BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7421

Length=1138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001266128.1|  E3 ubiquitin-protein ligase RGLG2-like             273   7e-83   Solanum lycopersicum
ref|XP_006338634.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    270   1e-81   Solanum tuberosum [potatoes]
ref|XP_009599491.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       269   2e-81   
gb|AAX20031.1|  RING-finger protein                                     267   7e-81   Capsicum annuum
gb|EPS58379.1|  hypothetical protein M569_16435                         259   8e-81   Genlisea aurea
ref|XP_011101822.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    264   1e-79   
ref|XP_009778227.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    263   3e-79   Nicotiana sylvestris
ref|XP_011097361.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    259   1e-77   
gb|EYU44849.1|  hypothetical protein MIMGU_mgv1a005375mg                250   2e-74   Erythranthe guttata [common monkey flower]
gb|EYU44848.1|  hypothetical protein MIMGU_mgv1a005375mg                249   5e-74   Erythranthe guttata [common monkey flower]
gb|KJB33860.1|  hypothetical protein B456_006G034900                    248   7e-74   Gossypium raimondii
emb|CDP16621.1|  unnamed protein product                                246   4e-73   Coffea canephora [robusta coffee]
gb|KJB33861.1|  hypothetical protein B456_006G034900                    246   6e-73   Gossypium raimondii
gb|KHG01454.1|  E3 ubiquitin-protein ligase RGLG2 -like protein         246   6e-73   Gossypium arboreum [tree cotton]
ref|XP_007031645.1|  RING domain ligase2 isoform 1                      246   1e-72   
ref|XP_007031647.1|  RING domain ligase2 isoform 3                      246   1e-72   
ref|XP_003618769.1|  E3 ubiquitin-protein ligase RGLG2                  246   1e-72   Medicago truncatula
ref|XP_006579983.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    245   2e-72   
ref|XP_003524729.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    245   4e-72   Glycine max [soybeans]
ref|XP_002526974.1|  copine, putative                                   244   4e-72   Ricinus communis
ref|XP_011005559.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       243   9e-72   Populus euphratica
gb|KDO82164.1|  hypothetical protein CISIN_1g0427521mg                  239   9e-72   Citrus sinensis [apfelsine]
gb|KJB75966.1|  hypothetical protein B456_012G065700                    243   1e-71   Gossypium raimondii
ref|XP_003531323.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    242   2e-71   Glycine max [soybeans]
ref|XP_006585247.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    242   2e-71   Glycine max [soybeans]
gb|KHG01849.1|  E3 ubiquitin-protein ligase RGLG2                       243   2e-71   Gossypium arboreum [tree cotton]
gb|KHN06536.1|  E3 ubiquitin-protein ligase RGLG2                       241   2e-71   Glycine soja [wild soybean]
ref|XP_004489546.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    242   2e-71   Cicer arietinum [garbanzo]
ref|XP_003524251.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    241   5e-71   Glycine max [soybeans]
ref|XP_010248698.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       240   6e-71   Nelumbo nucifera [Indian lotus]
ref|XP_004304674.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       241   7e-71   Fragaria vesca subsp. vesca
ref|XP_006438209.1|  hypothetical protein CICLE_v10031509mg             237   7e-71   
ref|XP_012071725.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       241   8e-71   Jatropha curcas
ref|XP_008458835.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       240   8e-71   Cucumis melo [Oriental melon]
gb|EPS60918.1|  hypothetical protein M569_13882                         238   8e-71   Genlisea aurea
gb|KHG01850.1|  E3 ubiquitin-protein ligase RGLG2                       241   9e-71   Gossypium arboreum [tree cotton]
gb|EYU34755.1|  hypothetical protein MIMGU_mgv1a006209mg                240   1e-70   Erythranthe guttata [common monkey flower]
ref|XP_004142779.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    240   1e-70   Cucumis sativus [cucumbers]
ref|XP_006374543.1|  hypothetical protein POPTR_0015s09780g             239   1e-70   
ref|XP_002271885.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    240   1e-70   Vitis vinifera
gb|KHG01848.1|  E3 ubiquitin-protein ligase RGLG2                       240   1e-70   Gossypium arboreum [tree cotton]
ref|XP_010660842.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    240   2e-70   Vitis vinifera
gb|KDO49018.1|  hypothetical protein CISIN_1g015418mg                   238   2e-70   Citrus sinensis [apfelsine]
ref|XP_003553280.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    241   2e-70   Glycine max [soybeans]
gb|KDO49015.1|  hypothetical protein CISIN_1g015418mg                   238   2e-70   Citrus sinensis [apfelsine]
ref|XP_002321646.1|  hypothetical protein POPTR_0015s09780g             238   2e-70   
ref|XP_011655384.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    239   3e-70   Cucumis sativus [cucumbers]
gb|AFN89139.1|  RING-type ubiquitin ligase                              239   3e-70   Mesembryanthemum crystallinum
ref|XP_011042369.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    239   3e-70   Populus euphratica
ref|XP_006446649.1|  hypothetical protein CICLE_v10015247mg             238   7e-70   
gb|KEH20743.1|  E3 ubiquitin-protein ligase RGLG2-like protein          238   7e-70   Medicago truncatula
ref|XP_007151612.1|  hypothetical protein PHAVU_004G061800g             239   7e-70   Phaseolus vulgaris [French bean]
gb|KCW59705.1|  hypothetical protein EUGRSUZ_H02465                     237   9e-70   Eucalyptus grandis [rose gum]
ref|XP_010089180.1|  E3 ubiquitin-protein ligase RGLG2                  238   1e-69   Morus notabilis
ref|XP_011625111.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       236   2e-69   Amborella trichopoda
ref|XP_010029080.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    238   2e-69   
ref|XP_010029085.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    238   2e-69   Eucalyptus grandis [rose gum]
gb|ERN10544.1|  hypothetical protein AMTR_s00166p00070360               236   2e-69   Amborella trichopoda
ref|XP_006591484.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    236   2e-69   Glycine max [soybeans]
gb|KCW59704.1|  hypothetical protein EUGRSUZ_H02465                     236   2e-69   Eucalyptus grandis [rose gum]
ref|XP_003538591.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    236   2e-69   Glycine max [soybeans]
ref|XP_010100348.1|  E3 ubiquitin-protein ligase RGLG2                  236   3e-69   Morus notabilis
ref|XP_006438208.1|  hypothetical protein CICLE_v10031509mg             236   3e-69   Citrus clementina [clementine]
ref|XP_006483979.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    236   3e-69   
ref|XP_006470207.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    236   3e-69   Citrus sinensis [apfelsine]
ref|XP_010524290.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    234   4e-69   Tarenaya hassleriana [spider flower]
gb|KHN43980.1|  E3 ubiquitin-protein ligase RGLG2                       235   5e-69   Glycine soja [wild soybean]
ref|XP_010250995.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    235   5e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010250991.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    235   6e-69   Nelumbo nucifera [Indian lotus]
ref|XP_011005612.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    235   7e-69   Populus euphratica
gb|KJB11578.1|  hypothetical protein B456_001G266800                    235   7e-69   Gossypium raimondii
ref|XP_003548557.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    234   8e-69   Glycine max [soybeans]
ref|XP_007222138.1|  hypothetical protein PRUPE_ppa005724mg             235   8e-69   
ref|XP_010102934.1|  hypothetical protein L484_018953                   228   9e-69   
ref|XP_010026602.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    236   9e-69   
gb|AFK35251.1|  unknown                                                 235   9e-69   Medicago truncatula
gb|AES72143.2|  E3 ubiquitin-protein ligase RGLG2-like protein          235   1e-68   Medicago truncatula
ref|XP_003601891.1|  E3 ubiquitin-protein ligase RGLG2                  235   1e-68   Medicago truncatula
ref|XP_004502384.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    235   1e-68   Cicer arietinum [garbanzo]
ref|XP_010550166.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    234   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_004141118.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    234   1e-68   Cucumis sativus [cucumbers]
gb|AES72144.2|  E3 ubiquitin-protein ligase RGLG2-like protein          235   1e-68   Medicago truncatula
ref|XP_010682022.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    235   1e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012079951.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    234   1e-68   Jatropha curcas
ref|XP_011652307.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    234   2e-68   Cucumis sativus [cucumbers]
ref|XP_004504141.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    234   2e-68   Cicer arietinum [garbanzo]
ref|XP_006601923.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    233   2e-68   Glycine max [soybeans]
ref|XP_003551971.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    234   2e-68   Glycine max [soybeans]
ref|XP_011071160.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       234   2e-68   Sesamum indicum [beniseed]
gb|KHN29015.1|  E3 ubiquitin-protein ligase RGLG2                       241   3e-68   Glycine soja [wild soybean]
ref|XP_004504140.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    234   3e-68   Cicer arietinum [garbanzo]
ref|XP_012085497.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    234   3e-68   Jatropha curcas
ref|XP_006601922.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    234   3e-68   Glycine max [soybeans]
ref|XP_003601892.1|  E3 ubiquitin-protein ligase RGLG2                  235   3e-68   
ref|XP_007163690.1|  hypothetical protein PHAVU_001G255900g             233   3e-68   Phaseolus vulgaris [French bean]
gb|KHN27569.1|  E3 ubiquitin-protein ligase RGLG2                       233   4e-68   Glycine soja [wild soybean]
ref|XP_003601893.1|  E3 ubiquitin-protein ligase RGLG2                  235   4e-68   
ref|XP_002312658.1|  hypothetical protein POPTR_0008s18400g             233   5e-68   
ref|XP_011034033.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    233   5e-68   Populus euphratica
ref|XP_007159686.1|  hypothetical protein PHAVU_002G258600g             233   5e-68   Phaseolus vulgaris [French bean]
ref|XP_011034031.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    233   5e-68   Populus euphratica
ref|XP_007163691.1|  hypothetical protein PHAVU_001G255900g             233   6e-68   Phaseolus vulgaris [French bean]
ref|XP_006379955.1|  hypothetical protein POPTR_0008s18400g             233   7e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010524288.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    232   7e-68   Tarenaya hassleriana [spider flower]
ref|XP_010524289.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    232   8e-68   Tarenaya hassleriana [spider flower]
ref|XP_004135284.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    232   8e-68   Cucumis sativus [cucumbers]
ref|XP_007044867.1|  Copine family isoform 1                            233   1e-67   
ref|XP_002515058.1|  copine, putative                                   233   1e-67   
ref|XP_003555130.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    231   2e-67   Glycine max [soybeans]
emb|CDP12686.1|  unnamed protein product                                231   2e-67   Coffea canephora [robusta coffee]
gb|KHN00030.1|  E3 ubiquitin-protein ligase RGLG1                       231   2e-67   Glycine soja [wild soybean]
gb|KJB51127.1|  hypothetical protein B456_008G202700                    227   3e-67   Gossypium raimondii
ref|XP_008221938.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       231   3e-67   
