             208   4e-60   Phaseolus vulgaris [French bean]
gb|KJB23283.1|  hypothetical protein B456_004G090000                    205   1e-59   Gossypium raimondii
gb|EYU46664.1|  hypothetical protein MIMGU_mgv1a006713mg                207   1e-59   Erythranthe guttata [common monkey flower]
gb|KDO87219.1|  hypothetical protein CISIN_1g0134671mg                  202   1e-59   Citrus sinensis [apfelsine]
gb|ABK24464.1|  unknown                                                 206   2e-59   Picea sitchensis
ref|XP_011011220.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    206   3e-59   Populus euphratica
ref|XP_011011217.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    206   3e-59   Populus euphratica
ref|XP_009335683.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    206   3e-59   Pyrus x bretschneideri [bai li]
ref|XP_009335739.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     206   3e-59   Pyrus x bretschneideri [bai li]
gb|KDO87218.1|  hypothetical protein CISIN_1g0134671mg                  202   4e-59   Citrus sinensis [apfelsine]
ref|XP_008369016.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     205   5e-59   
gb|KHG01436.1|  UDP-glucuronic acid decarboxylase 1                     205   5e-59   Gossypium arboreum [tree cotton]
ref|XP_003536125.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    205   6e-59   Glycine max [soybeans]
ref|XP_004495956.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    205   6e-59   Cicer arietinum [garbanzo]
gb|KJB41922.1|  hypothetical protein B456_007G128200                    205   7e-59   Gossypium raimondii
gb|KJB23284.1|  hypothetical protein B456_004G090000                    204   9e-59   Gossypium raimondii
ref|XP_004290795.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     204   1e-58   Fragaria vesca subsp. vesca
ref|XP_009348817.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    204   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_011079661.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    204   1e-58   Sesamum indicum [beniseed]
ref|XP_006386738.1|  hypothetical protein POPTR_0002s20570g             204   1e-58   Populus trichocarpa [western balsam poplar]
gb|KDO87217.1|  hypothetical protein CISIN_1g0134671mg                  202   1e-58   Citrus sinensis [apfelsine]
gb|AAX37335.1|  UDP-glucuronic acid decarboxylase 2                     204   1e-58   Populus tomentosa [Chinese white poplar]
ref|XP_002523086.1|  dtdp-glucose 4-6-dehydratase, putative             204   1e-58   
gb|KFK37504.1|  hypothetical protein AALP_AA4G266000                    204   2e-58   Arabis alpina [alpine rockcress]
gb|KHN08684.1|  UDP-glucuronic acid decarboxylase 1                     202   4e-58   Glycine soja [wild soybean]
ref|XP_010519351.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     203   4e-58   Tarenaya hassleriana [spider flower]
ref|XP_010497419.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    196   4e-58   Camelina sativa [gold-of-pleasure]
gb|KHG20554.1|  UDP-glucuronic acid decarboxylase 1                     197   4e-58   Gossypium arboreum [tree cotton]
ref|XP_009389617.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    202   5e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002321005.1|  UDP-XYLOSE SYNTHASE 4 family protein               202   6e-58   
ref|XP_008235095.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    202   6e-58   Prunus mume [ume]
gb|ABK92487.1|  unknown                                                 202   7e-58   Populus trichocarpa [western balsam poplar]
gb|AGK44103.1|  UDP-glucuronate decarboxylase protein 2                 202   1e-57   Populus tomentosa [Chinese white poplar]
gb|ACJ54441.1|  UDP-glucuronic acid decarboxylase 2                     202   1e-57   Gossypium hirsutum [American cotton]
ref|XP_006444354.1|  hypothetical protein CICLE_v10020167mg             202   1e-57   Citrus clementina [clementine]
gb|AAK91406.1|  AT3g62830/F26K9_260                                     194   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033535.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    201   2e-57   Populus euphratica
ref|XP_008454336.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     201   2e-57   Cucumis melo [Oriental melon]
ref|XP_006294240.1|  hypothetical protein CARUB_v10023238mg             201   2e-57   Capsella rubella
ref|XP_006479962.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    201   2e-57   Citrus sinensis [apfelsine]
ref|XP_011082471.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    201   2e-57   Sesamum indicum [beniseed]
emb|CDY25119.1|  BnaC06g18610D                                          201   2e-57   Brassica napus [oilseed rape]
ref|XP_012082771.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     201   3e-57   Jatropha curcas
ref|XP_009411672.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    201   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001769958.1|  predicted protein                                  201   3e-57   
ref|XP_009421356.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    201   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002301480.1|  UDP-XYLOSE SYNTHASE 4 family protein               200   3e-57   
ref|XP_002882125.1|  UDP-glucuronic acid decarboxylase 2                200   4e-57   
ref|XP_010921663.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    198   5e-57   Elaeis guineensis
ref|XP_004152248.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     200   5e-57   Cucumis sativus [cucumbers]
ref|XP_007050928.1|  NAD(P)-binding Rossmann-fold superfamily pro...    200   7e-57   Theobroma cacao [chocolate]
ref|XP_010259550.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    199   7e-57   Nelumbo nucifera [Indian lotus]
ref|XP_007050929.1|  NAD(P)-binding Rossmann-fold superfamily pro...    199   7e-57   
ref|XP_006402337.1|  hypothetical protein EUTSA_v10005973mg             199   9e-57   Eutrema salsugineum [saltwater cress]
ref|XP_007200976.1|  hypothetical protein PRUPE_ppa004626mg             201   9e-57   
ref|XP_010269565.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    199   1e-56   Nelumbo nucifera [Indian lotus]
gb|AGK44106.1|  UDP-glucuronate decarboxylase protein 5                 199   1e-56   Populus tomentosa [Chinese white poplar]
ref|XP_010069913.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     199   1e-56   Eucalyptus grandis [rose gum]
ref|XP_010512678.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    199   2e-56   Camelina sativa [gold-of-pleasure]
gb|KJB49910.1|  hypothetical protein B456_008G145200                    198   2e-56   Gossypium raimondii
ref|XP_001776651.1|  predicted protein                                  198   2e-56   
ref|XP_009404621.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    198   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010518480.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    198   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_008223207.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    198   3e-56   Prunus mume [ume]
ref|XP_002994140.1|  hypothetical protein SELMODRAFT_270121             197   6e-56   
ref|XP_010506806.1|  PREDICTED: UDP-glucuronic acid decarboxylase 4     197   6e-56   Camelina sativa [gold-of-pleasure]
ref|XP_002972645.1|  hypothetical protein SELMODRAFT_267587             197   6e-56   
ref|XP_010520999.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    197   9e-56   Tarenaya hassleriana [spider flower]
ref|XP_010684525.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     196   1e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009794075.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    196   1e-55   Nicotiana sylvestris
ref|XP_010413227.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     196   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006419549.1|  hypothetical protein CICLE_v10004959mg             196   1e-55   
ref|XP_010921662.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    196   1e-55   Elaeis guineensis
ref|XP_010468914.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    196   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009414893.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    196   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784747.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    196   2e-55   Phoenix dactylifera
ref|XP_010523949.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     196   2e-55   Tarenaya hassleriana [spider flower]
gb|KDO71703.1|  hypothetical protein CISIN_1g013226mg                   196   3e-55   Citrus sinensis [apfelsine]
ref|XP_009138714.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     195   4e-55   Brassica rapa
gb|KGN47434.1|  hypothetical protein Csa_6G319800                       189   4e-55   Cucumis sativus [cucumbers]
ref|XP_006397963.1|  hypothetical protein EUTSA_v10001451mg             195   5e-55   Eutrema salsugineum [saltwater cress]
ref|XP_009417727.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    194   6e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388332.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    191   6e-55   
ref|XP_006291142.1|  hypothetical protein CARUB_v10017258mg             194   7e-55   Capsella rubella
ref|NP_191842.1|  UDP-glucuronic acid decarboxylase                     194   8e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769957.1|  predicted protein                                  196   8e-55   
gb|AAK32785.1|AF361617_1  AT3g62830/F26K9_260                           194   8e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010922431.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    194   9e-55   Elaeis guineensis
gb|KFK35463.1|  hypothetical protein AALP_AA5G287200                    194   9e-55   Arabis alpina [alpine rockcress]
ref|NP_001189772.1|  UDP-xylose synthase 4                              194   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006489058.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    194   1e-54   Citrus sinensis [apfelsine]
ref|NP_182287.1|  UDP-xylose synthase 4                                 194   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009624356.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    194   1e-54   Nicotiana tomentosiformis
ref|XP_002268787.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    194   1e-54   Vitis vinifera
ref|XP_008789000.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    193   2e-54   
ref|XP_010931658.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    193   2e-54   Elaeis guineensis
ref|XP_008788999.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    193   3e-54   Phoenix dactylifera
ref|XP_002876692.1|  UDP-glucuronic acid decarboxylase 2                193   3e-54   
ref|XP_004247418.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     192   3e-54   Solanum lycopersicum
ref|XP_008783601.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    192   4e-54   Phoenix dactylifera
ref|XP_006359374.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    192   4e-54   Solanum tuberosum [potatoes]
emb|CDO98854.1|  unnamed protein product                                186   4e-54   Coffea canephora [robusta coffee]
ref|XP_004150505.2|  PREDICTED: UDP-glucuronic acid decarboxylase...    189   4e-54   Cucumis sativus [cucumbers]
ref|XP_010507865.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    192   5e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008458422.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    192   5e-54   Cucumis melo [Oriental melon]
gb|KHG12543.1|  UDP-glucuronic acid decarboxylase 1                     192   7e-54   Gossypium arboreum [tree cotton]
ref|XP_009133822.1|  PREDICTED: UDP-glucuronic acid decarboxylase 4     191   1e-53   Brassica rapa
ref|XP_007163114.1|  hypothetical protein PHAVU_001G207400g             189   2e-53   Phaseolus vulgaris [French bean]
ref|XP_009352283.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    191   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_009779106.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     190   3e-53   Nicotiana sylvestris
ref|XP_008390646.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    190   3e-53   
ref|XP_009104397.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    190   3e-53   Brassica rapa
gb|AAT40109.1|  putative UDP-glucuronate decarboxylase 3                190   4e-53   Nicotiana tabacum [American tobacco]
ref|XP_007163113.1|  hypothetical protein PHAVU_001G207400g             189   4e-53   Phaseolus vulgaris [French bean]
ref|XP_010937727.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    189   6e-53   
ref|XP_003553652.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    189   7e-53   Glycine max [soybeans]
ref|XP_009382533.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    188   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003520738.2|  PREDICTED: UDP-glucuronic acid decarboxylase...    188   2e-52   Glycine max [soybeans]
ref|XP_008789858.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    188   2e-52   Phoenix dactylifera
ref|XP_009596687.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     187   3e-52   Nicotiana tomentosiformis
gb|KJB28656.1|  hypothetical protein B456_005G061000                    187   4e-52   Gossypium raimondii
gb|KHN20398.1|  UDP-glucuronic acid decarboxylase 1                     186   4e-52   Glycine soja [wild soybean]
ref|XP_010938386.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    187   5e-52   Elaeis guineensis
ref|XP_006575782.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    186   6e-52   
gb|EPS69228.1|  hypothetical protein M569_05539                         186   9e-52   Genlisea aurea
gb|KHG10803.1|  UDP-glucuronic acid decarboxylase 1                     184   2e-51   Gossypium arboreum [tree cotton]
ref|XP_004298135.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    185   3e-51   Fragaria vesca subsp. vesca
ref|NP_001183139.1|  uncharacterized protein LOC100501508               178   5e-51   
ref|XP_007154178.1|  hypothetical protein PHAVU_003G096800g             184   5e-51   Phaseolus vulgaris [French bean]
ref|XP_006644976.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    182   1e-50   
ref|XP_010559031.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    174   1e-50   Tarenaya hassleriana [spider flower]
tpg|DAA56936.1|  TPA: UDP-glucuronic acid decarboxylase 1               182   3e-50   
ref|XP_008340799.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    182   3e-50   
tpg|DAA56935.1|  TPA: hypothetical protein ZEAMMB73_172315              182   3e-50   
gb|ACN36265.1|  unknown                                                 181   4e-50   Zea mays [maize]
ref|NP_001151221.1|  UDP-glucuronic acid decarboxylase 1                181   4e-50   
ref|NP_001055318.1|  Os05g0363200                                       182   5e-50   
ref|XP_001763355.1|  predicted protein                                  182   5e-50   
ref|XP_002456603.1|  hypothetical protein SORBIDRAFT_03g039180          180   7e-50   Sorghum bicolor [broomcorn]
dbj|BAJ85483.1|  predicted protein                                      181   7e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD73407.1|  UDP-glucuronic acid decarboxylase-like protein         174   1e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564565.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    180   1e-49   Brachypodium distachyon [annual false brome]
ref|XP_010024710.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    181   1e-49   Eucalyptus grandis [rose gum]
ref|XP_004970503.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    180   1e-49   Setaria italica
gb|AAV31405.1|  putative UDP-glucuronic acid decarboxylase              180   2e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010098259.1|  UDP-glucuronic acid decarboxylase 1                172   2e-49   
ref|XP_003567612.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    179   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_006584022.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    179   4e-49   
ref|XP_007035620.1|  NAD(P)-binding Rossmann-fold superfamily pro...    179   4e-49   
gb|ACL52693.1|  unknown                                                 179   5e-49   Zea mays [maize]
gb|AFW81510.1|  hypothetical protein ZEAMMB73_704580                    179   6e-49   
ref|XP_011090988.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    178   7e-49   Sesamum indicum [beniseed]
emb|CDM84875.1|  unnamed protein product                                177   1e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008812272.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    177   1e-48   Phoenix dactylifera
dbj|BAJ95172.1|  predicted protein                                      177   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW61168.1|  hypothetical protein EUGRSUZ_H03936                     174   2e-48   Eucalyptus grandis [rose gum]
gb|AAT80325.1|  UDP-D-glucuronate decarboxylase                         177   2e-48   Hordeum vulgare [barley]
ref|XP_002269917.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    177   2e-48   
ref|XP_002968263.1|  hypothetical protein SELMODRAFT_267191             176   3e-48   
ref|NP_001288406.1|  UDP-glucuronic acid decarboxylase 1-like           176   3e-48   
gb|KCW61167.1|  hypothetical protein EUGRSUZ_H03936                     174   5e-48   
ref|XP_002976115.1|  hypothetical protein SELMODRAFT_443053             176   5e-48   
ref|XP_002465450.1|  hypothetical protein SORBIDRAFT_01g039050          175   7e-48   
emb|CAN76038.1|  hypothetical protein VITISV_005029                     175   9e-48   
ref|XP_004984775.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    175   1e-47   
ref|XP_003558205.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    175   1e-47   
ref|XP_003550538.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    174   2e-47   
ref|XP_004229249.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    174   2e-47   
ref|XP_004962322.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    175   2e-47   
ref|XP_002440972.1|  hypothetical protein SORBIDRAFT_09g018070          174   2e-47   
ref|XP_004958670.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    175   2e-47   
ref|XP_004967510.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    174   2e-47   
dbj|BAD73406.1|  UDP-glucuronic acid decarboxylase                      174   3e-47   
ref|NP_001044737.1|  Os01g0837300                                       174   3e-47   
ref|XP_009787388.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    174   3e-47   
gb|EAY73735.1|  hypothetical protein OsI_01610                          168   3e-47   
ref|XP_008649519.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    173   7e-47   
gb|AFW77652.1|  hypothetical protein ZEAMMB73_341531                    173   8e-47   
gb|AAT80327.1|  UDP-D-glucuronate decarboxylase                         172   8e-47   
gb|AFW88781.1|  hypothetical protein ZEAMMB73_007028                    167   9e-47   
ref|XP_003568619.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     173   1e-46   
tpg|DAA54401.1|  TPA: hypothetical protein ZEAMMB73_310567              173   1e-46   
gb|AFW88780.1|  hypothetical protein ZEAMMB73_007028                    169   1e-46   
ref|NP_001141656.1|  hypothetical protein                               169   2e-46   
ref|XP_011627459.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     172   2e-46   
gb|EAZ11639.1|  hypothetical protein OsJ_01500                          166   2e-46   
ref|XP_007227467.1|  hypothetical protein PRUPE_ppa008317mg             169   3e-46   
gb|AAT80328.1|  UDP-D-glucuronate decarboxylase                         170   3e-46   
ref|XP_002457758.1|  hypothetical protein SORBIDRAFT_03g012980          170   7e-46   
gb|ERN17028.1|  hypothetical protein AMTR_s00057p00223540               171   7e-46   
ref|XP_008658277.1|  PREDICTED: hypothetical protein isoform X1         169   1e-45   
ref|XP_009769287.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    169   2e-45   
ref|NP_001060612.1|  Os07g0674100                                       169   2e-45   
gb|EAZ05112.1|  hypothetical protein OsI_27304                          169   2e-45   
ref|XP_009622783.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    169   2e-45   
ref|XP_006349950.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    168   3e-45   
ref|NP_001140492.1|  uncharacterized protein LOC100272553               167   7e-45   
ref|NP_001145832.1|  uncharacterized protein LOC100279339               166   1e-44   
ref|XP_004508205.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    167   1e-44   
ref|NP_001042876.1|  Os01g0315800                                       166   3e-44   
tpg|DAA54402.1|  TPA: hypothetical protein ZEAMMB73_310567              166   5e-44   
ref|XP_006649872.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    165   7e-44   
ref|XP_003609686.1|  UDP-glucuronic acid decarboxylase                  164   1e-43   
ref|XP_010314849.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    161   6e-43   
gb|EEE63432.1|  hypothetical protein OsJ_18245                          162   9e-43   
ref|NP_001049739.1|  Os03g0280800                                       161   1e-42   
ref|XP_003562461.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    156   1e-40   
ref|XP_002465293.1|  hypothetical protein SORBIDRAFT_01g035730          156   2e-40   
dbj|BAG92272.1|  unnamed protein product                                155   4e-40   
gb|EEC74985.1|  hypothetical protein OsI_11029                          155   4e-40   
ref|XP_001421368.1|  predicted protein                                  150   2e-39   
ref|XP_003083159.1|  GDP-mannose 4,6 dehydratase (ISS)                  152   3e-39   
gb|KHN05938.1|  UDP-glucuronic acid decarboxylase 1                     152   3e-39   
emb|CEG01656.1|  NAD-dependent epimerase/dehydratase                    153   4e-39   
ref|XP_006645818.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    148   2e-38   
ref|XP_003057114.1|  predicted protein                                  146   1e-37   
ref|XP_002534053.1|  dtdp-glucose 4-6-dehydratase, putative             146   3e-37   
ref|WP_039725557.1|  MULTISPECIES: NAD-dependent dehydratase            143   1e-36   
ref|XP_002506033.1|  predicted protein                                  143   2e-36   
gb|EWM27755.1|  dtdp-glucose -dehydratase                               141   4e-36   
gb|KIZ02006.1|  UDP-D-glucuronic acid decarboxylase                     139   8e-36   
ref|WP_008311123.1|  nucleoside-diphosphate-sugar epimerase             141   8e-36   
emb|CBJ48392.1|  conserved unknown protein                              143   1e-35   
ref|WP_041978773.1|  NAD-dependent dehydratase                          139   3e-35   
ref|WP_039741502.1|  NAD-dependent dehydratase                          139   4e-35   
ref|XP_001703494.1|  UDP-D-glucuronic acid decarboxylase                139   5e-35   
ref|XP_002955959.1|  hypothetical protein VOLCADRAFT_66420              139   5e-35   
ref|WP_019508538.1|  NAD-dependent dehydratase                          139   6e-35   
ref|WP_010583208.1|  NAD-dependent dehydratase                          138   9e-35   
ref|XP_002737647.2|  PREDICTED: UDP-glucuronic acid decarboxylase...    140   9e-35   
ref|WP_015184289.1|  nucleoside-diphosphate-sugar epimerase             138   1e-34   
ref|WP_026797442.1|  NAD-dependent dehydratase                          137   2e-34   
gb|EPB92378.1|  dTDP-glucose 4,6-dehydratase                            134   2e-34   
ref|WP_015201090.1|  UDP-glucuronate decarboxylase                      137   2e-34   
gb|AFK79146.1|  NAD-dependent epimerase/dehydratase                     137   2e-34   
ref|WP_006515774.1|  nucleoside-diphosphate-sugar epimerase             137   2e-34   
ref|WP_017288266.1|  NAD-dependent dehydratase                          137   2e-34   
ref|WP_006624789.1|  NAD-dependent dehydratase                          137   2e-34   
ref|WP_006507724.1|  nucleoside-diphosphate-sugar epimerase             137   3e-34   
ref|WP_004511637.1|  NAD-dependent dehydratase                          137   3e-34   
ref|WP_023068806.1|  polysaccharide biosynthesis family protein         137   3e-34   
dbj|BAQ60512.1|  dTDP-glucose 4,6-dehydratase                           137   3e-34   
ref|WP_027843441.1|  NAD-dependent dehydratase                          137   3e-34   
ref|WP_006620030.1|  NAD-dependent dehydratase                          137   3e-34   
gb|EPS61828.1|  hypothetical protein M569_12965                         136   3e-34   
gb|EJK54854.1|  hypothetical protein THAOC_25481                        137   3e-34   
gb|AAN40832.1|  dTDP-glucose 4-6-dehydratase-like protein               137   4e-34   
ref|WP_041237105.1|  NAD-dependent dehydratase                          136   4e-34   
ref|WP_011377884.1|  MULTISPECIES: NAD-dependent dehydratase            137   4e-34   
ref|WP_011242713.1|  NAD-dependent dehydratase                          137   4e-34   
ref|WP_017304837.1|  NAD-dependent dehydratase                          136   4e-34   
ref|WP_018399729.1|  NAD-dependent dehydratase                          136   4e-34   
gb|ESA00478.1|  hypothetical protein GLOINDRAFT_47097                   137   5e-34   
gb|EWC47015.1|  UDP-glucuronic acid decarboxylase 1                     138   5e-34   
ref|WP_009545409.1|  MULTISPECIES: NAD-dependent dehydratase            136   5e-34   
gb|KDD74452.1|  NAD dependent epimerase/dehydratase                     136   6e-34   
gb|ACL45616.1|  NAD-dependent epimerase/dehydratase                     136   6e-34   
ref|WP_009786001.1|  NAD-dependent dehydratase                          136   6e-34   
ref|WP_045360814.1|  NAD-dependent dehydratase                          135   6e-34   
ref|XP_005855230.1|  UDP-glucuronate decarboxylase                      139   7e-34   
ref|WP_015146439.1|  nucleoside-diphosphate-sugar epimerase             135   7e-34   
ref|WP_002797871.1|  NAD-dependent dehydratase                          135   8e-34   
ref|WP_012954532.1|  NAD-dependent dehydratase                          135   8e-34   
ref|XP_002291929.1|  dtdp-glucose 4,6-dehydratase                       137   9e-34   
gb|EXX71784.1|  bifunctional UDP-glucose 4-epimerase/aldose 1-epi...    137   9e-34   
ref|XP_005650385.1|  UDP-D-glucuronic acid decarboxylase                136   9e-34   
ref|WP_017293496.1|  NAD-dependent dehydratase                          135   1e-33   
ref|WP_026787336.1|  MULTISPECIES: NAD-dependent dehydratase            135   1e-33   
ref|WP_027249499.1|  NAD-dependent dehydratase                          135   1e-33   
gb|KFH68589.1|  UDP-glucuronate decarboxylase                           137   1e-33   
dbj|BAQ63982.1|  dTDP-glucose 4,6-dehydratase                           135   1e-33   
ref|XP_001419676.1|  predicted protein                                  135   1e-33   
ref|WP_023073773.1|  nucleoside-diphosphate-sugar epimerase             135   1e-33   
ref|WP_002781450.1|  putative sugar-nucleotide epimerase/dehydratase    135   1e-33   
ref|WP_002759994.1|  NAD-dependent dehydratase                          135   1e-33   
ref|WP_015218416.1|  UDP-glucuronate decarboxylase                      135   1e-33   
ref|WP_002804188.1|  NAD-dependent dehydratase                          135   1e-33   
ref|WP_002789512.1|  NAD-dependent dehydratase                          135   1e-33   
ref|WP_002765371.1|  NAD-dependent dehydratase                          135   1e-33   
ref|WP_015123275.1|  nucleoside-diphosphate-sugar epimerase             135   1e-33   
ref|XP_007510791.1|  predicted protein                                  135   2e-33   
ref|WP_008272691.1|  NAD-dependent dehydratase                          135   2e-33   
ref|XP_002289621.1|  dtdp-glucose 4,6-dehydratase                       135   2e-33   
ref|WP_009556421.1|  nucleoside-diphosphate-sugar epimerase             135   2e-33   
ref|WP_002746182.1|  NAD-dependent dehydratase                          134   2e-33   
emb|CEJ04208.1|  Putative dTDP-glucose 4,6-dehydratase                  132   2e-33   
ref|WP_016517129.1|  Polymyxin resistance protein PmrI                  134   2e-33   
ref|WP_024969851.1|  NAD-dependent dehydratase                          134   2e-33   
ref|WP_002736922.1|  rmlD substrate binding domain protein              134   2e-33   
ref|WP_002794867.1|  NAD-dependent dehydratase                          134   2e-33   
ref|WP_012265119.1|  NAD-dependent dehydratase                          134   3e-33   
gb|EDK99007.1|  mCG1036445                                              130   3e-33   
ref|WP_008206493.1|  NAD-dependent dehydratase                          134   3e-33   
ref|WP_022606792.1|  nucleoside-diphosphate-sugar epimerase             134   3e-33   
gb|KJB73848.1|  hypothetical protein B456_011G256100                    131   4e-33   
ref|WP_012469211.1|  NAD-dependent dehydratase                          134   4e-33   
ref|XP_005849383.1|  hypothetical protein CHLNCDRAFT_34919              134   4e-33   
ref|WP_015164200.1|  UDP-glucuronate decarboxylase                      134   5e-33   
ref|XP_011113672.1|  hypothetical protein H072_7947                     135   5e-33   
ref|WP_015170937.1|  NAD-dependent epimerase/dehydratase                134   5e-33   
gb|KJB73849.1|  hypothetical protein B456_011G256100                    132   5e-33   
ref|WP_015113346.1|  UDP-glucuronate decarboxylase                      133   5e-33   
ref|WP_007308510.1|  NAD-dependent dehydratase                          133   5e-33   
emb|CCQ62369.1|  UDP-glucose 4-epimerase                                133   5e-33   
ref|WP_012594246.1|  NAD-dependent dehydratase                          133   5e-33   
ref|WP_015783380.1|  NAD-dependent dehydratase                          133   6e-33   
emb|CCF52403.1|  related to dTDP-glucose 4,6-dehydratase                136   6e-33   
ref|WP_006853857.1|  NAD-dependent dehydratase                          133   6e-33   
ref|XP_011119342.1|  hypothetical protein AOL_s00043g554                135   6e-33   
ref|XP_004909894.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   7e-33   
ref|WP_015202026.1|  UDP-glucuronate decarboxylase                      133   7e-33   
ref|WP_010467739.1|  NAD-dependent dehydratase                          133   7e-33   
ref|WP_012162846.1|  NAD-dependent dehydratase                          133   7e-33   
ref|WP_017716267.1|  NAD-dependent dehydratase                          133   7e-33   
ref|XP_004984432.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    135   7e-33   
ref|WP_040554055.1|  NAD-dependent dehydratase                          133   7e-33   
ref|XP_004236755.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    134   8e-33   
ref|WP_024124067.1|  dTDP-glucose 4-6-dehydratase RfbB                  133   8e-33   
ref|XP_004330205.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   8e-33   
ref|WP_007358186.1|  MULTISPECIES: NAD-dependent dehydratase            132   9e-33   
ref|WP_011056512.1|  dTDP-glucose 4,6-dehydratase                       133   9e-33   
ref|XP_502440.1|  YALI0D05335p                                          134   9e-33   
ref|XP_012089497.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    133   1e-32   
ref|WP_006278549.1|  NAD-dependent dehydratase                          132   1e-32   
gb|EPS57930.1|  hypothetical protein M569_16886                         132   1e-32   
ref|WP_040054867.1|  NAD-dependent dehydratase                          132   1e-32   
gb|KCW50249.1|  hypothetical protein EUGRSUZ_J00040                     132   1e-32   
ref|WP_011863332.1|  NAD-dependent dehydratase                          132   1e-32   
gb|EKD30747.1|  hypothetical protein ACD_77C00477G0015                  132   1e-32   
ref|XP_006681589.1|  hypothetical protein BATDEDRAFT_13758              132   1e-32   
gb|KFQ69028.1|  UDP-glucuronic acid decarboxylase 1                     130   2e-32   
gb|KDQ64988.1|  hypothetical protein JAAARDRAFT_28651                   134   2e-32   
ref|WP_011416558.1|  NAD-dependent dehydratase                          132   2e-32   
ref|WP_027401089.1|  NAD-dependent dehydratase                          132   2e-32   
ref|XP_010070994.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     130   2e-32   
ref|WP_015194018.1|  UDP-glucuronate decarboxylase                      132   2e-32   
gb|KFU96828.1|  UDP-glucuronic acid decarboxylase 1                     130   2e-32   
ref|XP_010289669.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     130   2e-32   
ref|XP_008764974.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    134   2e-32   
ref|XP_008764975.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    134   2e-32   
gb|ETO07274.1|  dTDP-glucose 4-6-dehydratase                            131   2e-32   
ref|XP_009575285.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    130   2e-32   
ref|XP_008764971.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    134   2e-32   
ref|WP_011737213.1|  NAD-dependent dehydratase                          132   2e-32   
ref|NP_441431.1|  dTDP-glucose 4-6-dehydratase                          132   2e-32   
ref|WP_036484771.1|  NAD-dependent dehydratase                          132   2e-32   
emb|CCX12005.1|  Similar to UDP-glucuronic acid decarboxylase 1; ...    133   2e-32   
ref|XP_012065004.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    132   2e-32   
ref|WP_028082606.1|  NAD-dependent dehydratase                          132   2e-32   
ref|WP_007308996.1|  NAD-dependent dehydratase                          132   2e-32   
emb|CEP11320.1|  hypothetical protein                                   133   2e-32   
ref|WP_006632506.1|  NAD-dependent dehydratase                          132   2e-32   
gb|EJK74508.1|  hypothetical protein THAOC_03808                        134   2e-32   
ref|WP_015176482.1|  UDP-glucuronate decarboxylase                      132   2e-32   
ref|XP_008764972.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    134   2e-32   
ref|WP_006929905.1|  NAD-dependent dehydratase                          132   2e-32   
ref|WP_040696783.1|  NAD-dependent dehydratase                          131   2e-32   
ref|XP_008764970.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    134   2e-32   
ref|XP_009818096.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     130   3e-32   
ref|WP_012411446.1|  NAD-dependent dehydratase                          131   3e-32   
ref|XP_008764968.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    134   3e-32   
gb|KIJ82291.1|  NAD-dependent dehydratase                               131   3e-32   
gb|KIE08969.1|  NAD-dependent dehydratase                               131   3e-32   
emb|CDS08683.1|  Putative UDP-glucuronate decarboxylase                 133   3e-32   
gb|KJB73846.1|  hypothetical protein B456_011G256100                    132   3e-32   
gb|EIE90340.1|  hypothetical protein RO3G_15051                         132   3e-32   
ref|WP_014407106.1|  NAD-dependent dehydratase                          131   3e-32   
ref|XP_006400977.1|  hypothetical protein EUTSA_v10014020mg             132   3e-32   
ref|NP_001289643.1|  UDP-glucuronic acid decarboxylase 1                132   3e-32   
ref|XP_002603457.1|  hypothetical protein BRAFLDRAFT_222572             132   3e-32   
gb|KHF97898.1|  UDP-glucuronic acid decarboxylase 1                     132   3e-32   
emb|CDH57602.1|  udp-xylose synthase                                    132   3e-32   
ref|XP_011373294.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    130   3e-32   
ref|XP_002127542.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    133   3e-32   
ref|XP_010030993.1|  PREDICTED: UDP-glucuronic acid decarboxylase 3     132   3e-32   
ref|WP_035154486.1|  NAD-dependent dehydratase                          131   3e-32   
ref|XP_011373296.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    130   3e-32   
ref|WP_025935289.1|  NAD-dependent dehydratase                          131   3e-32   



>emb|CBI32663.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 161/206 (78%), Gaps = 27/206 (13%)
 Frame = +1

Query  211  AMK-LHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILI  384
            AMK LHKQ+SVN+RRDEE     +PPYSPKTLKHPRSLPRSINYL +EQRLLFILVGILI
Sbjct  108  AMKQLHKQSSVNHRRDEEIPTSQSPPYSPKTLKHPRSLPRSINYLFKEQRLLFILVGILI  167

Query  385  GSTFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARK  564
            GSTFFI+Q                     N+ ++P          GA  +GR+PVGI R+
Sbjct  168  GSTFFIVQ--------------------PNQISIP-----YPQSNGAGKVGRIPVGIGRR  202

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+RIV+TGGAGFVGSHLVDKL+ RGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE
Sbjct  203  RLRIVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  262

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  263  PILLEVDQIYHLACPASPVHYKYNPV  288



>ref|XP_002277802.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Vitis vinifera]
Length=437

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 173/206 (84%), Gaps = 7/206 (3%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+SVN+RRDEE     +PPYSPKTLKHPRSLPRSINYL +EQRLLFILVGILIGST
Sbjct  3    QLHKQSSVNHRRDEEIPTSQSPPYSPKTLKHPRSLPRSINYLFKEQRLLFILVGILIGST  62

Query  394  FFiiqpslsh---lsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARK  564
            FFI+QPSLS      + S IPRS +  +++R+ +    P  +   GA  +GR+PVGI R+
Sbjct  63   FFIVQPSLSRLGPAETRSTIPRSVTIGVTSRDQISIPYPQSN---GAGKVGRIPVGIGRR  119

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+RIV+TGGAGFVGSHLVDKL+ RGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE
Sbjct  120  RLRIVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  179

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  180  PILLEVDQIYHLACPASPVHYKYNPV  205



>ref|XP_006363689.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Solanum 
tuberosum]
Length=435

 Score =   278 bits (710),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 9/208 (4%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEET----AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGIL  381
            MKLH Q+S+N+RRDEET    +QNTPP SPKT KHPRSLPRSINYLL+EQRLLFILVGIL
Sbjct  1    MKLHTQSSMNHRRDEETTMSISQNTPPSSPKTFKHPRSLPRSINYLLKEQRLLFILVGIL  60

Query  382  IGSTFFiiqpslshlsssspiprshsFH-LSNREALPEYTPARSSGYGAAGIGRVPVGIA  558
            IGSTFFI+QPSLS L+ SSPIP+S  +H   +   +  +T   ++ Y   G GRVPVGI 
Sbjct  61   IGSTFFILQPSLSLLTPSSPIPQS--YHGFDSVPGVITHTSTVTTPY--RGAGRVPVGIG  116

Query  559  RKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDV  738
            RKRMR+V+TGGAGFVGSHLVDKL+KRGDDVIVIDNFFTGRKENVMHHFG+ RFELIRHDV
Sbjct  117  RKRMRVVVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVMHHFGDHRFELIRHDV  176

Query  739  VEPILLEVDQIYHLAWPASPXHYKYNPV  822
            VEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  177  VEPILLEVDQIYHLACPASPVHYKYNPV  204