ref|XP_009371747.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       231   3e-67   Pyrus x bretschneideri [bai li]
ref|XP_006439965.1|  hypothetical protein CICLE_v10020205mg             226   3e-67   
ref|XP_008341364.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       231   4e-67   
ref|XP_008446129.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    230   4e-67   Cucumis melo [Oriental melon]
ref|XP_008464939.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    230   5e-67   Cucumis melo [Oriental melon]
gb|KEH22094.1|  E3 ubiquitin-protein ligase RGLG2-like protein          229   6e-67   Medicago truncatula
ref|XP_002282202.2|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       229   7e-67   Vitis vinifera
ref|XP_010927545.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    228   8e-67   
ref|XP_010026980.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    229   1e-66   Eucalyptus grandis [rose gum]
gb|KHG28566.1|  E3 ubiquitin-protein ligase RGLG2                       229   1e-66   Gossypium arboreum [tree cotton]
ref|XP_006399953.1|  hypothetical protein EUTSA_v10013466mg             230   1e-66   Eutrema salsugineum [saltwater cress]
gb|ACA04857.1|  putative copine I                                       222   1e-66   Picea abies
ref|XP_009370343.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    229   1e-66   
ref|XP_006408532.1|  hypothetical protein EUTSA_v10020651mg             229   1e-66   Eutrema salsugineum [saltwater cress]
ref|XP_002318092.2|  hypothetical protein POPTR_0012s09190g             228   2e-66   
gb|KHG28565.1|  E3 ubiquitin-protein ligase RGLG2                       229   2e-66   Gossypium arboreum [tree cotton]
gb|KHG03783.1|  E3 ubiquitin-protein ligase RGLG2 -like protein         230   2e-66   Gossypium arboreum [tree cotton]
ref|XP_011040451.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    228   2e-66   Populus euphratica
gb|EYU22544.1|  hypothetical protein MIMGU_mgv1a006738mg                228   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_010420077.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    229   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006439964.1|  hypothetical protein CICLE_v10020205mg             228   2e-66   
gb|KJB51128.1|  hypothetical protein B456_008G202700                    228   2e-66   Gossypium raimondii
gb|KJB51125.1|  hypothetical protein B456_008G202700                    227   3e-66   Gossypium raimondii
ref|XP_010927546.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    225   3e-66   
gb|KJB51126.1|  hypothetical protein B456_008G202700                    228   3e-66   Gossypium raimondii
ref|XP_006476914.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    228   4e-66   Citrus sinensis [apfelsine]
ref|XP_003622329.1|  E3 ubiquitin-protein ligase RGLG2                  228   5e-66   Medicago truncatula
gb|KJB51129.1|  hypothetical protein B456_008G202700                    228   5e-66   Gossypium raimondii
ref|XP_007037786.1|  RING domain ligase2 isoform 1                      228   6e-66   
gb|KDO69439.1|  hypothetical protein CISIN_1g012303mg                   228   7e-66   Citrus sinensis [apfelsine]
ref|XP_010912939.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    228   7e-66   Elaeis guineensis
gb|KJB51124.1|  hypothetical protein B456_008G202700                    227   7e-66   Gossypium raimondii
gb|KDO69440.1|  hypothetical protein CISIN_1g012303mg                   228   8e-66   Citrus sinensis [apfelsine]
ref|XP_010519134.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   9e-66   Tarenaya hassleriana [spider flower]
gb|EPS73512.1|  hypothetical protein M569_01244                         226   1e-65   Genlisea aurea
ref|XP_006476915.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   1e-65   Citrus sinensis [apfelsine]
ref|XP_006439963.1|  hypothetical protein CICLE_v10020205mg             226   1e-65   Citrus clementina [clementine]
gb|KDO69441.1|  hypothetical protein CISIN_1g012303mg                   226   1e-65   Citrus sinensis [apfelsine]
gb|ABK24359.1|  unknown                                                 226   1e-65   Picea sitchensis
ref|XP_010927542.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   1e-65   
emb|CDX70564.1|  BnaC03g06480D                                          227   1e-65   
ref|NP_001240870.1|  uncharacterized protein LOC100809850               226   2e-65   Glycine max [soybeans]
ref|XP_008379181.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    227   2e-65   
ref|XP_011101825.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    224   2e-65   
ref|XP_004236287.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       226   2e-65   Solanum lycopersicum
ref|XP_006297977.1|  hypothetical protein CARUB_v10014021mg             223   2e-65   
ref|XP_007137991.1|  hypothetical protein PHAVU_009G171800g             225   3e-65   Phaseolus vulgaris [French bean]
ref|XP_010492244.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006351421.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    225   3e-65   Solanum tuberosum [potatoes]
gb|KCW52958.1|  hypothetical protein EUGRSUZ_J02261                     225   3e-65   Eucalyptus grandis [rose gum]
ref|XP_002298557.2|  hypothetical protein POPTR_0001s35660g             225   3e-65   
ref|XP_010932261.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   3e-65   Elaeis guineensis
ref|XP_010453560.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       226   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_004138080.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    225   4e-65   Cucumis sativus [cucumbers]
gb|KJB61002.1|  hypothetical protein B456_009G335200                    226   4e-65   Gossypium raimondii
ref|XP_009131405.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   4e-65   Brassica rapa
ref|XP_009131403.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    226   5e-65   Brassica rapa
ref|XP_007215340.1|  hypothetical protein PRUPE_ppa005347mg             225   5e-65   Prunus persica
ref|XP_008464499.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    224   5e-65   Cucumis melo [Oriental melon]
ref|XP_002884269.1|  hypothetical protein ARALYDRAFT_896079             224   5e-65   
gb|KGN63523.1|  hypothetical protein Csa_1G002920                       226   5e-65   Cucumis sativus [cucumbers]
ref|XP_009419388.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    225   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008797006.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    224   7e-65   
emb|CDX78576.1|  BnaA03g04880D                                          225   8e-65   
ref|XP_006287685.1|  hypothetical protein CARUB_v10000894mg             221   1e-64   
ref|XP_010485387.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    224   1e-64   Camelina sativa [gold-of-pleasure]
gb|EEE53061.1|  hypothetical protein OsJ_35797                          221   1e-64   Oryza sativa Japonica Group [Japonica rice]
emb|CDY09854.1|  BnaC09g43070D                                          224   1e-64   Brassica napus [oilseed rape]
ref|XP_010531508.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    224   1e-64   
emb|CDY37509.1|  BnaA05g33740D                                          224   1e-64   Brassica napus [oilseed rape]
ref|XP_009121662.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    224   1e-64   Brassica rapa
emb|CDX69581.1|  BnaA10g19300D                                          224   2e-64   
emb|CDY49066.1|  BnaC05g48940D                                          224   2e-64   Brassica napus [oilseed rape]
ref|XP_009147449.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    224   2e-64   Brassica rapa
gb|ERN19129.1|  hypothetical protein AMTR_s00061p00153710               221   2e-64   Amborella trichopoda
ref|XP_010033344.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    223   2e-64   
ref|NP_186814.1|  E3 ubiquitin-protein ligase RGLG1                     224   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010033343.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    223   3e-64   Eucalyptus grandis [rose gum]
ref|XP_011628239.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       221   3e-64   
ref|XP_011071995.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    223   3e-64   Sesamum indicum [beniseed]
ref|XP_006287684.1|  hypothetical protein CARUB_v10000894mg             223   3e-64   Capsella rubella
ref|NP_196946.1|  E3 ubiquitin-protein ligase RGLG2                     223   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496283.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       223   4e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009147448.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    224   4e-64   Brassica rapa
emb|CDX91935.1|  BnaC03g32370D                                          223   5e-64   
ref|XP_006664503.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    222   5e-64   
ref|XP_002873665.1|  hypothetical protein ARALYDRAFT_488284             223   5e-64   
ref|XP_002511290.1|  copine, putative                                   222   5e-64   Ricinus communis
ref|XP_010904547.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       223   5e-64   Elaeis guineensis
ref|XP_009125973.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       222   7e-64   Brassica rapa
ref|XP_003526988.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    221   7e-64   Glycine max [soybeans]
emb|CDX91062.1|  BnaC02g05350D                                          222   8e-64   
ref|XP_004309992.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    221   8e-64   Fragaria vesca subsp. vesca
ref|XP_008230495.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    222   9e-64   Prunus mume [ume]
ref|XP_008807474.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    222   9e-64   
ref|XP_010435648.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    221   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_007209145.1|  hypothetical protein PRUPE_ppa005852mg             221   1e-63   Prunus persica
ref|XP_009795957.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    221   1e-63   Nicotiana sylvestris
ref|XP_006646587.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    219   1e-63   Oryza brachyantha
emb|CDX74310.1|  BnaA03g27370D                                          221   2e-63   
gb|EYU44842.1|  hypothetical protein MIMGU_mgv1a024648mg                219   2e-63   Erythranthe guttata [common monkey flower]
gb|ACR36132.1|  unknown                                                 223   2e-63   Zea mays [maize]
ref|XP_004970988.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    221   2e-63   Setaria italica
ref|XP_009134597.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       221   2e-63   Brassica rapa
gb|KJB31093.1|  hypothetical protein B456_005G175700                    220   2e-63   Gossypium raimondii
emb|CAN81848.1|  hypothetical protein VITISV_036819                     220   2e-63   Vitis vinifera
ref|XP_009403629.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       221   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH19894.1|  AT5G14420                                              221   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008786705.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    221   3e-63   Phoenix dactylifera
ref|XP_010044533.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    220   3e-63   Eucalyptus grandis [rose gum]
ref|NP_001150002.1|  copine family protein                              222   4e-63   Zea mays [maize]
gb|AFW76346.1|  hypothetical protein ZEAMMB73_695996                    217   4e-63   
ref|XP_010044531.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    220   5e-63   Eucalyptus grandis [rose gum]
ref|XP_010044532.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    220   5e-63   Eucalyptus grandis [rose gum]
ref|XP_008239359.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    219   5e-63   Prunus mume [ume]
ref|XP_009608151.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    219   6e-63   Nicotiana tomentosiformis
ref|XP_004962600.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    221   7e-63   Setaria italica
dbj|BAD35623.1|  unknown protein                                        218   8e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010682339.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    219   9e-63   
tpg|DAA56240.1|  TPA: hypothetical protein ZEAMMB73_877987              219   1e-62   
tpg|DAA56239.1|  TPA: hypothetical protein ZEAMMB73_877987              219   1e-62   
ref|NP_001146212.1|  uncharacterized protein LOC100279782               219   1e-62   Zea mays [maize]
ref|XP_002458953.1|  hypothetical protein SORBIDRAFT_03g043290          219   1e-62   Sorghum bicolor [broomcorn]
ref|NP_001066593.1|  Os12g0288400                                       221   1e-62   
ref|XP_010682336.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    219   2e-62   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP13252.1|  unnamed protein product                                218   2e-62   Coffea canephora [robusta coffee]
gb|EEC69114.1|  hypothetical protein OsI_38028                          221   2e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_009412691.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    218   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299159.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    218   3e-62   Fragaria vesca subsp. vesca
ref|XP_002279018.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       217   3e-62   Vitis vinifera
gb|EYU22209.1|  hypothetical protein MIMGU_mgv1a006782mg                217   3e-62   Erythranthe guttata [common monkey flower]
ref|XP_004965913.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    218   3e-62   Setaria italica
ref|NP_001058043.1|  Os06g0608800                                       218   3e-62   
gb|EEC80951.1|  hypothetical protein OsI_23663                          217   4e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_008650441.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    216   4e-62   
ref|XP_010252862.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    217   4e-62   Nelumbo nucifera [Indian lotus]
ref|NP_001147447.1|  copine-1                                           217   4e-62   Zea mays [maize]
ref|XP_003578709.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    219   5e-62   Brachypodium distachyon [annual false brome]
ref|XP_002315654.1|  hypothetical protein POPTR_0010s05940g             215   8e-62   
ref|XP_008389744.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    217   9e-62   
emb|CDY27584.1|  BnaA09g28230D                                          210   9e-62   Brassica napus [oilseed rape]
ref|XP_011005762.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    215   9e-62   Populus euphratica
gb|ACN85268.1|  copine-1                                                216   1e-61   Oryza alta
ref|XP_004502383.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    218   1e-61   Cicer arietinum [garbanzo]
ref|XP_006656233.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    216   1e-61   Oryza brachyantha
ref|NP_001145987.1|  uncharacterized protein LOC100279516               217   1e-61   Zea mays [maize]
gb|AFW84239.1|  hypothetical protein ZEAMMB73_082799                    217   2e-61   
ref|XP_008357726.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    216   2e-61   
ref|XP_008778640.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    213   2e-61   
gb|EMS50180.1|  E3 ubiquitin-protein ligase RGLG2                       215   3e-61   Triticum urartu
emb|CDX84957.1|  BnaC05g20980D                                          213   3e-61   
ref|NP_001045146.1|  Os01g0908700                                       215   3e-61   
dbj|BAJ96252.1|  predicted protein                                      215   4e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003564886.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       215   4e-61   Brachypodium distachyon [annual false brome]
ref|XP_002308745.1|  hypothetical protein POPTR_0006s00450g             213   5e-61   Populus trichocarpa [western balsam poplar]
gb|EMT11740.1|  hypothetical protein F775_05193                         215   5e-61   
gb|EEE55855.1|  hypothetical protein OsJ_04480                          214   6e-61   Oryza sativa Japonica Group [Japonica rice]
gb|EYU44845.1|  hypothetical protein MIMGU_mgv1a011343mg                209   7e-61   Erythranthe guttata [common monkey flower]
dbj|BAK07422.1|  predicted protein                                      214   8e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC72000.1|  hypothetical protein OsI_04857                          214   8e-61   Oryza sativa Indica Group [Indian rice]
gb|EYU44844.1|  hypothetical protein MIMGU_mgv1a019091mg                212   8e-61   Erythranthe guttata [common monkey flower]
gb|KEH35020.1|  E3 ubiquitin-protein ligase RGLG2-like protein          213   8e-61   Medicago truncatula
ref|XP_010942537.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    213   8e-61   Elaeis guineensis
dbj|BAB92575.1|  P0497A05.19                                            215   1e-60   Oryza sativa Japonica Group [Japonica rice]
gb|EMS57170.1|  hypothetical protein TRIUR3_17359                       214   1e-60   Triticum urartu
ref|XP_010246555.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    213   1e-60   Nelumbo nucifera [Indian lotus]
ref|XP_003563639.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    213   2e-60   
ref|XP_009359243.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       213   2e-60   
gb|ABG34341.1|  copine-like protein                                     214   2e-60   
ref|XP_008778633.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    212   2e-60   
ref|XP_010647336.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    212   2e-60   
ref|XP_009417358.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    211   2e-60   
dbj|BAJ99595.1|  predicted protein                                      214   3e-60   
ref|XP_012074834.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    211   4e-60   
ref|XP_006415815.1|  hypothetical protein EUTSA_v10007950mg             210   4e-60   
ref|XP_004501852.1|  PREDICTED: uncharacterized protein LOC101503410    219   4e-60   
ref|XP_008340126.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       212   5e-60   
ref|XP_009417355.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    211   5e-60   
ref|XP_012074833.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    211   6e-60   
ref|XP_009113808.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    209   8e-60   
ref|XP_009623420.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    206   8e-60   
gb|EYU44847.1|  hypothetical protein MIMGU_mgv1a009476mg                206   1e-59   
ref|XP_011096142.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    209   2e-59   
ref|XP_009395842.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    209   2e-59   
ref|XP_010033345.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   3e-59   
gb|EYU44843.1|  hypothetical protein MIMGU_mgv1a018122mg                206   4e-59   
ref|XP_008794750.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    208   4e-59   
ref|XP_009385432.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    208   5e-59   
gb|KHN34573.1|  E3 ubiquitin-protein ligase RGLG1                       206   5e-59   
gb|EYU44846.1|  hypothetical protein MIMGU_mgv1a009476mg                206   6e-59   
ref|XP_010246559.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    204   8e-59   
ref|XP_010928040.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   1e-58   
ref|XP_010415369.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   1e-58   
ref|XP_006391217.1|  hypothetical protein EUTSA_v10019546mg             207   2e-58   
ref|XP_010470709.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   2e-58   
gb|KDO49014.1|  hypothetical protein CISIN_1g015418mg                   206   3e-58   
ref|XP_010511739.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   3e-58   
ref|XP_006301528.1|  hypothetical protein CARUB_v10021966mg             207   3e-58   
ref|XP_010928039.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   3e-58   
ref|XP_009792794.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    204   3e-58   
ref|XP_002888625.1|  hypothetical protein ARALYDRAFT_475885             207   3e-58   
gb|EMT11739.1|  hypothetical protein F775_05192                         206   3e-58   
ref|XP_010415367.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   3e-58   
ref|XP_007159860.1|  hypothetical protein PHAVU_002G273900g             207   4e-58   
ref|XP_009792793.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    204   4e-58   
ref|XP_010470708.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   4e-58   
ref|XP_008797058.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    205   5e-58   
ref|XP_010511738.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   5e-58   
ref|XP_010927541.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    203   6e-58   
ref|XP_002977516.1|  hypothetical protein SELMODRAFT_176218             205   6e-58   
ref|NP_564907.1|  Copine (Calcium-dependent phospholipid-binding ...    206   7e-58   
ref|XP_002972204.1|  hypothetical protein SELMODRAFT_148275             204   8e-58   
ref|XP_006307662.1|  hypothetical protein CARUB_v10009290mg             204   8e-58   
ref|XP_009589142.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    204   9e-58   
ref|XP_009333912.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    206   1e-57   
ref|XP_008797027.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    205   1e-57   
ref|XP_008374368.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    205   2e-57   
ref|NP_849857.1|  Copine (Calcium-dependent phospholipid-binding ...    205   2e-57   
ref|XP_006349743.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    204   2e-57   
ref|XP_006349745.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    204   2e-57   
ref|XP_008367487.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    204   2e-57   
ref|XP_009589140.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    204   2e-57   
ref|XP_010251001.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    197   2e-57   
emb|CDY01855.1|  BnaC06g28950D                                          204   3e-57   
ref|XP_009105330.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       204   3e-57   
emb|CDY56212.1|  BnaAnng14100D                                          204   3e-57   
ref|XP_010927540.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    202   4e-57   
ref|XP_006307664.1|  hypothetical protein CARUB_v10009290mg             203   5e-57   
ref|XP_010927538.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    202   5e-57   
ref|XP_010052495.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    202   6e-57   
ref|XP_009617437.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    201   7e-57   
ref|XP_004247214.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       202   7e-57   
ref|XP_010470707.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    207   1e-56   
ref|XP_002890706.1|  hypothetical protein ARALYDRAFT_890218             202   1e-56   
ref|XP_002525032.1|  copine, putative                                   201   1e-56   
ref|XP_009769353.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    201   2e-56   
ref|NP_001062128.1|  Os08g0494300                                       200   3e-56   
ref|XP_010478000.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    201   3e-56   
ref|XP_010251000.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    195   3e-56   
dbj|BAJ95185.1|  predicted protein                                      201   4e-56   
ref|XP_002516315.1|  copine, putative                                   199   5e-56   
ref|XP_004502961.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    201   5e-56   
ref|XP_010499161.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    200   5e-56   
ref|XP_009769351.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    200   6e-56   
gb|AES72894.2|  E3 ubiquitin-protein ligase RGLG2-like protein          201   6e-56   
ref|XP_003602643.1|  E3 ubiquitin-protein ligase mib1                   201   6e-56   