>ref|XP_004249606.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Solanum 
lycopersicum]
Length=439

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 178/210 (85%), Gaps = 9/210 (4%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEET----AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGIL  381
            MKLH Q+S+N+RRDEE+    +QNTPP SPKTLKHPRSLPRSINY+L+EQRLLFILVGIL
Sbjct  1    MKLHTQSSINHRRDEESTMSISQNTPPSSPKTLKHPRSLPRSINYILKEQRLLFILVGIL  60

Query  382  IGSTFFiiqpslshlsssspiprshsFH-LSNREALPEYTPARSSGYGAAG--IGRVPVG  552
            IGSTFFI+QPSLS L+ SSPIP+S  +H   +  A   +T   ++ Y  AG   GRVPVG
Sbjct  61   IGSTFFILQPSLSLLNPSSPIPKS--YHGFDSVPAGIHHTSTVTTPYRIAGSVTGRVPVG  118

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            I RKR R+V+TGGAGFVGSHLVDKL+KRGDDVIVIDNFFTGRKENVMHHFGN RFELIRH
Sbjct  119  IGRKRTRVVVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVMHHFGNHRFELIRH  178

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  179  DVVEPILLEVDQIYHLACPASPVHYKYNPV  208



>ref|XP_009631491.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Nicotiana 
tomentosiformis]
Length=429

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 171/207 (83%), Gaps = 13/207 (6%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEETA--QNT-PPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILI  384
            MKLH Q+S+N+RRDEE +  QNT PP SPK LKHPRSLPRSINYLL+EQRLLFILVGILI
Sbjct  1    MKLHTQSSMNHRRDEEMSMSQNTTPPSSPKPLKHPRSLPRSINYLLKEQRLLFILVGILI  60

Query  385  GSTFFiiqpslshlsssspiprshsFHLSNREALP-EYTPARSSGYGAAGIGRVPVGIAR  561
            GSTFFI+QP+L+  S          FH+S  E++P  +T   ++ Y     GRVPVGI +
Sbjct  61   GSTFFILQPNLNPSSPIPNSS----FHVS--ESVPLTHTSTVTTSYKT---GRVPVGIGK  111

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            KRMRIV+TGGAGFVGSHLVDKL+KRGDDVIVIDNFFTGRKENVMHHFGN RFELIRHDVV
Sbjct  112  KRMRIVVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVMHHFGNHRFELIRHDVV  171

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EPILLEVDQIYHLA PASP HYKYNPV
Sbjct  172  EPILLEVDQIYHLACPASPVHYKYNPV  198



>ref|XP_009800368.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Nicotiana 
sylvestris]
Length=431

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 168/209 (80%), Gaps = 15/209 (7%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEE-----TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGI  378
            MKLH Q+S+N+RRDEE     +   TPP SPK LKHPRSLPRSINYLL+EQRLLFILVGI
Sbjct  1    MKLHTQSSMNHRRDEEMSMSISKNTTPPSSPKPLKHPRSLPRSINYLLKEQRLLFILVGI  60

Query  379  LIGSTFFiiqpslshlsssspiprshsFHLSNREALP-EYTPARSSGYGAAGIGRVPVGI  555
            LIGSTFFI+QPSL+  S          FH+S  E++P  +T   ++ +      RVPVGI
Sbjct  61   LIGSTFFILQPSLNPSSPIPNSS----FHVS--ESVPLTHTSTVTTSFKTW---RVPVGI  111

Query  556  ARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHD  735
             +KRMRIV+TGGAGFVGSHLVDKL+KRGDDVIVIDNFFTGRKENVMHHFGN RFELIRHD
Sbjct  112  GKKRMRIVVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVMHHFGNHRFELIRHD  171

Query  736  VVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            VVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  172  VVEPILLEVDQIYHLACPASPVHYKYNPV  200



>ref|XP_008442593.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Cucumis melo]
 ref|XP_008442594.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Cucumis melo]
Length=438

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 163/203 (80%), Gaps = 2/203 (1%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEE     T PYSPK LKHPRSLPRSINYL REQRLLF+ VGILIGST
Sbjct  6    QLHKQSSINHRRDEEVPPGPTSPYSPKALKHPRSLPRSINYLFREQRLLFVFVGILIGST  65

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
            FFI+QPSLS +  S           +   +  + T +   G+G  G GRVPVGI R+R+R
Sbjct  66   FFILQPSLSRIGPSEAGSAIRRSFSTGLTSRDQITGSGIYGFGKTG-GRVPVGIGRRRLR  124

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVDKL++RGDDVIVIDNFFTGRK+N++HH GNPRFELIRHDVVEPIL
Sbjct  125  IVVTGGAGFVGSHLVDKLIERGDDVIVIDNFFTGRKDNLVHHLGNPRFELIRHDVVEPIL  184

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYKYNPV
Sbjct  185  LEVDQIYHLACPASPVHYKYNPV  207



>ref|XP_006345671.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Solanum 
tuberosum]
Length=436

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 170/209 (81%), Gaps = 10/209 (5%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEETAQNTPPYSPKTLKHP-RSLPRSINYLLREQRLLFILVGILIGS  390
            MKLHKQ+S   RRDEE   N+ PYSPKTLK+P RSLPRSINYLL+EQRLLFILVGILIGS
Sbjct  1    MKLHKQSS---RRDEELP-NSQPYSPKTLKYPNRSLPRSINYLLKEQRLLFILVGILIGS  56

Query  391  TFFiiqpslshlssssp--iprshsFHLSNREALPEYTPARSSGYG---AAGIGRVPVGI  555
            TFFIIQPSLSHLS+SS        S++  N E+L   +      +      G GRVPVG+
Sbjct  57   TFFIIQPSLSHLSTSSEPHSSIPRSYNALNHESLSTLSSYNDKDFSFRVNGGTGRVPVGV  116

Query  556  ARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHD  735
             RKRMRIV+TGGAGFVGSHLVDKL+KRGDDVIVIDNFFTGRKENV HHFGNPRFELIRHD
Sbjct  117  GRKRMRIVVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVKHHFGNPRFELIRHD  176

Query  736  VVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            VVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  177  VVEPILLEVDQIYHLACPASPVHYKYNPV  205



>ref|XP_004137768.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Cucumis sativus]
 gb|KGN58902.1| hypothetical protein Csa_3G735020 [Cucumis sativus]
Length=438

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 163/203 (80%), Gaps = 2/203 (1%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQ-NTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEE     T PYSPK LKHPRSLPRSINYL REQRLLF+ VGILIGST
Sbjct  6    QLHKQSSINHRRDEEVPPVPTSPYSPKALKHPRSLPRSINYLFREQRLLFVFVGILIGST  65

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
            FFI+QPSLS +  S           +   +  + + +   G+G  G GRVPVGI R+R+R
Sbjct  66   FFILQPSLSRIGPSEAGSAIRRSFATGLTSRDQVSGSGIYGFGKTG-GRVPVGIGRRRLR  124

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVDKL++RGDDVIVIDNFFTGRK+N++HH GNPRFELIRHDVVEPIL
Sbjct  125  IVVTGGAGFVGSHLVDKLIERGDDVIVIDNFFTGRKDNLVHHLGNPRFELIRHDVVEPIL  184

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYKYNPV
Sbjct  185  LEVDQIYHLACPASPVHYKYNPV  207



>gb|KDO49817.1| hypothetical protein CISIN_1g014011mg [Citrus sinensis]
Length=263

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 165/206 (80%), Gaps = 8/206 (4%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIG  387
            MKLHKQ+S+  RRDEET   QN+P Y  KT KHPRSLPRSINYL +EQRLLFILVGILIG
Sbjct  1    MKLHKQSSMTQRRDEETLSGQNSP-YLSKTPKHPRSLPRSINYLFKEQRLLFILVGILIG  59

Query  388  STFFiiqpslshlsssspiprshsFH-LSNREALPEYTPARSSGYGAAGIGRVPVGIARK  564
            STFFI+QP LS L     +     FH L+  +    +   R+S +GA   GRVPVGI R+
Sbjct  60   STFFILQPILSRLGPPQELHP---FHALTANQQRQSFQFHRTSSFGAK-TGRVPVGIGRR  115

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++HHF NPRFELIRHDVVE
Sbjct  116  RLRIVVTGGAGFVGSHLVDKLIDRGDEVIVIDNFFTGRKDNLVHHFRNPRFELIRHDVVE  175

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  176  PILLEVDQIYHLACPASPVHYKYNPV  201



>ref|XP_007027131.1| UDP-glucuronic acid decarboxylase 1 isoform 2 [Theobroma cacao]
 gb|EOY07633.1| UDP-glucuronic acid decarboxylase 1 isoform 2 [Theobroma cacao]
Length=321

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 168/216 (78%), Gaps = 15/216 (7%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+SVN+RRDEE   N TPPYSPK+LK PRSLPRSINYL +EQRLLFILVGILIGST
Sbjct  3    QLHKQSSVNHRRDEEIPSNQTPPYSPKSLKQPRSLPRSINYLFKEQRLLFILVGILIGST  62

Query  394  FFiiqpsls-------------hlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI  534
            FFI+QP+LS               S+ +    + +     ++A   Y+ A S+      +
Sbjct  63   FFILQPTLSRLGPTEVRSSIPRSFSTDTNTTTTTATISHTQDASGSYS-ADSNKPFHGKV  121

Query  535  GRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPR  714
            GRVPVGI R+RMRIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKENV+H FGNPR
Sbjct  122  GRVPVGIGRRRMRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENVVHLFGNPR  181

Query  715  FELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            FELIRHDVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  182  FELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPV  217



>gb|KDO49816.1| hypothetical protein CISIN_1g014011mg [Citrus sinensis]
Length=309

 Score =   260 bits (665),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 165/206 (80%), Gaps = 8/206 (4%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIG  387
            MKLHKQ+S+  RRDEET   QN+P Y  KT KHPRSLPRSINYL +EQRLLFILVGILIG
Sbjct  1    MKLHKQSSMTQRRDEETLSGQNSP-YLSKTPKHPRSLPRSINYLFKEQRLLFILVGILIG  59

Query  388  STFFiiqpslshlsssspiprshsFH-LSNREALPEYTPARSSGYGAAGIGRVPVGIARK  564
            STFFI+QP LS L     +     FH L+  +    +   R+S +GA   GRVPVGI R+
Sbjct  60   STFFILQPILSRLGPPQELHP---FHALTANQQRQSFQFHRTSSFGAK-TGRVPVGIGRR  115

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++HHF NPRFELIRHDVVE
Sbjct  116  RLRIVVTGGAGFVGSHLVDKLIDRGDEVIVIDNFFTGRKDNLVHHFRNPRFELIRHDVVE  175

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  176  PILLEVDQIYHLACPASPVHYKYNPV  201



>gb|KJB16892.1| hypothetical protein B456_002G253300 [Gossypium raimondii]
Length=376

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEE     TPPYSPK+LKHPRSLPRSINYL +EQRLLFI +GILIGST
Sbjct  3    QLHKQSSINHRRDEEILIPQTPPYSPKSLKHPRSLPRSINYLFKEQRLLFIFIGILIGST  62

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
            FFI+QP+LS L  +   P       +N  +  +     +       +GRVPVGI R+RMR
Sbjct  63   FFILQPTLSRLGPTETHPSIPKSFSNNVVSHTQEFSVSNQNPIHGKMGRVPVGIGRRRMR  122

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKENV+H FGNPRFELIRHDVVEPIL
Sbjct  123  IVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENVVHLFGNPRFELIRHDVVEPIL  182

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYKYNPV
Sbjct  183  LEVDQIYHLACPASPVHYKYNPV  205



>gb|KJB16893.1| hypothetical protein B456_002G253300 [Gossypium raimondii]
Length=355

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEE     TPPYSPK+LKHPRSLPRSINYL +EQRLLFI +GILIGST
Sbjct  3    QLHKQSSINHRRDEEILIPQTPPYSPKSLKHPRSLPRSINYLFKEQRLLFIFIGILIGST  62

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
            FFI+QP+LS L  +   P       +N  +  +     +       +GRVPVGI R+RMR
Sbjct  63   FFILQPTLSRLGPTETHPSIPKSFSNNVVSHTQEFSVSNQNPIHGKMGRVPVGIGRRRMR  122

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKENV+H FGNPRFELIRHDVVEPIL
Sbjct  123  IVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENVVHLFGNPRFELIRHDVVEPIL  182

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYKYNPV
Sbjct  183  LEVDQIYHLACPASPVHYKYNPV  205



>gb|KDO49815.1| hypothetical protein CISIN_1g014011mg [Citrus sinensis]
Length=335

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 165/206 (80%), Gaps = 8/206 (4%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIG  387
            MKLHKQ+S+  RRDEET   QN+P Y  KT KHPRSLPRSINYL +EQRLLFILVGILIG
Sbjct  1    MKLHKQSSMTQRRDEETLSGQNSP-YLSKTPKHPRSLPRSINYLFKEQRLLFILVGILIG  59

Query  388  STFFiiqpslshlsssspiprshsFH-LSNREALPEYTPARSSGYGAAGIGRVPVGIARK  564
            STFFI+QP LS L     +     FH L+  +    +   R+S +GA   GRVPVGI R+
Sbjct  60   STFFILQPILSRLGPPQELHP---FHALTANQQRQSFQFHRTSSFGAK-TGRVPVGIGRR  115

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++HHF NPRFELIRHDVVE
Sbjct  116  RLRIVVTGGAGFVGSHLVDKLIDRGDEVIVIDNFFTGRKDNLVHHFRNPRFELIRHDVVE  175

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  176  PILLEVDQIYHLACPASPVHYKYNPV  201



>ref|XP_008369838.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Malus domestica]
Length=433

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 164/205 (80%), Gaps = 10/205 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+SVN+RRDEET    + PYSPK LKHPRSLPRSINYL +EQRLLFILVGILIGST
Sbjct  4    QLHKQSSVNHRRDEETPSTLSSPYSPKALKHPRSLPRSINYLFKEQRLLFILVGILIGST  63

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARS--SGYGAAGIGRVPVGIARKR  567
            FFI+QP+LS    S P    ++   S       ++ A    S    A +GRVPVG+ ++R
Sbjct  64   FFILQPTLSRFGPSDPNSAMNTVSRS-------FSTAHDLVSKPTHAKVGRVPVGLGKRR  116

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
            +RIV+TGGAGFVGSHLVDKL+ RG+DVIVIDNFFTGRK NV+HHFGNPRFELIRHDVVEP
Sbjct  117  LRIVVTGGAGFVGSHLVDKLLDRGNDVIVIDNFFTGRKNNVVHHFGNPRFELIRHDVVEP  176

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVDQIYHLA PASP HYKYNPV
Sbjct  177  ILLEVDQIYHLACPASPVHYKYNPV  201



>ref|XP_010326162.1| PREDICTED: UDP-glucuronic acid decarboxylase 1, partial [Solanum 
lycopersicum]
Length=385

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 172/209 (82%), Gaps = 10/209 (5%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEETAQNTPPYSPKTLKHPR-SLPRSINYLLREQRLLFILVGILIGS  390
            MKL+KQ+S   RRDE+   N+ PYSPKTLK+PR SLPRSINYLL+EQRLLFILVGILIGS
Sbjct  1    MKLYKQSS---RRDEDLP-NSQPYSPKTLKYPRGSLPRSINYLLKEQRLLFILVGILIGS  56

Query  391  TFFiiqpslshlssssp--iprshsFHLSNREALPEYTP--ARSSGYGAAGI-GRVPVGI  555
            TFFIIQPSLSHLS+SS        S++  N E+L +      +   +   G+ GRVPVG+
Sbjct  57   TFFIIQPSLSHLSTSSEPHSSIPRSYNALNHESLSKLASYNDKDVSFRVNGVTGRVPVGV  116

Query  556  ARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHD  735
             RKRMRIV+TGGAGFVGSHLVDKL+KRGDDVIVIDNFFTGRKENV HHFGNPRFELIRHD
Sbjct  117  GRKRMRIVVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVKHHFGNPRFELIRHD  176

Query  736  VVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            VVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  177  VVEPILLEVDQIYHLACPASPVHYKYNPV  205



>ref|XP_007027130.1| UDP-glucuronic acid decarboxylase 1 isoform 1 [Theobroma cacao]
 gb|EOY07632.1| UDP-glucuronic acid decarboxylase 1 isoform 1 [Theobroma cacao]
Length=448

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 168/216 (78%), Gaps = 15/216 (7%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+SVN+RRDEE   N TPPYSPK+LK PRSLPRSINYL +EQRLLFILVGILIGST
Sbjct  3    QLHKQSSVNHRRDEEIPSNQTPPYSPKSLKQPRSLPRSINYLFKEQRLLFILVGILIGST  62

Query  394  FFiiqpsls-------------hlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI  534
            FFI+QP+LS               S+ +    + +     ++A   Y+ A S+      +
Sbjct  63   FFILQPTLSRLGPTEVRSSIPRSFSTDTNTTTTTATISHTQDASGSYS-ADSNKPFHGKV  121

Query  535  GRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPR  714
            GRVPVGI R+RMRIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKENV+H FGNPR
Sbjct  122  GRVPVGIGRRRMRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENVVHLFGNPR  181

Query  715  FELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            FELIRHDVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  182  FELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPV  217



>gb|ACI46983.1| UDP-glucuronic acid decarboxylase 1 [Gossypium hirsutum]
Length=436

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEE     TPPYSPK+LKHPRSLPRSINYL +EQRLLFI +GILIGST
Sbjct  3    QLHKQSSINHRRDEEILIPQTPPYSPKSLKHPRSLPRSINYLFKEQRLLFIFIGILIGST  62

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
            FFI+QP+LS L  +   P       +N  +  +     +       +GRVPVGI R+RMR
Sbjct  63   FFILQPTLSRLGPTETHPSVPKSFSNNVVSHTQEFSVSNQNPIHGKMGRVPVGIGRRRMR  122

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKENV+H FGNPRFELIRHDVVEPIL
Sbjct  123  IVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENVVHLFGNPRFELIRHDVVEPIL  182

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYKYNPV
Sbjct  183  LEVDQIYHLACPASPVHYKYNPV  205



>gb|KJB16891.1| hypothetical protein B456_002G253300 [Gossypium raimondii]
Length=436

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEE     TPPYSPK+LKHPRSLPRSINYL +EQRLLFI +GILIGST
Sbjct  3    QLHKQSSINHRRDEEILIPQTPPYSPKSLKHPRSLPRSINYLFKEQRLLFIFIGILIGST  62

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
            FFI+QP+LS L  +   P       +N  +  +     +       +GRVPVGI R+RMR
Sbjct  63   FFILQPTLSRLGPTETHPSIPKSFSNNVVSHTQEFSVSNQNPIHGKMGRVPVGIGRRRMR  122

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKENV+H FGNPRFELIRHDVVEPIL
Sbjct  123  IVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENVVHLFGNPRFELIRHDVVEPIL  182

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYKYNPV
Sbjct  183  LEVDQIYHLACPASPVHYKYNPV  205



>emb|CDP06664.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 167/214 (78%), Gaps = 12/214 (6%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S N+RRDEE  +  +PPYSPK+LKHPRSLPRS++YLL+EQRLLFILVGILIGST
Sbjct  3    QLHKQSSTNHRRDEEMPSGQSPPYSPKSLKHPRSLPRSLSYLLKEQRLLFILVGILIGST  62

Query  394  FFiiqpslshlsssspipr------shsFHLSNREALP-----EYTPARSSGYGAAGIGR  540
            FFI+QPSLS L+ SS          S   H S R +         TP     +   G GR
Sbjct  63   FFILQPSLSLLNPSSSPSARPHPLVSSVDHESERTSGSWSTSLATTPGVKQSHLNKGTGR  122

Query  541  VPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFE  720
            VPVG+ R+RMR+V+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGR++NV HHFGN RFE
Sbjct  123  VPVGLGRRRMRVVVTGGAGFVGSHLVDKLLDRGDEVIVIDNFFTGRRDNVKHHFGNTRFE  182

Query  721  LIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            LIRHDVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  183  LIRHDVVEPILLEVDQIYHLACPASPVHYKYNPV  216



>gb|KDO49814.1| hypothetical protein CISIN_1g014011mg [Citrus sinensis]
Length=432

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 165/206 (80%), Gaps = 8/206 (4%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIG  387
            MKLHKQ+S+  RRDEET   QN+P Y  KT KHPRSLPRSINYL +EQRLLFILVGILIG
Sbjct  1    MKLHKQSSMTQRRDEETLSGQNSP-YLSKTPKHPRSLPRSINYLFKEQRLLFILVGILIG  59

Query  388  STFFiiqpslshlsssspiprshsFH-LSNREALPEYTPARSSGYGAAGIGRVPVGIARK  564
            STFFI+QP LS L     +     FH L+  +    +   R+S +GA   GRVPVGI R+
Sbjct  60   STFFILQPILSRLGPPQELHP---FHALTANQQRQSFQFHRTSSFGAK-TGRVPVGIGRR  115

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++HHF NPRFELIRHDVVE
Sbjct  116  RLRIVVTGGAGFVGSHLVDKLIDRGDEVIVIDNFFTGRKDNLVHHFRNPRFELIRHDVVE  175

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  176  PILLEVDQIYHLACPASPVHYKYNPV  201



>ref|XP_007205215.1| hypothetical protein PRUPE_ppa005905mg [Prunus persica]
 gb|EMJ06414.1| hypothetical protein PRUPE_ppa005905mg [Prunus persica]
 gb|AGH25533.1| UDP-D-xylose synthase [Prunus persica]
Length=438

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 164/206 (80%), Gaps = 12/206 (6%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQASVN RRDEE   N    YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGST
Sbjct  3    QLHKQASVNQRRDEEIPSNLASTYSPKALKHPRSLPRSINYLFKEQRLLFILVGILIGST  62

Query  394  FFiiqpslshlsssspiprshsFHLSNREA---LPEYTPARSSGYGAAGIGRVPVGIARK  564
            FFI+QP+L  L  S P   + S   S   A   +P+ T A+        +GRVPVG+ ++
Sbjct  63   FFILQPTLYRLGPSDPNNPTTSISRSFSTAHDLVPKPTHAK--------VGRVPVGLGKR  114

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+RIV+TGGAGFVGSHLVDKL+ RG+DVIVIDNFFTGRK+N++HHFGNPRFELIRHDVVE
Sbjct  115  RLRIVVTGGAGFVGSHLVDKLLDRGNDVIVIDNFFTGRKDNLVHHFGNPRFELIRHDVVE  174

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  175  PILLEVDQIYHLACPASPVHYKYNPV  200



>ref|XP_009377117.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Pyrus x 
bretschneideri]
Length=433

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 164/205 (80%), Gaps = 10/205 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+SVN+RRDEET    + PYSPK LKHPRSLPRSINYL +EQRLLFILVGILIGST
Sbjct  4    QLHKQSSVNHRRDEETPSTLSSPYSPKALKHPRSLPRSINYLFKEQRLLFILVGILIGST  63

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARS--SGYGAAGIGRVPVGIARKR  567
            FFI+QP+LS L  S P    ++   S       ++ A    S    A +GRVPV + ++R
Sbjct  64   FFILQPTLSRLGPSDPNSAINTVSRS-------FSTAHDLVSKPTHAKVGRVPVALGKRR  116

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
            +RIV+TGGAGFVGSHLVDKL+ RG+DVIVIDNFFTGRK N++HHFGNPRFELIRHDVVEP
Sbjct  117  LRIVVTGGAGFVGSHLVDKLLDRGNDVIVIDNFFTGRKNNLVHHFGNPRFELIRHDVVEP  176

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            +LLEVDQIYHLA PASP HYKYNPV
Sbjct  177  VLLEVDQIYHLACPASPVHYKYNPV  201



>ref|XP_008241657.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Prunus mume]
Length=432

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 162/205 (79%), Gaps = 10/205 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQASVN RRDEE   N    YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGST
Sbjct  3    QLHKQASVNQRRDEEIPSNLASTYSPKALKHPRSLPRSINYLFKEQRLLFILVGILIGST  62

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARS--SGYGAAGIGRVPVGIARKR  567
            FFI+QP+L  L  S P   + S   S       ++ A    S    A +GRVPVG+ ++R
Sbjct  63   FFILQPTLYRLGPSDPNNPTTSISRS-------FSTAHDVVSKPTHAKVGRVPVGLGKRR  115

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
            +RIV+TGGAGFVGSHLVDKL+ RG+DVIVIDNFFTGRK+N++HHFGNPRFELIRHDVVEP
Sbjct  116  LRIVVTGGAGFVGSHLVDKLLDRGNDVIVIDNFFTGRKDNLVHHFGNPRFELIRHDVVEP  175

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVDQIYHLA PASP HYKYNPV
Sbjct  176  ILLEVDQIYHLACPASPVHYKYNPV  200



>ref|XP_010047285.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Eucalyptus grandis]
 gb|KCW88893.1| hypothetical protein EUGRSUZ_A01221 [Eucalyptus grandis]
Length=438

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 162/207 (78%), Gaps = 7/207 (3%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPP-YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N RRDEE A   P  YSPK LKHPRSLPRSI+YLLREQRLLF+LVGILIGST
Sbjct  3    QLHKQSSMNVRRDEEIAAPKPSSYSPKALKHPRSLPRSIHYLLREQRLLFVLVGILIGST  62

Query  394  FFiiqpslshlsssspiprs-hsFHLSNREALPE---YTPARSSGYGAAGIGRVPVGIAR  561
            FFI+QP+LS L            F ++    LPE    + A +      G GRVP  +AR
Sbjct  63   FFILQPTLSRLGPGEARASIPRLFRVA--PGLPERDQVSTATAVPKLVHGYGRVPASVAR  120

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            +R+RIV+TGGAGFVGSHLVDKL+ RGDDVIVIDNFFTGRKENV+HHF NPRFELIRHDVV
Sbjct  121  RRLRIVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKENVVHHFANPRFELIRHDVV  180

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EPILLEVDQIYHLA PASP HYKYNP+
Sbjct  181  EPILLEVDQIYHLACPASPVHYKYNPI  207



>ref|XP_006480725.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Citrus sinensis]
Length=432

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 164/206 (80%), Gaps = 8/206 (4%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIG  387
            MKLHKQ+S+  RRDEET   QN+P Y  KT KHPRSLPRSINY+ +EQRLLFILVGILIG
Sbjct  1    MKLHKQSSMTQRRDEETLSGQNSP-YLSKTPKHPRSLPRSINYIFKEQRLLFILVGILIG  59

Query  388  STFFiiqpslshlsssspiprshsFH-LSNREALPEYTPARSSGYGAAGIGRVPVGIARK  564
            STFFI+QP LS L           FH L+  +    +   R+S +GA   GRVPVGI R+
Sbjct  60   STFFILQPILSRLGPPQEPHP---FHALTANQQRQSFQFHRTSSFGAK-TGRVPVGIGRR  115

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+R+V+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++HHF NPRFELIRHDVVE
Sbjct  116  RLRLVVTGGAGFVGSHLVDKLIDRGDEVIVIDNFFTGRKDNLVHHFRNPRFELIRHDVVE  175

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  176  PILLEVDQIYHLACPASPVHYKYNPV  201



>ref|XP_006428995.1| hypothetical protein CICLE_v10011665mg [Citrus clementina]
 gb|ESR42235.1| hypothetical protein CICLE_v10011665mg [Citrus clementina]
Length=464

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 164/206 (80%), Gaps = 8/206 (4%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIG  387
            MKLHKQ+S+  RRDEET   QN+P Y  KT KHPRSLPRSINY+ +EQRLLFILVGILIG
Sbjct  33   MKLHKQSSMTQRRDEETLSGQNSP-YLSKTPKHPRSLPRSINYIFKEQRLLFILVGILIG  91

Query  388  STFFiiqpslshlsssspiprshsFH-LSNREALPEYTPARSSGYGAAGIGRVPVGIARK  564
            STFFI+QP LS L           FH L+  +    +   R+S +GA   GRVPVGI R+
Sbjct  92   STFFILQPILSRLGPPQEPHP---FHALTANQQRQSFQFHRTSSFGAK-TGRVPVGIGRR  147

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+R+V+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++HHF NPRFELIRHDVVE
Sbjct  148  RLRLVVTGGAGFVGSHLVDKLIDRGDEVIVIDNFFTGRKDNLVHHFRNPRFELIRHDVVE  207

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  208  PILLEVDQIYHLACPASPVHYKYNPV  233



>ref|XP_003542474.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Glycine 
max]
Length=427

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 161/204 (79%), Gaps = 13/204 (6%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S+N+RR+EE   +  T PYSPK++KH RSLPRSINYLLREQRLLFILVGILIGS
Sbjct  3    QLHKQTSLNHRREEEMLGSSETSPYSPKSIKHTRSLPRSINYLLREQRLLFILVGILIGS  62

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFIIQP+LS L    P+             LP    AR +G G    GRVPVGI  +R 
Sbjct  63   TFFIIQPTLSRLGPPEPVHTF----------LPRTGLARFAGPGPR-TGRVPVGIGGRRQ  111

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGDDVIVIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  112  RIVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  171

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNPV
Sbjct  172  LLEVDQIYHLACPASPVHYKYNPV  195



>gb|EPS72114.1| hypothetical protein M569_02642 [Genlisea aurea]
Length=437

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 165/210 (79%), Gaps = 15/210 (7%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ S + R+DEE  A +TPPYSPK+LK+PRSLPRS+NY+L+EQRLLF+L+GI+IG+T
Sbjct  3    QLHKQ-SASARKDEEMPASDTPPYSPKSLKNPRSLPRSLNYILKEQRLLFVLIGIVIGAT  61

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEY-----TPARSSGYG--AAGIGRVPVG  552
            FFI+QPSLS               ++NRE++        T     GYG    G+GRVPVG
Sbjct  62   FFILQPSLSSSDGRGV------ISIANRESIDGLGHRGQTDFGRHGYGKYTNGVGRVPVG  115

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            I  +R RIV+TGGAGFVGSHLVDKL+ RGDDVIVIDNFFTGRKENV+H FGNPRFELIRH
Sbjct  116  IGNRRKRIVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKENVVHLFGNPRFELIRH  175

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEPILLEVDQIYHLA PASP HYK+NPV
Sbjct  176  DVVEPILLEVDQIYHLACPASPVHYKHNPV  205



>gb|KFK34603.1| hypothetical protein AALP_AA5G167100 [Arabis alpina]
Length=435

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 164/207 (79%), Gaps = 10/207 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RD+ET     + PYSPK LKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDDETIPMSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSS---GYGAAGIGRVPVGIAR  561
            TFFI+QPSLS L ++            +  ++  YTP R S   G G+ G GRVPVG+ R
Sbjct  61   TFFILQPSLSRLGAAESTSLIT--RSVSLTSVDNYTPPRMSFNYGGGSRG-GRVPVGLGR  117

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            KR+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++HHF NPRFELIRHDVV
Sbjct  118  KRLRIVVTGGAGFVGSHLVDKLLGRGDEVIVIDNFFTGRKENLVHHFSNPRFELIRHDVV  177

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EPILLEVDQIYHLA PASP HYKYNPV
Sbjct  178  EPILLEVDQIYHLACPASPVHYKYNPV  204



>ref|XP_004302799.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Fragaria vesca 
subsp. vesca]
Length=437

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+SVN+RRDEE   + +  YSPK LKHPRSLPRS+NY+ +EQRLLFILVGILIGST
Sbjct  4    QLHKQSSVNHRRDEEIPTSLSSSYSPKALKHPRSLPRSLNYIFKEQRLLFILVGILIGST  63

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
            FFI+QP+LS LS S P P       S+  +    + A  S        RVP G+ ++R+R
Sbjct  64   FFILQPTLSRLSPSDPHPSIPRSFSSSVVSHDRISTASFSSDLRNNAARVPAGLGKRRLR  123

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVDKL+ RG+DVIVIDNFFTGRKENV HHFGNPRFELIRHDVVEPIL
Sbjct  124  IVVTGGAGFVGSHLVDKLLSRGNDVIVIDNFFTGRKENVAHHFGNPRFELIRHDVVEPIL  183

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYKYNPV
Sbjct  184  LEVDQIYHLACPASPVHYKYNPV  206



>ref|XP_003537209.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like isoform 1 
[Glycine max]
Length=427

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 159/204 (78%), Gaps = 13/204 (6%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S+N+RR+EE   +  + PYSPK++KH RSLPRSINYLLREQRLLFILVGILIGS
Sbjct  3    QLHKQTSLNHRREEEMLGSSESSPYSPKSIKHTRSLPRSINYLLREQRLLFILVGILIGS  62

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFIIQP+LS +    P              LP    AR SG      GRVPVGI  +R 
Sbjct  63   TFFIIQPTLSRMGPPEPAHTF----------LPRTGLARFSGT-RPRTGRVPVGIGGRRQ  111

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGDDVIVIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  112  RIVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  171

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNPV
Sbjct  172  LLEVDQIYHLACPASPVHYKYNPV  195



>gb|AAT40110.1| putative UDP-glucuronate decarboxylase 4 [Nicotiana tabacum]
Length=409

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 153/186 (82%), Gaps = 10/186 (5%)
 Frame = +1

Query  268  QNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspip  447
              TPP SPK LKHPRSLPRSINYLL+EQRLLFILVGILIGSTFFI+QP+L+  S      
Sbjct  2    NTTPPSSPKPLKHPRSLPRSINYLLKEQRLLFILVGILIGSTFFILQPNLNPSSPIPNSS  61

Query  448  rshsFHLSNREALP-EYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDK  624
                FH+S  E++P  +T   ++ Y     GRVPVGI +KRMRIV+TGGAGFVGSHLVDK
Sbjct  62   ----FHVS--ESVPLTHTSTVTTSYKT---GRVPVGIGKKRMRIVVTGGAGFVGSHLVDK  112

Query  625  LMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXH  804
            L+KRGDDVIVIDNFFTGRKENVMHHFGN RFELIRHDVVEPILLEVDQIYHLA PASP H
Sbjct  113  LIKRGDDVIVIDNFFTGRKENVMHHFGNHRFELIRHDVVEPILLEVDQIYHLACPASPVH  172

Query  805  YKYNPV  822
            YKYNPV
Sbjct  173  YKYNPV  178



>ref|XP_007144481.1| hypothetical protein PHAVU_007G159700g [Phaseolus vulgaris]
 gb|ESW16475.1| hypothetical protein PHAVU_007G159700g [Phaseolus vulgaris]
Length=423

 Score =   254 bits (648),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 159/205 (78%), Gaps = 19/205 (9%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ S+N+RR+EE + N   PYSPK++KH RSLPRSINYLLREQRLLFILVGILIGST
Sbjct  3    QLHKQTSLNHRREEEMSSNEASPYSPKSIKHTRSLPRSINYLLREQRLLFILVGILIGST  62

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAG--IGRVPVGIARKR  567
            FFIIQP+LS +                    P + P RS     AG   GRVPVGI  +R
Sbjct  63   FFIIQPTLSRIGPPET---------------PNFLP-RSGLNRLAGSRTGRVPVGIYGRR  106

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
             RIV+TGGAGFVGSHLVDKL+ RGDDVIVIDNFFTGRKEN++H FGNPRFELIRHDVVEP
Sbjct  107  PRIVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEP  166