gb|KEH35604.1|  E3 ubiquitin-protein ligase RGLG2-like protein          201   6e-56   
ref|XP_004502959.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    201   6e-56   
ref|XP_010250997.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    194   6e-56   
gb|KDO51651.1|  hypothetical protein CISIN_1g0139001mg                  199   9e-56   
ref|XP_006432148.1|  hypothetical protein CICLE_v100012031mg            199   9e-56   
gb|KEH35605.1|  E3 ubiquitin-protein ligase RGLG2-like protein          201   9e-56   
ref|XP_009366697.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    198   1e-55   
ref|XP_009366700.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    197   1e-55   
ref|XP_006659095.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    199   1e-55   
ref|XP_009366698.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    198   1e-55   
ref|XP_003525130.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    199   1e-55   
ref|XP_010460441.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    199   1e-55   
ref|XP_006465084.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    199   2e-55   
ref|XP_009366696.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    198   2e-55   
gb|ADZ04649.1|  hypothetical protein                                    199   2e-55   
dbj|BAJ90048.1|  predicted protein                                      198   2e-55   
ref|XP_009366693.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    197   3e-55   
gb|EAZ37602.1|  hypothetical protein OsJ_21935                          196   3e-55   
ref|XP_011022915.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    197   3e-55   
gb|EEC82864.1|  hypothetical protein OsI_27723                          198   3e-55   
ref|NP_001060941.1|  Os08g0135400                                       198   3e-55   
gb|ADZ04633.1|  hypothetical protein                                    198   5e-55   
ref|XP_011014300.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    197   5e-55   
ref|XP_011031152.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    197   6e-55   
ref|XP_011031151.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    197   7e-55   
ref|XP_008355636.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    194   8e-55   
ref|XP_007137784.1|  hypothetical protein PHAVU_009G155300g             197   1e-54   
ref|XP_007137785.1|  hypothetical protein PHAVU_009G155300g             197   1e-54   
ref|XP_006578783.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    197   1e-54   
ref|XP_007212314.1|  hypothetical protein PRUPE_ppa006783mg             194   1e-54   
gb|EMT16285.1|  hypothetical protein F775_32201                         201   1e-54   
ref|XP_001761538.1|  predicted protein                                  192   1e-54   
ref|XP_007048456.1|  Copine (Calcium-dependent phospholipid-bindi...    195   2e-54   
gb|KHN31170.1|  E3 ubiquitin-protein ligase RGLG1                       196   2e-54   
ref|XP_004293813.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    196   2e-54   
ref|XP_002306262.2|  hypothetical protein POPTR_0005s06680g             196   2e-54   
ref|XP_006578782.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    196   2e-54   
ref|XP_011014272.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    196   2e-54   
ref|XP_003523218.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    196   2e-54   
ref|XP_010674439.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       195   2e-54   
ref|XP_007048452.1|  Copine family isoform 3                            196   3e-54   
ref|XP_006382872.1|  hypothetical protein POPTR_0005s06680g             196   3e-54   
ref|XP_012079809.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       196   3e-54   
ref|XP_007048455.1|  Copine family isoform 6                            195   3e-54   
ref|XP_007212315.1|  hypothetical protein PRUPE_ppa006783mg             194   3e-54   
gb|EYU27634.1|  hypothetical protein MIMGU_mgv1a009116mg                194   3e-54   
ref|XP_004973794.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    196   3e-54   
ref|XP_011099706.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       196   3e-54   
ref|XP_007048450.1|  Copine family isoform 1                            195   3e-54   
ref|XP_011040117.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    195   3e-54   
ref|XP_002309925.1|  hypothetical protein POPTR_0007s04370g             194   4e-54   
ref|XP_007048451.1|  Copine family isoform 2                            195   4e-54   
ref|XP_002316157.2|  hypothetical protein POPTR_0010s18200g             196   4e-54   
ref|XP_011465074.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    194   4e-54   
ref|XP_010649350.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    194   5e-54   
ref|XP_011031153.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    194   5e-54   
gb|ERN16585.1|  hypothetical protein AMTR_s00031p00212930               194   5e-54   
ref|XP_007212316.1|  hypothetical protein PRUPE_ppa006783mg             194   5e-54   
ref|XP_003631930.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    194   6e-54   
ref|XP_012084310.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       195   6e-54   
ref|XP_004488557.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    195   6e-54   
ref|XP_010247786.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    195   6e-54   
ref|XP_004288136.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    194   8e-54   
ref|XP_002974682.1|  hypothetical protein SELMODRAFT_102156             194   8e-54   
ref|XP_008227410.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    193   8e-54   
ref|XP_010649348.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    194   8e-54   
ref|XP_002266834.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    194   9e-54   
ref|XP_011627303.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       194   9e-54   
ref|XP_006422303.1|  hypothetical protein CICLE_v10005036mg             192   9e-54   
ref|XP_003574693.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    194   9e-54   
ref|XP_002963397.1|  hypothetical protein SELMODRAFT_141864             194   1e-53   
ref|XP_011040112.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    194   1e-53   
ref|XP_006373569.1|  hypothetical protein POPTR_0016s00470g             193   1e-53   
ref|XP_009340213.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    193   2e-53   
ref|XP_009340215.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    193   2e-53   
ref|XP_008227408.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    193   2e-53   
ref|XP_008648442.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    193   2e-53   
gb|KJB48938.1|  hypothetical protein B456_008G094400                    190   3e-53   
ref|XP_010927544.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    194   3e-53   
ref|XP_006422304.1|  hypothetical protein CICLE_v10005036mg             192   3e-53   
ref|XP_009782421.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       194   4e-53   
gb|EYU20648.1|  hypothetical protein MIMGU_mgv1a007011mg                192   4e-53   
gb|EMS53474.1|  E3 ubiquitin-protein ligase RGLG2                       197   4e-53   
ref|XP_008225986.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       192   5e-53   
ref|XP_010907788.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       192   5e-53   
gb|KEH38212.1|  E3 ubiquitin-protein ligase RGLG2-like protein          191   6e-53   
ref|XP_002444822.1|  hypothetical protein SORBIDRAFT_07g028640          192   6e-53   
emb|CAN77261.1|  hypothetical protein VITISV_024760                     193   6e-53   
gb|AFW83893.1|  hypothetical protein ZEAMMB73_890555                    185   7e-53   
gb|KJB48931.1|  hypothetical protein B456_008G094400                    191   7e-53   
ref|XP_006422305.1|  hypothetical protein CICLE_v10005036mg             192   7e-53   
gb|KJB48932.1|  hypothetical protein B456_008G094400                    191   7e-53   
ref|XP_007022766.1|  Ca(2)-dependent phospholipid-binding protein...    191   8e-53   
ref|XP_010270329.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1       191   8e-53   
gb|KDO61520.1|  hypothetical protein CISIN_1g042398mg                   192   8e-53   
gb|KCW54196.1|  hypothetical protein EUGRSUZ_I00183                     189   9e-53   
gb|KJB81449.1|  hypothetical protein B456_013G146400                    188   1e-52   
dbj|BAJ90588.1|  predicted protein                                      191   1e-52   
ref|XP_007022765.1|  Ca(2)-dependent phospholipid-binding protein...    191   1e-52   
gb|KJB48935.1|  hypothetical protein B456_008G094400                    191   1e-52   
ref|XP_003620808.1|  E3 ubiquitin-protein ligase RGLG2                  187   1e-52   
ref|XP_010528712.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    190   1e-52   
emb|CDP04648.1|  unnamed protein product                                192   1e-52   
gb|KJB48934.1|  hypothetical protein B456_008G094400                    191   1e-52   
ref|XP_010905316.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    191   1e-52   
gb|EMT09647.1|  E3 ubiquitin-protein ligase RGLG1                       192   2e-52   
ref|XP_010528713.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    189   2e-52   
ref|XP_001757898.1|  predicted protein                                  192   2e-52   
ref|XP_009607653.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2       190   2e-52   
ref|XP_007211456.1|  hypothetical protein PRUPE_ppa007341mg             189   2e-52   
gb|KEH19335.1|  calcium-dependent phospholipid-binding copine fam...    188   2e-52   
gb|KEH38211.1|  E3 ubiquitin-protein ligase RGLG2-like protein          191   2e-52   
ref|XP_010027626.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   2e-52   
ref|XP_006585725.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    189   3e-52   
ref|XP_003620903.1|  E3 ubiquitin-protein ligase RGLG2                  187   3e-52   
ref|XP_008797041.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    191   3e-52   
ref|XP_006598024.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    190   3e-52   
ref|XP_008781601.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   3e-52   
ref|XP_008781600.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   4e-52   
ref|XP_009402658.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    190   4e-52   
ref|XP_009402653.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    190   4e-52   
emb|CDP11374.1|  unnamed protein product                                191   4e-52   
gb|KCW54193.1|  hypothetical protein EUGRSUZ_I00183                     189   4e-52   
ref|XP_010547672.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    189   5e-52   
gb|KHG01421.1|  E3 ubiquitin-protein ligase RGLG1 -like protein         189   5e-52   
ref|XP_009387980.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    190   5e-52   
ref|XP_010529009.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    185   5e-52   
ref|XP_010528715.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    188   5e-52   
ref|XP_003546661.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    189   6e-52   
ref|XP_010645087.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    189   7e-52   
ref|XP_007022767.1|  Copine I-like protein isoform 3                    187   7e-52   
gb|EMS60330.1|  E3 ubiquitin-protein ligase RGLG2                       189   7e-52   
ref|XP_003531811.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    189   8e-52   
ref|XP_009340139.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    189   8e-52   
gb|EMT24645.1|  E3 ubiquitin-protein ligase RGLG2                       187   8e-52   
ref|XP_006365458.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    190   8e-52   
ref|XP_006365459.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    190   8e-52   
ref|XP_010027625.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG1...    186   9e-52   
ref|XP_011095832.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    189   9e-52   
gb|EMS57413.1|  E3 ubiquitin-protein ligase RGLG2                       189   9e-52   
ref|XP_011095831.1|  PREDICTED: E3 ubiquitin-protein ligase RGLG2...    189   9e-52   



>ref|NP_001266128.1| E3 ubiquitin-protein ligase RGLG2-like [Solanum lycopersicum]
 ref|XP_010315864.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Solanum lycopersicum]
 gb|AGL95793.1| RING-finger protein [Solanum lycopersicum]
Length=492

 Score =   273 bits (698),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 173/225 (77%), Gaps = 23/225 (10%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswN-YEYPQTAYP----------------PQPQESYNYPV  644
             MGGKSSR+DSWRQAS + SSSWN Y+YPQTAYP                P P    NYP 
Sbjct  1     MGGKSSREDSWRQASSTRSSSWNQYDYPQTAYPQDSYSYSQQTAVPSYAPPPPSQQNYPP  60

Query  645   QHaypsyappppqeqqypppsqDFASRNHA-PPQRRLDRRYSRIADNYNSLEEVTEALAR  821
             QH +   + P      +     +  SR H   P+ RLDRRYSRIADNYNSL+EVTEALAR
Sbjct  61    QHQHNYSSQPQQNYASH-----EHESRTHTHAPRPRLDRRYSRIADNYNSLDEVTEALAR  115

Query  822   AGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNL  1001
             AGLESSNLIVGIDFTKSNEWTGK+SF+ RSLH+IG  LNPYEQAISIIGKTLAAFD+DNL
Sbjct  116   AGLESSNLIVGIDFTKSNEWTGKRSFSNRSLHHIGQNLNPYEQAISIIGKTLAAFDEDNL  175

Query  1002  IPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             IPCFGFGDASTHDQDVFSF+P+ERFCNGFEEVLS+YREI P+LKL
Sbjct  176   IPCFGFGDASTHDQDVFSFFPNERFCNGFEEVLSRYREIVPQLKL  220



>ref|XP_006338634.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Solanum tuberosum]
Length=485

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 176/216 (81%), Gaps = 12/216 (6%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswN-YEYPQTAYPPQPQESYNYPVQHa--ypsyappppqe  686
             MGGKSSR+DSWRQAS + SSSWN Y+YPQTAYP   Q+SY+Y  Q A    +  PP  Q 
Sbjct  1     MGGKSSREDSWRQASSTRSSSWNQYDYPQTAYP---QDSYSYSQQAAVPSYAPPPPSQQN  57

Query  687   qqypppsqDFASRNHA------PPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLI  848
                P P  ++AS  H        P+ RLDRRYSRIADNYNSL+EVTEALARAGLESSNLI
Sbjct  58    FPPPQPQHNYASHEHESLPHAHAPRPRLDRRYSRIADNYNSLDEVTEALARAGLESSNLI  117

Query  849   VGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDA  1028
             VGIDFTKSNEWTGK+SF  RSLH+IG  LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDA
Sbjct  118   VGIDFTKSNEWTGKRSFGNRSLHHIGQNLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDA  177

Query  1029  STHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             STHDQDVF+F+PDERFCNGFEEVLS+YREI P+LKL
Sbjct  178   STHDQDVFNFFPDERFCNGFEEVLSRYREIVPQLKL  213



>ref|XP_009599491.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nicotiana tomentosiformis]
 ref|XP_009599492.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nicotiana tomentosiformis]
Length=485

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 163/209 (78%), Gaps = 2/209 (1%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqy  695
             MGGKSSR+DSWRQ S + SS   Y YPQT      Q+SYNYP  H   +     P   Q 
Sbjct  1     MGGKSSREDSWRQTSSTRSSWNQYNYPQTQSSYPQQDSYNYPPSHHQQAVPSYAPPPPQQ  60

Query  696   pppsqDFASRNHAP--PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  869
               P      +N+    P+ RLDRRYSRIADNY+SL+EVTEALAR GLESSNLIVGIDFTK
Sbjct  61    SYPPPPPQQQNYPSHVPKPRLDRRYSRIADNYSSLDEVTEALAREGLESSNLIVGIDFTK  120

Query  870   SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  1049
             SNEWTGK+SF GRSLH+IG  LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDV
Sbjct  121   SNEWTGKRSFGGRSLHHIGQNLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDV  180

Query  1050  FSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             FSF+PDERFCNGFEEVLS+YREI P LKL
Sbjct  181   FSFFPDERFCNGFEEVLSRYREIVPELKL  209



>gb|AAX20031.1| RING-finger protein [Capsicum annuum]
Length=484

 Score =   267 bits (683),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 167/218 (77%), Gaps = 17/218 (8%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQT--AYPPQPQESYNYPVQHaypsyappppqeq  689
             MGGKSSR+DSWRQ S + SS   YEYP T  + P  PQ+SY+Y  Q        PPP  Q
Sbjct  1     MGGKSSREDSWRQTSSTRSSWNQYEYPPTHSSSPSYPQDSYSYSSQQQAVPSYAPPPPHQ  60

Query  690   qypppsqDFASRNHAPPQR---------RLDRRYSRIADNYNSLEEVTEALARAGLESSN  842
             Q         S   APPQ+         RLDRRYSRIADNYNSL+EVTEALARAGLESSN
Sbjct  61    QA------VPSYAPAPPQQNYASHASRPRLDRRYSRIADNYNSLDEVTEALARAGLESSN  114

Query  843   LIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFG  1022
             LIVGIDFTKSNEWTGK+SF  RSLH+IG  LNPYEQAISIIGKTLAAFD+DNLIPCFGFG
Sbjct  115   LIVGIDFTKSNEWTGKRSFGNRSLHHIGQNLNPYEQAISIIGKTLAAFDEDNLIPCFGFG  174

Query  1023  DASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             DASTHDQDVFSF+PDERFCNGFEEVL +YREI P+LKL
Sbjct  175   DASTHDQDVFSFFPDERFCNGFEEVLFRYREIVPQLKL  212



>gb|EPS58379.1| hypothetical protein M569_16435, partial [Genlisea aurea]
Length=251

 Score =   259 bits (663),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQR+LDRRYSRIADNY SLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKS+NGRSLH
Sbjct  84    PQRKLDRRYSRIADNYRSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSYNGRSLH  143

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             NIG GLNPYEQAISIIGKTLAAFDDDNLIPC+GFGDASTHDQDVFSF PD+RFC GFEEV
Sbjct  144   NIGSGLNPYEQAISIIGKTLAAFDDDNLIPCYGFGDASTHDQDVFSFNPDDRFCVGFEEV  203

Query  1098  LSQYREIAPRLKL  1136
             LS+YREI PRLKL
Sbjct  204   LSRYREIVPRLKL  216



>ref|XP_011101822.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Sesamum indicum]
 ref|XP_011101823.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Sesamum indicum]
 ref|XP_011101824.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Sesamum indicum]
Length=464

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 158/197 (80%), Gaps = 16/197 (8%)
 Frame = +3

Query  585   YEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqypp-psqDFASRNHAP--------  737
             ++Y Q++Y    Q + NYP QH YP+ A  PPQ +      +    S+ HAP        
Sbjct  28    HQYAQSSYS---QYAQNYPAQHPYPAPAGYPPQNEYCASPQNYGTQSQAHAPSQNNGPQF  84

Query  738   ----PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
                 PQ++LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK+S+NG
Sbjct  85    QLHAPQKQLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKRSYNG  144

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             RSLH+IG GLNPYEQAISI+GKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG
Sbjct  145   RSLHHIGSGLNPYEQAISIVGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  204

Query  1086  FEEVLSQYREIAPRLKL  1136
             FEEVLS+YREI P LKL
Sbjct  205   FEEVLSRYREIVPHLKL  221



>ref|XP_009778227.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
 ref|XP_009778228.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
 gb|AGL95792.1| RING-finger protein [Nicotiana tabacum]
Length=486

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 168/211 (80%), Gaps = 5/211 (2%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsy----appppq  683
             MGGKSSR+DSWRQ S + SS   Y YPQT      Q+SYNYP  H +       APPPPQ
Sbjct  1     MGGKSSREDSWRQTSSTRSSWNQYNYPQTQSSYPQQDSYNYPPSHHHQQAVPSYAPPPPQ  60

Query  684   eqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDF  863
             +   PPP Q     +H P + RLDRRYSRIADNY+SL+EVTEALAR GLESSNLIVGIDF
Sbjct  61    QNYPPPPPQQQNYPSHVP-KPRLDRRYSRIADNYSSLDEVTEALAREGLESSNLIVGIDF  119

Query  864   TKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQ  1043
             TKSNEWTGK+SF  RSLH+IG  LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQ
Sbjct  120   TKSNEWTGKRSFGSRSLHHIGQNLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQ  179

Query  1044  DVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             DVFSF+PDERFC GFEEVLS+YREI P LKL
Sbjct  180   DVFSFFPDERFCYGFEEVLSRYREIVPELKL  210



>ref|XP_011097361.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
 ref|XP_011097362.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
 ref|XP_011097363.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
Length=474

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQ++LDRRYSRIADNY SLEEVTEALARAGLESSNLI+GIDFTKSNEWTGK+S+NGRSLH
Sbjct  97    PQKKLDRRYSRIADNYRSLEEVTEALARAGLESSNLIIGIDFTKSNEWTGKRSYNGRSLH  156

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG GLNPYEQAI+IIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV
Sbjct  157   HIGSGLNPYEQAITIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  216

Query  1098  LSQYREIAPRLKL  1136
             LS+YRE+ P LKL
Sbjct  217   LSRYRELVPNLKL  229



>gb|EYU44849.1| hypothetical protein MIMGU_mgv1a005375mg [Erythranthe guttata]
 gb|EYU44850.1| hypothetical protein MIMGU_mgv1a005375mg [Erythranthe guttata]
Length=460

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 141/177 (80%), Gaps = 19/177 (11%)
 Frame = +3

Query  606   YPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNY  785
             YPPQ  E+ ++P Q+  P                   +S+ H P +++LDRRYSRIADNY
Sbjct  67    YPPQSYETPSHPPQNTGP-------------------SSQQHVPQKKKLDRRYSRIADNY  107

Query  786   NSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISII  965
             NSL EVTEAL  AGLESSNLIVGIDFTKSNEWTGK+S+NGRSLH+IG+GLNPYEQAISII
Sbjct  108   NSLHEVTEALKHAGLESSNLIVGIDFTKSNEWTGKRSYNGRSLHHIGNGLNPYEQAISII  167

Query  966   GKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             GKTLAAFDDDNLIPCFGFGDASTHDQ+VFSF  D+RF NGFEEVLSQYREI P LKL
Sbjct  168   GKTLAAFDDDNLIPCFGFGDASTHDQNVFSFNSDDRFSNGFEEVLSQYREIVPNLKL  224



>gb|EYU44848.1| hypothetical protein MIMGU_mgv1a005375mg [Erythranthe guttata]
Length=486

 Score =   249 bits (637),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 141/177 (80%), Gaps = 19/177 (11%)
 Frame = +3

Query  606   YPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNY  785
             YPPQ  E+ ++P Q+  P                   +S+ H P +++LDRRYSRIADNY
Sbjct  67    YPPQSYETPSHPPQNTGP-------------------SSQQHVPQKKKLDRRYSRIADNY  107