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVDQIYHLA PASP HYKYNPV
Sbjct  167  ILLEVDQIYHLACPASPVHYKYNPV  191



>ref|XP_010260024.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Nelumbo 
nucifera]
 ref|XP_010260025.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Nelumbo 
nucifera]
 ref|XP_010260026.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Nelumbo 
nucifera]
Length=438

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ S NYRRD+E    T  YS KTLK PR++PRSINYL++EQRLLFILVGILI STF
Sbjct  3    QLHKQPSGNYRRDDENPITTSSYSTKTLKQPRTIPRSINYLMKEQRLLFILVGILIASTF  62

Query  397  Fiiqpslshlsssspiprs-hsFHLSNREALPEYTPARSSGYGAAG-IGRVPVGIARKRM  570
            FI+QPSLS L            F +S         P+ SSG    G +GRVP GI R  +
Sbjct  63   FILQPSLSRLGPPESHHVIPREFPVSVSGHQQILNPSWSSGNHQLGKVGRVPAGIRRPGL  122

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD VIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI
Sbjct  123  RIVVTGGAGFVGSHLVDKLLARGDYVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  182

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNPV
Sbjct  183  LLEVDQIYHLACPASPVHYKYNPV  206



>ref|XP_010684197.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Beta vulgaris 
subsp. vulgaris]
Length=437

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 162/207 (78%), Gaps = 8/207 (4%)
 Frame = +1

Query  217  KLHKQASVNY-RRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIG  387
            +LHKQ+S N  RRDEE   +QN+P YSPKT K+ RS PRSINYLL+EQRLLFILVGILIG
Sbjct  3    QLHKQSSGNTNRRDEEIPMSQNSP-YSPKTQKYHRSFPRSINYLLKEQRLLFILVGILIG  61

Query  388  STFFiiqpslshlsssspiprshsFHLSNREA--LPEYTPARSSGYGAAGIGRVPVGIAR  561
            +TFFI+QP+LS +          S  L   E   L  Y P   S +    +GRVP GI R
Sbjct  62   ATFFILQPTLSRIGPQDSNFPKSSV-LGKWETNDLGSY-PRHQSNWVGGKVGRVPAGIGR  119

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            +RMR+V+TGGAGFVGSHLVDKL+ RGDDVIVIDNFFTGRKENV+HHFGNPRFELIRHDVV
Sbjct  120  RRMRVVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKENVVHHFGNPRFELIRHDVV  179

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EPILLEVDQIYHLA PASP HYKYNPV
Sbjct  180  EPILLEVDQIYHLACPASPVHYKYNPV  206



>ref|XP_006403678.1| hypothetical protein EUTSA_v10010296mg [Eutrema salsugineum]
 gb|ESQ45131.1| hypothetical protein EUTSA_v10010296mg [Eutrema salsugineum]
Length=517

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 162/209 (78%), Gaps = 7/209 (3%)
 Frame = +1

Query  205  EFAMKLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGI  378
            E   +LHKQ S   +RDEET     + PYSPK LKHPRSLPRS++YL REQRLLFILVGI
Sbjct  82   ETMKQLHKQMS--SKRDEETIPMSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGI  139

Query  379  LIGSTFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSS-GYGAAGIGRVPVGI  555
            LIGSTFFI+QPSLS L ++            +   +  Y+P++ S  YG    GRVPVGI
Sbjct  140  LIGSTFFILQPSLSRLGAAESTSLIT--RSVSTAVVDNYSPSKMSFNYGGGKTGRVPVGI  197

Query  556  ARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHD  735
             R+R+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++H F NPRFELIRHD
Sbjct  198  GRRRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKDNLVHLFSNPRFELIRHD  257

Query  736  VVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            VVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  258  VVEPILLEVDQIYHLACPASPVHYKYNPV  286



>gb|EYU38483.1| hypothetical protein MIMGU_mgv1a006574mg [Erythranthe guttata]
Length=438

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 162/207 (78%), Gaps = 8/207 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ++   + +E     TPPYSPK+LKHPRSLPRS+NY+L+EQRLLFILVGILIGSTF
Sbjct  3    QLHKQSTSTRKEEEIPISQTPPYSPKSLKHPRSLPRSLNYILKEQRLLFILVGILIGSTF  62

Query  397  FiiqpslshlsssspiprshsFHLSNREALPE-----YTPARSSGYGAAGIGRVPVGIAR  561
            FIIQPSLS LSSS   PR       NRE         +   R+    + G+GRVPVGI  
Sbjct  63   FIIQPSLSALSSSDSRPR---ISAQNRELAVTTVRNPFGDGRNYNKYSNGVGRVPVGIGA  119

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            KR RIV+TGGAGFVGSHLVDKL+  GDDVIVIDNFFTGRKENV+H FGNPRFELIRHDVV
Sbjct  120  KRKRIVVTGGAGFVGSHLVDKLIAMGDDVIVIDNFFTGRKENVVHLFGNPRFELIRHDVV  179

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EPILLEVDQIYHLA PASP HYKYNPV
Sbjct  180  EPILLEVDQIYHLACPASPVHYKYNPV  206



>ref|XP_009116044.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Brassica rapa]
Length=431

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 161/205 (79%), Gaps = 10/205 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RD++T     + PYSPK LKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDDDTIPTSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSS-GYGAAGIGRVPVGIARKR  567
            TFFI+QPSLS LS +          ++   +   Y+P+R S  YG    GRVPVGI  +R
Sbjct  61   TFFILQPSLSRLSPAESTSL-----IARSASSTNYSPSRMSFNYGGGKTGRVPVGINPRR  115

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
            +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEP
Sbjct  116  LRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVVEP  175

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVDQIYHLA PASP HYKYNPV
Sbjct  176  ILLEVDQIYHLACPASPVHYKYNPV  200



>ref|XP_008387725.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Malus domestica]
Length=433

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 162/203 (80%), Gaps = 6/203 (3%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEE   + + PYS K  KHPRSLPRSINYL +EQRLLFILVGILIGST
Sbjct  4    QLHKQSSLNHRRDEEIPSSLSSPYSTKAPKHPRSLPRSINYLFKEQRLLFILVGILIGST  63

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
            FFI+QP+LS L  S P   + S   +   A    + A       A +GRVPV + ++R+R
Sbjct  64   FFILQPTLSRLGPSDPNSAATSVSRTFSTAHDLVSKATH-----AKVGRVPVALGQRRLR  118

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVDKL+ RG+DVIVIDNFFTGRK+N++HHFGNPRFELIRHDVVEPIL
Sbjct  119  IVVTGGAGFVGSHLVDKLIDRGNDVIVIDNFFTGRKDNLVHHFGNPRFELIRHDVVEPIL  178

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYKYNPV
Sbjct  179  LEVDQIYHLACPASPVHYKYNPV  201



>ref|XP_006373844.1| hypothetical protein POPTR_0016s08130g [Populus trichocarpa]
 gb|ERP51641.1| hypothetical protein POPTR_0016s08130g [Populus trichocarpa]
Length=319

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 157/204 (77%), Gaps = 5/204 (2%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  TAQ+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTAQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S              + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSSLSSSIYPRNQDSSSGSSGFFSKRTFPGRVPAGIGRKSL  120

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  121  RIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  180

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNPV
Sbjct  181  LLEVDQIYHLACPASPVHYKYNPV  204



>ref|XP_004494986.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Cicer arietinum]
Length=430

 Score =   251 bits (642),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 157/205 (77%), Gaps = 11/205 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQ---NTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIG  387
            +LHKQ S+N+RR+EE       TPPYSPK++KH RSLPRSINYLLREQRLLFILVGILIG
Sbjct  3    QLHKQQSLNHRREEEMGSGQGETPPYSPKSMKHTRSLPRSINYLLREQRLLFILVGILIG  62

Query  388  STFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKR  567
            STFF     +    S    P +HSF   +   L  +     SG     +GRVP G+  +R
Sbjct  63   STFF----IIQPTLSRIGPPEAHSFIPRSGGGLVRF----DSGVVPGRVGRVPAGLGGRR  114

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
            +R+V+TGGAGFVGSHLVDKL+ RG+DVIVIDNFFTGRKEN++H FGNPRFELIRHDVVEP
Sbjct  115  LRVVVTGGAGFVGSHLVDKLIGRGNDVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEP  174

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVDQIYHLA PASP HYKYNP+
Sbjct  175  ILLEVDQIYHLACPASPVHYKYNPI  199



>ref|XP_011007309.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Populus 
euphratica]
Length=435

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 161/208 (77%), Gaps = 13/208 (6%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYLL+EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLLKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshls----ssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIA  558
            TFFI QP+LS L+    ++     S  +H +   +           +     GRVP GI 
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSSLSSSIYHRNQDSSSGSSGFFSKRTFP----GRVPAGIG  116

Query  559  RKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDV  738
            RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIRHDV
Sbjct  117  RKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIRHDV  176

Query  739  VEPILLEVDQIYHLAWPASPXHYKYNPV  822
            VEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  177  VEPILLEVDQIYHLACPASPVHYKYNPV  204



>ref|NP_001078277.1| UDP-glucuronic acid decarboxylase 1 [Arabidopsis thaliana]
 gb|AEE79102.1| UDP-glucuronic acid decarboxylase 1 [Arabidopsis thaliana]
Length=354

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 163/207 (79%), Gaps = 10/207 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RDEET     + PYSPKTLKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDEETIPMSQSSPYSPKTLKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARS---SGYGAAGIGRVPVGIAR  561
            TFFI+QPSLS L ++           S   A+ +  P+RS   SG G    GRVPVGI R
Sbjct  61   TFFILQPSLSRLGAAESTSLITR---SVSYAVTDSPPSRSTFNSGGGGGRTGRVPVGIGR  117

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            KR+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVV
Sbjct  118  KRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVV  177

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EPILLEVDQIYHLA PASP HYKYNPV
Sbjct  178  EPILLEVDQIYHLACPASPVHYKYNPV  204



>ref|XP_009341642.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Pyrus x 
bretschneideri]
Length=433

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 162/205 (79%), Gaps = 10/205 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEE     + PYS K  KHPRSLPRSINYL +EQRLLFILVGILIGST
Sbjct  4    QLHKQSSLNHRRDEEIPSTLSSPYSSKAPKHPRSLPRSINYLFKEQRLLFILVGILIGST  63

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARS--SGYGAAGIGRVPVGIARKR  567
            FFI+QP+LS L  S P   + S   +       ++ A    S    A +GRVPV + ++R
Sbjct  64   FFILQPTLSRLGPSDPNSAATSVSKT-------FSTAHDLVSKPTHAKVGRVPVALGQRR  116

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
            +RIV+TGGAGFVGSHLVDKL+ RG+DVIVIDNFFTGRK+N++HHFGNPRFELIRHDVVEP
Sbjct  117  LRIVVTGGAGFVGSHLVDKLIDRGNDVIVIDNFFTGRKDNLVHHFGNPRFELIRHDVVEP  176

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVDQIYHLA PASP HYKYNPV
Sbjct  177  ILLEVDQIYHLACPASPVHYKYNPV  201



>ref|XP_009374642.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Pyrus x 
bretschneideri]
Length=433

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 160/203 (79%), Gaps = 6/203 (3%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEE     + PYS K  KHPRSLPRSINYL +EQRLLFILVGILIGST
Sbjct  4    QLHKQSSLNHRRDEEIPSTLSSPYSTKAPKHPRSLPRSINYLFKEQRLLFILVGILIGST  63

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
            FFI+QP+LS L  S P   + S   +   A    +         A +GRVPV + ++R+R
Sbjct  64   FFILQPTLSRLGPSDPNSAATSVSRTISAAHDLVSKPTH-----AKVGRVPVALGQRRLR  118

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVDKL+ RG+DVIVIDNFFTGRK+N++HHFGNPRFELIRHDVVEPIL
Sbjct  119  IVVTGGAGFVGSHLVDKLIDRGNDVIVIDNFFTGRKDNLVHHFGNPRFELIRHDVVEPIL  178

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYKYNPV
Sbjct  179  LEVDQIYHLACPASPVHYKYNPV  201



>ref|XP_002876209.1| UDP-glucuronic acid decarboxylase 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52468.1| UDP-glucuronic acid decarboxylase 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   249 bits (635),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 156/205 (76%), Gaps = 7/205 (3%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RDEET     + PYSPKTLKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDEETIPMSQSSPYSPKTLKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiq-pslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKR  567
            TFFI+Q       ++ S    + S   +  ++ P      S G G  G  RVPVGI RKR
Sbjct  61   TFFILQPSLSRLGAAESTSLITRSVSYAVSDSPPSMKTFNSGGGGRTG--RVPVGIGRKR  118

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
            +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEP
Sbjct  119  LRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVVEP  178

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVD IYHLA PASP HYKYNPV
Sbjct  179  ILLEVDHIYHLACPASPVHYKYNPV  203



>ref|XP_010253356.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Nelumbo 
nucifera]
Length=439

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 162/208 (78%), Gaps = 9/208 (4%)
 Frame = +1

Query  217  KLHKQASV-NYRRDEE----TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGIL  381
            +LHKQ+SV NYRRDEE    T+ +   Y  KT K PRSLPRSINYL++EQRLLFILVGIL
Sbjct  3    QLHKQSSVVNYRRDEENPPTTSTHPSTYPSKTQKQPRSLPRSINYLMKEQRLLFILVGIL  62

Query  382  IGSTFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAG-IGRVPVGIA  558
            I STFF +QP+LS L  S  I       ++N   +  + P+ SS     G +GRVP GI 
Sbjct  63   IASTFFFLQPTLSRLGPSEYISVEP-IGVTNHHNV--WNPSWSSANRQVGKVGRVPAGIQ  119

Query  559  RKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDV  738
            R+++RIV+TGGAGFVGSHLVDKL+ RG++VIVIDNFFTGRKEN MHHFGNPRFELIRHDV
Sbjct  120  RRQLRIVVTGGAGFVGSHLVDKLLARGNNVIVIDNFFTGRKENAMHHFGNPRFELIRHDV  179

Query  739  VEPILLEVDQIYHLAWPASPXHYKYNPV  822
            VEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  180  VEPILLEVDQIYHLACPASPVHYKYNPI  207



>emb|CDX76206.1| BnaA04g04700D [Brassica napus]
Length=433

 Score =   249 bits (635),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 155/205 (76%), Gaps = 22/205 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RD++T     + PYSPK LKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDDDTIPMSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSS-GYGAAGIGRVPVGIARKR  567
            TFFI+QPS                 LS       Y+P++ S  YG    GRVPVGI  +R
Sbjct  61   TFFILQPS-----------------LSRLAPADNYSPSKMSFNYGGGRTGRVPVGIGGRR  103

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
            +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEP
Sbjct  104  LRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVVEP  163

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVDQIYHLA PASP HYK+NPV
Sbjct  164  ILLEVDQIYHLACPASPVHYKFNPV  188



>gb|AAX37334.1| UDP-glucuronic acid decarboxylase 1 [Populus tomentosa]
Length=435

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 160/208 (77%), Gaps = 13/208 (6%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshls----ssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIA  558
            TFFI QP+LS L+    ++     S  +H +   +           +     GRVP GI 
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSSLSSSIYHRNQDSSSGSSGFFSKRTFP----GRVPAGIG  116

Query  559  RKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDV  738
            RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIRHDV
Sbjct  117  RKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIRHDV  176

Query  739  VEPILLEVDQIYHLAWPASPXHYKYNPV  822
            VEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  177  VEPILLEVDQIYHLACPASPVHYKYNPV  204



>ref|XP_002323432.2| hypothetical protein POPTR_0016s08130g [Populus trichocarpa]
 gb|EEF05193.2| hypothetical protein POPTR_0016s08130g [Populus trichocarpa]
Length=435

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 157/204 (77%), Gaps = 5/204 (2%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  TAQ+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTAQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S              + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSSLSSSIYPRNQDSSSGSSGFFSKRTFPGRVPAGIGRKSL  120

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  121  RIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  180

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNPV
Sbjct  181  LLEVDQIYHLACPASPVHYKYNPV  204



>gb|AGK44132.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 160/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIVITGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFEL
Sbjct  112  PAGIGRKSLRIVITGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44138.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44151.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 160/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44124.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 160/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>ref|NP_850694.2| UDP-glucuronic acid decarboxylase 1 [Arabidopsis thaliana]
 sp|Q8VZC0.1|UXS1_ARATH RecName: Full=UDP-glucuronic acid decarboxylase 1; AltName: Full=UDP-XYL 
synthase 1; AltName: Full=UDP-glucuronate decarboxylase 
1; Short=UGD; Short=UXS-1 [Arabidopsis thaliana]
 gb|AAL38251.1| dTDP-glucose 4-6-dehydratase-like protein [Arabidopsis thaliana]
 gb|AAO29973.1| dTDP-glucose 4-6-dehydratase-like protein [Arabidopsis thaliana]
 gb|AEE79100.1| UDP-glucuronic acid decarboxylase 1 [Arabidopsis thaliana]
Length=435

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 163/207 (79%), Gaps = 10/207 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RDEET     + PYSPKTLKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDEETIPMSQSSPYSPKTLKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARS---SGYGAAGIGRVPVGIAR  561
            TFFI+QPSLS L ++           S   A+ +  P+RS   SG G    GRVPVGI R
Sbjct  61   TFFILQPSLSRLGAAESTSLITR---SVSYAVTDSPPSRSTFNSGGGGGRTGRVPVGIGR  117

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            KR+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVV
Sbjct  118  KRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVV  177

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EPILLEVDQIYHLA PASP HYKYNPV
Sbjct  178  EPILLEVDQIYHLACPASPVHYKYNPV  204



>gb|AGK44127.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 160/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>ref|XP_009139397.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Brassica 
rapa]
Length=432

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 160/205 (78%), Gaps = 9/205 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RD++T     + PYSPK LKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDDDTIPMSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSS-GYGAAGIGRVPVGIARKR  567
            TFFI+QPSLS L+ +          + +      Y+P++ S  YG    GRVPVGI  +R
Sbjct  61   TFFILQPSLSRLAPAESTSLITRSVVDSNN----YSPSKMSFNYGGGRTGRVPVGIGGRR  116

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
            +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEP
Sbjct  117  LRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVVEP  176

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVDQIYHLA PASP HYK+NPV
Sbjct  177  ILLEVDQIYHLACPASPVHYKFNPV  201



>ref|NP_190920.3| UDP-glucuronic acid decarboxylase 1 [Arabidopsis thaliana]
 gb|AAK70880.1|AF387787_1 UDP-glucuronic acid decarboxylase [Arabidopsis thaliana]
 emb|CAB67659.1| dTDP-glucose 4-6-dehydratase-like protein [Arabidopsis thaliana]
 gb|AEE79101.1| UDP-glucuronic acid decarboxylase 1 [Arabidopsis thaliana]
Length=433

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 163/207 (79%), Gaps = 10/207 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RDEET     + PYSPKTLKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDEETIPMSQSSPYSPKTLKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARS---SGYGAAGIGRVPVGIAR  561
            TFFI+QPSLS L ++           S   A+ +  P+RS   SG G    GRVPVGI R
Sbjct  61   TFFILQPSLSRLGAAESTSLITR---SVSYAVTDSPPSRSTFNSGGGGGRTGRVPVGIGR  117

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            KR+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVV
Sbjct  118  KRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVV  177

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EPILLEVDQIYHLA PASP HYKYNPV
Sbjct  178  EPILLEVDQIYHLACPASPVHYKYNPV  204



>gb|AGK44128.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 159/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44156.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 159/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44153.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 157/211 (74%), Gaps = 19/211 (9%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ SVN RRDEE   ++  YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGSTF
Sbjct  4    QLHKQTSVNQRRDEEIP-SSQSYSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGSTF  62

Query  397  FiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRVPV  549
            FI QP+LS L+ S P         +   +LP     R+    +            GRVP 
Sbjct  63   FIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRVPA  113

Query  550  GIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIR  729
            GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIR
Sbjct  114  GIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIR  173

Query  730  HDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            HDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  174  HDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44150.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   247 bits (630),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 159/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44121.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 159/212 (75%), Gaps = 23/212 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNP  819
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNP  203



>gb|AGK44157.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 157/211 (74%), Gaps = 19/211 (9%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ SVN RRDEE   ++  YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGSTF
Sbjct  4    QLHKQTSVNQRRDEEIP-SSQSYSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGSTF  62

Query  397  FiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRVPV  549
            FI QP+LS L+ S P         +   +LP     R+    +            GRVP 
Sbjct  63   FIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRVPA  113

Query  550  GIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIR  729
            GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIR
Sbjct  114  GIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIR  173

Query  730  HDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            HDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  174  HDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44109.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 158/211 (75%), Gaps = 19/211 (9%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ SVN RRDEE   ++  YSPK LKHPRSLPRS+NYL +EQRLLFILVGILIGSTF
Sbjct  4    QLHKQTSVNQRRDEEIP-SSQSYSPKMLKHPRSLPRSVNYLFKEQRLLFILVGILIGSTF  62

Query  397  FiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRVPV  549
            FI+QP+LS L+ S P         +   +LP     R+    +            GRVP 
Sbjct  63   FIVQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRVPA  113

Query  550  GIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIR  729
            GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIR
Sbjct  114  GIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIR  173

Query  730  HDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            HDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  174  HDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44148.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44152.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 158/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>gb|AGK44117.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44118.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44149.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 158/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>gb|AGK44130.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 158/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>ref|XP_010528269.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Tarenaya 
hassleriana]
Length=433

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 163/206 (79%), Gaps = 10/206 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE---TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIG  387
            +LHKQ S   +RD+E   T+Q+TP YSPK LKHPRSLPRSINY+ REQRLLF+LVGILIG
Sbjct  3    QLHKQMS--SKRDDEALPTSQSTP-YSPKALKHPRSLPRSINYIFREQRLLFVLVGILIG  59

Query  388  STFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGY-GAAGIGRVPVGIARK  564
            STFFI+QPSLS L ++           S  +A+ + +  ++S   G    GRVPVGI R+
Sbjct  60   STFFIVQPSLSRLGATGSNSLVTR---SIHDAVVDSSSYKTSFIPGGGKTGRVPVGIRRR  116

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
             +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVE
Sbjct  117  GLRIVVTGGAGFVGSHLVDKLIARGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVVE  176

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  177  PILLEVDQIYHLACPASPVHYKYNPV  202



>gb|AGK44146.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 158/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>gb|AGK44116.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 158/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVG HLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGCHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>ref|NP_001190080.1| UDP-glucuronic acid decarboxylase 1 [Arabidopsis thaliana]
 gb|AEE79103.1| UDP-glucuronic acid decarboxylase 1 [Arabidopsis thaliana]
Length=458

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 162/206 (79%), Gaps = 10/206 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RDEET     + PYSPKTLKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDEETIPMSQSSPYSPKTLKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARS---SGYGAAGIGRVPVGIAR  561
            TFFI+QPSLS L ++           S   A+ +  P+RS   SG G    GRVPVGI R
Sbjct  61   TFFILQPSLSRLGAAESTSLITR---SVSYAVTDSPPSRSTFNSGGGGGRTGRVPVGIGR  117

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            KR+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVV
Sbjct  118  KRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVV  177

Query  742  EPILLEVDQIYHLAWPASPXHYKYNP  819
            EPILLEVDQIYHLA PASP HYKYNP
Sbjct  178  EPILLEVDQIYHLACPASPVHYKYNP  203



>gb|AGK44159.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 158/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+V VIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGSHLVDKLISRGDEVTVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>gb|AGK44145.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 159/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHMFRNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44143.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 159/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHP SLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPLSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44140.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 159/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHMFRNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44129.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 159/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +E RLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKELRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|KEH42335.1| UDP-glucuronic acid decarboxylase [Medicago truncatula]
Length=460

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 158/204 (77%), Gaps = 20/204 (10%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ S+N+RR+EE    TPPYSPK++KH R+LPRSINYLLREQRLLFILVGILIGSTF
Sbjct  3    QLHKQQSLNHRREEEMGSETPPYSPKSMKHTRTLPRSINYLLREQRLLFILVGILIGSTF  62

Query  397  FiiqpslshlsssspiprshsFHLSNREA---LPEYTPAR-SSGYGAAG--IGRVPVGIA  558
            FIIQP+LS               +S  EA   LP     R ++G   A   +GR+P GI 
Sbjct  63   FIIQPTLS--------------RISPPEAGLFLPRSGLVRFNTGNEGASLRVGRIPAGIG  108

Query  559  RKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDV  738
             +R+R+V+TGGAGFVGSHLVDKL+ RG+DVIVIDNFFTGRKEN++H FGNPRFELIRHDV
Sbjct  109  GRRLRVVVTGGAGFVGSHLVDKLIGRGNDVIVIDNFFTGRKENLVHLFGNPRFELIRHDV  168

Query  739  VEPILLEVDQIYHLAWPASPXHYK  810
            V+PILLEVDQIYHLA PASP HY 
Sbjct  169  VDPILLEVDQIYHLACPASPVHYN  192



>gb|AGK44125.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 159/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44133.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 157/211 (74%), Gaps = 19/211 (9%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ SVN+RRDEE   ++  YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGSTF
Sbjct  4    QLHKQTSVNHRRDEEIP-SSQSYSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGSTF  62

Query  397  FiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRVPV  549
            FI QP+LS L+ S P         +   +LP     R+    +            GRVP 
Sbjct  63   FIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRVPA  113

Query  550  GIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIR  729
            GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIR
Sbjct  114  GIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFELIR  173

Query  730  HDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            HDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  174  HDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44158.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 157/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+V VIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGSHLVDKLISRGDEVTVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>gb|AGK44122.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 158/203 (78%), Gaps = 8/203 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   +SPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---HSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H FGNPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFGNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNP  819
            LLEVDQIYHLA PASP HYKYNP
Sbjct  178  LLEVDQIYHLACPASPVHYKYNP  200



>gb|AGK44155.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   243 bits (621),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 158/213 (74%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44137.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 158/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>gb|AGK44131.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44154.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 156/211 (74%), Gaps = 19/211 (9%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ SVN RRDEE   ++  YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGSTF
Sbjct  4    QLHKQTSVNQRRDEEIP-SSQSYSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGSTF  62

Query  397  FiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRVPV  549
            FI QP+LS L+ S P         +   +LP     R+    +            GRVP 
Sbjct  63   FIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRVPA  113

Query  550  GIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIR  729
            GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIR
Sbjct  114  GIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFELIR  173

Query  730  HDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            HDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  174  HDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44144.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 157/208 (75%), Gaps = 13/208 (6%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshls----ssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIA  558
            TFFI QP+LS L+    ++     S  +H +   +           +     GRVP GI 
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSSLSSSIYHRNQDSSSGSSGFFSKRTFP----GRVPAGIG  116

Query  559  RKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDV  738
            RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDV
Sbjct  117  RKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFELIRHDV  176

Query  739  VEPILLEVDQIYHLAWPASPXHYKYNPV  822
            VEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  177  VEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44142.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 159/213 (75%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK L+HPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLEHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSRLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI RK +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFEL
Sbjct  112  PAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>gb|AGK44119.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44120.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44123.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44126.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44139.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44141.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 157/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>ref|XP_010427004.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Camelina 
sativa]
Length=435

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 162/207 (78%), Gaps = 10/207 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RDEET     + PYSPK LKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDEETIPMSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARS---SGYGAAGIGRVPVGIAR  561
            TFFI+QPSLS L ++           S   A+ +  P+R+   SG G    GRVPVGI R
Sbjct  61   TFFILQPSLSRLGAAESTSLITR---SVSYAVTDSPPSRTTFNSGGGGVRTGRVPVGIGR  117

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            KR+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVV
Sbjct  118  KRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVV  177

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EPILLEVDQIYHLA PASP HYKYNPV
Sbjct  178  EPILLEVDQIYHLACPASPVHYKYNPV  204



>ref|XP_010504116.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Camelina sativa]
 ref|XP_010515846.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Camelina sativa]
 ref|XP_010515847.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Camelina sativa]
Length=435

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 162/207 (78%), Gaps = 10/207 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RDEET     + PYSPK LKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDEETIPMSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARS---SGYGAAGIGRVPVGIAR  561
            TFFI+QPSLS L ++           S   A+ +  P+R+   SG G    GRVPVGI R
Sbjct  61   TFFILQPSLSRLGAAESTSLITR---SVSYAVTDSPPSRTTFNSGGGGVRTGRVPVGIGR  117

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            KR+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVV
Sbjct  118  KRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVV  177

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EPILLEVDQIYHLA PASP HYKYNPV
Sbjct  178  EPILLEVDQIYHLACPASPVHYKYNPV  204



>ref|XP_009602593.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Nicotiana 
tomentosiformis]
Length=433

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 171/210 (81%), Gaps = 15/210 (7%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEE--TAQNTPPYSPKTLKHP-RSLPRSINYLLREQRLLFILVGILI  384
            MKLHKQ+S   RRDEE   +Q + PYSPKTLKHP RSLPRSINYLL+EQRLLFIL+GILI
Sbjct  1    MKLHKQSS---RRDEEIPNSQISLPYSPKTLKHPTRSLPRSINYLLKEQRLLFILIGILI  57

Query  385  GSTFFiiqpslshlssssp--iprshsFHLSNREALPEYTPARSSGYGAAGI--GRVPVG  552
            GSTFFI QPSLS LS+SS        S++  N E+L  +     S Y    I  GRVPVG
Sbjct  58   GSTFFIFQPSLSLLSTSSEPHSSIPRSYNALNHESLSTF-----SSYNNVPIFKGRVPVG  112

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            + RKRMRIV+TGGAGFVGSHLVDKL+KRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH
Sbjct  113  VGRKRMRIVVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  172

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  173  DVVEPILLEVDQIYHLACPASPVHYKYNPV  202



>ref|XP_012074855.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Jatropha curcas]
 gb|KDP35573.1| hypothetical protein JCGZ_09011 [Jatropha curcas]
Length=436

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 161/206 (78%), Gaps = 8/206 (4%)
 Frame = +1

Query  217  KLHKQASVNY-RRDEETA-QNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S N+ RRDEE A   T  YSPK +KHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  3    QLHKQISGNHHRRDEEIATSQTSSYSPKIMKHPRSLPRSINYLFKEQRLLFILVGILIGS  62

Query  391  TFFiiqpslshlsssspip-rshsFHLSNREALPEYTPARSSGYGAAGI-GRVPVGIARK  564
            TFFI+QP+LS L  S P    S SF  S   +L     + SS +      GRVP G+ R+
Sbjct  63   TFFILQPTLSRLGPSEPHSPFSRSFSTSTHNSLG----SSSSLFQKHSFSGRVPAGLGRR  118

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++H FGN RFELIRHDVVE
Sbjct  119  RLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKDNLVHLFGNSRFELIRHDVVE  178

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYKYNPV
Sbjct  179  PILLEVDQIYHLACPASPVHYKYNPV  204



>gb|AGK44136.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 157/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEPI
Sbjct  118  RIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>gb|AGK44147.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=427

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 157/204 (77%), Gaps = 8/204 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNQRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRM  570
            TFFI QP+LS L+ S P   S    LS+       + +          GRVP GI RK +
Sbjct  61   TFFIFQPTLSRLNPSDPTTHSS---LSSSIYHDSSSGSSGFFSKRTFPGRVPAGIGRKSL  117

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            R+V+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEPI
Sbjct  118  RVVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFELIRHDVVEPI  177

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYKYNP 
Sbjct  178  LLEVDQIYHLACPASPVHYKYNPT  201



>gb|AGK44134.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 158/213 (74%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSSLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI  K +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFEL
Sbjct  112  PAGIGWKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>ref|XP_011077418.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Sesamum 
indicum]
 ref|XP_011077419.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Sesamum 
indicum]
Length=450

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 165/217 (76%), Gaps = 16/217 (7%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ + + R+DEE+  +  +  YSPK+LK  RSLPRS+NY+L+EQRLLFILVGILIGS
Sbjct  3    QLHKQPT-SSRKDEESPFSHTSSTYSPKSLKPSRSLPRSLNYILKEQRLLFILVGILIGS  61

Query  391  TFFiiqpslshlsssspi--prshsFHLSNREALPEYTPARSSGYG-----------AAG  531
            TFFIIQPSLS LS + P     S + H  + +  P +T   +  +            A+G
Sbjct  62   TFFIIQPSLSILSPTDPRPPHISAANHHQSLDTFPHHTSPDTHNFHNHFGINNYNRYASG  121

Query  532  IGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNP  711
            +GRVPVGI  KR RIV+TGGAGFVGSHLVDKL+ RGDDVIVIDNFFTGRKENVMH FGN 
Sbjct  122  VGRVPVGIGSKRKRIVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKENVMHLFGNS  181

Query  712  RFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            RFELIRHDVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  182  RFELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPV  218



>gb|AGK44135.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 158/213 (74%), Gaps = 23/213 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ SVN+RRDEE  T+Q+   YSPK LKHPRSLPRSINYL +EQRLLFILVGILIGS
Sbjct  4    QLHKQTSVNHRRDEEIPTSQS---YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI---------GRV  543
            TFFI QP+LS L+ S P         +   +LP     R+    +            GRV
Sbjct  61   TFFIFQPTLSSLNPSDP---------TTHSSLPSSIYHRNQDSSSGSSGFFSKRTFPGRV  111

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P GI  K +RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFEL
Sbjct  112  PAGIGWKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKENLVHLFRNPRFEL  171

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  172  IRHDVVEPILLEVDQIYHLACPASPVHYKYNPT  204



>ref|XP_009783145.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Nicotiana 
sylvestris]
Length=433

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 171/210 (81%), Gaps = 15/210 (7%)
 Frame = +1

Query  214  MKLHKQASVNYRRDEE--TAQNTPPYSPKTLKHP-RSLPRSINYLLREQRLLFILVGILI  384
            MKLHKQ+S   RRDEE   +Q + PYSPKTLKHP RSLPRSINYLL+EQRLLFIL+GILI
Sbjct  1    MKLHKQSS---RRDEEIPNSQISLPYSPKTLKHPTRSLPRSINYLLKEQRLLFILIGILI  57

Query  385  GSTFFiiqpslshlssssp--iprshsFHLSNREALPEYTPARSSGYGAAGI--GRVPVG  552
            GSTFFI QPSLS LS+SS        S++  N E+L     +  S Y    I  GRVPVG
Sbjct  58   GSTFFIFQPSLSLLSTSSEPHSSIPRSYNALNHESL-----STISSYNNVPIFKGRVPVG  112

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            + RKRMRIV+TGGAGFVGSHLVDKL+KRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH
Sbjct  113  VGRKRMRIVVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  172

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  173  DVVEPILLEVDQIYHLACPASPVHYKYNPV  202



>ref|XP_006293145.1| hypothetical protein CARUB_v10019457mg, partial [Capsella rubella]
 gb|EOA26043.1| hypothetical protein CARUB_v10019457mg, partial [Capsella rubella]
Length=489

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 162/206 (79%), Gaps = 10/206 (5%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RD+ET     + PYSPKTLKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  59   QLHKQMSS--KRDDETIPMSQSSPYSPKTLKHPRSLPRSLHYLFREQRLLFILVGILIGS  116