Query  786   NSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISII  965
             NSL EVTEAL  AGLESSNLIVGIDFTKSNEWTGK+S+NGRSLH+IG+GLNPYEQAISII
Sbjct  108   NSLHEVTEALKHAGLESSNLIVGIDFTKSNEWTGKRSYNGRSLHHIGNGLNPYEQAISII  167

Query  966   GKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             GKTLAAFDDDNLIPCFGFGDASTHDQ+VFSF  D+RF NGFEEVLSQYREI P LKL
Sbjct  168   GKTLAAFDDDNLIPCFGFGDASTHDQNVFSFNSDDRFSNGFEEVLSQYREIVPNLKL  224



>gb|KJB33860.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
Length=459

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             N    +R LDRRYSRIADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  67    NRGSDKRTLDRRYSRIADNYNSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  126

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             +SLH+IG+ LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPD+RFCNG
Sbjct  127   KSLHHIGNSLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDDRFCNG  186

Query  1086  FEEVLSQYREIAPRLKL  1136
             FEEVLS+YREI P L+L
Sbjct  187   FEEVLSRYREIVPHLRL  203



>emb|CDP16621.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 164/219 (75%), Gaps = 12/219 (5%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYP------QTAYPPQ-PQESYNYP----VQHayps  662
             MG  +SRD++ RQ+S S+S     +YP      Q +YP    Q+SY+YP    V    P 
Sbjct  1     MGASNSRDNNGRQSSSSSSWDQYNQYPPSVGYSQDSYPQSYQQDSYSYPSRPTVPAYGPP  60

Query  663   yappppqeqqypppsqDFASRNHAPP-QRRLDRRYSRIADNYNSLEEVTEALARAGLESS  839
                   Q       +Q +     AP  +R+LDRRYSRIADNYNSLEEVTEALARAGLESS
Sbjct  61    PPQQQQQHHYQGTSAQSYGYGGQAPAAERKLDRRYSRIADNYNSLEEVTEALARAGLESS  120

Query  840   NLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGF  1019
             NLIVGIDFTKSNEWTG++SF+GRSLH+IG+ LNPYEQAISIIGKTLAAFD+DN IPC+GF
Sbjct  121   NLIVGIDFTKSNEWTGRRSFHGRSLHHIGNTLNPYEQAISIIGKTLAAFDEDNQIPCYGF  180

Query  1020  GDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             GDASTHDQDVFSFYPD+  CNGFEEVLS+YREI P+LKL
Sbjct  181   GDASTHDQDVFSFYPDDEVCNGFEEVLSRYREIVPQLKL  219



>gb|KJB33861.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33862.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33863.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33864.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
 gb|KJB33865.1| hypothetical protein B456_006G034900 [Gossypium raimondii]
Length=466

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             N    +R LDRRYSRIADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  67    NRGSDKRTLDRRYSRIADNYNSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  126

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             +SLH+IG+ LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPD+RFCNG
Sbjct  127   KSLHHIGNSLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDDRFCNG  186

Query  1086  FEEVLSQYREIAPRLKL  1136
             FEEVLS+YREI P L+L
Sbjct  187   FEEVLSRYREIVPHLRL  203



>gb|KHG01454.1| E3 ubiquitin-protein ligase RGLG2 -like protein [Gossypium arboreum]
Length=476

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             N    +R LDRRYSRIADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  77    NRGSDKRTLDRRYSRIADNYNSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  136

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             +SLH+IG+ LNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPD+RFCNG
Sbjct  137   KSLHHIGNSLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDDRFCNG  196

Query  1086  FEEVLSQYREIAPRLKL  1136
             FEEVLS+YREI P L+L
Sbjct  197   FEEVLSRYREIVPHLRL  213



>ref|XP_007031645.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 ref|XP_007031646.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 ref|XP_007031648.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY02571.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY02572.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY02574.1| RING domain ligase2 isoform 1 [Theobroma cacao]
Length=485

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             +++H   +R LDRRYSRIADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SF
Sbjct  83    TQDHDRDKRTLDRRYSRIADNYNSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGKRSF  142

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH+IG GLNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ERFC
Sbjct  143   NRKSLHHIGDGLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPNERFC  202

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFE+VLS+YREI P L+L
Sbjct  203   NGFEDVLSRYREIVPHLRL  221



>ref|XP_007031647.1| RING domain ligase2 isoform 3 [Theobroma cacao]
 gb|EOY02573.1| RING domain ligase2 isoform 3 [Theobroma cacao]
Length=486

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             +++H   +R LDRRYSRIADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SF
Sbjct  83    TQDHDRDKRTLDRRYSRIADNYNSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGKRSF  142

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH+IG GLNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ERFC
Sbjct  143   NRKSLHHIGDGLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPNERFC  202

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFE+VLS+YREI P L+L
Sbjct  203   NGFEDVLSRYREIVPHLRL  221



>ref|XP_003618769.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
 gb|AES74987.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=486

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             QR+LDR+YSRIADNYNS++EVTEALARAGLESSNLI+GIDFTKSNEWTGK SFN +SLH+
Sbjct  94    QRKLDRKYSRIADNYNSIDEVTEALARAGLESSNLILGIDFTKSNEWTGKHSFNRKSLHH  153

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGFEEVL
Sbjct  154   IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERICNGFEEVL  213

Query  1101  SQYREIAPRLKL  1136
             S+YREI P +KL
Sbjct  214   SRYREIVPNIKL  225



>ref|XP_006579983.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X3 [Glycine 
max]
Length=484

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RLDR+YSRIADNYNS++EVTEALA AGLESSNLI+GIDFTKSNEWTGK SFN +SLH+
Sbjct  87    EKRLDRKYSRIADNYNSIDEVTEALAHAGLESSNLILGIDFTKSNEWTGKHSFNRKSLHH  146

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL
Sbjct  147   IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  206

Query  1101  SQYREIAPRLKL  1136
             SQYREI P ++L
Sbjct  207   SQYREIVPNIRL  218



>ref|XP_003524729.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Glycine 
max]
 ref|XP_006579982.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Glycine 
max]
 gb|KHN42754.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=491

 Score =   245 bits (625),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RLDR+YSRIADNYNS++EVTEALA AGLESSNLI+GIDFTKSNEWTGK SFN +SLH+
Sbjct  87    EKRLDRKYSRIADNYNSIDEVTEALAHAGLESSNLILGIDFTKSNEWTGKHSFNRKSLHH  146

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL
Sbjct  147   IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  206

Query  1101  SQYREIAPRLKL  1136
             SQYREI P ++L
Sbjct  207   SQYREIVPNIRL  218



>ref|XP_002526974.1| copine, putative [Ricinus communis]
 gb|EEF35461.1| copine, putative [Ricinus communis]
Length=461

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  636   YPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEAL  815
             YP QH Y S                  +S+N    +R+LDRRYSRIAD+Y SL++VTEAL
Sbjct  50    YPTQHTYGSEQQYQDYSGGDIRQQYHSSSQNFGGQRRQLDRRYSRIADDYKSLDQVTEAL  109

Query  816   ARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDD  995
             A+AGLESSNLIVGIDFTKSNEWTG +S+N RSLH+IG GLNPYEQAISIIGKTLAAFD+D
Sbjct  110   AQAGLESSNLIVGIDFTKSNEWTGARSYNRRSLHHIGDGLNPYEQAISIIGKTLAAFDED  169

Query  996   NLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             NLIPCFGFGDASTHDQDVF FYPDERFCNGFEEVLS+YREI P L+L
Sbjct  170   NLIPCFGFGDASTHDQDVFCFYPDERFCNGFEEVLSRYREIVPNLRL  216



>ref|XP_011005559.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005560.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005561.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005562.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
 ref|XP_011005563.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Populus euphratica]
Length=443

 Score =   243 bits (619),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +RRL+R+YSRIAD+Y SL +VTEALARAGLESSNLIVGIDFTKSNEWTG +S+N R LH+
Sbjct  67    RRRLERKYSRIADDYKSLHQVTEALARAGLESSNLIVGIDFTKSNEWTGARSYNRRCLHH  126

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG GLNPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL
Sbjct  127   IGDGLNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  186

Query  1101  SQYREIAPRLKL  1136
             S+YREI P L+L
Sbjct  187   SRYREIVPNLRL  198



>gb|KDO82164.1| hypothetical protein CISIN_1g0427521mg, partial [Citrus sinensis]
Length=336

 Score =   239 bits (610),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQRRLDR+YSRI DNY SL++VT ALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  65    PQRRLDRKYSRIDDNYKSLDQVTGALAHAGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  124

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IGHG NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD+  CNGFEEV
Sbjct  125   HIGHGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDDICCNGFEEV  184

Query  1098  LSQYREIAPRLKL  1136
             L+QYREI P L+L
Sbjct  185   LTQYREIVPSLRL  197



>gb|KJB75966.1| hypothetical protein B456_012G065700 [Gossypium raimondii]
 gb|KJB75967.1| hypothetical protein B456_012G065700 [Gossypium raimondii]
 gb|KJB75968.1| hypothetical protein B456_012G065700 [Gossypium raimondii]
Length=480

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 162/216 (75%), Gaps = 9/216 (4%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYE----YPQTAYPPQ-----PQESYNYPVQHaypsya  668
             MGG SS++ SWRQ S   S+  +++    YPQT+Y  +     PQ SY  P  + Y    
Sbjct  1     MGGSSSKEGSWRQGSSYHSNPPSWDSHQGYPQTSYGQENHSYPPQYSYAEPQYYPYSQPE  60

Query  669   ppppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLI  848
             P        P P    + ++    +++L R+YS+IADNYNSL++VTEALA AGLESSNLI
Sbjct  61    PQQHYPPPQPEPQYHPSPQDRVGDKKKLQRKYSKIADNYNSLDQVTEALANAGLESSNLI  120

Query  849   VGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDA  1028
             VGIDFTKSNEWTGK+SFN RSLH+IG G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDA
Sbjct  121   VGIDFTKSNEWTGKRSFNRRSLHHIGDGSNPYEQAISIIGKTLAAFDEDNLIPCFGFGDA  180

Query  1029  STHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             STHDQDVFSFYPDERFCNGFEEVLS+YRE+ P L+L
Sbjct  181   STHDQDVFSFYPDERFCNGFEEVLSRYRELVPHLRL  216