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSS---GYGAAGIGRVPVGIAR  561
            TFFI+QPSLS L ++           S   A+ +  P+R++   G G    GRVPVGI R
Sbjct  117  TFFILQPSLSRLGAAESTSLITR---SVSYAVSDSPPSRATFNYGGGGGRTGRVPVGIGR  173

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            KR+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVV
Sbjct  174  KRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVV  233

Query  742  EPILLEVDQIYHLAWPASPXHYKYNP  819
            EPILLEVDQIYHLA PASP HYKYNP
Sbjct  234  EPILLEVDQIYHLACPASPVHYKYNP  259



>emb|CDY30862.1| BnaC04g27170D [Brassica napus]
Length=416

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 157/206 (76%), Gaps = 22/206 (11%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RD++T     + PYSPK LKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDDDTIPMSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSS-GYGAA-GIGRVPVGIARK  564
            TFFI+QPSLS L+                 A   Y+P++ S  YG     GRVPVGI  +
Sbjct  61   TFFILQPSLSRLA----------------PADNNYSPSKMSFNYGGGKTTGRVPVGIGGR  104

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
            R+RIV+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVE
Sbjct  105  RLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVVE  164

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYK+NP 
Sbjct  165  PILLEVDQIYHLACPASPVHYKFNPT  190



>ref|XP_010530427.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Tarenaya hassleriana]
Length=430

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 155/189 (82%), Gaps = 7/189 (4%)
 Frame = +1

Query  262  TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlssssp  441
            T+Q++P YSPK LKHPRSLPRSINY+ REQRLLFILVGILIGSTFFI+QPSLS L ++  
Sbjct  16   TSQSSP-YSPKALKHPRSLPRSINYIFREQRLLFILVGILIGSTFFILQPSLSRLGTAES  74

Query  442  iprshsFHLSNREALPEYTPARSSGY--GAAGIGRVPVGIARKRMRIVITGGAGFVGSHL  615
                    +SN   + + +P R+ G+  G    GRVPVGI R+R+RIV+TGGAGFVGSHL
Sbjct  75   NSLIPR-SISN--VVVDSSPYRT-GFMPGGGKTGRVPVGIGRRRLRIVVTGGAGFVGSHL  130

Query  616  VDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPAS  795
            VDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEPILLEVDQIYHLA PAS
Sbjct  131  VDKLIARGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVVEPILLEVDQIYHLACPAS  190

Query  796  PXHYKYNPV  822
            P HYKYNPV
Sbjct  191  PVHYKYNPV  199



>gb|ERN12219.1| hypothetical protein AMTR_s00034p00191920 [Amborella trichopoda]
Length=220

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 157/208 (75%), Gaps = 6/208 (3%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSP----KTLKHPRSLPRSINYLLREQRLLFILVGILI  384
            +LHKQAS+N+RRDEE A      SP    K+   PRS PRSINY+L+EQRLLF+LVG+LI
Sbjct  3    QLHKQASLNHRRDEEGAHTPSHRSPSLPMKSSHKPRSWPRSINYMLKEQRLLFVLVGMLI  62

Query  385  GSTFFiiqpslshlsssspiprshsFHL-SNREALPEYTPARSSGYGAA-GIGRVPVGIA  558
             STFF++QPSLS L     +   +S ++  N +   E T   S  +      GRV VG+ 
Sbjct  63   ASTFFMLQPSLSKLGVVERVNNPNSINIRGNEDHERETTQVVSHDFKPQRSNGRVTVGLR  122

Query  559  RKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDV  738
            RK +RIV+TGGAGFVGSHLVD+L++RGD VI+IDNFFTGRKENV+HHF NPRFE+IRHDV
Sbjct  123  RKALRIVVTGGAGFVGSHLVDRLLERGDYVIIIDNFFTGRKENVVHHFRNPRFEMIRHDV  182

Query  739  VEPILLEVDQIYHLAWPASPXHYKYNPV  822
            VEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  183  VEPILLEVDQIYHLACPASPVHYKYNPI  210



>gb|KJB62548.1| hypothetical protein B456_009G422900 [Gossypium raimondii]
Length=331

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 168/217 (77%), Gaps = 17/217 (8%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEET +  TPPYSPK+LKHP+S+PRSINYL +EQRLLFIL+GILIGST
Sbjct  3    QLHKQSSMNHRRDEETPSTQTPPYSPKSLKHPKSIPRSINYLFKEQRLLFILIGILIGST  62

Query  394  FFiiqpsls-------------hlsssspiprshsFHLSNREALPEYTPARSSG-YGAAG  531
            FFI+QPSLS               S  + +    S    N ++   ++   +   YG   
Sbjct  63   FFILQPSLSRLGPTDAHSPIRRSFSKDNTVSSGVSVFSDNHDSSASFSSGTNRAVYGK--  120

Query  532  IGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNP  711
            +GRVPVGI R+RMR+V+TGGAGFVGSHLVDKL+ RGD+VIV+DNFFTGRK+N++H FGNP
Sbjct  121  VGRVPVGIGRRRMRVVVTGGAGFVGSHLVDKLIARGDEVIVLDNFFTGRKDNLVHLFGNP  180

Query  712  RFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
             FELIRHDVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  181  MFELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPV  217



>gb|KHG08310.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum]
Length=317

 Score =   232 bits (592),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 169/215 (79%), Gaps = 13/215 (6%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEET +  TPPYSPK+LKHP+S+PRSINYL +EQRLLFIL+GILIGST
Sbjct  3    QLHKQSSMNHRRDEETPSTQTPPYSPKSLKHPKSIPRSINYLFKEQRLLFILIGILIGST  62

Query  394  FFiiqpslshlsssspip-rshsFHLSNREALP--------EYTPARSSGYGAA---GIG  537
            FFI+QPSLS L  +        SF   N  +          + + + SSG   A    +G
Sbjct  63   FFILQPSLSRLGPTDARSPIRRSFSKDNIVSSDVSVVSDNHDSSASFSSGTNRAVYGKVG  122

Query  538  RVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRF  717
            RVPVGI R+RMR+V+TGGAGFVGSHLVDKL+ RGD+VIV+DNFFTGRK+N++H FGNP F
Sbjct  123  RVPVGIGRRRMRVVVTGGAGFVGSHLVDKLIARGDEVIVLDNFFTGRKDNLVHLFGNPMF  182

Query  718  ELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            ELIRHDVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  183  ELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPV  217



>ref|XP_011019255.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Populus 
euphratica]
Length=429

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 157/202 (78%), Gaps = 7/202 (3%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ SVN+RR++E+  +T  YSPKTLKHPRSLP    Y+ +EQR LFILVGILIGS F
Sbjct  4    QLHKQTSVNHRREDESPTSTQSYSPKTLKHPRSLP----YIFKEQRFLFILVGILIGSAF  59

Query  397  FiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRI  576
            FI QP+LS L+ S+      S +  ++++    +   S G      GRVP  I RKR+RI
Sbjct  60   FIFQPTLSRLNRSTHSSIPTSIYHRHQDSSSGSSGFASKGSFP---GRVPAAIGRKRLRI  116

Query  577  VITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILL  756
            V+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++H FGNPRFELIRHDVV+PILL
Sbjct  117  VVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKDNLVHLFGNPRFELIRHDVVDPILL  176

Query  757  EVDQIYHLAWPASPXHYKYNPV  822
            EVDQIYHLA PASP HYKYNPV
Sbjct  177  EVDQIYHLACPASPVHYKYNPV  198



>ref|XP_011625643.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 isoform X3 [Amborella 
trichopoda]
Length=362

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 158/215 (73%), Gaps = 20/215 (9%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSP----KTLKHPRSLPRSINYLLREQRLLFILVGILI  384
            +LHKQAS+N+RRDEE A      SP    K+   PRS PRSINY+L+EQRLLF+LVG+LI
Sbjct  3    QLHKQASLNHRRDEEGAHTPSHRSPSLPMKSSHKPRSWPRSINYMLKEQRLLFVLVGMLI  62

Query  385  GSTFFiiqpslshlsssspiprshsFHLSNRE---------ALPEYTPARSSGYGAAGIG  537
             STFF++QPSLS L     +   +S ++   E            ++ P RS+G       
Sbjct  63   ASTFFMLQPSLSKLGVVERVNNPNSINIRGNEDHERETTQVVSHDFKPQRSNG-------  115

Query  538  RVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRF  717
            RV VG+ RK +RIV+TGGAGFVGSHLVD+L++RGD VI+IDNFFTGRKENV+HHF NPRF
Sbjct  116  RVTVGLRRKALRIVVTGGAGFVGSHLVDRLLERGDYVIIIDNFFTGRKENVVHHFRNPRF  175

Query  718  ELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            E+IRHDVVEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  176  EMIRHDVVEPILLEVDQIYHLACPASPVHYKYNPI  210



>ref|XP_011625642.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 isoform X2 [Amborella 
trichopoda]
Length=412

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 158/215 (73%), Gaps = 20/215 (9%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSP----KTLKHPRSLPRSINYLLREQRLLFILVGILI  384
            +LHKQAS+N+RRDEE A      SP    K+   PRS PRSINY+L+EQRLLF+LVG+LI
Sbjct  3    QLHKQASLNHRRDEEGAHTPSHRSPSLPMKSSHKPRSWPRSINYMLKEQRLLFVLVGMLI  62

Query  385  GSTFFiiqpslshlsssspiprshsFHLSNRE---------ALPEYTPARSSGYGAAGIG  537
             STFF++QPSLS L     +   +S ++   E            ++ P RS+G       
Sbjct  63   ASTFFMLQPSLSKLGVVERVNNPNSINIRGNEDHERETTQVVSHDFKPQRSNG-------  115

Query  538  RVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRF  717
            RV VG+ RK +RIV+TGGAGFVGSHLVD+L++RGD VI+IDNFFTGRKENV+HHF NPRF
Sbjct  116  RVTVGLRRKALRIVVTGGAGFVGSHLVDRLLERGDYVIIIDNFFTGRKENVVHHFRNPRF  175

Query  718  ELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            E+IRHDVVEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  176  EMIRHDVVEPILLEVDQIYHLACPASPVHYKYNPI  210



>ref|XP_006850637.2| PREDICTED: UDP-glucuronic acid decarboxylase 1 isoform X1 [Amborella 
trichopoda]
Length=440

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 158/215 (73%), Gaps = 20/215 (9%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSP----KTLKHPRSLPRSINYLLREQRLLFILVGILI  384
            +LHKQAS+N+RRDEE A      SP    K+   PRS PRSINY+L+EQRLLF+LVG+LI
Sbjct  3    QLHKQASLNHRRDEEGAHTPSHRSPSLPMKSSHKPRSWPRSINYMLKEQRLLFVLVGMLI  62

Query  385  GSTFFiiqpslshlsssspiprshsFHLSNRE---------ALPEYTPARSSGYGAAGIG  537
             STFF++QPSLS L     +   +S ++   E            ++ P RS+G       
Sbjct  63   ASTFFMLQPSLSKLGVVERVNNPNSINIRGNEDHERETTQVVSHDFKPQRSNG-------  115

Query  538  RVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRF  717
            RV VG+ RK +RIV+TGGAGFVGSHLVD+L++RGD VI+IDNFFTGRKENV+HHF NPRF
Sbjct  116  RVTVGLRRKALRIVVTGGAGFVGSHLVDRLLERGDYVIIIDNFFTGRKENVVHHFRNPRF  175

Query  718  ELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            E+IRHDVVEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  176  EMIRHDVVEPILLEVDQIYHLACPASPVHYKYNPI  210



>ref|XP_002309433.2| hypothetical protein POPTR_0006s23050g [Populus trichocarpa]
 gb|EEE92956.2| hypothetical protein POPTR_0006s23050g [Populus trichocarpa]
Length=429

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 156/202 (77%), Gaps = 7/202 (3%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ SVN+RR++E   +T  YSPKTLKHPRS+P    Y+ +EQR LFILVGILIGS F
Sbjct  4    QLHKQTSVNHRREDEIPTSTQSYSPKTLKHPRSIP----YIFKEQRFLFILVGILIGSAF  59

Query  397  FiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRI  576
            FI QP+LS L+ S+      S +  ++++    +   S G      GRVP  I RKR+RI
Sbjct  60   FIFQPTLSRLNPSTHSSIPTSIYHRHQDSSSGSSGFASKGSFP---GRVPAAIGRKRLRI  116

Query  577  VITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILL  756
            V+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++H FGNPRFELIRHDVV+PILL
Sbjct  117  VVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKDNLVHLFGNPRFELIRHDVVDPILL  176

Query  757  EVDQIYHLAWPASPXHYKYNPV  822
            EVDQIYHLA PASP HYKYNPV
Sbjct  177  EVDQIYHLACPASPVHYKYNPV  198



>gb|KJB62551.1| hypothetical protein B456_009G422900 [Gossypium raimondii]
Length=448

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 169/215 (79%), Gaps = 13/215 (6%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEET +  TPPYSPK+LKHP+S+PRSINYL +EQRLLFIL+GILIGST
Sbjct  3    QLHKQSSMNHRRDEETPSTQTPPYSPKSLKHPKSIPRSINYLFKEQRLLFILIGILIGST  62

Query  394  FFiiqpslshlsssspip-rshsFHLSNREALP--------EYTPARSSGYGAA---GIG  537
            FFI+QPSLS L  +        SF   N  +          + + + SSG   A    +G
Sbjct  63   FFILQPSLSRLGPTDAHSPIRRSFSKDNTVSSGVSVFSDNHDSSASFSSGTNRAVYGKVG  122

Query  538  RVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRF  717
            RVPVGI R+RMR+V+TGGAGFVGSHLVDKL+ RGD+VIV+DNFFTGRK+N++H FGNP F
Sbjct  123  RVPVGIGRRRMRVVVTGGAGFVGSHLVDKLIARGDEVIVLDNFFTGRKDNLVHLFGNPMF  182

Query  718  ELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            ELIRHDVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  183  ELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPV  217



>gb|AGK44105.1| UDP-glucuronate decarboxylase protein 4 [Populus tomentosa]
 gb|AGK44112.1| UDP-glucuronate decarboxylase protein 4 [Populus tomentosa]
Length=424

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 156/202 (77%), Gaps = 7/202 (3%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ SVN+RR++E   +T  YSPKTLKHPRS+P    Y+ +EQR LFILVGILIGS F
Sbjct  4    QLHKQTSVNHRREDEIPTSTQSYSPKTLKHPRSIP----YIFKEQRFLFILVGILIGSAF  59

Query  397  FiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRI  576
            FI QP+LS L+ S+      S +  ++++    +   S G      GR+PV I RKR+RI
Sbjct  60   FIFQPTLSRLNPSTHSSIPTSIYHRHQDSSSGSSGFASKGSFP---GRIPVAIGRKRLRI  116

Query  577  VITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILL  756
            V+TGGAGFVGSHLVDKL+ RGD+VIVIDNFFTGRK+N++H FGNPRFELIRHDVV+PILL
Sbjct  117  VVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKDNLVHLFGNPRFELIRHDVVDPILL  176

Query  757  EVDQIYHLAWPASPXHYKYNPV  822
            EVDQIYHLA PASP HYKYNP 
Sbjct  177  EVDQIYHLACPASPVHYKYNPT  198



>gb|KJB62549.1| hypothetical protein B456_009G422900 [Gossypium raimondii]
 gb|KJB62550.1| hypothetical protein B456_009G422900 [Gossypium raimondii]
Length=448

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 169/215 (79%), Gaps = 13/215 (6%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEET +  TPPYSPK+LKHP+S+PRSINYL +EQRLLFIL+GILIGST
Sbjct  3    QLHKQSSMNHRRDEETPSTQTPPYSPKSLKHPKSIPRSINYLFKEQRLLFILIGILIGST  62

Query  394  FFiiqpslshlsssspip-rshsFHLSNREALP--------EYTPARSSGYGAA---GIG  537
            FFI+QPSLS L  +        SF   N  +          + + + SSG   A    +G
Sbjct  63   FFILQPSLSRLGPTDAHSPIRRSFSKDNTVSSGVSVFSDNHDSSASFSSGTNRAVYGKVG  122

Query  538  RVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRF  717
            RVPVGI R+RMR+V+TGGAGFVGSHLVDKL+ RGD+VIV+DNFFTGRK+N++H FGNP F
Sbjct  123  RVPVGIGRRRMRVVVTGGAGFVGSHLVDKLIARGDEVIVLDNFFTGRKDNLVHLFGNPMF  182

Query  718  ELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            ELIRHDVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  183  ELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPV  217



>gb|EYU41667.1| hypothetical protein MIMGU_mgv1a006632mg [Erythranthe guttata]
Length=437

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 153/210 (73%), Gaps = 14/210 (7%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTF  396
            +LHKQ+S+        +  +  YSPK+LKHPRSLPRSI YLL+EQRLLFILVG+ IG TF
Sbjct  3    QLHKQSSM------PISHASQLYSPKSLKHPRSLPRSITYLLKEQRLLFILVGVFIGFTF  56

Query  397  FiiqpslshlsssspiprshsFHLSNREALPEYTP--------ARSSGYGAAGIGRVPVG  552
            F++QPSLS       +  +    L+                  AR++   + G+GRVPVG
Sbjct  57   FLLQPSLSPADPRPHLFSATRASLTTDPDPAAAAATYANSNPVARNNPRYSNGVGRVPVG  116

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            I  KR RIV+TGGAGFVGSHLVDKL+ RGDDVIV+DNFFTGRKENV+H FGNPRFELIRH
Sbjct  117  IGSKRRRIVVTGGAGFVGSHLVDKLIARGDDVIVVDNFFTGRKENVVHLFGNPRFELIRH  176

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  177  DVVEPILLEVDQIYHLACPASPVHYKYNPI  206



>ref|XP_010097372.1| UDP-glucuronic acid decarboxylase 1 [Morus notabilis]
 gb|EXB67878.1| UDP-glucuronic acid decarboxylase 1 [Morus notabilis]
Length=434

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 162/210 (77%), Gaps = 13/210 (6%)
 Frame = +1

Query  217  KLHKQAS-VNYRRDEETAQNTPPYSPKTLKH---PRSLPRSINYLLREQRLLFILVGILI  384
            +LHKQ+S V++RRDEE+A  T   + KTLKH    RSLPRSINYL +EQRLLFILVGILI
Sbjct  3    QLHKQSSAVSHRRDEESA--TAGGAAKTLKHSAAARSLPRSINYLFKEQRLLFILVGILI  60

Query  385  GSTFFiiqpslshlsssspiprshsFHLSNREALP----EYTPARSSGYGAAGIGRVPVG  552
            G+TFFI+QPSLS +S S              E++     +++   +S +    +GRVP  
Sbjct  61   GATFFILQPSLSRISPSDTTSALSRSSSFRGESITSRDNQFSFPTTSHFK---VGRVPAA  117

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            + ++R+RIV+TGGAGFVGSHLVDKL++RG+DVIVIDNFFTGRKENV+HHF NPRFELIRH
Sbjct  118  LRQRRLRIVVTGGAGFVGSHLVDKLIERGNDVIVIDNFFTGRKENVVHHFVNPRFELIRH  177

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEPILLEVDQIYHLA PASP HYKYNP 
Sbjct  178  DVVEPILLEVDQIYHLACPASPVHYKYNPT  207



>gb|KJB62552.1| hypothetical protein B456_009G422900 [Gossypium raimondii]
Length=479

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 168/217 (77%), Gaps = 17/217 (8%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET-AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+S+N+RRDEET +  TPPYSPK+LKHP+S+PRSINYL +EQRLLFIL+GILIGST
Sbjct  3    QLHKQSSMNHRRDEETPSTQTPPYSPKSLKHPKSIPRSINYLFKEQRLLFILIGILIGST  62

Query  394  FFiiqpsls-------------hlsssspiprshsFHLSNREALPEYTPARSSG-YGAAG  531
            FFI+QPSLS               S  + +    S    N ++   ++   +   YG   
Sbjct  63   FFILQPSLSRLGPTDAHSPIRRSFSKDNTVSSGVSVFSDNHDSSASFSSGTNRAVYGK--  120

Query  532  IGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNP  711
            +GRVPVGI R+RMR+V+TGGAGFVGSHLVDKL+ RGD+VIV+DNFFTGRK+N++H FGNP
Sbjct  121  VGRVPVGIGRRRMRVVVTGGAGFVGSHLVDKLIARGDEVIVLDNFFTGRKDNLVHLFGNP  180

Query  712  RFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
             FELIRHDVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  181  MFELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPV  217



>ref|XP_011094795.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Sesamum indicum]
Length=438

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 159/212 (75%), Gaps = 17/212 (8%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPP-YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +LHKQ+++          +TP  YSPK+ KH RSLPRS+ YLLREQRLLFI VG+LIGS 
Sbjct  3    QLHKQSTM-------PISHTPKLYSPKSQKHIRSLPRSLTYLLREQRLLFIFVGVLIGSI  55

Query  394  FFiiqpslshlsssspiprsh-sFHLSNREALPEYTP--------ARSSGYGAAGIGRVP  546
            FF++QPS++ LSS++P          +NRE+   Y           R++   A+G+GR+P
Sbjct  56   FFLLQPSVNPLSSATPSADQPPRIFSANRESSVRYQDPNYEHNLGTRNNYRYASGVGRIP  115

Query  547  VGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELI  726
            VGI RKR RIV+TGGAGFVG  LVDKL+ RGDDVIV+DNFFTGRK+N++H FGNPRFELI
Sbjct  116  VGIGRKRNRIVVTGGAGFVGFDLVDKLIARGDDVIVVDNFFTGRKDNLVHLFGNPRFELI  175

Query  727  RHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            RHDVVEPILLEVDQIYHLA PASP HYKYNPV
Sbjct  176  RHDVVEPILLEVDQIYHLACPASPVHYKYNPV  207



>gb|ABK24329.1| unknown [Picea sitchensis]
Length=417

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 148/203 (73%), Gaps = 11/203 (5%)
 Frame = +1

Query  220  LHKQASVNYRRDEE--TAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGST  393
            +HKQ+S+N+RRDEE  T  +  PYSPK +K P+SLP+ ++YLL+EQR LF+LVG+LI ST
Sbjct  1    MHKQSSLNHRRDEEVQTPADADPYSPKAVK-PKSLPKPVHYLLKEQRWLFVLVGMLIAST  59

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
             FI+ P+L+               +   E        +S       + R+  G+ R+ +R
Sbjct  60   LFILGPNLAKRDIRKT--------IGGSEKFVSKGVEKSGVQKTITVHRLVAGVRRQPLR  111

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVD+L++RGD VIVIDNFFTGRKENVMHHF NPRFELIRHDVVEPIL
Sbjct  112  IVVTGGAGFVGSHLVDRLLERGDHVIVIDNFFTGRKENVMHHFKNPRFELIRHDVVEPIL  171

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYK+NPV
Sbjct  172  LEVDQIYHLACPASPVHYKFNPV  194



>emb|CDY67354.1| BnaA09g54730D [Brassica napus]
Length=412

 Score =   222 bits (566),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 148/205 (72%), Gaps = 24/205 (12%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RD++T     + PYSPK LKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMS--SKRDDDTIPTSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSS-GYGAAGIGRVPVGIARKR  567
            TFFI+QPSLS LS +          ++   +   Y+P+R S  YG    GRVPV      
Sbjct  61   TFFILQPSLSRLSPAESTSL-----IARSASSTNYSPSRMSFNYGGGKTGRVPV------  109

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
                    AGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEP
Sbjct  110  --------AGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVVEP  161

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVDQIYHLA PASP HYKYNP 
Sbjct  162  ILLEVDQIYHLACPASPVHYKYNPT  186



>emb|CDX73548.1| BnaC08g24550D [Brassica napus]
Length=412

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 148/205 (72%), Gaps = 24/205 (12%)
 Frame = +1

Query  217  KLHKQASVNYRRDEET--AQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS  390
            +LHKQ S   +RD++T     + PYSPK LKHPRSLPRS++YL REQRLLFILVGILIGS
Sbjct  3    QLHKQMSS--KRDDDTIPMSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGILIGS  60

Query  391  TFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSS-GYGAAGIGRVPVGIARKR  567
            TFFI+QPSLS LS +          ++   +   Y+P+R S  YG    GRVPV      
Sbjct  61   TFFILQPSLSRLSPAESTSL-----ITRSVSSTNYSPSRMSFNYGGGKTGRVPV------  109

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
                    AGFVGSHLVDKL+ RGD+VIVIDNFFTGRKEN++H F NPRFELIRHDVVEP
Sbjct  110  --------AGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVVEP  161

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            ILLEVDQIYHLA PASP HYKYNP 
Sbjct  162  ILLEVDQIYHLACPASPVHYKYNPT  186



>ref|XP_003591521.1| UDP-glucuronic acid decarboxylase [Medicago truncatula]
 gb|AES61772.1| UDP-glucuronic acid decarboxylase-like protein [Medicago truncatula]
Length=430

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 143/197 (73%), Gaps = 8/197 (4%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET Q    YSPK  K   S+ R I Y+LREQRL+F+L+GI+I S FF I PS S  S
Sbjct  8    RGHETQQVNDEYSPKPNKPWLSVIRPIRYMLREQRLVFVLIGIVIASVFFTIIPSSSTSS  67

Query  430  ssspip---rshsFHLSNREALPEYTPARSSGYGAAGI---GRVPVGIARKRMRIVITGG  591
            SSS       S S    +RE+  + TPA      A+ +   G++P+GI RK +RIV+TGG
Sbjct  68   SSSFSTRPYESDSISYFDRES--KTTPAVYKQRAASVVHSSGKIPLGIKRKGLRIVVTGG  125

Query  592  AGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQI  771
            AGFVGSHLVD+LM RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQI
Sbjct  126  AGFVGSHLVDRLMARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQI  185

Query  772  YHLAWPASPXHYKYNPV  822
            YHLA PASP HYK+NP 
Sbjct  186  YHLACPASPVHYKFNPT  202



>ref|XP_011011221.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like isoform X3 
[Populus euphratica]
Length=396

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 139/198 (70%), Gaps = 5/198 (3%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET   +  YSPK  K   ++ R I YLL EQRL+FILVGI I + FF + PS S 
Sbjct  8    FRGHDETQTTSDAYSPKPPKPWLAVTRPIRYLLLEQRLVFILVGIAIATLFFTLLPSSSS  67

Query  424  lsssspiprshsF-HLSNREALPE----YTPARSSGYGAAGIGRVPVGIARKRMRIVITG  588
             S     P  ++F H S+    P     Y P R     A+  G++P+G+  K +RIV+TG
Sbjct  68   SSPYEHDPIPNTFSHFSHELTTPMRYKYYEPLRVGFQSASSGGKIPLGLKSKSLRIVVTG  127

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHF NPRFELIRHDVVEP+LLEVDQ
Sbjct  128  GAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLLLEVDQ  187

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  188  IYHLACPASPVHYKHNPV  205



>ref|XP_007144320.1| hypothetical protein PHAVU_007G146300g [Phaseolus vulgaris]
 gb|ESW16314.1| hypothetical protein PHAVU_007G146300g [Phaseolus vulgaris]
Length=429

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 136/191 (71%), Gaps = 2/191 (1%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  E       YSPK  K   S+ R I+Y+LREQRLLF+L+G++I + FF + PS S  S
Sbjct  8    RGHEAQPVNDAYSPKPNKPWLSVTRPIHYMLREQRLLFVLLGVIIATLFFTLIPSSSTSS  67

Query  430  ssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGS  609
             + P       +      LP Y    ++      +G+VP+GI RK +RIV+TGGAGFVGS
Sbjct  68   PTVPYDPLPISYFDGESKLPAYHHRIAAA--VHSVGKVPLGIKRKGLRIVVTGGAGFVGS  125

Query  610  HLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWP  789
            HLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIYHLA P
Sbjct  126  HLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIYHLACP  185

Query  790  ASPXHYKYNPV  822
            ASP HYK+NPV
Sbjct  186  ASPVHYKFNPV  196



>gb|KJB23283.1| hypothetical protein B456_004G090000 [Gossypium raimondii]
Length=378

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 138/196 (70%), Gaps = 5/196 (3%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET  ++  YSPK +K   S+ R+I+YLLREQRLLF+ VGI I +  F + P+ S   
Sbjct  8    RGSETQPSSDSYSPKPVKPWASVTRTIHYLLREQRLLFVFVGIAIATLIFTVFPTSSAPY  67

Query  430  ssspiprshsFHLSNR----EALPEYTPARSSGYGAAG-IGRVPVGIARKRMRIVITGGA  594
             +     +     S      E   +++ A   G+G+A    ++P+G+ RK +RIV+TGGA
Sbjct  68   VAPHSRFTTLIPDSITYFPIETQQKFSSAHRLGFGSANPTSKIPLGLKRKGLRIVVTGGA  127

Query  595  GFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIY  774
            GFVGSHLVD+L+ RGD VIV+DNFFTG K+NVMHHFGNP FELIRHDVVEP+LLEVDQIY
Sbjct  128  GFVGSHLVDRLIARGDSVIVVDNFFTGTKQNVMHHFGNPNFELIRHDVVEPLLLEVDQIY  187

Query  775  HLAWPASPXHYKYNPV  822
            HLA PASP HYK+NPV
Sbjct  188  HLACPASPVHYKFNPV  203



>gb|EYU46664.1| hypothetical protein MIMGU_mgv1a006713mg [Erythranthe guttata]
Length=434

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 14/199 (7%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  E+   +  YSPK  K   ++ R I+YLLREQRL+F+LVGI I + FF + P+ +   
Sbjct  8    RGHESQPVSDAYSPKPAKPWLTVTRPIHYLLREQRLVFVLVGIAIATLFFTVVPTSNSPH  67

Query  430  ssspiprshsFHLSNREALPEYTPARS--------SGYGAAGIGRVPVGIARKRMRIVIT  585
            +  P          + E    + P RS        +G+G   +G++P+G+ RK +RIV+T
Sbjct  68   APIPDA------FISSELTQLHQPHRSMYQNGHLATGFGINSVGKIPLGLKRKGLRIVVT  121

Query  586  GGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVD  765
            GGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENV+HHFGNPRFELIRHDVVEP+LLEVD
Sbjct  122  GGAGFVGSHLVDRLISRGDSVIVVDNFFTGRKENVVHHFGNPRFELIRHDVVEPLLLEVD  181

Query  766  QIYHLAWPASPXHYKYNPV  822
            QIYHLA PASP HYK+NPV
Sbjct  182  QIYHLACPASPVHYKHNPV  200



>gb|KDO87219.1| hypothetical protein CISIN_1g0134671mg [Citrus sinensis]
Length=290

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 13/199 (7%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ++   T  YSPK +K   ++ + I Y+LREQRL+F+LVGI I + FF + P+    S
Sbjct  8    RGHDSQLATDSYSPKPIKPWFAVTQPIRYMLREQRLVFVLVGIAIATLFFTVIPTSYPAS  67

Query  430  ssspiprshsFHLSNREALPEY---TPARS----SGYGAAGI-GRVPVGIARKRMRIVIT  585
                       H++  ++L  Y   T  R+     G+GA    G++P+G+ RK +RIV+T
Sbjct  68   YGGARG-----HVAISDSLSYYPVETYQRAYNPRVGFGAVNSGGKIPLGLKRKGLRIVVT  122

Query  586  GGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVD  765
            GGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVD
Sbjct  123  GGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVD  182

Query  766  QIYHLAWPASPXHYKYNPV  822
            QIYHLA PASP HYK+NPV
Sbjct  183  QIYHLACPASPVHYKFNPV  201



>gb|ABK24464.1| unknown [Picea sitchensis]
Length=439

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 136/195 (70%), Gaps = 8/195 (4%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  E   N+  YSPK  K P S+ R ++YLLREQRLLFI +GI I S FFI+QP     +
Sbjct  8    RGHEAPSNSDEYSPKPEK-PWSIIRPVDYLLREQRLLFIFIGIAIASMFFILQPGFFASN  66

Query  430  ssspiprshsFHLSNREALPEYTPARSSGYGAAGI----GRVPVGIARKRMRIVITGGAG  597
                       H      + E   +R + Y +  +     +VP+G+ RK +R+V+TGGAG
Sbjct  67   VDENARFVPDQH---HRVVYETPLSRVAQYHSGSMVNSGAKVPLGLKRKSLRVVVTGGAG  123

Query  598  FVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYH  777
            FVGSHLVD+LM RGD VIV+DNFFTGRKENV+HHFGNPRFELIRHDVVEP+LLEVDQIYH
Sbjct  124  FVGSHLVDRLMARGDSVIVVDNFFTGRKENVLHHFGNPRFELIRHDVVEPLLLEVDQIYH  183

Query  778  LAWPASPXHYKYNPV  822
            LA PASP HYK+NPV
Sbjct  184  LACPASPVHYKHNPV  198



>ref|XP_011011220.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like isoform X2 
[Populus euphratica]
Length=444

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 139/198 (70%), Gaps = 5/198 (3%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET   +  YSPK  K   ++ R I YLL EQRL+FILVGI I + FF + PS S 
Sbjct  8    FRGHDETQTTSDAYSPKPPKPWLAVTRPIRYLLLEQRLVFILVGIAIATLFFTLLPSSSS  67

Query  424  lsssspiprshsF-HLSNREALPE----YTPARSSGYGAAGIGRVPVGIARKRMRIVITG  588
             S     P  ++F H S+    P     Y P R     A+  G++P+G+  K +RIV+TG
Sbjct  68   SSPYEHDPIPNTFSHFSHELTTPMRYKYYEPLRVGFQSASSGGKIPLGLKSKSLRIVVTG  127

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHF NPRFELIRHDVVEP+LLEVDQ
Sbjct  128  GAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLLLEVDQ  187

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  188  IYHLACPASPVHYKHNPV  205



>ref|XP_011011217.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like isoform X1 
[Populus euphratica]
Length=444

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 139/198 (70%), Gaps = 5/198 (3%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET   +  YSPK  K   ++ R I YLL EQRL+FILVGI I + FF + PS S 
Sbjct  8    FRGHDETQTTSDAYSPKPPKPWLAVTRPIRYLLLEQRLVFILVGIAIATLFFTLLPSSSS  67

Query  424  lsssspiprshsF-HLSNREALPE----YTPARSSGYGAAGIGRVPVGIARKRMRIVITG  588
             S     P  ++F H S+    P     Y P R     A+  G++P+G+  K +RIV+TG
Sbjct  68   SSPYEHDPIPNTFSHFSHELTTPMRYKYYEPLRVGFQSASSGGKIPLGLKSKSLRIVVTG  127

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHF NPRFELIRHDVVEP+LLEVDQ
Sbjct  128  GAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLLLEVDQ  187

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  188  IYHLACPASPVHYKHNPV  205



>ref|XP_009335683.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Pyrus x 
bretschneideri]
Length=441

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  E   Q    YSPK  K   S+ R I YLLREQRL+FILVGI I +  F + PS + 
Sbjct  7    FRGHEADQQVADTYSPKPPKPWASVTRPIQYLLREQRLVFILVGIAIATVVFTLLPSSAP  66

Query  424  lsssspiprshsFHLS----NREALPEYTPARSSGYGAAGI---GRVPVGIARKRMRIVI  582
            +S  +      S        +  A   Y PA    +G       G+VP+G+ RK +RIV+
Sbjct  67   ISPYATGNVPISNEYVRYDFDSSATAHYKPAYDRRFGLNSWNSGGKVPLGLKRKGLRIVV  126