>ref|XP_003531323.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
Length=459

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 158/215 (73%), Gaps = 27/215 (13%)
 Frame = +3

Query  513   LMGGKSSRDDswrqasrstsssw-----NYEYPQT--AYPPQPQESYNYPVQHaypsyap  671
             +MGGKSS+    R  S   S+       +YEYPQ+  AYP Q    Y+ P+ H  P+   
Sbjct  25    IMGGKSSKGSERRHVSSYGSAGSSSSWDDYEYPQSPNAYPQQ--NPYHTPLHHRAPAPF-  81

Query  672   pppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIV  851
                               +++ P+R+LDRRYSRIAD+Y+SL+EVT AL+ AGLESSNLIV
Sbjct  82    -----------------HDYSQPKRKLDRRYSRIADDYHSLDEVTTALSHAGLESSNLIV  124

Query  852   GIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAS  1031
             GIDFTKSNEWTGK+SFN +SLH+IG G NPYEQAISIIGKTL+ FD+DNLIPCFGFGDAS
Sbjct  125   GIDFTKSNEWTGKRSFNRKSLHHIGSGQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDAS  184

Query  1032  THDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             THDQDVFSF+ DERFCNGFEEVLS+YR+I PRL+L
Sbjct  185   THDQDVFSFHSDERFCNGFEEVLSRYRDIVPRLRL  219



>ref|XP_006585247.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
 ref|XP_006585248.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
Length=460

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 158/215 (73%), Gaps = 27/215 (13%)
 Frame = +3

Query  513   LMGGKSSRDDswrqasrstsssw-----NYEYPQT--AYPPQPQESYNYPVQHaypsyap  671
             +MGGKSS+    R  S   S+       +YEYPQ+  AYP Q    Y+ P+ H  P+   
Sbjct  25    IMGGKSSKGSERRHVSSYGSAGSSSSWDDYEYPQSPNAYPQQ--NPYHTPLHHRAPAPF-  81

Query  672   pppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIV  851
                               +++ P+R+LDRRYSRIAD+Y+SL+EVT AL+ AGLESSNLIV
Sbjct  82    -----------------HDYSQPKRKLDRRYSRIADDYHSLDEVTTALSHAGLESSNLIV  124

Query  852   GIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAS  1031
             GIDFTKSNEWTGK+SFN +SLH+IG G NPYEQAISIIGKTL+ FD+DNLIPCFGFGDAS
Sbjct  125   GIDFTKSNEWTGKRSFNRKSLHHIGSGQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDAS  184

Query  1032  THDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             THDQDVFSF+ DERFCNGFEEVLS+YR+I PRL+L
Sbjct  185   THDQDVFSFHSDERFCNGFEEVLSRYRDIVPRLRL  219



>gb|KHG01849.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=503

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 167/222 (75%), Gaps = 15/222 (7%)
 Frame = +3

Query  507   IELMGGKSSRDDswrqasrstssswNYE----YPQTAYPPQPQESYNYPVQHaypsyapp  674
             + LMGG SS++ SWRQ S   S+  +++    YPQT+Y    QE++++P Q++Y      
Sbjct  21    VWLMGGSSSKEGSWRQGSSYHSNPPSWDSHQGYPQTSYG---QENHSFPPQYSYAEPQYY  77

Query  675   ppqeqqypppsqDFAS--RNHAPPQ------RRLDRRYSRIADNYNSLEEVTEALARAGL  830
             P  + +            + H  PQ      ++L R+YS+IADNYNSL++VTEALA AGL
Sbjct  78    PYSQPEPQQHYPPLQPEPQYHPSPQDRVGDKKKLQRKYSKIADNYNSLDQVTEALAIAGL  137

Query  831   ESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPC  1010
             ESSNLIVGIDFTKSNEWTGK+SFN RSLH+IG G NPYEQAISIIGKTLAAFD+DNLIPC
Sbjct  138   ESSNLIVGIDFTKSNEWTGKRSFNRRSLHHIGDGSNPYEQAISIIGKTLAAFDEDNLIPC  197

Query  1011  FGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             FGFGDASTHDQDVFSFYPDERFCNGFEEVLS+YRE+ P L+L
Sbjct  198   FGFGDASTHDQDVFSFYPDERFCNGFEEVLSRYRELVPYLRL  239



>gb|KHN06536.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=435

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 159/214 (74%), Gaps = 27/214 (13%)
 Frame = +3

Query  516   MGGKSS-----RDDswrqasrstssswNYEYPQT--AYPPQPQESYNYPVQHaypsyapp  674
             MGGKSS     R  S   ++ S+SS  +Y YPQ+  AYP Q    YN P+ H  P+    
Sbjct  1     MGGKSSKRSERRHVSSYGSAGSSSSRDSYGYPQSPNAYPQQ--NPYNTPLHHRAPAPF--  56

Query  675   ppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  854
                              +++ P+RRLDRRYSRIAD+Y+SL+EVT AL+ AGLESSNLIVG
Sbjct  57    ----------------HDYSRPKRRLDRRYSRIADDYHSLDEVTTALSHAGLESSNLIVG  100

Query  855   IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  1034
             IDFTKSNEWTGK+SFN +SLH+IG G NPYEQAISIIGKTL+ FD+DNLIPCFGFGDAST
Sbjct  101   IDFTKSNEWTGKRSFNRKSLHHIGSGQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDAST  160

Query  1035  HDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             HDQDVFSF+ DERFCNGFEEVLS+YR+I PRL+L
Sbjct  161   HDQDVFSFHSDERFCNGFEEVLSRYRDIVPRLRL  194



>ref|XP_004489546.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Cicer arietinum]
 ref|XP_004489547.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Cicer arietinum]
Length=460

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +R+L+R+YSRIADNYNS++EVTEALARAGLESSNLI+GIDFTKSNEWTGK+SFN +SLH+
Sbjct  85    RRKLERKYSRIADNYNSIDEVTEALARAGLESSNLILGIDFTKSNEWTGKRSFNRQSLHH  144

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSF+PDERFCNGFEEVL
Sbjct  145   IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFFPDERFCNGFEEVL  204

Query  1101  SQYREIAPRLKL  1136
             S+YREI P ++L
Sbjct  205   SRYREIVPSVRL  216



>ref|XP_003524251.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006580246.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
Length=460

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 160/215 (74%), Gaps = 27/215 (13%)
 Frame = +3

Query  513   LMGGKSS-----RDDswrqasrstssswNYEYPQT--AYPPQPQESYNYPVQHaypsyap  671
             +MGGKSS     R  S   ++ S+SS  +Y YPQ+  AYP Q    YN P+ H  P+   
Sbjct  25    IMGGKSSKRSERRHVSSYGSAGSSSSRDSYGYPQSPNAYPQQ--NPYNTPLHHRAPAPF-  81

Query  672   pppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIV  851
                               +++ P+RRLDRRYSRIAD+Y+SL+EVT AL+ AGLESSNLIV
Sbjct  82    -----------------HDYSRPKRRLDRRYSRIADDYHSLDEVTTALSHAGLESSNLIV  124

Query  852   GIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAS  1031
             GIDFTKSNEWTGK+SFN +SLH+IG G NPYEQAISIIGKTL+ FD+DNLIPCFGFGDAS
Sbjct  125   GIDFTKSNEWTGKRSFNRKSLHHIGSGQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDAS  184

Query  1032  THDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             THDQDVFSF+ DERFC+GFEEVLS+YR+I PRL+L
Sbjct  185   THDQDVFSFHSDERFCHGFEEVLSRYRDIVPRLRL  219



>ref|XP_010248698.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nelumbo nucifera]
 ref|XP_010248699.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nelumbo nucifera]
 ref|XP_010248701.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Nelumbo nucifera]
Length=445

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P+R+L+RRYSRIADNYNSLE+VTEALA+AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  66    PRRKLERRYSRIADNYNSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGARSFNRRSLH  125

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             ++G   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGFEE 
Sbjct  126   HLGDTQNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDERLCNGFEEA  185

Query  1098  LSQYREIAPRLKL  1136
             L+QYREI P L+L
Sbjct  186   LTQYREIVPHLRL  198



>ref|XP_004304674.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468321.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   241 bits (615),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +R+LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK SFN RSLH+
Sbjct  85    KRKLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKNSFNRRSLHH  144

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG G NPYE AI+IIGKTLAAFD+DN+IPC+GFGDA+THDQDVFSFYPD+R CNGFEEVL
Sbjct  145   IGGGQNPYEHAITIIGKTLAAFDEDNIIPCYGFGDATTHDQDVFSFYPDDRHCNGFEEVL  204

Query  1101  SQYREIAPRLKL  1136
             ++YREI P L+L
Sbjct  205   TRYREIVPNLRL  216



>ref|XP_006438209.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51449.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
Length=336

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQRRLDR+YSRI DNY SL++VT ALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  65    PQRRLDRKYSRIDDNYKSLDQVTGALAHAGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  124

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IGHG NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD+  CNGFEEV
Sbjct  125   HIGHGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDDICCNGFEEV  184

Query  1098  LSQYREIAPRLKL  1136
             L++YREI P L+L
Sbjct  185   LTRYREIIPSLRL  197



>ref|XP_012071725.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Jatropha curcas]
 ref|XP_012071734.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Jatropha curcas]
 gb|KDP46390.1| hypothetical protein JCGZ_10230 [Jatropha curcas]
Length=464

 Score =   241 bits (614),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 162/217 (75%), Gaps = 13/217 (6%)
 Frame = +3

Query  516   MGGKSSRD-----DswrqasrstssswNYEYPQTAYPPQPQESYNY---PVQHaypsyap  671
             MGGK+SR+     +S  ++S S+S   ++ YPQT+Y    QESY Y   P Q        
Sbjct  1     MGGKNSREGSWRSNSSIRSSSSSSYGSHHGYPQTSYG---QESYGYNQAPQQSYSQESYS  57

Query  672   pppqeqqypppsqDFASRNHAPPQRR--LDRRYSRIADNYNSLEEVTEALARAGLESSNL  845
                  QQ     Q ++S++++    R  L+R+YSRIAD+Y SL++VT ALARAGLESSNL
Sbjct  58    YNYPSQQSYGSQQHYSSQDYSTSNNRKHLERKYSRIADDYKSLDQVTAALARAGLESSNL  117