Query  583  TGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEV  762
            TGGAGFVGSHLVD+L++RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEV
Sbjct  127  TGGAGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEV  186

Query  763  DQIYHLAWPASPXHYKYNPV  822
            DQIYHLA PASP HYK+NPV
Sbjct  187  DQIYHLACPASPVHYKFNPV  206



>ref|XP_009335739.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Pyrus x bretschneideri]
Length=441

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 137/200 (69%), Gaps = 7/200 (4%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  E   Q    YSPK  K   S+ R I YLLREQRL+FILVGI I +  F + PS + 
Sbjct  7    FRGHEADQQVADTYSPKPPKPWASVTRPIQYLLREQRLVFILVGIAIATVVFTLLPSSAP  66

Query  424  lsssspiprshsFHLS----NREALPEYTPARSSGYGAAGI---GRVPVGIARKRMRIVI  582
            +S  +      S        +  A   Y PA    +G       G+VP+G+ RK +RIV+
Sbjct  67   ISPYATGNIPISNEYVRYDFDSSATAHYKPAYERRFGLNSWNSGGKVPLGLKRKGLRIVV  126

Query  583  TGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEV  762
            TGGAGFVGSHLVD+L++RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEV
Sbjct  127  TGGAGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEV  186

Query  763  DQIYHLAWPASPXHYKYNPV  822
            DQIYHLA PASP HYK+NPV
Sbjct  187  DQIYHLACPASPVHYKFNPV  206



>gb|KDO87218.1| hypothetical protein CISIN_1g0134671mg [Citrus sinensis]
Length=340

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 13/199 (7%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ++   T  YSPK +K   ++ + I Y+LREQRL+F+LVGI I + FF + P+    S
Sbjct  8    RGHDSQLATDSYSPKPIKPWFAVTQPIRYMLREQRLVFVLVGIAIATLFFTVIPTSYPAS  67

Query  430  ssspiprshsFHLSNREALPEY---TPARS----SGYGAAGI-GRVPVGIARKRMRIVIT  585
                       H++  ++L  Y   T  R+     G+GA    G++P+G+ RK +RIV+T
Sbjct  68   YGGARG-----HVAISDSLSYYPVETYQRAYNPRVGFGAVNSGGKIPLGLKRKGLRIVVT  122

Query  586  GGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVD  765
            GGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVD
Sbjct  123  GGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVD  182

Query  766  QIYHLAWPASPXHYKYNPV  822
            QIYHLA PASP HYK+NPV
Sbjct  183  QIYHLACPASPVHYKFNPV  201



>ref|XP_008369016.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Malus domestica]
Length=441

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 138/200 (69%), Gaps = 7/200 (4%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  E   Q    YSPK  K   S+ R I+YLLREQRL+FILVGI I +  F + PS + 
Sbjct  7    FRGHEADQQVADTYSPKPPKPWASVTRPIHYLLREQRLVFILVGIAIATVVFTLLPSSAP  66

Query  424  lsssspiprshsFHLS----NREALPEYTPARSSGYGAAGI---GRVPVGIARKRMRIVI  582
            +S  +      S        +  A   Y PA    +G       G+VP+G+ RK +RIV+
Sbjct  67   ISPYAXGNVPISNEYVRYDFDSSATAHYKPAYDRRFGLNSWNSGGKVPLGLKRKGLRIVV  126

Query  583  TGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEV  762
            TGGAGFVGSHLVD+L++RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEV
Sbjct  127  TGGAGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEV  186

Query  763  DQIYHLAWPASPXHYKYNPV  822
            DQIYHLA PASP HYK+NPV
Sbjct  187  DQIYHLACPASPVHYKFNPV  206



>gb|KHG01436.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum]
Length=436

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 137/196 (70%), Gaps = 5/196 (3%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET  ++  YSPK +K   S+ R I+YLLREQRLLF+ +GI I +  F + P+     
Sbjct  8    RGSETQPSSDSYSPKPVKPWASVTRPIHYLLREQRLLFVFIGIAIATLIFTVFPTSPAPY  67

Query  430  ssspiprshsFHLSNR----EALPEYTPARSSGYGAAG-IGRVPVGIARKRMRIVITGGA  594
             +     +     S      E   +++ A   G+G+A   G++P+G+ RK +RIV+TGGA
Sbjct  68   VAPHSRFTTLIPDSITYFPIETQQKFSSAHRLGFGSANPTGKIPLGLKRKGLRIVVTGGA  127

Query  595  GFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIY  774
            GFVGSHLVD+L+ RGD VIV+DNFFTGRK+NVMHHFGNP FELIRHDVVEP+LLEVDQIY
Sbjct  128  GFVGSHLVDRLIARGDSVIVVDNFFTGRKQNVMHHFGNPNFELIRHDVVEPLLLEVDQIY  187

Query  775  HLAWPASPXHYKYNPV  822
            HLA PASP HYK+NP 
Sbjct  188  HLACPASPVHYKFNPT  203



>ref|XP_003536125.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Glycine 
max]
Length=427

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 135/193 (70%), Gaps = 8/193 (4%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  E       YSPK  K   ++ R I+Y+LREQRL+F+LVG++I + FF + PS S  S
Sbjct  8    RGHEAQPVDDSYSPKPHKPWFTVTRPIHYMLREQRLVFVLVGVIIATLFFTLVPSSSSSS  67

Query  430  ssspiprshsFHLSNREALPEYTPARSSGYGAA--GIGRVPVGIARKRMRIVITGGAGFV  603
                      F   ++       PA      AA   +G+VP+GI RK +RIV+TGGAGFV
Sbjct  68   VPYESLPISYFERESK------IPAYHHRVAAAVHSVGKVPLGIKRKGLRIVVTGGAGFV  121

Query  604  GSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLA  783
            GSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIYHLA
Sbjct  122  GSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIYHLA  181

Query  784  WPASPXHYKYNPV  822
             PASP HYK+NPV
Sbjct  182  CPASPVHYKFNPV  194



>ref|XP_004495956.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Cicer arietinum]
Length=433

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 136/193 (70%), Gaps = 2/193 (1%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiq--pslsh  423
            R  ET Q    YSPK  K   S+ R I Y+L EQR++F+L+GI+I + FF +    S + 
Sbjct  8    RGHETQQVNDEYSPKPNKPWLSVIRPIRYMLLEQRIVFVLIGIVIATLFFTLVPNSSSNS  67

Query  424  lsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFV  603
             SS+       +  +S  E   + TP +         G++P+GI RK +RIV+TGGAGFV
Sbjct  68   SSSAFSTVHYDAHPISYFEHESKNTPYQQRAAVVHSFGKIPLGIKRKGLRIVVTGGAGFV  127

Query  604  GSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLA  783
            GSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIYHLA
Sbjct  128  GSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIYHLA  187

Query  784  WPASPXHYKYNPV  822
             PASP HYK+NPV
Sbjct  188  CPASPVHYKFNPV  200



>gb|KJB41922.1| hypothetical protein B456_007G128200 [Gossypium raimondii]
Length=442

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS---TFFiiqpsls  420
            R  ET   +  YSPK +K   S+ R++ Y+LREQRLLF+LVGI I +   T F    +  
Sbjct  8    RGHETQLASDSYSPKPVKPWASVTRAVRYMLREQRLLFVLVGIAIATLVFTVFPASRAAH  67

Query  421  hlsssspiprshsFHLSNREALPEYTPARSSGYGAAG-IGRVPVGIARKRMRIVITGGAG  597
                 S  P   S      E   +++ A   G+G+    G++P+G+ RK +RIV+TGGAG
Sbjct  68   GPHLHSTTPLLDSIPYFPIETQNKFSYAHRLGFGSGNPTGKIPLGLKRKGLRIVVTGGAG  127

Query  598  FVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYH  777
            FVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVDQIYH
Sbjct  128  FVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYH  187

Query  778  LAWPASPXHYKYNPV  822
            LA PASP HYK+NPV
Sbjct  188  LACPASPVHYKFNPV  202



>gb|KJB23284.1| hypothetical protein B456_004G090000 [Gossypium raimondii]
Length=441

 Score =   204 bits (520),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 138/196 (70%), Gaps = 5/196 (3%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET  ++  YSPK +K   S+ R+I+YLLREQRLLF+ VGI I +  F + P+ S   
Sbjct  8    RGSETQPSSDSYSPKPVKPWASVTRTIHYLLREQRLLFVFVGIAIATLIFTVFPTSSAPY  67

Query  430  ssspiprshsFHLSNR----EALPEYTPARSSGYGAAG-IGRVPVGIARKRMRIVITGGA  594
             +     +     S      E   +++ A   G+G+A    ++P+G+ RK +RIV+TGGA
Sbjct  68   VAPHSRFTTLIPDSITYFPIETQQKFSSAHRLGFGSANPTSKIPLGLKRKGLRIVVTGGA  127

Query  595  GFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIY  774
            GFVGSHLVD+L+ RGD VIV+DNFFTG K+NVMHHFGNP FELIRHDVVEP+LLEVDQIY
Sbjct  128  GFVGSHLVDRLIARGDSVIVVDNFFTGTKQNVMHHFGNPNFELIRHDVVEPLLLEVDQIY  187

Query  775  HLAWPASPXHYKYNPV  822
            HLA PASP HYK+NPV
Sbjct  188  HLACPASPVHYKFNPV  203



>ref|XP_004290795.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 130/192 (68%), Gaps = 3/192 (2%)
 Frame = +1

Query  256  EETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsss  435
            +E    +  YSPK  K   S+ R I YLLREQRL+FILVGI+I +  F + PS       
Sbjct  12   DEAQPASDTYSPKRPKPWASVTRPIGYLLREQRLIFILVGIVIATVCFTLLPSSRPAFHG  71

Query  436  spiprshsFHLSNREALPEYTPARSSGYGAAGI---GRVPVGIARKRMRIVITGGAGFVG  606
                 +             + PA    +G       G+VP+G+ RK +RIV+TGGAGFVG
Sbjct  72   QNPIPNDFVRFDFESTHLSHKPAYERRFGLTNYNSGGKVPLGLKRKGLRIVVTGGAGFVG  131

Query  607  SHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAW  786
            SHLVD+LM+RGD VIV+DNFFTGRKENV HHFGNPRFELIRHDVVEP+LLEVDQIYHLA 
Sbjct  132  SHLVDRLMERGDSVIVVDNFFTGRKENVQHHFGNPRFELIRHDVVEPLLLEVDQIYHLAC  191

Query  787  PASPXHYKYNPV  822
            PASP HYK+NPV
Sbjct  192  PASPVHYKFNPV  203



>ref|XP_009348817.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Pyrus x 
bretschneideri]
Length=440

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 136/199 (68%), Gaps = 6/199 (3%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  E        YSPK  K   S+ R   YLLREQRL+FILVGI I +  F + PS + 
Sbjct  7    FRGHEADQHVADTYSPKRPKPWASVTRPFQYLLREQRLVFILVGIAIATVGFTLLPSSTP  66

Query  424  lsssspiprshsFHLS---NREALPEYTPARSSGYGA---AGIGRVPVGIARKRMRIVIT  585
             S  +      S ++    +  A  +Y PA    +G       G+VP+G+ RK +RIV+T
Sbjct  67   RSPYASSNVPISNYVRYDFDSSATTQYKPAYERRFGLNSWGSSGKVPLGLKRKGLRIVVT  126

Query  586  GGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVD  765
            GGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVD
Sbjct  127  GGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVD  186

Query  766  QIYHLAWPASPXHYKYNPV  822
            QIYHLA PASP HYK+NPV
Sbjct  187  QIYHLACPASPVHYKFNPV  205



>ref|XP_011079661.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Sesamum 
indicum]
Length=427

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 137/201 (68%), Gaps = 16/201 (8%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +E+   T  YSPK  K   ++ R I Y+LREQRLLF+ VGI I +  F   PS + 
Sbjct  7    FRGHDESQPVTDSYSPKPQKPWFNVTRPICYMLREQRLLFVFVGIAIATLVFAFVPSSNP  66

Query  424  lsssspiprshsFHLSNREALPEYTPARS--------SGYGAAGIGRVPVGIARKRMRIV  579
             +       S          L +  P RS        +G+G   +G++P+G+ RK +RIV
Sbjct  67   QAPIPDAYFST--------ELTQLQPHRSMYQNGHLATGFGINSVGKIPLGLKRKGLRIV  118

Query  580  ITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLE  759
            +TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENV+HHFGNPRFELIRHDVVEP+LLE
Sbjct  119  VTGGAGFVGSHLVDRLISRGDSVIVVDNFFTGRKENVVHHFGNPRFELIRHDVVEPLLLE  178

Query  760  VDQIYHLAWPASPXHYKYNPV  822
            VDQIYHLA PASP HYK+NPV
Sbjct  179  VDQIYHLACPASPVHYKHNPV  199



>ref|XP_006386738.1| hypothetical protein POPTR_0002s20570g [Populus trichocarpa]
 gb|ERP64535.1| hypothetical protein POPTR_0002s20570g [Populus trichocarpa]
Length=443

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 138/198 (70%), Gaps = 5/198 (3%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET   +  YSPK  K   ++ R I YLL EQRL+FILVGI I + FF + PS S 
Sbjct  8    FRGHDETQPASDAYSPKPPKPWLAVTRPIRYLLLEQRLVFILVGIAIATLFFTLLPSSSS  67

Query  424  lsssspiprshsF-HLSNREALPE----YTPARSSGYGAAGIGRVPVGIARKRMRIVITG  588
             S     P  ++F H S+    P     Y P R     A   G++P+G+  K +RIV+TG
Sbjct  68   SSPYEHDPIPNTFSHFSHELTTPMRYKYYEPLRVGLQSANSGGKIPLGLKSKSLRIVVTG  127

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHF NPRFELIRHDVVEP+LLEVDQ
Sbjct  128  GAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLLLEVDQ  187

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  188  IYHLACPASPVHYKHNPV  205



>gb|KDO87217.1| hypothetical protein CISIN_1g0134671mg, partial [Citrus sinensis]
Length=364

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 13/199 (7%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ++   T  YSPK +K   ++ + I Y+LREQRL+F+LVGI I + FF + P+    S
Sbjct  8    RGHDSQLATDSYSPKPIKPWFAVTQPIRYMLREQRLVFVLVGIAIATLFFTVIPTSYPAS  67

Query  430  ssspiprshsFHLSNREALPEY---TPARS----SGYGAAGI-GRVPVGIARKRMRIVIT  585
                       H++  ++L  Y   T  R+     G+GA    G++P+G+ RK +RIV+T
Sbjct  68   YGGARG-----HVAISDSLSYYPVETYQRAYNPRVGFGAVNSGGKIPLGLKRKGLRIVVT  122

Query  586  GGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVD  765
            GGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVD
Sbjct  123  GGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVD  182

Query  766  QIYHLAWPASPXHYKYNPV  822
            QIYHLA PASP HYK+NPV
Sbjct  183  QIYHLACPASPVHYKFNPV  201



>gb|AAX37335.1| UDP-glucuronic acid decarboxylase 2 [Populus tomentosa]
 gb|AGK44110.1| UDP-glucuronate decarboxylase protein 2 [Populus tomentosa]
Length=443

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 138/198 (70%), Gaps = 5/198 (3%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET   +  YSPK  K   ++ R I YLL EQRL+FILVGI I + FF + PS S 
Sbjct  8    FRGHDETQPASDAYSPKPPKPWLAVTRPIRYLLLEQRLVFILVGIAIATLFFTLLPSSSS  67

Query  424  lsssspiprshsF-HLSNREALPE----YTPARSSGYGAAGIGRVPVGIARKRMRIVITG  588
             S     P  ++F H S+    P     Y P R     A   G++P+G+  K +RIV+TG
Sbjct  68   SSPYEHDPIPNTFSHFSHELTAPMRYKYYEPLRVGFQSANSGGKIPLGLKSKSLRIVVTG  127

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHF NPRFELIRHDVVEP+LLEVDQ
Sbjct  128  GAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLLLEVDQ  187

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  188  IYHLACPASPVHYKHNPV  205



>ref|XP_002523086.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis]
 gb|EEF39271.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis]
Length=419

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 140/197 (71%), Gaps = 8/197 (4%)
 Frame = +1

Query  253  DEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlss  432
            D+E       YSPK  K   S+ R I Y+LREQRL+F+LVGI I + FF + PS S    
Sbjct  11   DDEGHHMADEYSPKPPKRWLSVTRPIRYVLREQRLVFVLVGIAIATLFFTVIPSSSPPPR  70

Query  433  sspiprshsFHLSNREALPEYTPARS-------SGYGAAGIGRVPVGIARKRMRIVITGG  591
            S+ I       +SN  +  +  PAR        +G   +G G++P+G+ RK +RIV+TGG
Sbjct  71   STYINYDKYDPISNPLSHFDSVPARHRYYEPLVTGSMNSG-GKIPLGLKRKGLRIVVTGG  129

Query  592  AGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQI  771
            AGFVGSHLVD+L++RGD VIV+DNFFTGRKENVMHHF NPRFELIRHDVVEP+LLEVDQI
Sbjct  130  AGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLLLEVDQI  189

Query  772  YHLAWPASPXHYKYNPV  822
            YHLA PASP HYK+NPV
Sbjct  190  YHLACPASPVHYKHNPV  206



>gb|KFK37504.1| hypothetical protein AALP_AA4G266000 [Arabis alpina]
Length=436

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 138/200 (69%), Gaps = 5/200 (3%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            + + YRR E     T  Y+PK +K      R I YLLREQRL+FILVGI I +  F I  
Sbjct  3    SELTYRRHEMDQPETETYNPKRIKPWFVSIRPIRYLLREQRLIFILVGIAIATLGFTIFS  62

Query  412  slshlsssspiprshsFHLSNREALPEYTPA---RSSGYGAAGIGRVPVGIARKRMRIVI  582
              +   +    P S  + + +        P     +S  G+AG G++P+G+ RK +R+V+
Sbjct  63   KSTPQQTPYSDPFSD-YGIRSESIQIHRKPNIDYMTSQIGSAG-GKIPLGLKRKVLRVVV  120

Query  583  TGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEV  762
            TGGAGFVGSHLVD+LM RGD+VIV+DNFFTGRKENVMHHFGNP FE+IRHDVVEPILLEV
Sbjct  121  TGGAGFVGSHLVDRLMARGDNVIVVDNFFTGRKENVMHHFGNPNFEMIRHDVVEPILLEV  180

Query  763  DQIYHLAWPASPXHYKYNPV  822
            DQIYHLA PASP HYK+NPV
Sbjct  181  DQIYHLACPASPVHYKFNPV  200



>gb|KHN08684.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja]
Length=426

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 137/193 (71%), Gaps = 4/193 (2%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET      YSPK  K   ++ R I+Y+LREQRLLF+L+G++I + FF   PS S  +
Sbjct  8    RGHETQPVDDAYSPKPHKPWLTVTRPIHYMLREQRLLFVLLGVIIATLFFTFVPSSSPSA  67

Query  430  ssspiprshs--FHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFV  603
            SSS +        +      +P Y    ++      +G+VP+GI RK +RIV+TGGAGFV
Sbjct  68   SSSSVSYESLPISYFERESKIPAYHHRVAAA--VHSVGKVPLGIKRKGLRIVVTGGAGFV  125

Query  604  GSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLA  783
            GSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIYHLA
Sbjct  126  GSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIYHLA  185

Query  784  WPASPXHYKYNPV  822
             PASP HYK+NP 
Sbjct  186  CPASPVHYKFNPT  198



>ref|XP_010519351.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Tarenaya hassleriana]
Length=439

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 139/203 (68%), Gaps = 8/203 (4%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            + + YRR E    +   Y PK +K    +PRSI Y+LREQRL+F+LVGI I +  F I P
Sbjct  3    SELMYRRYETDQPSVDAYYPKPIKPWFFVPRSIRYMLREQRLVFVLVGIAIATLGFTIFP  62

Query  412  slshlsssspiprshsFHLSNREALPEYTPARSSGY------GAAGIGRVPVGIARKRMR  573
              +     S     +    S    L  +   +   +      G+AG G++P+G+ RK +R
Sbjct  63   RSTQPIPYSDPFSGYGLR-SESSYLTAFQAQKKPSFEYLNRVGSAG-GKIPLGLKRKGLR  120

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVD+L+ RGD+VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+L
Sbjct  121  IVVTGGAGFVGSHLVDRLIARGDNVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLL  180

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYK+NPV
Sbjct  181  LEVDQIYHLACPASPVHYKFNPV  203



>ref|XP_010497419.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like, partial 
[Camelina sativa]
Length=209

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 130/194 (67%), Gaps = 3/194 (2%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y PK +K    + R + YLLREQRL+F+LVGI I +  F + P  +  
Sbjct  8    RRHEADQPTADAYYPKPIKPWFMVTRPMRYLLREQRLIFVLVGIAIATLVFTLFPRPTQS  67

Query  427  sssspiprshsFHLSNREALPEYTPARS--SGYGAAGIGRVPVGIARKRMRIVITGGAGF  600
            +  S     +           +  P+    +  GA G G++P+G+ RK +R+V+TGGAGF
Sbjct  68   TPYSDPFSGYGIRTDESYVPAQRKPSLEYLNRIGATG-GKIPLGLKRKGLRVVVTGGAGF  126

Query  601  VGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHL  780
            VGSHLVD+LM RGD VIV+DNFFTGRKENVMHHF NP FELIRHDVVEPILLEVDQIYHL
Sbjct  127  VGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFSNPNFELIRHDVVEPILLEVDQIYHL  186

Query  781  AWPASPXHYKYNPV  822
            A PASP HYK+NPV
Sbjct  187  ACPASPVHYKFNPV  200



>gb|KHG20554.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum]
Length=244

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 135/192 (70%), Gaps = 5/192 (3%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET   +  YSPK  K   S+ R I Y+LREQRLLF+ +GI I +  F + P+     
Sbjct  9    RGHETQPVSDSYSPKPDKPWASVTRPIRYMLREQRLLFVFLGIAIATLIFTLFPASRATQ  68

Query  430  ssspiprshsFHLSNREALPEYTPARSSGYGAAG-IGRVPVGIARKRMRIVITGGAGFVG  606
             +     ++ F +  +    +++     G+G++   G++P+G+ RK +RIV+TGGAGFVG
Sbjct  69   HNFADSITY-FPIDTQS---KFSNPHRLGFGSSNPTGKIPLGLKRKGLRIVVTGGAGFVG  124

Query  607  SHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAW  786
            SHLVD+L+ RGD V+V+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVDQIYHLA 
Sbjct  125  SHLVDRLIARGDSVMVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYHLAC  184

Query  787  PASPXHYKYNPV  822
            PASP HYK+NP 
Sbjct  185  PASPVHYKFNPT  196



>ref|XP_009389617.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 138/203 (68%), Gaps = 13/203 (6%)
 Frame = +1

Query  232  ASVNYR-RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiq  408
            + + YR R+   A +    SPK  K    LPR + YLL EQRLLF+LVG+ + S FF+  
Sbjct  3    SELTYRGREALPADDAGANSPKPEKRFLCLPRPLRYLLSEQRLLFVLVGVALASVFFVFA  62

Query  409  pslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI-----GRVPVGIARKRMR  573
            P  +  S++         HL+   A     PA   GY  A       GRVP+G+ RK +R
Sbjct  63   PPYTGPSTAGA-------HLAVDLARLSSMPAVHGGYRMALERRFVGGRVPLGLKRKGLR  115

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVD+L++RGD VIV+DNFFTG+KENVMHH GNP FELIRHDVVEP+L
Sbjct  116  IVVTGGAGFVGSHLVDRLIERGDSVIVVDNFFTGQKENVMHHLGNPNFELIRHDVVEPLL  175

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYK+NPV
Sbjct  176  LEVDQIYHLACPASPVHYKFNPV  198



>ref|XP_002321005.1| UDP-XYLOSE SYNTHASE 4 family protein [Populus trichocarpa]
 gb|ABK94298.1| unknown [Populus trichocarpa]
 gb|EEE99320.1| UDP-XYLOSE SYNTHASE 4 family protein [Populus trichocarpa]
Length=442

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 134/197 (68%), Gaps = 4/197 (2%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET      YSPK  K    + R + YLLRE+RL+F LVG+ I + FF I PS S 
Sbjct  8    FRGHDETQPTPDAYSPKPAKPWLFVIRPVRYLLREKRLVFFLVGMAIATVFFTILPSSSP  67

Query  424  lsssspiprshsFHLSNREALP----EYTPARSSGYGAAGIGRVPVGIARKRMRIVITGG  591
             +           H+S+    P     Y P +     A   G++P+G+ RK +RIV+TGG
Sbjct  68   HAHKYDPLPDSFSHISHELTTPVRYKYYEPLQVGFQSANSGGKIPLGLKRKGLRIVVTGG  127

Query  592  AGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQI  771
            AGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHF NPRFELIRHDVVEP+LLEVDQI
Sbjct  128  AGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLLLEVDQI  187

Query  772  YHLAWPASPXHYKYNPV  822
            YHLA PASP HYK+NPV
Sbjct  188  YHLACPASPVHYKHNPV  204



>ref|XP_008235095.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Prunus mume]
Length=445

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 139/198 (70%), Gaps = 5/198 (3%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +E       YSPK  K   S+ R I YLLREQRL+F+LVGI I +  F + PS   
Sbjct  7    FRGHDEAQHVADTYSPKPPKPWASVTRPIGYLLREQRLVFVLVGIAIATVGFTLLPSSRS  66

Query  424  lsssspiprshsFHLSNREALPEYT--PARSSGYGAAGI---GRVPVGIARKRMRIVITG  588
               +  +P S+ +   + ++    T  PA    +G       G+VP+G+ RK +RIV+TG
Sbjct  67   SDVNGSVPISNEYVRYDFDSSTHLTHKPAYERRFGLTNWNSGGKVPLGLKRKGLRIVVTG  126

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L++RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQ
Sbjct  127  GAGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQ  186

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  187  IYHLACPASPVHYKFNPV  204



>gb|ABK92487.1| unknown [Populus trichocarpa]
Length=443

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 137/198 (69%), Gaps = 5/198 (3%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET   +  YSPK  K   ++ R I YLL EQRL+FILVGI I + FF + PS S 
Sbjct  8    FRGHDETQPASDAYSPKPPKPWLAVTRPIRYLLLEQRLVFILVGIAIATLFFTVLPSSSS  67

Query  424  lsssspiprshsF-HLSNREALPE----YTPARSSGYGAAGIGRVPVGIARKRMRIVITG  588
             S     P  ++F H S+    P     Y P R     A   G++P+G+  K +RIV+TG
Sbjct  68   SSPYEHDPIPNTFSHFSHELTTPMRYKYYEPLRVGLQSANSGGKIPLGLKSKSLRIVVTG  127

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHH  NPRFELIRHDVVEP+LLEVDQ
Sbjct  128  GAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHLKNPRFELIRHDVVEPLLLEVDQ  187

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  188  IYHLACPASPVHYKHNPV  205



>gb|AGK44103.1| UDP-glucuronate decarboxylase protein 2 [Populus tomentosa]
Length=443

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 138/198 (70%), Gaps = 5/198 (3%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET   +  YSPK  K   ++ R I YLL EQRL+FILVGI I + FF + PS S 
Sbjct  8    FRGHDETQPASDAYSPKPPKPWLAVTRPIRYLLLEQRLVFILVGIAIATLFFTLLPSSSS  67

Query  424  lsssspiprshsF-HLSNREALPE----YTPARSSGYGAAGIGRVPVGIARKRMRIVITG  588
             S     P  ++F H S+    P     Y P R     A   G++P+G+  K +RIV+TG
Sbjct  68   SSPYEHDPIPNTFSHFSHELTAPMRYKYYEPLRVGFQSANSGGKIPLGLKSKSLRIVVTG  127

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMH+F NPRFELIRHDVVEP+LLEVDQ
Sbjct  128  GAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHYFKNPRFELIRHDVVEPLLLEVDQ  187

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  188  IYHLACPASPVHYKHNPV  205



>gb|ACJ54441.1| UDP-glucuronic acid decarboxylase 2 [Gossypium hirsutum]
Length=442

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 135/204 (66%), Gaps = 22/204 (11%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET   +  YSPK +K   S+ R + Y+LREQRLLF+LVGI I +  F + P+     
Sbjct  8    RGHETQLASDSYSPKPVKPWASVTRVVRYMLREQRLLFVLVGIAIATLVFNVFPAPRAAH  67

Query  430  ssspiprshsFHLSNREALPEYTP------------ARSSGYGAAG-IGRVPVGIARKRM  570
                       HL +   L +  P            A   G+G+    G++P+G+ RK +
Sbjct  68   GP---------HLHSTTPLLDSIPYFPIETQNKFSYAHRLGFGSGNPTGKIPLGLKRKGL  118

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+
Sbjct  119  RIVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPL  178

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYK+NPV
Sbjct  179  LLEVDQIYHLACPASPVHYKFNPV  202



>ref|XP_006444354.1| hypothetical protein CICLE_v10020167mg [Citrus clementina]
 gb|ESR57594.1| hypothetical protein CICLE_v10020167mg [Citrus clementina]
Length=442

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 139/200 (70%), Gaps = 15/200 (8%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ++   T  YSPK +K   ++ + I Y+LREQRL+F+LVGI I + FF + P+    S
Sbjct  8    RGHDSQLATDSYSPKPIKPWFAVTQPIRYMLREQRLVFVLVGIAIATLFFTVIPTSYPAS  67

Query  430  ssspiprshsFHLSNREALPEYTPARS--------SGYGAAGI-GRVPVGIARKRMRIVI  582
                       H++  ++L  Y P  +         G+GA    G++P+G+ RK +RIV+
Sbjct  68   YGGARG-----HVAISDSL-SYYPVETYQRAYNPRVGFGAVNSGGKIPLGLKRKGLRIVV  121

Query  583  TGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEV  762
            TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEV
Sbjct  122  TGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEV  181

Query  763  DQIYHLAWPASPXHYKYNPV  822
            DQIYHLA PASP HYK+NPV
Sbjct  182  DQIYHLACPASPVHYKFNPV  201



>gb|AAK91406.1| AT3g62830/F26K9_260 [Arabidopsis thaliana]
 gb|AAN18049.1| At3g62830/F26K9_260 [Arabidopsis thaliana]
Length=213

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 131/198 (66%), Gaps = 8/198 (4%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y PK +K   ++ R + Y+LREQRL+F+LVGI I +  F I P  +  
Sbjct  8    RRHETDQPTADAYYPKPIKPWFTVTRPMRYMLREQRLIFVLVGIAIATLVFTIFPRSTQS  67

Query  427  sssspiprshsFHLSNREALPEYTPARSSGY------GAAGIGRVPVGIARKRMRIVITG  588
            +  S     +     +   +P     R          GA G G++P+G+ RK +R+V+TG
Sbjct  68   TPYSDPFSGYGIR-PDESYVPAIQAQRKPSLEYLNRIGATG-GKIPLGLKRKGLRVVVTG  125

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+LM RGD VIV+DNFFTGRKENVMHHF NP FE+IRHDVVEPILLEVDQ
Sbjct  126  GAGFVGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFSNPNFEMIRHDVVEPILLEVDQ  185

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  186  IYHLACPASPVHYKFNPV  203



>ref|XP_011033535.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Populus 
euphratica]
Length=442

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 133/197 (68%), Gaps = 4/197 (2%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET      YSPK  K    + R + YLLRE+RL+F LVG+ I + FF I PS S 
Sbjct  8    FRGHDETQPTPDAYSPKPAKPWLFVTRPVRYLLREKRLVFFLVGMAIATVFFTILPSSSP  67

Query  424  lsssspiprshsFHLSNREALP----EYTPARSSGYGAAGIGRVPVGIARKRMRIVITGG  591
             +           H+S+    P     Y P +     A   G++P+G+ RK +RIV+TGG
Sbjct  68   HAHKYDPLPDSFSHISHELTTPVRYKYYEPLKVGFQPANSGGKIPLGLKRKGLRIVVTGG  127

Query  592  AGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQI  771
            AGFVGSHLVD+L+ RGD V V+DNFFTGRKENVMHHF NPRFELIRHDVVEP+LLEVDQI
Sbjct  128  AGFVGSHLVDRLIARGDSVTVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLLLEVDQI  187

Query  772  YHLAWPASPXHYKYNPV  822
            YHLA PASP HYK+NPV
Sbjct  188  YHLACPASPVHYKHNPV  204



>ref|XP_008454336.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Cucumis melo]
Length=435

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 138/197 (70%), Gaps = 8/197 (4%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET      YSPK  K   S+ R I Y+LREQRLLF+LVGI I +  F + PS ++
Sbjct  7    FRGHDETQPAADAYSPKPPKPWLSVTRPIRYMLREQRLLFVLVGIAIATFVFALLPSSNY  66

Query  424  lsssspiprshsFHLSNREALPEYTPARSSGYGAAGI----GRVPVGIARKRMRIVITGG  591
             S     P      L+     P Y     +G+    +    G++P+G+ RK +RIV+TGG
Sbjct  67   PSRVGYDPIPT--ELARWSNTPSY--EHRAGFQVHRVMNSGGKIPLGLKRKGLRIVVTGG  122

Query  592  AGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQI  771
            AGFVGSHLVD+L++RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQI
Sbjct  123  AGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQI  182

Query  772  YHLAWPASPXHYKYNPV  822
            YHLA PASP HYK+NPV
Sbjct  183  YHLACPASPVHYKFNPV  199



>ref|XP_006294240.1| hypothetical protein CARUB_v10023238mg [Capsella rubella]
 gb|EOA27138.1| hypothetical protein CARUB_v10023238mg [Capsella rubella]
Length=437

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 129/198 (65%), Gaps = 2/198 (1%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            + + YRR E        Y PK +K      R I Y+LREQRL+F+LVGI I +  F +  
Sbjct  3    SELTYRRHEVGQPEAESYYPKPIKPWFVAIRPIRYMLREQRLVFVLVGIAIATLAFTLFS  62

Query  412  slshlsssspiprshsFHLSNREALPEY-TPARSSGYGAAGIGRVPVGIARKRMRIVITG  588
                                 R AL    T    S  G+AG G++P+G+ RK +R+V+TG
Sbjct  63   KSPSPPPVPYGGPDPLAEYGMRSALQRKPTIKYMSRIGSAG-GKIPLGLKRKALRVVVTG  121

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L+ RGD+VIV+DNFFTG KENVMHHF NP FELIRHDVVEPILLEVDQ
Sbjct  122  GAGFVGSHLVDRLIARGDNVIVVDNFFTGNKENVMHHFSNPNFELIRHDVVEPILLEVDQ  181

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  182  IYHLACPASPVHYKFNPV  199



>ref|XP_006479962.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Citrus sinensis]
Length=442

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 140/200 (70%), Gaps = 15/200 (8%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ++   T  YSPK +K   ++ + I Y+LREQRL+F+LVGI I + FF + P+    S
Sbjct  8    RGHDSQLATDSYSPKPIKPWFAVTQPIRYMLREQRLVFVLVGIAIATLFFTVIPTSYPAS  67

Query  430  ssspiprshsFHLSNREALPEYTPARS--------SGYGAAGI-GRVPVGIARKRMRIVI  582
               P       H++  ++L  Y P  +         G+GA    G++P+G+ RK +RIV+
Sbjct  68   YGGPRG-----HVAISDSL-SYYPVETYQRAYNPRVGFGAVNSGGKIPLGLKRKGLRIVV  121

Query  583  TGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEV  762
            TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEV
Sbjct  122  TGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEV  181

Query  763  DQIYHLAWPASPXHYKYNPV  822
            DQIYHLA PASP HYK+NPV
Sbjct  182  DQIYHLACPASPVHYKFNPV  201



>ref|XP_011082471.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Sesamum 
indicum]
Length=430

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 10/195 (5%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  E    +  YSPK  K   S+ R I Y+LREQRL+F+ VGI I +  F+++PS +   
Sbjct  8    RGHEPQTASDAYSPKPPKPWLSVVRPIRYMLREQRLVFLFVGIAIATLVFVLRPSSNSPP  67

Query  430  ssspiprshsFHLSNREALPEYTPARS----SGYGAAGIGRVPVGIARKRMRIVITGGAG  597
                       + S+    P     ++    +G+G   +G++P+G+ RK +RIV+TGGAG
Sbjct  68   PIGYS------YFSSELTQPHRAIYQNGHLINGFGFKSVGKIPLGLKRKGLRIVVTGGAG  121

Query  598  FVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYH  777
            FVGSHLVD+LMKRGD VIV+DNFFTGRKENVM HFGNPRFELIRHDVVEP+LLEVDQIYH
Sbjct  122  FVGSHLVDRLMKRGDSVIVVDNFFTGRKENVMQHFGNPRFELIRHDVVEPLLLEVDQIYH  181

Query  778  LAWPASPXHYKYNPV  822
            LA PASP HYK+NPV
Sbjct  182  LACPASPVHYKHNPV  196



>emb|CDY25119.1| BnaC06g18610D [Brassica napus]
Length=438

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 133/195 (68%), Gaps = 7/195 (4%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLK-HPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            RR E    +   Y P+ +K    ++ R + Y+LREQRLLF+LVGI I +  F I P  + 
Sbjct  8    RRHEADQPDADAYYPRPIKPWSSTVTRPMRYMLREQRLLFVLVGIAIATLVFTIFPRSTP  67

Query  424  lsssspiprshsFHLSNREALPEYTPAR--SSGYGAAGIGRVPVGIARKRMRIVITGGAG  597
             S              +   +P +   R  S   GA G G++P+G+ RK MR+V+TGGAG
Sbjct  68   YSDPFSGYG---IRPGDESYVPAFQAQRRPSLSMGATG-GKIPLGLKRKGMRVVVTGGAG  123

Query  598  FVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYH  777
            FVGSHLVD+LM RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEPILLEVDQIYH
Sbjct  124  FVGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPILLEVDQIYH  183

Query  778  LAWPASPXHYKYNPV  822
            LA PASP HYK+NPV
Sbjct  184  LACPASPVHYKFNPV  198



>ref|XP_012082771.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Jatropha curcas]
 gb|KDP28164.1| hypothetical protein JCGZ_13935 [Jatropha curcas]
Length=437

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 139/203 (68%), Gaps = 20/203 (10%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +E    T  YSPK  K   S+ R I Y+LREQRL+F+LVGI I + FF + PS S 
Sbjct  7    FRGHDEPQHITDAYSPKPPKRWLSVTRPIRYMLREQRLVFVLVGIAIATLFFTVLPSSSR  66

Query  424  lsssspiprshsFHLSNREALPEY--------TPARSSGYG--AAGIGRVPVGIARKRMR  573
             S             S  + +P+          PAR   +    AG G++P+G+ RK +R
Sbjct  67   TSYVPH---------SKYDPIPDSLAHFSLDSVPARYKLFQPHTAG-GKIPLGLKRKGLR  116

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVD+L++RGD VIV+DNFFTGRKENVMHHF NPRFELIRHDVVEP+L
Sbjct  117  IVVTGGAGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLL  176

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYK+NPV
Sbjct  177  LEVDQIYHLACPASPVHYKHNPV  199



>ref|XP_009411672.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 133/183 (73%), Gaps = 4/183 (2%)
 Frame = +1

Query  283  YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsF  462
            Y PK  K    L R I YLLREQRL+F+LVG+ +GS FF + PS S  S+ +      S 
Sbjct  22   YVPKPEKRILWLSRPIRYLLREQRLVFVLVGMALGSLFFALAPSSSSSSAVAVEIALRSV  81

Query  463  HLSNREALPEY---TPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMK  633
              +   A  ++   T   ++  G  G G+VP+GI RK +R+V+TGGAGFVGSHLVD+L+ 
Sbjct  82   EPTRFGAFQQHHHRTAFEAANKGFVG-GKVPLGIKRKGLRVVVTGGAGFVGSHLVDRLIA  140

Query  634  RGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKY  813
            RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVDQIYHLA PASP HYK+
Sbjct  141  RGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYHLACPASPVHYKF  200

Query  814  NPV  822
            NP+
Sbjct  201  NPI  203



>ref|XP_001769958.1| predicted protein [Physcomitrella patens]
 gb|EDQ65134.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 145/206 (70%), Gaps = 10/206 (5%)
 Frame = +1

Query  229  QASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiq  408
             A++N+RR + T++N   Y+PK  K   S+  S+ Y+LREQR +F+LVG+ I + FF+  
Sbjct  2    NATLNHRRVDVTSENEK-YTPKPQKQ-WSMSNSVEYVLREQRFVFVLVGVAITTAFFLFL  59

Query  409  p------slshlsssspiprshsFHLSNREALP-EYTPARSSGYGAAGIG-RVPVGIARK  564
                     +   SS    ++++F  S +     E  P +S       +G ++P+G+ RK
Sbjct  60   QPEFGSGQRTMDVSSYTAVQAYNFDESYQTTRTFETAPYKSHRSAIVSLGGKIPLGLPRK  119

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
             +RIV+TGGAGFVGSHLVD+L++RGD VIV+DNFFTGRKENV HHFGNPRFELIRHDVVE
Sbjct  120  PLRIVVTGGAGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVQHHFGNPRFELIRHDVVE  179

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            P+LLEVDQIYHLA PASP HYK+NP+
Sbjct  180  PLLLEVDQIYHLACPASPVHYKFNPI  205



>ref|XP_009421356.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Musa acuminata 
subsp. malaccensis]
Length=437

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 145/221 (66%), Gaps = 32/221 (14%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSI---------NYLLREQRLLFIL  369
            +LHKQ+S+N        Q  P Y+ K  K P++ P S           YLLREQRLLF+L
Sbjct  3    QLHKQSSLN------QTQLIPTYAAKPAK-PQARPSSAASSPLRAAAGYLLREQRLLFVL  55

Query  370  VGILIGSTFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIG----  537
             G +I STFF++ P    LS   P       HLS+R  LP +    S  + A+  G    
Sbjct  56   AGAVIASTFFLLHPYYHSLSRPHPYD-----HLSHR-LLPTFRHPSSPSFSASDGGGSVG  109

Query  538  ------RVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHH  699
                  R+PVG+ +   RIV+TGGAGFVGSHLVDKL+ RGD VIVIDNFFTGRK+NV+HH
Sbjct  110  VGGGGRRIPVGLKKPSKRIVVTGGAGFVGSHLVDKLLGRGDSVIVIDNFFTGRKDNVVHH  169

Query  700  FGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            FGNPRFELIRHDVVEPILLEVD+IYHLA PASP HYKYNP+
Sbjct  170  FGNPRFELIRHDVVEPILLEVDEIYHLACPASPVHYKYNPI  210



>ref|XP_002301480.1| UDP-XYLOSE SYNTHASE 4 family protein [Populus trichocarpa]
 gb|EEE80753.1| UDP-XYLOSE SYNTHASE 4 family protein [Populus trichocarpa]
Length=429

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 137/193 (71%), Gaps = 9/193 (5%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET   +  YSPK  K   ++ R I YLL EQRL+FILVGI I + FF + PS S 
Sbjct  8    FRGHDETQPASDAYSPKPPKPWLAVTRPIRYLLLEQRLVFILVGIAIATLFFTLLPSSSS  67

Query  424  lsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFV  603
             S     P  ++F   + E     TP  +SG      G++P+G+  K +RIV+TGGAGFV
Sbjct  68   SSPYEHDPIPNTFSHFSHELT---TPMPNSG------GKIPLGLKSKSLRIVVTGGAGFV  118

Query  604  GSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLA  783
            GSHLVD+L+ RGD VIV+DNFFTGRKENVMHHF NPRFELIRHDVVEP+LLEVDQIYHLA
Sbjct  119  GSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLLLEVDQIYHLA  178

Query  784  WPASPXHYKYNPV  822
             PASP HYK+NPV
Sbjct  179  CPASPVHYKHNPV  191



>ref|XP_002882125.1| UDP-glucuronic acid decarboxylase 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58384.1| UDP-glucuronic acid decarboxylase 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 137/199 (69%), Gaps = 7/199 (4%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            + + YRR E        Y PK +K      R I Y+LREQRL+F+LVGI + +  F I  
Sbjct  3    SELTYRRHEMEQAEAESYYPKPIKPWFVAIRPIRYMLREQRLVFVLVGIAMATLGFTIFS  62

Query  412  slshlsssspiprshsFHLSN--REALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVIT  585
              S+      +     + + +  ++A  EY     S  G+AG G++P+G+ RK +R+V+T
Sbjct  63   KPSNQPIPYDVDPLPGYGMRSYEKKASIEYM----SRIGSAG-GKIPLGLKRKVLRVVVT  117

Query  586  GGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVD  765
            GGAGFVGSHLVD+LM RGD+VIV+DNFFTGRKENVMHHF NP FE+IRHDVVEPILLEVD
Sbjct  118  GGAGFVGSHLVDRLMARGDNVIVVDNFFTGRKENVMHHFSNPNFEMIRHDVVEPILLEVD  177

Query  766  QIYHLAWPASPXHYKYNPV  822
            QIYHLA PASP HYK+NPV
Sbjct  178  QIYHLACPASPVHYKFNPV  196



>ref|XP_010921663.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like isoform X2 
[Elaeis guineensis]
Length=357

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 134/203 (66%), Gaps = 22/203 (11%)
 Frame = +1

Query  253  DEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFF-----------  399
            D +  +    YSPK LK    + R + YLLREQRLLF+LVG+ + +              
Sbjct  11   DHQPQEGAGGYSPKPLKQWWWISRPLRYLLREQRLLFVLVGMALATLVVFLLPRASPAAG  70

Query  400  --iiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
              I    +  L+  S        H S+R ALP    AR    G  G G+VP+G+ RK +R
Sbjct  71   SAIGAHLMVDLARRSTAAVGGGGHYSHRTALP----AR----GFVG-GKVPLGLKRKGLR  121

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+L
Sbjct  122  IVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLL  181

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYK+NPV
Sbjct  182  LEVDQIYHLACPASPVHYKFNPV  204



>ref|XP_004152248.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Cucumis sativus]
 gb|KGN52813.1| hypothetical protein Csa_4G001800 [Cucumis sativus]
Length=435

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 137/197 (70%), Gaps = 8/197 (4%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET      YSPK  K   S+ R I Y+LREQRL+F+LVGI I +  F + PS + 
Sbjct  7    FRGHDETQPAADAYSPKPPKPWLSVTRPIRYMLREQRLVFVLVGIAIATFVFTLFPSSNS  66

Query  424  lsssspiprshsFHLSNREALPEYTPARSSGYGAAGI----GRVPVGIARKRMRIVITGG  591
             S     P      L+     P Y     +G+    +    G++P+G+ RK +RIV+TGG
Sbjct  67   PSRVGYDPIPT--ELARWSNTPSY--EHRAGFQVHRVMNSGGKIPLGLKRKGLRIVVTGG  122

Query  592  AGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQI  771
            AGFVGSHLVD+L++RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQI
Sbjct  123  AGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQI  182

Query  772  YHLAWPASPXHYKYNPV  822
            YHLA PASP HYK+NPV
Sbjct  183  YHLACPASPVHYKFNPV  199



>ref|XP_007050928.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX95085.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=440

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 133/195 (68%), Gaps = 4/195 (2%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS---TFFiiqpsls  420
            R  ET   +  YSPK +K   S+ R I Y+LREQRLLF+LVGI I +   T F    +  
Sbjct  8    RGHETHPASDSYSPKPVKPWASVIRPIRYMLREQRLLFVLVGIAIATLIFTIFPTSRAPH  67

Query  421  hlsssspiprshsFHLSNREALPEYTPARSSGYGAAG-IGRVPVGIARKRMRIVITGGAG  597
                      S S      E   +++     G+ +A   G++P+G+ RK +RIV+TGGAG
Sbjct  68   VPHHHFTTSISDSITYFPIEPQNKFSYPHRVGFESANPTGKIPLGLKRKGLRIVVTGGAG  127

Query  598  FVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYH  777
            FVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVDQIYH
Sbjct  128  FVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYH  187

Query  778  LAWPASPXHYKYNPV  822
            LA PASP HYK+NPV
Sbjct  188  LACPASPVHYKFNPV  202



>ref|XP_010259550.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Nelumbo 
nucifera]
Length=433

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 137/198 (69%), Gaps = 12/198 (6%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET      YSPK LK   ++ R I Y+LREQRL+F+LVG+ I +  F + PS    +
Sbjct  8    RGHETQPQVDAYSPKPLKPWFAVTRPIRYMLREQRLIFVLVGMAIATLVFTLLPSSPPKA  67

Query  430  ssspiprshsF-------HLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITG  588
              +  P   ++        LS+R  L      R  G    G G++P+G+ RK +RIV+TG
Sbjct  68   GHNYYPIPETYFPTGVSNALSHRVGLQH----RILGTTNPG-GKIPLGLKRKGLRIVVTG  122

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQ
Sbjct  123  GAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQ  182

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  183  IYHLACPASPVHYKFNPV  200



>ref|XP_007050929.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX95086.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=441

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 133/195 (68%), Gaps = 4/195 (2%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS---TFFiiqpsls  420
            R  ET   +  YSPK +K   S+ R I Y+LREQRLLF+LVGI I +   T F    +  
Sbjct  8    RGHETHPASDSYSPKPVKPWASVIRPIRYMLREQRLLFVLVGIAIATLIFTIFPTSRAPH  67

Query  421  hlsssspiprshsFHLSNREALPEYTPARSSGYGAAG-IGRVPVGIARKRMRIVITGGAG  597
                      S S      E   +++     G+ +A   G++P+G+ RK +RIV+TGGAG
Sbjct  68   VPHHHFTTSISDSITYFPIEPQNKFSYPHRVGFESANPTGKIPLGLKRKGLRIVVTGGAG  127

Query  598  FVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYH  777
            FVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVDQIYH
Sbjct  128  FVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYH  187

Query  778  LAWPASPXHYKYNPV  822
            LA PASP HYK+NPV
Sbjct  188  LACPASPVHYKFNPV  202



>ref|XP_006402337.1| hypothetical protein EUTSA_v10005973mg [Eutrema salsugineum]
 gb|ESQ43790.1| hypothetical protein EUTSA_v10005973mg [Eutrema salsugineum]
Length=445

 Score =   199 bits (507),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 133/198 (67%), Gaps = 8/198 (4%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y PK +K    + R + Y+LREQRLLF+LVGI I +  F I P  +  
Sbjct  8    RRHEADQPAADAYYPKPIKPWFMVTRPMRYMLREQRLLFVLVGIAIATLVFTIFPRSTQS  67

Query  427  sssspiprshsFHLSNREALPEYTPARSSGY------GAAGIGRVPVGIARKRMRIVITG  588
             + S     +    ++   LP     R          GA G G++P+G+ RK +R+V+TG
Sbjct  68   IAYSDPFSGYGIR-TDESYLPAVQAQRKPSVEYLNRIGATG-GKIPLGLKRKGLRVVVTG  125

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+LM+RGD VIV+DNFFTGRKENVMHHFGNP FE+IRHDVVEPILLEVDQ
Sbjct  126  GAGFVGSHLVDRLMERGDTVIVVDNFFTGRKENVMHHFGNPNFEMIRHDVVEPILLEVDQ  185

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  186  IYHLACPASPVHYKFNPV  203



>ref|XP_007200976.1| hypothetical protein PRUPE_ppa004626mg [Prunus persica]
 gb|EMJ02175.1| hypothetical protein PRUPE_ppa004626mg [Prunus persica]
Length=499

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 137/196 (70%), Gaps = 5/196 (3%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  E       YSPK  K   S+ R I YLLREQRL+F+LVGI I +  F + PS     
Sbjct  63   RGHEAQHVADTYSPKPPKPWASVTRPIGYLLREQRLVFVLVGIAIATVGFTLLPSSRSPY  122

Query  430  ssspiprshsFHLSNREALPEYT--PARSSGYGAAGI---GRVPVGIARKRMRIVITGGA  594
             +  +P S+ +   + ++    T  PA    +G       G+VP+G+ RK +RIV+TGGA
Sbjct  123  VNGNVPISNEYVRYDFDSSTHLTHKPAYERRFGLTNWNSGGKVPLGLKRKGLRIVVTGGA  182

Query  595  GFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIY  774
            GFVGSHLVD+L++RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIY
Sbjct  183  GFVGSHLVDRLIERGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIY  242

Query  775  HLAWPASPXHYKYNPV  822
            HLA PASP HYK+NPV
Sbjct  243  HLACPASPVHYKFNPV  258



>ref|XP_010269565.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Nelumbo 
nucifera]
Length=443

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 131/196 (67%), Gaps = 5/196 (3%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET      YSPK  K   S+ R I Y+LREQRL+F+LVGI I +  F + P      
Sbjct  8    RGHETLPQADTYSPKPPKPWLSVTRPIRYMLREQRLVFVLVGIAIATLVFTLLPPSPAKL  67

Query  430  ssspiprshsFHLSNREALPE----YTPARSSGYGAAG-IGRVPVGIARKRMRIVITGGA  594
              +  P       S  +A+          R  G G     G++P+G+ RK +RIV+TGGA
Sbjct  68   RHNYYPMPEMDFPSGSDAVAHPHRFAFEHRGGGLGTTNPAGKIPLGLKRKGLRIVVTGGA  127

Query  595  GFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIY  774
            GFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIY
Sbjct  128  GFVGSHLVDRLIGRGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIY  187

Query  775  HLAWPASPXHYKYNPV  822
            HLA PASP HYK+NPV
Sbjct  188  HLACPASPVHYKFNPV  203



>gb|AGK44106.1| UDP-glucuronate decarboxylase protein 5 [Populus tomentosa]
 gb|AGK44113.1| UDP-glucuronate decarboxylase protein 5 [Populus tomentosa]
Length=439

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 132/194 (68%), Gaps = 1/194 (1%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            +R  +ET      YSPK  K    + R + YLLRE+RL+F LVG+ I + FF I PS S 
Sbjct  8    FRGHDETQPTPDAYSPKPAKPWLFVIRPVRYLLREKRLVFFLVGMAIATVFFTILPSSSP  67

Query  424  lsssspiprshsFH-LSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGF  600
             +           H L+       Y P +     A   G++P+G+ RK +RIV+TGGAGF
Sbjct  68   HAHKYDPLPDSFSHELTTPVRYKYYEPLQVGFQSANSGGKIPLGLKRKGLRIVVTGGAGF  127

Query  601  VGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHL  780
            VGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHF NPRFELIRHDVVEP+LLEVDQIYHL
Sbjct  128  VGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFKNPRFELIRHDVVEPLLLEVDQIYHL  187

Query  781  AWPASPXHYKYNPV  822
            A PASP HYK+NPV
Sbjct  188  ACPASPVHYKHNPV  201



>ref|XP_010069913.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Eucalyptus grandis]
 gb|KCW58435.1| hypothetical protein EUGRSUZ_H01112 [Eucalyptus grandis]
Length=443

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 134/192 (70%), Gaps = 10/192 (5%)
 Frame = +1

Query  274  TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGS---TFFiiqpslshlsssspi  444
            T  YSPK  K    + R+I YLLREQRLLF+LVGI I +   T F   PS      S P 
Sbjct  16   TDAYSPKPDKPWLPVARAIRYLLREQRLLFVLVGIAIATVLFTVFPGGPSARPGYGSGPY  75

Query  445  prshsFHLS------NREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVG  606
                  H++      +R         + +G+G+   G+VP+G+ RK +RIV+TGGAGFVG
Sbjct  76   DPIPGAHVARYGGGFDRFESERALYQQRAGFGSVS-GKVPLGLKRKGLRIVVTGGAGFVG  134

Query  607  SHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAW  786
            SHLVD+LM RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIYHLA 
Sbjct  135  SHLVDRLMARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIYHLAC  194

Query  787  PASPXHYKYNPV  822
            PASP HYK+NPV
Sbjct  195  PASPVHYKFNPV  206



>ref|XP_010512678.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Camelina 
sativa]
Length=444

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 133/199 (67%), Gaps = 11/199 (6%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y PK +K    + R + YLLREQRL+F+LVGI I S  F + P  S  
Sbjct  8    RRHEADQHTADAYYPKPIKPWFMVTRPMRYLLREQRLIFVLVGIAIASLVFTLFPRTSTQ  67

Query  427  sssspiprshsFHLSNREALPEYTPARS-------SGYGAAGIGRVPVGIARKRMRIVIT  585
            S+    P S   +   R     Y PA         +  GA G G++P+G+ RK +R+V+T
Sbjct  68   STPYSDPFS---NYGFRTEESSYVPATRKPSLEYLNRIGATG-GKIPLGLKRKGLRVVVT  123

Query  586  GGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVD  765
            GGAGFVGSHLVD+LM RGD VIV+DNFFTGRKENVMHHF NP FELIRHDVVEPILLEVD
Sbjct  124  GGAGFVGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFSNPNFELIRHDVVEPILLEVD  183

Query  766  QIYHLAWPASPXHYKYNPV  822
            QIYHLA PASP HYK+NPV
Sbjct  184  QIYHLACPASPVHYKFNPV  202



>gb|KJB49910.1| hypothetical protein B456_008G145200 [Gossypium raimondii]
Length=433

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 5/192 (3%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET   +  YSPK  K   S+ R I Y+LREQRLLF+ +GI I +  F + P+     
Sbjct  9    RGHETQPVSDSYSPKPDKPWASVTRPIRYMLREQRLLFVFLGIAIATLIFTLFPASRAPQ  68

Query  430  ssspiprshsFHLSNREALPEYTPARSSGYGAAG-IGRVPVGIARKRMRIVITGGAGFVG  606
             +     ++ F +  +    +++     G+G++   G++P+G+ RK +RIV+TGGAGFVG
Sbjct  69   HNFADSITY-FPIDTQS---KFSNPHRLGFGSSNPTGKIPLGLKRKGLRIVVTGGAGFVG  124

Query  607  SHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAW  786
            SHLVD+L+ RGD V+V+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVDQIYHLA 
Sbjct  125  SHLVDRLIARGDSVMVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYHLAC  184

Query  787  PASPXHYKYNPV  822
            PASP HYK+NPV
Sbjct  185  PASPVHYKFNPV  196



>ref|XP_001776651.1| predicted protein [Physcomitrella patens]
 gb|EDQ58487.1| predicted protein [Physcomitrella patens]
Length=436

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 141/204 (69%), Gaps = 9/204 (4%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            A++++RR E   +N   Y+PK  K   S+ +S+ Y+LREQR +F+LVG+ + + FF+   
Sbjct  3    ATLSHRRVEVAPENVE-YTPKPQKK-WSVSKSVEYVLREQRFVFVLVGVALTTVFFMFLQ  60

Query  412  slshlsssspiprshsFHLSNRE----ALPEYTPARSSGYGAAGI---GRVPVGIARKRM  570
                 + SS        H  N +     +  +  A      AA +   G++P+G+ RK +
Sbjct  61   PGGRFAQSSDGSVYTGVHEYNVDEAYGTVRAFEKAPYRAQHAAMVSPGGKIPLGLPRKPL  120

Query  571  RIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPI  750
            RIV+TGGAGFVGSHLVD+L++RGD VIV+DNFFTGRKENV HHFGNPRFELIRHDVVEP+
Sbjct  121  RIVVTGGAGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVQHHFGNPRFELIRHDVVEPL  180

Query  751  LLEVDQIYHLAWPASPXHYKYNPV  822
            LLEVDQIYHLA PASP HYK+NP+
Sbjct  181  LLEVDQIYHLACPASPVHYKFNPI  204



>ref|XP_009404621.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 140/216 (65%), Gaps = 27/216 (13%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRS----------LPRSINYLLREQRLLFI  366
            +LHKQ+S+N        Q  P Y+ K  K              L  +  YLLREQRLLF+
Sbjct  3    QLHKQSSLNQN------QQIPTYAAKPAKQQARPSSASSSPSFLRSAAGYLLREQRLLFV  56

Query  367  LVGILIGSTFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIG---  537
            L G +I STFF++QP     +S          HL+ R      + + S G G A +G   
Sbjct  57   LAGAVIASTFFLLQPYYHSSTSGLQPSD----HLAYRHP---SSSSSSFGGGDAALGGSG  109

Query  538  -RVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPR  714
             R+PVG+ +   R+ +TGGAGFVGSHLVDKL+ RGD VIVIDNFFTGRKENV+HHFGNPR
Sbjct  110  KRMPVGLKKPSKRVAVTGGAGFVGSHLVDKLLSRGDSVIVIDNFFTGRKENVVHHFGNPR  169

Query  715  FELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            FELIRHDVVEPILLEVD+IYHLA PASP HYKYNP+
Sbjct  170  FELIRHDVVEPILLEVDEIYHLACPASPVHYKYNPI  205



>ref|XP_010518480.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Camelina 
sativa]
Length=438

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 137/202 (68%), Gaps = 14/202 (7%)
 Frame = +1

Query  238  VNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpsl  417
             N R + E  +    Y P+ +K   +  R I Y+LREQRL+F+LVGI I +  F +    
Sbjct  6    TNRRHEIEQREEAESYYPRPIKPWFAAIRPIRYMLREQRLIFVLVGIAIATLAFTLFSKS  65

Query  418  shlsssspiprshsFHLSNREALPEY-------TPARSSGYGAAGIGRVPVGIARKRMRI  576
            S  S S P          + + LP Y       T   +S  G+AG G++P+G+ RK +R+
Sbjct  66   SSSSPSQP------IPYDDADPLPGYGMRSYHPTIEYTSRIGSAG-GKIPLGLKRKVLRV  118

Query  577  VITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILL  756
            V+TGGAGFVGSHLVD+L+ RGD+VIV+DNFFTGRKENVMHHF NP FELIRHDVVEPILL
Sbjct  119  VVTGGAGFVGSHLVDRLIARGDNVIVVDNFFTGRKENVMHHFSNPNFELIRHDVVEPILL  178

Query  757  EVDQIYHLAWPASPXHYKYNPV  822
            EVDQIYHLA PASP HYKYNPV
Sbjct  179  EVDQIYHLACPASPVHYKYNPV  200



>ref|XP_008223207.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Prunus mume]
Length=455

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 142/224 (63%), Gaps = 47/224 (21%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPP---YSPKT-LKHPRSLPRSINYLLREQRLLFILVGILIGSTFF  399
             + ++++DE+  Q++ P   + P++  + P + P  I YLLREQRLLF+L+GI I + FF
Sbjct  15   TTQSHQQDEQPDQSSQPTIDFDPQSNCRPPHTNP--IRYLLREQRLLFVLIGIAIATLFF  72

Query  400  iiqpslshlsssspiprshsFHLSNREALPEYTP---------------------ARSSG  516
                                F LSN E      P                     AR  G
Sbjct  73   SS------------------FPLSNPELATTNDPRFESESGLDLPANPTRRVLYEARGVG  114

Query  517  YGA--AGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENV  690
            +G+  +  G+VP+G+ +K  RIV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKEN+
Sbjct  115  FGSVMSAGGKVPLGLKKKNQRIVVTGGAGFVGSHLVDRLIARGDSVIVLDNFFTGRKENL  174

Query  691  MHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            +HHFGNP+FELIRHDVVEPILLEVDQIYHLA PASP HYK+NPV
Sbjct  175  VHHFGNPKFELIRHDVVEPILLEVDQIYHLACPASPVHYKFNPV  218



>ref|XP_002994140.1| hypothetical protein SELMODRAFT_270121 [Selaginella moellendorffii]
 gb|EFJ04801.1| hypothetical protein SELMODRAFT_270121 [Selaginella moellendorffii]
Length=423

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = +1

Query  235  SVNYRRDEETAQNTPP-YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            S+N+RR EE A + P  YS K  K     PR ++YL+REQRL+F+L+G+ + + FFI+QP
Sbjct  6    SLNHRRHEEDAPSPPEDYSAKPSK---PWPRPVDYLIREQRLMFVLLGMALATAFFIVQP  62

Query  412  slshlsssspiprshsFHLSNREALPEYT--PARSSGYGAAGIG-RVPVGIARKRMRIVI  582
                 S              +REA       P  S+       G ++P+G+ RK +R+V+
Sbjct  63   GYFGNSDRPSSAA----RFFDREAETRIVVRPQVSTVPAVFSTGAKIPLGLRRKPLRVVV  118

Query  583  TGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEV  762
            TGGAGFVGSHLVD+LM RGD VIV+DNFFTGRKENV+HH GNPRFELIRHDVVEP+LLEV
Sbjct  119  TGGAGFVGSHLVDRLMARGDSVIVVDNFFTGRKENVIHHVGNPRFELIRHDVVEPLLLEV  178

Query  763  DQIYHLAWPASPXHYKYNPV  822
            DQIYHLA PASP HYKYNP 
Sbjct  179  DQIYHLACPASPVHYKYNPT  198



>ref|XP_010506806.1| PREDICTED: UDP-glucuronic acid decarboxylase 4 [Camelina sativa]
Length=435

 Score =   197 bits (501),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 131/197 (66%), Gaps = 7/197 (4%)
 Frame = +1

Query  238  VNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpsl  417
             N R + E  +    Y P+ +K      R I Y+LREQRL+F+LVG+ I +  F +    
Sbjct  6    TNRRHEIEQREEAESYYPRPIKPWFVAIRPIRYMLREQRLVFVLVGVAIATLAFTLFSKS  65

Query  418  shlsssspiprshsFHLSNREALP--EYTPARSSGYGAAGIGRVPVGIARKRMRIVITGG  591
            S                  R   P  EYT    S  G+AG G++P+G+ RK +R+V+TGG
Sbjct  66   SPSQPIPYDDADPLAGYGMRSYQPTIEYT----SRIGSAG-GKIPLGLKRKVLRVVVTGG  120

Query  592  AGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQI  771
            AGFVGSHLVD+L+ RGD+VIV+DNFFTGRKENVMHHF NP FELIRHDVVEPILLEVDQI
Sbjct  121  AGFVGSHLVDRLIARGDNVIVVDNFFTGRKENVMHHFSNPNFELIRHDVVEPILLEVDQI  180

Query  772  YHLAWPASPXHYKYNPV  822
            YHLA PASP HYK+NPV
Sbjct  181  YHLACPASPVHYKFNPV  197



>ref|XP_002972645.1| hypothetical protein SELMODRAFT_267587 [Selaginella moellendorffii]
 gb|EFJ25866.1| hypothetical protein SELMODRAFT_267587 [Selaginella moellendorffii]
Length=423

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = +1

Query  235  SVNYRRDEETAQNTPP-YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            S+N+RR EE A + P  YS K  K     PR ++YL+REQRL+F+L+G+ + + FFI+QP
Sbjct  6    SLNHRRHEEDAPSPPEDYSAKPSK---PWPRPVDYLIREQRLMFVLLGMALATAFFIVQP  62

Query  412  slshlsssspiprshsFHLSNREALPEYT--PARSSGYGAAGIG-RVPVGIARKRMRIVI  582
                 S              +REA       P  S+       G ++P+G+ RK +R+V+
Sbjct  63   GYFGNSDRPSSAA----RFFDREAETRIVVRPQVSTVPAVFSTGAKIPLGLRRKPLRVVV  118

Query  583  TGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEV  762
            TGGAGFVGSHLVD+LM RGD VIV+DNFFTGRKENV+HH GNPRFELIRHDVVEP+LLEV
Sbjct  119  TGGAGFVGSHLVDRLMARGDSVIVVDNFFTGRKENVIHHVGNPRFELIRHDVVEPLLLEV  178

Query  763  DQIYHLAWPASPXHYKYNPV  822
            DQIYHLA PASP HYKYNP 
Sbjct  179  DQIYHLACPASPVHYKYNPT  198



>ref|XP_010520999.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Tarenaya 
hassleriana]
Length=434

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 137/203 (67%), Gaps = 8/203 (4%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            + + YRR E    +   Y PK +K    +  SI Y+LREQRL+F+LVGI I +  F I P
Sbjct  3    SELMYRRYETDQPSVDAYYPKPIKPWFFVTPSIRYMLREQRLVFVLVGIAIATLGFTIFP  62

Query  412  slshlsssspiprshsFHLSNREALPEYTPARSSGY------GAAGIGRVPVGIARKRMR  573
              +     S     +    S    L  +   +   +      G+AG G++P+G+ RK +R
Sbjct  63   RSTQPIPYSDPFSGYGLR-SESSYLTAFQAQKKPSFEYLNRIGSAG-GKIPLGLKRKGLR  120

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVD+L+ RGD+VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+L
Sbjct  121  IVVTGGAGFVGSHLVDRLIARGDNVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLL  180

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYK+NPV
Sbjct  181  LEVDQIYHLACPASPVHYKFNPV  203



>ref|XP_010684525.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Beta vulgaris 
subsp. vulgaris]
Length=438

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 134/198 (68%), Gaps = 5/198 (3%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFii---qps  414
            +R  EE+   + PYSPK  K   ++ R I+YLLREQR++F+ +GI I +  F +     +
Sbjct  7    FRGHEESHLKSEPYSPKPQKPWFNVTRPIHYLLREQRIVFLFLGIAIATLIFSLLPISTT  66

Query  415  lshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGI--GRVPVGIARKRMRIVITG  588
             +  +       +    +     L   +    S     G   G+VP+G+ RK +RIV+TG
Sbjct  67   TTTTTRVGNNYNNMQESIGGESFLSSESTRMLSHRVTDGFRSGKVPLGLKRKGLRIVVTG  126

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQ
Sbjct  127  GAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQ  186

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  187  IYHLACPASPVHYKHNPV  204



>ref|XP_009794075.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Nicotiana 
sylvestris]
Length=439

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 130/185 (70%), Gaps = 5/185 (3%)
 Frame = +1

Query  283  YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsF  462
            Y+PK  K   S+ R + YLLREQR++F+  GI I S  F + PS    S +      +  
Sbjct  19   YTPKPDKPWLSVIRPVRYLLREQRIVFLFAGIAIASLIFALLPSSRSGSLNYANNMIYDS  78

Query  463  HLSNREALPEYTP----ARSSGYGAAGIG-RVPVGIARKRMRIVITGGAGFVGSHLVDKL  627
            +L +    P+           G+G+   G ++P+G+ RK +RIV+TGGAGFVGSHLVD+L
Sbjct  79   YLPSESTQPQVAHRMIYQNRPGFGSFNSGGKIPLGLQRKGLRIVVTGGAGFVGSHLVDRL  138

Query  628  MKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHY  807
            + RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIYHLA PASP HY
Sbjct  139  IARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIYHLACPASPVHY  198

Query  808  KYNPV  822
            K+NPV
Sbjct  199  KHNPV  203



>ref|XP_010413227.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Camelina sativa]
 ref|XP_010413228.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Camelina sativa]
 ref|XP_010413229.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Camelina sativa]
Length=442

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 130/194 (67%), Gaps = 3/194 (2%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y PK +K    + R + YLLREQRL+F+LVGI I +  F + P  +  
Sbjct  8    RRHEADQPTADAYYPKPIKPWFMVTRPMRYLLREQRLIFVLVGIAIATLVFTLFPRSTQS  67

Query  427  sssspiprshsFHLSNREALPEYTPARS--SGYGAAGIGRVPVGIARKRMRIVITGGAGF  600
            +  S     +           +  P+    +  GA G G++P+G+ RK +R+V+TGGAGF
Sbjct  68   TPYSDPFSGYGIRTDESYVPAQRKPSLEYLNRIGATG-GKIPLGLKRKGLRVVVTGGAGF  126

Query  601  VGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHL  780
            VGSHLVD+LM RGD VIV+DNFFTGRKENVMHHF NP FELIRHDVVEPILLEVDQIYHL
Sbjct  127  VGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFSNPNFELIRHDVVEPILLEVDQIYHL  186

Query  781  AWPASPXHYKYNPV  822
            A PASP HYK+NPV
Sbjct  187  ACPASPVHYKFNPV  200



>ref|XP_006419549.1| hypothetical protein CICLE_v10004959mg [Citrus clementina]
 gb|ESR32789.1| hypothetical protein CICLE_v10004959mg [Citrus clementina]
Length=447

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 129/180 (72%), Gaps = 5/180 (3%)
 Frame = +1

Query  286  SPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsss-spiprshsF  462
            SP+  K  +S    + Y+LR QRL+F+ +GI I S  F   P   H  ++ + +  S + 
Sbjct  25   SPRPSKSVKSFRNPVQYMLRSQRLIFLFIGIAISSLIFSKLPLRQHQIANPALLTTSETT  84

Query  463  HLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGD  642
            HLS R  L E    +    G    G+VP+G+ RK +RI++TGGAGFVGSHLVD+LM RGD
Sbjct  85   HLSRRRVLYEAAEVQHVNAG----GKVPLGLQRKSLRILVTGGAGFVGSHLVDRLMDRGD  140

Query  643  DVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
             VIV+DN+FTG+K+N++HHFGNPRFELIRHDVVEPILLEVDQIYHLA PASP HYK+NPV
Sbjct  141  SVIVVDNYFTGKKDNLIHHFGNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKFNPV  200



>ref|XP_010921662.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like isoform X1 
[Elaeis guineensis]
Length=443

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 134/203 (66%), Gaps = 22/203 (11%)
 Frame = +1

Query  253  DEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFF-----------  399
            D +  +    YSPK LK    + R + YLLREQRLLF+LVG+ + +              
Sbjct  11   DHQPQEGAGGYSPKPLKQWWWISRPLRYLLREQRLLFVLVGMALATLVVFLLPRASPAAG  70

Query  400  --iiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
              I    +  L+  S        H S+R ALP    AR    G  G G+VP+G+ RK +R
Sbjct  71   SAIGAHLMVDLARRSTAAVGGGGHYSHRTALP----AR----GFVG-GKVPLGLKRKGLR  121

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+L
Sbjct  122  IVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLL  181

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYK+NPV
Sbjct  182  LEVDQIYHLACPASPVHYKFNPV  204



>ref|XP_010468914.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Camelina 
sativa]
 ref|XP_010468915.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Camelina 
sativa]
 ref|XP_010468916.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Camelina 
sativa]
Length=442

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 130/194 (67%), Gaps = 3/194 (2%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y PK +K    + R + YLLREQRL+F+LVGI I +  F + P  +  
Sbjct  8    RRHEADQPTADAYYPKPIKPWFMVTRPMRYLLREQRLIFVLVGIAIATLVFTLFPRPTQS  67

Query  427  sssspiprshsFHLSNREALPEYTPARS--SGYGAAGIGRVPVGIARKRMRIVITGGAGF  600
            +  S     +           +  P+    +  GA G G++P+G+ RK +R+V+TGGAGF
Sbjct  68   TPYSDPFSGYGIRTDESYVPAQRKPSLEYLNRIGATG-GKIPLGLKRKGLRVVVTGGAGF  126

Query  601  VGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHL  780
            VGSHLVD+LM RGD VIV+DNFFTGRKENVMHHF NP FELIRHDVVEPILLEVDQIYHL
Sbjct  127  VGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFSNPNFELIRHDVVEPILLEVDQIYHL  186

Query  781  AWPASPXHYKYNPV  822
            A PASP HYK+NPV
Sbjct  187  ACPASPVHYKFNPV  200



>ref|XP_009414893.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 132/195 (68%), Gaps = 12/195 (6%)
 Frame = +1

Query  253  DEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlss  432
            D   A++   YSP+  K    L R   YLLREQRLLF+LVG+ + S FF   P  +  SS
Sbjct  11   DGPPAEDGGEYSPRPEKRVVWLARPFRYLLREQRLLFVLVGMALVSVFFAFAPPSATPSS  70

Query  433  sspiprshsFHLSNREALPEYTPARSSGYGAA---GI--GRVPVGIARKRMRIVITGGAG  597
                       L    A     PA   GY  A   G    +VP+G+ RKR+R+V+TGGAG
Sbjct  71   YDS-------RLVVDRARQFSVPAVHGGYRTALERGFVGAKVPLGLKRKRLRVVVTGGAG  123

Query  598  FVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYH  777
            FVGSHLVD+L++RGD VIV+DNFFTGRKEN++HHFGNP FELIRHDVVEP+LLEVDQIYH
Sbjct  124  FVGSHLVDRLIERGDSVIVVDNFFTGRKENLVHHFGNPNFELIRHDVVEPLLLEVDQIYH  183

Query  778  LAWPASPXHYKYNPV  822
            LA PASP HYK+NPV
Sbjct  184  LACPASPVHYKFNPV  198



>ref|XP_008784747.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Phoenix 
dactylifera]
Length=443

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 138/207 (67%), Gaps = 23/207 (11%)
 Frame = +1

Query  244  YRRDEETAQNTPP-YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIG-----------  387
            YRR +   Q+ P  YSPK LK    L R + YLLREQRLLF+LVG+ +            
Sbjct  7    YRRHDPQPQDGPGGYSPKPLKRWWWLSRPLRYLLREQRLLFVLVGMALAYLVVAFLPRAP  66

Query  388  --STFFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIAR  561
              +   +    +  L+  S        + S+R ALP    AR    G  G G+VP+G+ R
Sbjct  67   PAAGSAVGAHLMVDLARRSAAAAGGGGYYSHRVALP----AR----GFVG-GKVPLGLKR  117

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            K +RIV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVV
Sbjct  118  KGLRIVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVV  177

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EP+LLEVDQIYHLA PASP HYK+NPV
Sbjct  178  EPLLLEVDQIYHLACPASPVHYKFNPV  204



>ref|XP_010523949.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Tarenaya hassleriana]
 ref|XP_010523950.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Tarenaya hassleriana]
Length=441

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 133/199 (67%), Gaps = 8/199 (4%)
 Frame = +1

Query  244  YRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslsh  423
            YRR E        Y PK +K    + R I Y+LREQRL+F+LVGI I +  F + P  + 
Sbjct  7    YRRHETDQPAAEAYYPKPIKPWFVVTRPIRYMLREQRLVFVLVGIAIATLGFTVFPRSTQ  66

Query  424  lsssspiprshsFHLSNREALPEYTPARSSGY------GAAGIGRVPVGIARKRMRIVIT  585
                +     +    S+   +  +   R          G+AG G++P+G+ RK +R+V+T
Sbjct  67   PIPYTDPLSGYGLG-SDSSYITAFQSQRKPSLEYLNRIGSAG-GKIPLGLKRKGLRVVVT  124

Query  586  GGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVD  765
            GGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVD
Sbjct  125  GGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVD  184

Query  766  QIYHLAWPASPXHYKYNPV  822
            QIYHLA PASP HYK+NPV
Sbjct  185  QIYHLACPASPVHYKFNPV  203



>gb|KDO71703.1| hypothetical protein CISIN_1g013226mg [Citrus sinensis]
Length=447

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 128/180 (71%), Gaps = 5/180 (3%)
 Frame = +1

Query  286  SPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlssssp-iprshsF  462
            SP+  K  +S    + Y+LR QRL+F+ +GI I S  F   P   H  ++   +  S + 
Sbjct  25   SPRPSKSVKSFRNPVQYVLRSQRLIFLFIGIAISSLIFSKLPVRQHQIANPAPLTTSETT  84

Query  463  HLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGD  642
            HLS R  L E    +    G    G+VP+G+ RK +RI++TGGAGFVGSHLVD+LM RGD
Sbjct  85   HLSRRRVLYEAAEVQHVNAG----GKVPLGLQRKSLRILVTGGAGFVGSHLVDRLMDRGD  140

Query  643  DVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
             VIV+DN+FTG+K+N++HHFGNPRFELIRHDVVEPILLEVDQIYHLA PASP HYK+NPV
Sbjct  141  SVIVVDNYFTGKKDNLIHHFGNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKFNPV  200



>ref|XP_009138714.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Brassica rapa]
Length=442

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 130/194 (67%), Gaps = 3/194 (2%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y P+  K   S  R + Y+LREQRL+F+LVGI I +  F I P  +  
Sbjct  8    RRHEADQAGADAYYPRPPKRWLSASRPMRYMLREQRLIFVLVGIAIATLAFTIFPRSTRS  67

Query  427  sssspiprshsFHLSNREALPEYTPARS--SGYGAAGIGRVPVGIARKRMRIVITGGAGF  600
             S S     +           +  P+    S  G+ G G++P+G+ RK +R+V+TGGAGF
Sbjct  68   ISYSDPFAGYGIKPEESHVPAQRRPSVEYVSRIGSTG-GKIPLGLKRKGLRVVVTGGAGF  126

Query  601  VGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHL  780
            VGSHLVD+LM+RGD VIV+DNFFTG KENVMHHFGNP FELIRHDVVEPILLEVDQIYHL
Sbjct  127  VGSHLVDRLMERGDTVIVVDNFFTGSKENVMHHFGNPNFELIRHDVVEPILLEVDQIYHL  186

Query  781  AWPASPXHYKYNPV  822
            A PASP HYK+NPV
Sbjct  187  ACPASPVHYKFNPV  200



>gb|KGN47434.1| hypothetical protein Csa_6G319800 [Cucumis sativus]
Length=241

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 126/188 (67%), Gaps = 11/188 (6%)
 Frame = +1

Query  274  TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprs  453
            TPP S    + P      I Y+LREQRLLF+ VGI I + FF +              R+
Sbjct  23   TPPSSSVKSRSP------IRYMLREQRLLFVFVGIAIATLFFNVVRFTFPPELRDDHHRA  76

Query  454  hsFHLSNREALPE----YTPARSSGYGAAGI-GRVPVGIARKRMRIVITGGAGFVGSHLV  618
             +  +     +P     Y   R    G   + GRVP G+ ++ +RIV+TGGAGFVGSHLV
Sbjct  77   FNSFVRLDSTIPMRRVLYETRREGPLGRVNLAGRVPPGLTKRNLRIVVTGGAGFVGSHLV  136

Query  619  DKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASP  798
            D+L++RGD VIV+DNFFTGRK+N++HHFGNPRFELIRHDVV+PILLEVDQIYHLA PASP
Sbjct  137  DRLIERGDSVIVVDNFFTGRKDNLVHHFGNPRFELIRHDVVQPILLEVDQIYHLACPASP  196

Query  799  XHYKYNPV  822
             HYK+NPV
Sbjct  197  VHYKFNPV  204



>ref|XP_006397963.1| hypothetical protein EUTSA_v10001451mg [Eutrema salsugineum]
 gb|ESQ39416.1| hypothetical protein EUTSA_v10001451mg [Eutrema salsugineum]
Length=440

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 133/203 (66%), Gaps = 21/203 (10%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            +R+E  A +  P  P  +       R I Y+LREQRL+F+LVGI I +  F +       
Sbjct  11   QREEAQAYHRKPTRPWFVA-----ARPIRYMLREQRLVFVLVGIAIATLGFAVFSRSPSR  65

Query  427  sssspiprshsFHLSNREALPEYTPARS-----------SGYGAAGIGRVPVGIARKRMR  573
                       + + + E+   Y PA             SG G+AG G++P+G+ RK +R
Sbjct  66   PIDHLSG----YGMRSSESSSSYMPAAETRKRGSIEYYRSGIGSAG-GKIPLGLKRKGLR  120

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            +V+TGGAGFVGSHLVD+LM RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+L
Sbjct  121  VVVTGGAGFVGSHLVDRLMARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLL  180

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYK+NPV
Sbjct  181  LEVDQIYHLACPASPVHYKFNPV  203



>ref|XP_009417727.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 127/186 (68%), Gaps = 13/186 (7%)
 Frame = +1

Query  283  YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsF  462
            YS K  K   SL R++ YLLREQRLLF+LVG+ +         +    +  + +  +  +
Sbjct  21   YSAKPEKRMLSLSRALRYLLREQRLLFLLVGMALAVLVLASARTSPAATRGARLMMADPW  80

Query  463  ------HLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDK  624
                  H  N  A  E T       G  G G+VP+G+ RK +RIV+TGGAGFVGSHLVD+
Sbjct  81   STAVHHHGHNHRAEFEVT------RGFVG-GKVPLGLKRKGLRIVVTGGAGFVGSHLVDR  133

Query  625  LMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXH  804
            LM RGD VIV+DNFFTGRK+NVMHHFGNP FELIRHDVVEP+LLEVDQIYHLA PASP H
Sbjct  134  LMARGDSVIVVDNFFTGRKQNVMHHFGNPNFELIRHDVVEPLLLEVDQIYHLACPASPVH  193

Query  805  YKYNPV  822
            YK+NPV
Sbjct  194  YKFNPV  199



>ref|XP_009388332.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like, partial 
[Musa acuminata subsp. malaccensis]
Length=302

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 131/191 (69%), Gaps = 17/191 (9%)
 Frame = +1

Query  283  YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsF  462
            Y+PK  K      R + YL+REQRL F+LVG+ + + FF + PS S  S SS      + 
Sbjct  23   YTPKPEKRLLWFSRPLRYLIREQRLAFLLVGMALATLFFALAPSSSPSSYSSAAAAELAL  82

Query  463  -----------HLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGS  609
                       H  +R A   +  A S G+     G+VP+GI RK +RIV+TGGAGFVGS
Sbjct  83   RSAMELARFGEHHRHRAA---FEAATSRGFVG---GKVPLGIKRKGLRIVVTGGAGFVGS  136

Query  610  HLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWP  789
            HLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVDQIYHLA P
Sbjct  137  HLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYHLACP  196

Query  790  ASPXHYKYNPV  822
            ASP HYK+NPV
Sbjct  197  ASPVHYKFNPV  207



>ref|XP_006291142.1| hypothetical protein CARUB_v10017258mg [Capsella rubella]
 gb|EOA24040.1| hypothetical protein CARUB_v10017258mg [Capsella rubella]
Length=442

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 130/199 (65%), Gaps = 13/199 (7%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y PK +K      R + Y+LREQRL+F+LVGI I +  F I P  +  
Sbjct  8    RRHEADQPTADAYYPKPIKPWFMATRPMRYMLREQRLIFVLVGIAIATLVFTIFPRSTQS  67

Query  427  sssspiprshsFHLSNREALPEYTPARS-------SGYGAAGIGRVPVGIARKRMRIVIT  585
            S  S       F       +  Y PA         +  GA G G++P+G+ RK +R+V+T
Sbjct  68   SPYSDP-----FSGYGIRPVESYVPAHRKPSLEYLNRIGATG-GKIPLGLKRKGLRVVVT  121

Query  586  GGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVD  765
            GGAGFVGSHLVD+LM RGD VIV+DNFFTGRKENVMHHF NP FELIRHDVVEPILLEVD
Sbjct  122  GGAGFVGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFSNPNFELIRHDVVEPILLEVD  181

Query  766  QIYHLAWPASPXHYKYNPV  822
            QIYHLA PASP HYK+NPV
Sbjct  182  QIYHLACPASPVHYKFNPV  200



>ref|NP_191842.1| UDP-glucuronic acid decarboxylase [Arabidopsis thaliana]
 ref|NP_001118893.1| UDP-glucuronic acid decarboxylase [Arabidopsis thaliana]
 sp|Q9LZI2.1|UXS2_ARATH RecName: Full=UDP-glucuronic acid decarboxylase 2; AltName: Full=UDP-XYL 
synthase 2; AltName: Full=UDP-glucuronate decarboxylase 
2; Short=UGD; Short=UXS-2; AltName: Full=dTDP-glucose 
4-6-dehydratase homolog D18 [Arabidopsis thaliana]
 emb|CAB83133.1| dTDP-glucose 4-6-dehydratase homolog D18 [Arabidopsis thaliana]
 gb|AAN28836.1| At3g62830/F26K9_260 [Arabidopsis thaliana]
 gb|AEE80398.1| UDP-glucuronic acid decarboxylase [Arabidopsis thaliana]
 gb|AEE80399.1| UDP-glucuronic acid decarboxylase [Arabidopsis thaliana]
Length=445

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 131/198 (66%), Gaps = 8/198 (4%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y PK +K   ++ R + Y+LREQRL+F+LVGI I +  F I P  +  
Sbjct  8    RRHETDQPTADAYYPKPIKPWFTVTRPMRYMLREQRLIFVLVGIAIATLVFTIFPRSTQS  67

Query  427  sssspiprshsFHLSNREALPEYTPARSSGY------GAAGIGRVPVGIARKRMRIVITG  588
            +  S     +     +   +P     R          GA G G++P+G+ RK +R+V+TG
Sbjct  68   TPYSDPFSGYGIR-PDESYVPAIQAQRKPSLEYLNRIGATG-GKIPLGLKRKGLRVVVTG  125

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+LM RGD VIV+DNFFTGRKENVMHHF NP FE+IRHDVVEPILLEVDQ
Sbjct  126  GAGFVGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFSNPNFEMIRHDVVEPILLEVDQ  185

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  186  IYHLACPASPVHYKFNPV  203



>ref|XP_001769957.1| predicted protein [Physcomitrella patens]
 gb|EDQ65133.1| predicted protein [Physcomitrella patens]
Length=524

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 142/207 (69%), Gaps = 13/207 (6%)
 Frame = +1

Query  235  SVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp-  411
            ++N+RR  E +     Y+PK  K   SL RS  Y+LREQR +F+L+G+ I + FF+    
Sbjct  5    NLNHRR-VEVSPGDEKYTPKPQKQ-WSLARSAEYVLREQRFVFVLIGVAITTLFFLFLQP  62

Query  412  ----slshlsssspiprshsFHLSNREALPEYTPARSSGYG------AAGIGRVPVGIAR  561
                  ++++S +       F++ +      ++   +S Y         G G++P+G+ R
Sbjct  63   EFRFMRTYVNSGAIGGVDGGFNVKDSLGETRFSGNGNSPYKQHAAVITGGAGKIPLGLPR  122

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            K +RIV+TGGAGFVGSHLVD+L++RGD VIV+DNFFTGRKENV HHFGNPRFELIRHDVV
Sbjct  123  KPLRIVVTGGAGFVGSHLVDRLIERGDSVIVVDNFFTGRKENVQHHFGNPRFELIRHDVV  182

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EP+LLEVDQIYHLA PASP HYK+NP+
Sbjct  183  EPLLLEVDQIYHLACPASPVHYKFNPI  209



>gb|AAK32785.1|AF361617_1 AT3g62830/F26K9_260 [Arabidopsis thaliana]
 gb|AAK70881.1|AF387788_1 UDP-glucuronic acid decarboxylase [Arabidopsis thaliana]
 emb|CAA89205.1| homolog of dTDP-glucose 4-6-dehydratases [Arabidopsis thaliana]
 prf||2124427B diamide resistance gene
Length=445

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 131/198 (66%), Gaps = 8/198 (4%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y PK +K   ++ R + Y+LREQRL+F+LVGI I +  F I P  +  
Sbjct  8    RRHETDQPTADAYYPKPIKPWFTVTRPMRYMLREQRLIFVLVGIAIATLVFTIFPRSTQS  67

Query  427  sssspiprshsFHLSNREALPEYTPARSSGY------GAAGIGRVPVGIARKRMRIVITG  588
            +  S     +     +   +P     R          GA G G++P+G+ RK +R+V+TG
Sbjct  68   TPYSDPFSGYGIR-PDESYVPAIQAQRKPSLEYLNRIGATG-GKIPLGLKRKGLRVVVTG  125

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+LM RGD VIV+DNFFTGRKENVMHHF NP FE+IRHDVVEPILLEVDQ
Sbjct  126  GAGFVGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFSNPNFEMIRHDVVEPILLEVDQ  185

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  186  IYHLACPASPVHYKFNPV  203



>ref|XP_010922431.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Elaeis guineensis]
 ref|XP_010922432.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Elaeis guineensis]
Length=417

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 138/203 (68%), Gaps = 16/203 (8%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSI-NYLLREQRLLFILVGILIGST  393
            +LHK +S+  ++   T  ++P YS K  +   S   +  +YLLRE+RLLFIL+G  + S 
Sbjct  3    QLHKLSSLGQQQPIPT--HSPTYSVKAARQLNSRSSAAASYLLREKRLLFILIGAALASF  60

Query  394  FFiiqpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMR  573
            FF++QP LS      P       HL     LP  T        A+   R PVG+ R  +R
Sbjct  61   FFLLQPYLSSSDRILPTSDVPHRHL-----LPVST--------ASAGRRFPVGLRRPPLR  107

Query  574  IVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPIL  753
            IV+TGGAGFVGSHLVDKL+ RGD VIVIDNFFTGRKENV+HHF NPRFELIRHDVVEPIL
Sbjct  108  IVVTGGAGFVGSHLVDKLLARGDSVIVIDNFFTGRKENVVHHFQNPRFELIRHDVVEPIL  167

Query  754  LEVDQIYHLAWPASPXHYKYNPV  822
            LEVDQIYHLA PASP HYKYNPV
Sbjct  168  LEVDQIYHLACPASPVHYKYNPV  190



>gb|KFK35463.1| hypothetical protein AALP_AA5G287200 [Arabis alpina]
Length=437

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 129/195 (66%), Gaps = 5/195 (3%)
 Frame = +1

Query  238  VNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpsl  417
            +N R + +       Y PK +K    + R + Y+LREQRLLF+  GI I +  F + P  
Sbjct  6    INRRHESDQHTTESSYYPKPIKPWFFVTRPMRYMLREQRLLFVFFGIAIATLVFTLFPRS  65

Query  418  shlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAG  597
            +          S      N E+       R+    A   G++P+G+ RK +R+V+TGGAG
Sbjct  66   TQSIDPFSGYDSPYQRKPNLESY-----HRNQIGAAVTGGKIPLGLKRKVLRVVVTGGAG  120

Query  598  FVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYH  777
            FVGSHLVD+LM RGD+VIV+DNFFTGRKEN+MHHFGNP FE+IRHDVVEPILLEVDQIYH
Sbjct  121  FVGSHLVDRLMARGDNVIVVDNFFTGRKENLMHHFGNPNFEMIRHDVVEPILLEVDQIYH  180

Query  778  LAWPASPXHYKYNPV  822
            LA PASP HYK+NPV
Sbjct  181  LACPASPVHYKFNPV  195



>ref|NP_001189772.1| UDP-xylose synthase 4 [Arabidopsis thaliana]
 dbj|BAH56912.1| AT2G47650 [Arabidopsis thaliana]
 gb|AEC10872.1| UDP-xylose synthase 4 [Arabidopsis thaliana]
Length=449

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 134/206 (65%), Gaps = 12/206 (6%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            + +  RR E        Y PK +K      R I Y+LREQRL+F+LVGI I +  F I  
Sbjct  3    SELTNRRHEIEQPEAESYYPKPIKPWFVAIRPIRYMLREQRLVFVLVGIAIATLGFTIFS  62

Query  412  slshlsssspiprshsFHLSNREALPEYTPAR---------SSGYGAAGIGRVPVGIARK  564
              S+           S +    E+   Y PA           S  G+AG G++P+G+ RK
Sbjct  63   KSSNHQPIPYDVDPLSGYGMRSES--SYLPATIHKKPSIEYMSRIGSAG-GKIPLGLKRK  119

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
             +R+V+TGGAGFVGSHLVD+LM RGD+VIV+DNFFTGRKENVMHHF NP FE+IRHDVVE
Sbjct  120  VLRVVVTGGAGFVGSHLVDRLMARGDNVIVVDNFFTGRKENVMHHFNNPNFEMIRHDVVE  179

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYK+NPV
Sbjct  180  PILLEVDQIYHLACPASPVHYKFNPV  205



>ref|XP_006489058.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Citrus sinensis]
Length=447

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 128/180 (71%), Gaps = 5/180 (3%)
 Frame = +1

Query  286  SPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsss-spiprshsF  462
            SP+  K  +S    + Y+LR QRL+F+ +GI I S  F   P   H  ++ + +  S + 
Sbjct  25   SPRPSKSVKSFRNPVQYMLRSQRLIFLFIGIAISSLIFSKLPLRQHQIANPALLTTSETT  84

Query  463  HLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGD  642
             LS R  L E    +    G    G+VP+G+ RK +RI++TGGAGFVGSHLVD+LM RGD
Sbjct  85   QLSRRRVLYEAAEVQHVNAG----GKVPLGLQRKSLRILVTGGAGFVGSHLVDRLMDRGD  140

Query  643  DVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
             VIV+DN+FTG+K+N++HHFGNPRFELIRHDVVEPILLEVDQIYHLA PASP HYK+NPV
Sbjct  141  SVIVVDNYFTGKKDNLIHHFGNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKFNPV  200



>ref|NP_182287.1| UDP-xylose synthase 4 [Arabidopsis thaliana]
 sp|Q8S8T4.1|UXS4_ARATH RecName: Full=UDP-glucuronic acid decarboxylase 4; AltName: Full=UDP-XYL 
synthase 4; AltName: Full=UDP-glucuronate decarboxylase 
4; Short=UGD; Short=UXS-4 [Arabidopsis thaliana]
 gb|AAM14846.1| putative dTDP-glucose 4-6-dehydratase [Arabidopsis thaliana]
 gb|AAY25428.1| At2g47650 [Arabidopsis thaliana]
 dbj|BAH19459.1| AT2G47650 [Arabidopsis thaliana]
 gb|AEC10871.1| UDP-xylose synthase 4 [Arabidopsis thaliana]
Length=443

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 134/206 (65%), Gaps = 12/206 (6%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            + +  RR E        Y PK +K      R I Y+LREQRL+F+LVGI I +  F I  
Sbjct  3    SELTNRRHEIEQPEAESYYPKPIKPWFVAIRPIRYMLREQRLVFVLVGIAIATLGFTIFS  62

Query  412  slshlsssspiprshsFHLSNREALPEYTPAR---------SSGYGAAGIGRVPVGIARK  564
              S+           S +    E+   Y PA           S  G+AG G++P+G+ RK
Sbjct  63   KSSNHQPIPYDVDPLSGYGMRSES--SYLPATIHKKPSIEYMSRIGSAG-GKIPLGLKRK  119

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
             +R+V+TGGAGFVGSHLVD+LM RGD+VIV+DNFFTGRKENVMHHF NP FE+IRHDVVE
Sbjct  120  VLRVVVTGGAGFVGSHLVDRLMARGDNVIVVDNFFTGRKENVMHHFNNPNFEMIRHDVVE  179

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYK+NPV
Sbjct  180  PILLEVDQIYHLACPASPVHYKFNPV  205



>ref|XP_009624356.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Nicotiana 
tomentosiformis]
Length=433

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 130/195 (67%), Gaps = 28/195 (14%)
 Frame = +1

Query  283  YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsF  462
            Y+PK  K   S+ R + YLLREQR++F+ VGI I S  F + PS    S           
Sbjct  19   YTPKPDKPWLSVIRPVRYLLREQRIVFLFVGIAIASLIFALLPSSRSGSL----------  68

Query  463  HLSNREALPEYTPARSS--------------GYGAAGIG-RVPVGIARKRMRIVITGGAG  597
               N      Y P+ S+              G+G+   G ++P+G+ RK +RIV+TGGAG
Sbjct  69   ---NYAIYDSYLPSESTQSQVAHRMIYQNRPGFGSFNSGGKIPLGLQRKGLRIVVTGGAG  125

Query  598  FVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYH  777
            FVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIYH
Sbjct  126  FVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIYH  185

Query  778  LAWPASPXHYKYNPV  822
            LA PASP HYK+NPV
Sbjct  186  LACPASPVHYKHNPV  200



>ref|XP_002268787.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Vitis vinifera]
Length=444

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 133/196 (68%), Gaps = 5/196 (3%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET      YSPK  K   S+ R I Y+LREQRLLF LVGI I +  F++ PS     
Sbjct  8    RGHETQPMADGYSPKPPKPWLSVVRPIRYMLREQRLLFTLVGIAIATVVFLLLPSSPAPY  67

Query  430  ssspiprshsFHLSNREALPEYTPARSSGYGAAGIG-----RVPVGIARKRMRIVITGGA  594
            +    P S S+  S       +  A +   G          +VP+G+ RK +RIV+TGGA
Sbjct  68   THRFDPISDSYFPSETTTQLAHRVAYAGHGGGGFGFVNSGGKVPLGLKRKGLRIVVTGGA  127

Query  595  GFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIY  774
            GFVGSHLVD+L++RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIY
Sbjct  128  GFVGSHLVDRLIRRGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIY  187

Query  775  HLAWPASPXHYKYNPV  822
            HLA PASP HYK+NPV
Sbjct  188  HLACPASPVHYKFNPV  203



>ref|XP_008789000.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like isoform X2 
[Phoenix dactylifera]
Length=414

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 146/211 (69%), Gaps = 9/211 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKH-PRS---LPRSINYLLREQRLLFILVGILI  384
            +LHKQ S+N +    T  +TP YS K+ K   RS   L  + +YLLREQRLLF+L G++I
Sbjct  3    QLHKQPSLNQQHQIPTHTHTPSYSSKSAKQQTRSSSFLRSAASYLLREQRLLFVLAGVII  62

Query  385  GSTFFiiqpslshlsssspiprshs----FHLSNRE-ALPEYTPARSSGYGAAGIGRVPV  549
             STFF++ P      S      S      F  S R  +L   +  ++S  G  G  RVPV
Sbjct  63   ASTFFLLSPYYHSSLSRLSSSSSDEGPHRFLPSFRHPSLDRSSTTKASVAGGGGGRRVPV  122

Query  550  GIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIR  729
            G+ +  +RIV+TGGAGFVGSHLVDKL+ RGD VIV+DNFFTGRK+N++ HFGNPRFELIR
Sbjct  123  GLRKPALRIVVTGGAGFVGSHLVDKLLARGDSVIVLDNFFTGRKDNLVRHFGNPRFELIR  182

Query  730  HDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            HDVVEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  183  HDVVEPILLEVDQIYHLACPASPVHYKYNPI  213



>ref|XP_010931658.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Elaeis guineensis]
Length=427

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 130/205 (63%), Gaps = 15/205 (7%)
 Frame = +1

Query  229  QASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiq  408
            Q+ + YR  E   +    YSPK  K    +PR + YLLREQRLLF+L+G+ + +  F I 
Sbjct  3    QSELIYRGHESQHKPDGAYSPKPEKRWLDVPRLVRYLLREQRLLFVLLGMALAAVLFSIP  62

Query  409  psl-------shlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKR  567
                      +           H  H   ++        R S   A   G+VP+G+ ++ 
Sbjct  63   HPSFRHPPPLAGGIGGGAAGLVHPHHHGGQQ--------RWSERAATAGGKVPLGLRKRG  114

Query  568  MRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEP  747
             R+V+TGGAGFVGSHLVDKLM RGD VIV+DNFFTGRKENVMHH GNP FELIRHDVVEP
Sbjct  115  RRVVVTGGAGFVGSHLVDKLMARGDTVIVVDNFFTGRKENVMHHLGNPNFELIRHDVVEP  174

Query  748  ILLEVDQIYHLAWPASPXHYKYNPV  822
            +LLEVDQIYHLA PASP HYK+NPV
Sbjct  175  LLLEVDQIYHLACPASPVHYKFNPV  199



>ref|XP_008788999.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like isoform X1 
[Phoenix dactylifera]
Length=439

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 146/211 (69%), Gaps = 9/211 (4%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKH-PRS---LPRSINYLLREQRLLFILVGILI  384
            +LHKQ S+N +    T  +TP YS K+ K   RS   L  + +YLLREQRLLF+L G++I
Sbjct  3    QLHKQPSLNQQHQIPTHTHTPSYSSKSAKQQTRSSSFLRSAASYLLREQRLLFVLAGVII  62

Query  385  GSTFFiiqpslshlsssspiprshs----FHLSNRE-ALPEYTPARSSGYGAAGIGRVPV  549
             STFF++ P      S      S      F  S R  +L   +  ++S  G  G  RVPV
Sbjct  63   ASTFFLLSPYYHSSLSRLSSSSSDEGPHRFLPSFRHPSLDRSSTTKASVAGGGGGRRVPV  122

Query  550  GIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIR  729
            G+ +  +RIV+TGGAGFVGSHLVDKL+ RGD VIV+DNFFTGRK+N++ HFGNPRFELIR
Sbjct  123  GLRKPALRIVVTGGAGFVGSHLVDKLLARGDSVIVLDNFFTGRKDNLVRHFGNPRFELIR  182

Query  730  HDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            HDVVEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  183  HDVVEPILLEVDQIYHLACPASPVHYKYNPI  213



>ref|XP_002876692.1| UDP-glucuronic acid decarboxylase 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52951.1| UDP-glucuronic acid decarboxylase 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=445

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 131/198 (66%), Gaps = 8/198 (4%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            RR E        Y PK +K    + R + Y+LREQRL+F+LVGI I +  F I P  +  
Sbjct  8    RRHEADQPIADAYYPKPIKPWFMVTRPMRYMLREQRLIFVLVGIAIATLVFTIFPRSTQS  67

Query  427  sssspiprshsFHLSNREALPEYTPARSSGY------GAAGIGRVPVGIARKRMRIVITG  588
            S+ S     +     +   +P     R          GA G G++P+G+ RK +R+V+TG
Sbjct  68   SAYSDPFSGYGIR-PDESYVPAIQAQRKPSLEYLNRIGATG-GKIPLGLKRKGLRVVVTG  125

Query  589  GAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQ  768
            GAGFVGSHLVD+LM RGD VIV+DNFFTGRKENVMHHF NP FELIRHDVVEPILLEVDQ
Sbjct  126  GAGFVGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFSNPNFELIRHDVVEPILLEVDQ  185

Query  769  IYHLAWPASPXHYKYNPV  822
            IYHLA PASP HYK+NPV
Sbjct  186  IYHLACPASPVHYKFNPV  203



>ref|XP_004247418.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Solanum lycopersicum]
Length=440

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 134/206 (65%), Gaps = 24/206 (12%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  E+   T  Y+PK  K   ++ R + YLLREQR++F+  GI I S  F   PS     
Sbjct  8    RGPESVPVTDGYTPKPHKPWFTVIRPLRYLLREQRIVFLFAGIAIASLIFAFLPSSRSSG  67

Query  430  ssspiprshsFHLSNREALPEYTPARSS--------------GYGAAGI-GRVPVGIARK  564
             SS          +N      Y P+ S+              G+G+    G++P+G+ RK
Sbjct  68   GSS---------YANTGIYDSYLPSESTESQVAHRMIYHNRVGFGSINSGGKIPLGLKRK  118

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
             +RIV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVE
Sbjct  119  VLRIVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVE  178

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            P+LLEVDQIYHLA PASP HYK+NPV
Sbjct  179  PLLLEVDQIYHLACPASPVHYKHNPV  204



>ref|XP_008783601.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Phoenix 
dactylifera]
Length=417

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 124/166 (75%), Gaps = 13/166 (8%)
 Frame = +1

Query  325  SINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsFHLSNREALPEYTPA  504
            + +YLLREQRLLF+LVG  + S FF++QP LS      P        + +R+ LP    A
Sbjct  38   AASYLLREQRLLFVLVGAALASCFFLLQPYLSSSDRLLPTS-----DVPHRDLLP--VSA  90

Query  505  RSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKE  684
             S+G       R+PVG+ R  +RIV+TGGAGFVGSHLVDKL+ RGD VIVIDNFFTGRKE
Sbjct  91   ASAGR------RMPVGLRRPPLRIVVTGGAGFVGSHLVDKLLARGDSVIVIDNFFTGRKE  144

Query  685  NVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            NV+HHF NPRFELIRHDVVEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  145  NVVHHFHNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPI  190



>ref|XP_006359374.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Solanum 
tuberosum]
Length=439

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 130/195 (67%), Gaps = 25/195 (13%)
 Frame = +1

Query  283  YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsF  462
            Y+PK  K   ++ R + YLLREQR++F+  GI I S  F   PS     S          
Sbjct  19   YTPKPHKPWFTVIRPLRYLLREQRIVFLFAGIAIASLIFAFLPSSRSGGS----------  68

Query  463  HLSNREALPEYTPARSS--------------GYGAAGIG-RVPVGIARKRMRIVITGGAG  597
            + +N      Y P+ S+              G+G+   G ++P+G+ RK +RIV+TGGAG
Sbjct  69   NYANTGIYDSYLPSESTQSQVAHRIIYQNRVGFGSFNSGGKIPLGLQRKSLRIVVTGGAG  128

Query  598  FVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYH  777
            FVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIYH
Sbjct  129  FVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIYH  188

Query  778  LAWPASPXHYKYNPV  822
            LA PASP HYK+NPV
Sbjct  189  LACPASPVHYKHNPV  203



>emb|CDO98854.1| unnamed protein product [Coffea canephora]
Length=212

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 127/176 (72%), Gaps = 15/176 (9%)
 Frame = +1

Query  328  INYLLREQRLLFILVGILIGSTFFiiqpslshlssssp---------iprshsFHLSNRE  480
            I Y+L EQRL+ +L+GI I S  F   P+L+  SSSS               + H+  R 
Sbjct  32   IQYVLEEQRLVCLLIGIGIASLIFTAVPALTSSSSSSTPNHHGWIPDSLTESTHHVPRRI  91

Query  481  AL--PEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIV  654
            AL   +Y   +SS     G+ R+PVG+  KR+R+++TGGAGFVGSHLVD+LM+RGD VIV
Sbjct  92   ALELSDYDRDQSSN----GVARLPVGLKNKRLRVLVTGGAGFVGSHLVDRLMERGDSVIV  147

Query  655  IDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            +DNFFTGRK+N++HHF NPRFELIRHDVVEPI+LEVDQIYHLA PASP HYKYNPV
Sbjct  148  VDNFFTGRKDNLVHHFSNPRFELIRHDVVEPIMLEVDQIYHLACPASPVHYKYNPV  203



>ref|XP_004150505.2| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Cucumis 
sativus]
Length=314

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 126/188 (67%), Gaps = 11/188 (6%)
 Frame = +1

Query  274  TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprs  453
            TPP S    + P      I Y+LREQRLLF+ VGI I + FF +              R+
Sbjct  23   TPPSSSVKSRSP------IRYMLREQRLLFVFVGIAIATLFFNVVRFTFPPELRDDHHRA  76

Query  454  hsFHLSNREALPE----YTPARSSGYGAAGI-GRVPVGIARKRMRIVITGGAGFVGSHLV  618
             +  +     +P     Y   R    G   + GRVP G+ ++ +RIV+TGGAGFVGSHLV
Sbjct  77   FNSFVRLDSTIPMRRVLYETRREGPLGRVNLAGRVPPGLTKRNLRIVVTGGAGFVGSHLV  136

Query  619  DKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASP  798
            D+L++RGD VIV+DNFFTGRK+N++HHFGNPRFELIRHDVV+PILLEVDQIYHLA PASP
Sbjct  137  DRLIERGDSVIVVDNFFTGRKDNLVHHFGNPRFELIRHDVVQPILLEVDQIYHLACPASP  196

Query  799  XHYKYNPV  822
             HYK+NPV
Sbjct  197  VHYKFNPV  204



>ref|XP_010507865.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Camelina 
sativa]
Length=438

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 127/184 (69%), Gaps = 9/184 (5%)
 Frame = +1

Query  283  YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsss----spipr  450
            Y P+ +K      R I Y+LREQRL+F+LVGI I +  F +    S              
Sbjct  22   YYPRPIKPWFVAIRPIRYMLREQRLVFVLVGIAIATLAFTLFSKSSSSPIQPIPYENADP  81

Query  451  shsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLM  630
               + + + +   EYT    S  G AG G++P+G+ RK +R+V+TGGAGFVGSHLVD+L+
Sbjct  82   LAGYGMRSYQPTIEYT----SRIGLAG-GKIPLGLKRKVLRVVVTGGAGFVGSHLVDRLI  136

Query  631  KRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYK  810
             RGD+VIV+DNFFTGRKENVMHHF NP FELIRHDVVEPILLEVDQIYHLA PASP HYK
Sbjct  137  ARGDNVIVVDNFFTGRKENVMHHFSNPNFELIRHDVVEPILLEVDQIYHLACPASPVHYK  196

Query  811  YNPV  822
            +NPV
Sbjct  197  FNPV  200



>ref|XP_008458422.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Cucumis 
melo]
Length=448

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 130/197 (66%), Gaps = 14/197 (7%)
 Frame = +1

Query  268  QNTPPYSPKTLKHPRSLPRS-------INYLLREQRLLFILVGILIGSTFFiiqpslshl  426
            Q+ P  SP  +  PR+ P S       I Y+LREQRLLF+ VGI I + FF +       
Sbjct  11   QSNP--SPAVIDSPRTPPCSSCKTRSPIRYMLREQRLLFVFVGIAIATLFFNVVRFTFPP  68

Query  427  sssspiprshsFHLSNREALPE----YTPARSSGYGAAGI-GRVPVGIARKRMRIVITGG  591
                   R+ +  +     +P     Y   R    G   + GRVP G+  K +RIV+TGG
Sbjct  69   ELRDDHHRALNSFVRLGSTIPMRRVLYETRREGSLGRVNLAGRVPPGLKNKNLRIVVTGG  128

Query  592  AGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQI  771
            AGFVGSHLVD+L++RGD VIV+DNFFTGRK+N++HHFGNPRFELIRHDVV+PILLEVDQI
Sbjct  129  AGFVGSHLVDRLIERGDSVIVVDNFFTGRKDNLVHHFGNPRFELIRHDVVQPILLEVDQI  188

Query  772  YHLAWPASPXHYKYNPV  822
            YHLA PASP HYK+NPV
Sbjct  189  YHLACPASPVHYKFNPV  205



>gb|KHG12543.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum]
Length=445

 Score =   192 bits (487),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 128/213 (60%), Gaps = 16/213 (8%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHP-RSLPRSINYLLREQRLLFILVGILIGSTFFiiq  408
            AS    R++ T Q++P  SP T   P R+      Y+ ++QR  F+LVGI I + FF   
Sbjct  2    ASELIHRNQTTPQSSPNISPGTPSSPVRNWKTPFRYVAQKQRFFFVLVGIAIAALFFNSF  61

Query  409  pslshlsssspiprshsFHL---------------SNREALPEYTPARSSGYGAAGIGRV  543
            P  +                                 R  L E       G   A  G+V
Sbjct  62   PVSTSSLFQELSGGGGGGSGLIAGSVSGLGAESSEVTRRVLYEAYTEGFRGRNVAATGKV  121

Query  544  PVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFEL  723
            P+G+ +K +RIV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKEN+MHHFGNP+FEL
Sbjct  122  PLGLKKKNLRIVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENLMHHFGNPKFEL  181

Query  724  IRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            IRHDVVEPILLEVDQIYHLA PASP HYK+NP 
Sbjct  182  IRHDVVEPILLEVDQIYHLACPASPVHYKFNPT  214



>ref|XP_009133822.1| PREDICTED: UDP-glucuronic acid decarboxylase 4 [Brassica rapa]
Length=438

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 136/201 (68%), Gaps = 8/201 (4%)
 Frame = +1

Query  223  HKQASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFi  402
            +++  +   + E  A N  P  P  +    S+   I+Y+LREQRLLF+LVGI I +  F 
Sbjct  7    YRRHEMEVEQPEAQALNRKPIKPWFV----SIRPVISYMLREQRLLFVLVGIAIATLAFT  62

Query  403  iqpslshlsssspiprshsFHLS-NREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIV  579
            I    S+    +         LS  R++  EY    + G   +  G++P+G+ RK +R+V
Sbjct  63   ILSPSSNQPIPNYSDPISGSSLSVQRKSSIEYI---TGGGMGSVGGKIPLGLKRKGLRVV  119

Query  580  ITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLE  759
            +TGGAGFVGSHLVD+LM RGD+VIV+DNFFTG KENVMHHFGNP FELIRHDVVEPILLE
Sbjct  120  VTGGAGFVGSHLVDRLMARGDNVIVVDNFFTGSKENVMHHFGNPNFELIRHDVVEPILLE  179

Query  760  VDQIYHLAWPASPXHYKYNPV  822
            VDQIYHLA PASP HYK+NPV
Sbjct  180  VDQIYHLACPASPVHYKFNPV  200



>ref|XP_007163114.1| hypothetical protein PHAVU_001G207400g [Phaseolus vulgaris]
 gb|ESW35108.1| hypothetical protein PHAVU_001G207400g [Phaseolus vulgaris]
Length=392

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 117/166 (70%), Gaps = 1/166 (1%)
 Frame = +1

Query  328  INYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsFHLSNRE-ALPEYTPA  504
            + Y+LREQRL F+ +G+L+ S FF      S            +  L+  +  L   T  
Sbjct  30   LRYILREQRLHFLFLGVLLASVFFFFLLPSSSSPPVRAHDPFPASFLARDDLTLWPTTNT  89

Query  505  RSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKE  684
            RS       +G++P+GI RK +R+V+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKE
Sbjct  90   RSYDVAVHSVGKIPLGIKRKGLRVVVTGGAGFVGSHLVDRLISRGDSVIVVDNFFTGRKE  149

Query  685  NVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            NVMHHFGNP FEL+RHDVVEP+LLEVDQIYHLA PASP HYK+NP 
Sbjct  150  NVMHHFGNPNFELLRHDVVEPLLLEVDQIYHLACPASPVHYKFNPT  195



>ref|XP_009352283.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Pyrus x 
bretschneideri]
Length=445

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 128/210 (61%), Gaps = 39/210 (19%)
 Frame = +1

Query  256  EETAQNTPPYSPKTL-KHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlss  432
            +   Q+ P   P+T  K P S    I Y+LREQR +F+L+G+ I   FF           
Sbjct  19   QNDDQSQPVLEPQTNHKPPHSSANPIRYMLREQRFIFVLIGVAIAVFFFTT---------  69

Query  433  sspiprshsFHLSNREALPEYTPARSSGYGAA--GI------------------GRVPVG  552
                     F  SN      + P   SG G+   GI                  G+VP+G
Sbjct  70   ---------FLASNPLLESVHDPGLESGLGSDKPGIDLPANPIRRVLLETRNVGGKVPLG  120

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            + +K MRI++TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKEN+ HHFGNP+FELIRH
Sbjct  121  VRKKNMRIIVTGGAGFVGSHLVDRLIARGDSVIVLDNFFTGRKENLAHHFGNPKFELIRH  180

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEPILLEVDQIYHLA PASP HYK+NPV
Sbjct  181  DVVEPILLEVDQIYHLACPASPVHYKFNPV  210



>ref|XP_009779106.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Nicotiana sylvestris]
Length=446

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 141/210 (67%), Gaps = 14/210 (7%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFi---  402
            AS  + R +ET      Y+PK  K  +++ R + Y+L+E+RL+F+  GI I S  F    
Sbjct  2    ASELFFRGQETHHIINAYTPKPRKPWQNVIRPVRYMLKEKRLVFLFAGIAIASLIFALLP  61

Query  403  -iqpslshlsssspiprshsFHLSNREALPEYTPARS--------SGYGAA-GIGRVPVG  552
              +      + S      +  HL + E+   ++ AR+        +G G+    G++P+G
Sbjct  62   SSRAPSGQGTYSYVNNAIYDSHLPS-ESTQSHSIARAHRIIYQNRAGIGSLHSGGKIPLG  120

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            + RK +RI++TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRH
Sbjct  121  LQRKGLRILVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRH  180

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEP+L+EVDQIYHLA PASP HYK+NPV
Sbjct  181  DVVEPLLVEVDQIYHLACPASPVHYKHNPV  210



>ref|XP_008390646.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Malus domestica]
Length=445

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 127/206 (62%), Gaps = 39/206 (19%)
 Frame = +1

Query  268  QNTPPYSPKTL-KHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspi  444
            Q+ P   P+T  K P S    I Y+LREQR +F+L+G+ I   FF               
Sbjct  23   QSXPFLEPQTNHKPPHSSTNPIRYMLREQRFIFVLIGVAIAVFFFTT-------------  69

Query  445  prshsFHLSNREALPEYTPARSSGYGAA--GI------------------GRVPVGIARK  564
                 F  SN      + P   SG G+   GI                  G+VP+G+ +K
Sbjct  70   -----FLASNPLLESVHDPGLESGLGSDRPGIDLPANPTRRVLLETWNVGGKVPLGVRKK  124

Query  565  RMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVE  744
             MRIV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKEN+ HHFGNP+FELIRHDVVE
Sbjct  125  NMRIVVTGGAGFVGSHLVDRLIARGDSVIVLDNFFTGRKENLAHHFGNPKFELIRHDVVE  184

Query  745  PILLEVDQIYHLAWPASPXHYKYNPV  822
            PILLEVDQIYHLA PASP HYK+NPV
Sbjct  185  PILLEVDQIYHLACPASPVHYKFNPV  210



>ref|XP_009104397.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Brassica 
rapa]
Length=433

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 130/197 (66%), Gaps = 15/197 (8%)
 Frame = +1

Query  247  RRDEETAQNTPPYSPKTLK-HPRSLPRSINYLLREQRLLFILVGILIGSTFFi----iqp  411
            RR E    +   Y P+ +K    ++ R + Y+LREQRLLF+LVGI I +  F       P
Sbjct  8    RRHEAGQPHADAYYPRPIKPWSSTVTRPMRYMLREQRLLFVLVGIAIATLVFTIFPRSTP  67

Query  412  slshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGG  591
                 S     P   SF    R +L           GA G G++P+G+ RK +R+V+TGG
Sbjct  68   YSDPFSGYGIRPDDESFQAQRRPSLL---------MGATG-GKIPLGLKRKGLRVVVTGG  117

Query  592  AGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQI  771
            AGFVGS LVD+LM RGD VIV+DNFFTGRKENVMHHFG+P FELIRHDVVEPILLEVDQI
Sbjct  118  AGFVGSQLVDRLMVRGDTVIVVDNFFTGRKENVMHHFGSPNFELIRHDVVEPILLEVDQI  177

Query  772  YHLAWPASPXHYKYNPV  822
            YHLA PASP HYK+NPV
Sbjct  178  YHLACPASPVHYKFNPV  194



>gb|AAT40109.1| putative UDP-glucuronate decarboxylase 3 [Nicotiana tabacum]
Length=446

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 143/210 (68%), Gaps = 14/210 (7%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            AS  + R +ET      Y+PK  K  +++ R ++Y+L+E+RL+F+  GI I S  F + P
Sbjct  2    ASELFFRGQETHHIINAYTPKPRKPWQNVIRPVHYMLKEKRLVFLFAGIAIASLIFAMLP  61

Query  412  slshlssssp----iprshsFHLSNREALPEYTPARS--------SGYGAA-GIGRVPVG  552
            S    S            +  HL + E+   ++ AR+        +G G+    G++P+G
Sbjct  62   SSRAPSGQGSYSYINNAIYDSHLPS-ESTHSHSIARAHRIIYQNRAGLGSLHSGGKIPLG  120

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            + RK +RI++TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRH
Sbjct  121  LQRKGLRILVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRH  180

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEP+L+EVDQIYHLA PASP HYK+NPV
Sbjct  181  DVVEPLLVEVDQIYHLACPASPVHYKHNPV  210



>ref|XP_007163113.1| hypothetical protein PHAVU_001G207400g [Phaseolus vulgaris]
 gb|ESW35107.1| hypothetical protein PHAVU_001G207400g [Phaseolus vulgaris]
Length=423

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 117/166 (70%), Gaps = 1/166 (1%)
 Frame = +1

Query  328  INYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsFHLSNRE-ALPEYTPA  504
            + Y+LREQRL F+ +G+L+ S FF      S            +  L+  +  L   T  
Sbjct  30   LRYILREQRLHFLFLGVLLASVFFFFLLPSSSSPPVRAHDPFPASFLARDDLTLWPTTNT  89

Query  505  RSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKE  684
            RS       +G++P+GI RK +R+V+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKE
Sbjct  90   RSYDVAVHSVGKIPLGIKRKGLRVVVTGGAGFVGSHLVDRLISRGDSVIVVDNFFTGRKE  149

Query  685  NVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            NVMHHFGNP FEL+RHDVVEP+LLEVDQIYHLA PASP HYK+NP 
Sbjct  150  NVMHHFGNPNFELLRHDVVEPLLLEVDQIYHLACPASPVHYKFNPT  195



>ref|XP_010937727.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Elaeis guineensis]
Length=437

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 141/214 (66%), Gaps = 17/214 (8%)
 Frame = +1

Query  217  KLHKQASVNYRRDEETAQNTPPYSPKTLKH---PRSLPRSI-NYLLREQRLLFILVGILI  384
            +LHKQ S+N  +  +   +TP YS K+ K    P S  RS   YLLREQRLLF+L G LI
Sbjct  3    QLHKQPSLN--QQHQIPTHTPSYSSKSAKQQTRPSSFLRSAATYLLREQRLLFVLAGALI  60

Query  385  GSTFFiiqpslshlsssspiprsh--------sFHLSNREALPEYTPARSSGYGAAGIGR  540
             STFF++ P      S                SFH     +L       ++  G  G  R
Sbjct  61   ASTFFLLSPYYHSSLSRLSFSSPDEGPHRFLPSFH---DRSLTTKASVSAAAGGGGGGRR  117

Query  541  VPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFE  720
            VP G+ +  +RIV+TGGAGFVGSHLVDKL+ RGD VIV+DNFFTGRK+N++HHFGNPRFE
Sbjct  118  VPAGLRKPALRIVVTGGAGFVGSHLVDKLLARGDSVIVLDNFFTGRKDNLVHHFGNPRFE  177

Query  721  LIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            LIRHDVVEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  178  LIRHDVVEPILLEVDQIYHLACPASPVHYKYNPI  211



>ref|XP_003553652.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Glycine 
max]
Length=420

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 127/194 (65%), Gaps = 19/194 (10%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  E       Y PK    P+    S  YLLREQRL F+L+GI++ + FF + PS  H  
Sbjct  10   RGHEAQPMDDAYYPK----PQKPWLSFRYLLREQRLHFLLLGIVLATLFFFLLPSGLHDP  65

Query  430  ssspiprshsFHLSNREALPEYTPARSSGYGAA---GIGRVPVGIARKRMRIVITGGAGF  600
              +P               P   P  S  Y       +G++P+GI RK +RIV+TGGAGF
Sbjct  66   FPTPYLE------------PTRWPTNSPSYDVVSVHSVGKIPLGIKRKGLRIVVTGGAGF  113

Query  601  VGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHL  780
            VGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVDQIYHL
Sbjct  114  VGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYHL  173

Query  781  AWPASPXHYKYNPV  822
            A PASP HYK+NPV
Sbjct  174  ACPASPVHYKFNPV  187



>ref|XP_009382533.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Musa acuminata 
subsp. malaccensis]
Length=449

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 133/197 (68%), Gaps = 9/197 (5%)
 Frame = +1

Query  253  DEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlss  432
            D    ++   Y+PK  KH   L R + YLLREQRL+F+LVG +  ++        S  ++
Sbjct  12   DAHPPESGSGYTPKPEKHLLWLWRPLRYLLREQRLVFVLVG-MALASLLFALAPSSSSTN  70

Query  433  sspiprshsFHLSNREALPEYTPA-------RSSGYGAAGIGRVPVGIARKRMRIVITGG  591
            S     + +  L+ R A+              ++  G  G G+VP+GI RK +RIV+TGG
Sbjct  71   SYSYSSAVASELALRSAMDRQQQQHHHRAAFEAAARGFVG-GKVPLGIKRKGLRIVVTGG  129

Query  592  AGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQI  771
            AGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVDQI
Sbjct  130  AGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQI  189

Query  772  YHLAWPASPXHYKYNPV  822
            YHLA PASP HYK+NPV
Sbjct  190  YHLACPASPVHYKFNPV  206



>ref|XP_003520738.2| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Glycine 
max]
Length=428

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 119/169 (70%), Gaps = 8/169 (5%)
 Frame = +1

Query  325  SINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsFHLSNREALPEYTPA  504
            S  YLLREQRL F+L+G ++ + FF + PS S            + +L      P   P 
Sbjct  32   SFGYLLREQRLHFLLLGFVLATLFFFLLPSSSPSQPLGAHDPFPTPYLE-----PTRWPT  86

Query  505  RSSGYGAAGI---GRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTG  675
             S  Y    +   G++P+GI RK +RIV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTG
Sbjct  87   NSRSYDVVSVHSVGKIPLGIKRKGLRIVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTG  146

Query  676  RKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
             KENVMHHFGNP FELIRHDVVEP+LLEVDQIYHLA PASP HYK+NPV
Sbjct  147  MKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYHLACPASPVHYKFNPV  195



>ref|XP_008789858.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Phoenix 
dactylifera]
Length=445

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 133/207 (64%), Gaps = 23/207 (11%)
 Frame = +1

Query  244  YRRDEETAQNTPP-YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFii-----  405
            YR  E   Q+    Y PK  K    L R + YLL EQRLLF+LVG+ + S  F++     
Sbjct  7    YRGHEPQPQDGDGGYLPKPPKRCGWLSRPLRYLLGEQRLLFVLVGMALASLVFVLLPRAP  66

Query  406  --------qpslshlsssspiprshsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIAR  561
                       +  L   S        + ++REALP     R  G      G+VP+G+ R
Sbjct  67   PAAGSAVGAHVMVDLVRRSAAAGVGGGYYNHREALPAR---RFVG------GKVPLGLKR  117

Query  562  KRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVV  741
            K +RIV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTG+KENVMHHFGNP FELIRHDVV
Sbjct  118  KGLRIVVTGGAGFVGSHLVDRLLARGDSVIVVDNFFTGKKENVMHHFGNPNFELIRHDVV  177

Query  742  EPILLEVDQIYHLAWPASPXHYKYNPV  822
            EP+LLEVDQIYHLA PASP HYK+NP+
Sbjct  178  EPLLLEVDQIYHLACPASPVHYKFNPI  204



>ref|XP_009596687.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Nicotiana tomentosiformis]
Length=446

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 142/210 (68%), Gaps = 14/210 (7%)
 Frame = +1

Query  232  ASVNYRRDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqp  411
            AS  + R +ET      Y+PK  K  +++ R ++Y+L+E+RL+F+  GI I S  F + P
Sbjct  2    ASELFFRGQETHHIINAYTPKPRKPWQNVIRPVHYMLKEKRLVFLFAGIAIASLIFAMLP  61

Query  412  slshlssssp----iprshsFHLSNREALPEYTPARS--------SGYGAA-GIGRVPVG  552
            S    S            +  HL + E+   ++ AR+        +G G+    G++P+G
Sbjct  62   SSRAPSGQGSYSYINNAIYDSHLPS-ESTHSHSIARAHRIIYQNRAGLGSLHSGGKIPLG  120

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            +  K +RI++TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRH
Sbjct  121  LQCKGLRILVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRH  180

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEP+L+EVDQIYHLA PASP HYK+NPV
Sbjct  181  DVVEPLLVEVDQIYHLACPASPVHYKHNPV  210



>gb|KJB28656.1| hypothetical protein B456_005G061000 [Gossypium raimondii]
Length=440

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 125/202 (62%), Gaps = 15/202 (7%)
 Frame = +1

Query  262  TAQNTPPYSPKTLKHP-RSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlssss  438
            T +++P  SP T   P R+      Y+ ++QR  F+LVGI I + FF   P  +   S  
Sbjct  8    TQKSSPNISPGTPSSPVRNWKTPFLYVAQKQRFFFVLVGIAIAALFFNSFPVSTSSLSQE  67

Query  439  piprshsFHLS--------------NREALPEYTPARSSGYGAAGIGRVPVGIARKRMRI  576
                     L                R  L E       G   A  G+VP+G+ +K +RI
Sbjct  68   LSGGGGGAGLIAGSVSGLGAESSEVTRRVLYEAYTEGFRGRNVAAAGKVPLGLKKKNLRI  127

Query  577  VITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILL  756
            V+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTGRKEN+MHHFGNP+FELIRHDVVEPILL
Sbjct  128  VVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKENLMHHFGNPKFELIRHDVVEPILL  187

Query  757  EVDQIYHLAWPASPXHYKYNPV  822
            EVDQIYHLA PASP HYK+NP 
Sbjct  188  EVDQIYHLACPASPVHYKFNPT  209



>gb|KHN20398.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja]
Length=406

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 118/169 (70%), Gaps = 8/169 (5%)
 Frame = +1

Query  325  SINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsFHLSNREALPEYTPA  504
            S  YLLREQRL F+L+G ++ + FF + PS S            + +L      P   P 
Sbjct  15   SFGYLLREQRLHFLLLGFVLATLFFFLLPSSSPSQPLGAHDPFPTPYLE-----PTRWPT  69

Query  505  RSSGYGAAGI---GRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTG  675
             S  Y    +   G++P+GI RK +RIV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTG
Sbjct  70   NSPSYDVVSVHSVGKIPLGIKRKGLRIVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTG  129

Query  676  RKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
             KENVMHHFGNP FELIRHDVVEP+LLEVDQIYHLA PASP HYK+NP 
Sbjct  130  MKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYHLACPASPVHYKFNPT  178



>ref|XP_010938386.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronic acid decarboxylase 
2 [Elaeis guineensis]
Length=442

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 130/223 (58%), Gaps = 56/223 (25%)
 Frame = +1

Query  244  YRRDEETAQN-TPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpsls  420
            YR  E   Q+    YSPK  K    L   + YLL EQRLL +LVG+ + S  F++     
Sbjct  7    YRGHEPQPQDGAGGYSPKPPKRSGWLSWPLRYLLGEQRLLCVLVGMALASLAFVL-----  61

Query  421  hlsssspiprshsFHLSNREALPEYTPARSSGYGA-----------AGIG----------  537
                                 LP  +PA  S  GA           AG+G          
Sbjct  62   ---------------------LPHASPAAGSAVGAQVMVDLVRRSAAGVGGGYYNHREAL  100

Query  538  --------RVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVM  693
                    +VP+G+ RK +RIV+TGGAGFVGSHLVD+L+ RGD VIV+DNFFTG+KENVM
Sbjct  101  PVRRFIGGKVPLGLKRKGLRIVVTGGAGFVGSHLVDRLLARGDSVIVVDNFFTGKKENVM  160

Query  694  HHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            HHFGNP FELIRHDVVEP+LLEVDQIYHLA PASP HYK+NPV
Sbjct  161  HHFGNPNFELIRHDVVEPLLLEVDQIYHLACPASPVHYKFNPV  203



>ref|XP_006575782.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Glycine 
max]
Length=391

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 129/184 (70%), Gaps = 4/184 (2%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  ET      YSPK  K   ++ R I+Y+LREQRLLF+L+G++I + FF   PS S  +
Sbjct  8    RGHETQPVDDAYSPKPHKPWLTVTRPIHYMLREQRLLFVLLGVIIATLFFTFVPSSSPSA  67

Query  430  ssspiprshs--FHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFV  603
            SSS +        +      +P Y    ++      +G+VP+GI RK +RIV+TGGAGFV
Sbjct  68   SSSSVSYESLPISYFERESKIPAYHHRVAAA--VHSVGKVPLGIKRKGLRIVVTGGAGFV  125

Query  604  GSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLA  783
            GSHLVD+L+ RGD VIV+DNFFTGRKENVMHHFGNPRFELIRHDVVEP+LLEVDQIYHLA
Sbjct  126  GSHLVDRLIARGDSVIVVDNFFTGRKENVMHHFGNPRFELIRHDVVEPLLLEVDQIYHLA  185

Query  784  WPAS  795
             PA 
Sbjct  186  CPAE  189



>gb|EPS69228.1| hypothetical protein M569_05539, partial [Genlisea aurea]
Length=431

 Score =   186 bits (472),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 127/192 (66%), Gaps = 1/192 (1%)
 Frame = +1

Query  250  RDEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshls  429
            R  E+   T  YSPK  K    + R   YLLREQRL+F++VGI+  +  F I PSL+   
Sbjct  10   RGHESQPVTEYYSPKPEKPWLDVVRPFRYLLREQRLIFLVVGIVASTVIFAIAPSLNRKP  69

Query  430  ssspiprs-hsFHLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVG  606
            +          F               ++G+G   +G++P+G+  K +RI++TGGAGFVG
Sbjct  70   APISDGFVPAVFSRQEPNRRMSQNEPLATGFGINSVGKIPLGLKPKSLRILVTGGAGFVG  129

Query  607  SHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAW  786
            SHLVD+L+ RGD VIV+DNFFTGRKEN+  HF NPRFELIRHDVVE ILLEVDQIYHLA 
Sbjct  130  SHLVDRLIDRGDTVIVLDNFFTGRKENLEQHFSNPRFELIRHDVVESILLEVDQIYHLAC  189

Query  787  PASPXHYKYNPV  822
            PASP HYKYNPV
Sbjct  190  PASPVHYKYNPV  201



>gb|KHG10803.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum]
Length=401

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 119/175 (68%), Gaps = 22/175 (13%)
 Frame = +1

Query  337  LLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsFHLSNREALPEYTP-----  501
            +LREQRLLF+LVGI I +  F + P+                HL +   L +  P     
Sbjct  1    MLREQRLLFVLVGIAIATLVFNVFPASRAAHGP---------HLHSTTPLLDSIPYFPIE  51

Query  502  -------ARSSGYGAAG-IGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVI  657
                   A   G+G+    G++P+G+ RK +RIV+TGGAGFVGSHLVD+L+ RGD VIV+
Sbjct  52   TQNKFSYAHRLGFGSGNPTGKIPLGLKRKGLRIVVTGGAGFVGSHLVDRLIARGDSVIVV  111

Query  658  DNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DNFFTGRKENVMHHFGNP FELIRHDVVEP+LLEVDQIYHLA PASP HYK+NP 
Sbjct  112  DNFFTGRKENVMHHFGNPNFELIRHDVVEPLLLEVDQIYHLACPASPVHYKFNPT  166



>ref|XP_004298135.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Fragaria 
vesca subsp. vesca]
Length=439

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 125/210 (60%), Gaps = 40/210 (19%)
 Frame = +1

Query  253  DEETAQNTPPYSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlss  432
            +E+  Q+ P  SP   K        I Y+LREQR LF+L+G+ I + +F           
Sbjct  15   NEDLLQHNP--SPLQNKTRNLSTNPIRYMLREQRFLFVLIGVAIATLYFSA---------  63

Query  433  sspiprshsFHLSNREALPE---YTPARSSGYGAAGI-----------------GRVPVG  552
                     F LSN E       + P R   + +  +                 G+VP+G
Sbjct  64   ---------FPLSNPELASSPILHDPTRDLSFSSGSVLPTRRVLLEGLRSVNVGGKVPLG  114

Query  553  IARKRMRIVITGGAGFVGSHLVDKLMKRGDDVIVIDNFFTGRKENVMHHFGNPRFELIRH  732
            +  K  RIV+TGGAGFVGSHLVD+L+ RGD VIVIDNFFTGRKEN+ HHFGN +FELIRH
Sbjct  115  LKSKNQRIVVTGGAGFVGSHLVDRLIARGDSVIVIDNFFTGRKENLAHHFGNSKFELIRH  174

Query  733  DVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
            DVVEPILLEVDQIYHLA PASP HYK+NPV
Sbjct  175  DVVEPILLEVDQIYHLACPASPVHYKFNPV  204



>ref|NP_001183139.1| uncharacterized protein LOC100501508 [Zea mays]
 gb|ACR35828.1| unknown [Zea mays]
Length=225

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 126/180 (70%), Gaps = 2/180 (1%)
 Frame = +1

Query  283  YSPKTLKHPRSLPRSINYLLREQRLLFILVGILIGSTFFiiqpslshlsssspiprshsF  462
            YSPK  K    LPR+  Y + E R LF L G+LI +    I    +  SSS+    S++ 
Sbjct  23   YSPKPSKPLAWLPRAARYAVAENRPLFALAGMLIAAAVISIASPSASSSSSAASSYSNNN  82

Query  463  HLSNREALPEYTPARSSGYGAAGIGRVPVGIARKRMRIVITGGAGFVGSHLVDKLMKRGD  642
             L+     P +    ++ +     G+VP+G+ RK +R+++TGGAGFVGSHLVD+L++RGD
Sbjct  83   PLARFSVEPAHHRDVATRHFVG--GKVPLGLKRKVLRVLVTGGAGFVGSHLVDRLLQRGD  140

Query  643  DVIVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLAWPASPXHYKYNPV  822
             VIV+DNFFTGRK+NV+HH G+P FE+IRHDVVEPILLEVDQIYHLA PASP HYKYNP+
Sbjct  141  SVIVVDNFFTGRKDNVLHHLGDPNFEMIRHDVVEPILLEVDQIYHLACPASPVHYKYNPI  200



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1752198629708