Query  846   IVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGD  1025
             IVGIDFTKSNEWTG KSFN RSLH+IG GLNPYEQAISIIGKTLAAFD+DNLIPCFGFGD
Sbjct  118   IVGIDFTKSNEWTGAKSFNRRSLHHIGDGLNPYEQAISIIGKTLAAFDEDNLIPCFGFGD  177

Query  1026  ASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             ASTHDQDVF F PD+RFCNGFEEVLS+YREI P L+L
Sbjct  178   ASTHDQDVFCFNPDDRFCNGFEEVLSRYREIVPHLRL  214



>ref|XP_008458835.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
 ref|XP_008458837.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
 ref|XP_008458838.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
 ref|XP_008458839.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Cucumis melo]
Length=447

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             RRLDR+YSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+I
Sbjct  63    RRLDRKYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHI  122

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYP-DERFCNGFEEVL  1100
             G   NPY+QAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSF+P +ERFCNGFEEVL
Sbjct  123   GDQPNPYQQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFFPEEERFCNGFEEVL  182

Query  1101  SQYREIAPRLKL  1136
             S+Y+EIAP L+L
Sbjct  183   SRYQEIAPHLRL  194



>gb|EPS60918.1| hypothetical protein M569_13882, partial [Genlisea aurea]
Length=368

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             +RN   P ++ DRRYSRIADNYNSL++V+EALARAGLESSNLI+GIDFTKSNEWTGK S+
Sbjct  68    ARNLQAPNKKFDRRYSRIADNYNSLDQVSEALARAGLESSNLIIGIDFTKSNEWTGKNSY  127

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             NG SLH+ G GLNPYEQAI+IIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSF  D R C
Sbjct  128   NGLSLHHTGTGLNPYEQAITIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFCSDGRSC  187

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVLS+YRE+ P LKL
Sbjct  188   NGFEEVLSRYRELVPNLKL  206



>gb|KHG01850.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=469

 Score =   241 bits (614),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +++L R+YS+IADNYNSL++VTEALA AGLESSNLIVGIDFTKSNEWTGK+SFN RSLH+
Sbjct  74    KKKLQRKYSKIADNYNSLDQVTEALAIAGLESSNLIVGIDFTKSNEWTGKRSFNRRSLHH  133

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL
Sbjct  134   IGDGSNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  193

Query  1101  SQYREIAPRLKL  1136
             S+YRE+ P L+L
Sbjct  194   SRYRELVPYLRL  205



>gb|EYU34755.1| hypothetical protein MIMGU_mgv1a006209mg [Erythranthe guttata]
Length=452

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQ++ DRRYSRIADNYNSLEEVTEAL RAGLESSNLI+GIDFTKSNEWTGK+S+NG+SLH
Sbjct  82    PQKKFDRRYSRIADNYNSLEEVTEALGRAGLESSNLIIGIDFTKSNEWTGKRSYNGKSLH  141

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
              IG+  NPYEQAISIIGKTLA FD+DNLIPCFGFGDA THDQDVFSFYPDER  NGFEEV
Sbjct  142   YIGNEQNPYEQAISIIGKTLAVFDEDNLIPCFGFGDAYTHDQDVFSFYPDERVSNGFEEV  201

Query  1098  LSQYREIAPRLKL  1136
             LS+YRE+ P+LKL
Sbjct  202   LSRYRELVPQLKL  214



>ref|XP_004142779.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Cucumis 
sativus]
 ref|XP_011655385.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Cucumis 
sativus]
 ref|XP_011655386.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Cucumis 
sativus]
 ref|XP_011655387.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Cucumis 
sativus]
 gb|KGN51346.1| hypothetical protein Csa_5G522920 [Cucumis sativus]
Length=447

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+I
Sbjct  63    RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHI  122

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYP-DERFCNGFEEVL  1100
             G   NPY+QAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSF+P +ERFCNGFEEVL
Sbjct  123   GDQPNPYQQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFFPEEERFCNGFEEVL  182

Query  1101  SQYREIAPRLKL  1136
             ++Y+EIAP L+L
Sbjct  183   NRYQEIAPHLRL  194



>ref|XP_006374543.1| hypothetical protein POPTR_0015s09780g [Populus trichocarpa]
 gb|ERP52340.1| hypothetical protein POPTR_0015s09780g [Populus trichocarpa]
Length=432

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             + AP  RRL+R+YSRI DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SFN 
Sbjct  52    DRAPNSRRLERKYSRIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFNR  111

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSF+PDERFCNG
Sbjct  112   RSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFFPDERFCNG  171

Query  1086  FEEVLSQYREIAPRLKL  1136
             F EVL+QYRE+AP+L+L
Sbjct  172   FAEVLTQYRELAPQLRL  188



>ref|XP_002271885.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Vitis 
vinifera]
 emb|CBI34842.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 140/195 (72%), Gaps = 37/195 (19%)
 Frame = +3

Query  591   YPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQ---------  743
             YP  A P QP  SY  P Q+                        ++H PPQ         
Sbjct  44    YPSYAPPQQPYPSYAPPQQY------------------------QSHEPPQQNYSSSQGN  79

Query  744   ----RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRS  911
                 RRL+R YSRIAD+Y SL+EVT ALARAGLESSNLIVGIDFTKSNEWTG +SFN +S
Sbjct  80    GDNRRRLERMYSRIADDYRSLDEVTAALARAGLESSNLIVGIDFTKSNEWTGARSFNRQS  139

Query  912   LHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFE  1091
             LH++G GLNPY+QAISIIGKTLAAFD+DN+IPCFGFGDASTHDQDVFSFY DERFCNGFE
Sbjct  140   LHHVGDGLNPYQQAISIIGKTLAAFDEDNMIPCFGFGDASTHDQDVFSFYEDERFCNGFE  199

Query  1092  EVLSQYREIAPRLKL  1136
             EVLS+YREI PRL+L
Sbjct  200   EVLSRYREIVPRLRL  214



>gb|KHG01848.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=480

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 165/219 (75%), Gaps = 15/219 (7%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYE----YPQTAYPPQPQESYNYPVQHaypsyappppq  683
             MGG SS++ SWRQ S   S+  +++    YPQT+Y    QE++++P Q++Y      P  
Sbjct  1     MGGSSSKEGSWRQGSSYHSNPPSWDSHQGYPQTSYG---QENHSFPPQYSYAEPQYYPYS  57

Query  684   eqqypppsqDFAS--RNHAPPQ------RRLDRRYSRIADNYNSLEEVTEALARAGLESS  839
             + +            + H  PQ      ++L R+YS+IADNYNSL++VTEALA AGLESS
Sbjct  58    QPEPQQHYPPLQPEPQYHPSPQDRVGDKKKLQRKYSKIADNYNSLDQVTEALAIAGLESS  117

Query  840   NLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGF  1019
             NLIVGIDFTKSNEWTGK+SFN RSLH+IG G NPYEQAISIIGKTLAAFD+DNLIPCFGF
Sbjct  118   NLIVGIDFTKSNEWTGKRSFNRRSLHHIGDGSNPYEQAISIIGKTLAAFDEDNLIPCFGF  177

Query  1020  GDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             GDASTHDQDVFSFYPDERFCNGFEEVLS+YRE+ P L+L
Sbjct  178   GDASTHDQDVFSFYPDERFCNGFEEVLSRYRELVPYLRL  216



>ref|XP_010660842.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Vitis 
vinifera]
Length=485

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 140/195 (72%), Gaps = 37/195 (19%)
 Frame = +3

Query  591   YPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQ---------  743
             YP  A P QP  SY  P Q+                        ++H PPQ         
Sbjct  44    YPSYAPPQQPYPSYAPPQQY------------------------QSHEPPQQNYSSSQGN  79

Query  744   ----RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRS  911
                 RRL+R YSRIAD+Y SL+EVT ALARAGLESSNLIVGIDFTKSNEWTG +SFN +S
Sbjct  80    GDNRRRLERMYSRIADDYRSLDEVTAALARAGLESSNLIVGIDFTKSNEWTGARSFNRQS  139

Query  912   LHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFE  1091
             LH++G GLNPY+QAISIIGKTLAAFD+DN+IPCFGFGDASTHDQDVFSFY DERFCNGFE
Sbjct  140   LHHVGDGLNPYQQAISIIGKTLAAFDEDNMIPCFGFGDASTHDQDVFSFYEDERFCNGFE  199

Query  1092  EVLSQYREIAPRLKL  1136
             EVLS+YREI PRL+L
Sbjct  200   EVLSRYREIVPRLRL  214



>gb|KDO49018.1| hypothetical protein CISIN_1g015418mg [Citrus sinensis]
Length=407

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 157/209 (75%), Gaps = 11/209 (5%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  689
             MGG+SSR+ SWRQ S   S+S +++ PQT Y   P  QES NYP Q   P       Q  
Sbjct  1     MGGRSSREASWRQDSSFRSTSSSWD-PQTGYLQSPYGQESQNYPPQTYPPPQTYSTQQYY  59

Query  690   qypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  869
                      +S  H+   R+LDRRYSRIAD+Y SL++VTEALARAGLESSNLIVGIDFTK
Sbjct  60    P--------SSEEHSGNTRKLDRRYSRIADDYKSLDQVTEALARAGLESSNLIVGIDFTK  111

Query  870   SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  1049
             SNEWTGK+SFN RSLH IG GLNPYEQAISIIGKTLA FD+DNLIPC+GFGDASTHDQDV
Sbjct  112   SNEWTGKRSFNRRSLHYIGDGLNPYEQAISIIGKTLAVFDEDNLIPCYGFGDASTHDQDV  171

Query  1050  FSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             FSFY   RFC GFEEVLS+YREI P LKL
Sbjct  172   FSFYSGGRFCYGFEEVLSRYREIVPNLKL  200



>ref|XP_003553280.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006603981.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
 ref|XP_006603982.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
Length=496

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RLDR+YSRI DNYNS++EVTEALARAGLESSNLI+GIDFTKSNEWTGK SFN +SLH+
Sbjct  87    EKRLDRKYSRITDNYNSIDEVTEALARAGLESSNLILGIDFTKSNEWTGKHSFNRKSLHH  146

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGFEEVL
Sbjct  147   IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERICNGFEEVL  206

Query  1101  SQYREIAPRLKL  1136
             S+YREI P ++L
Sbjct  207   SRYREIVPIIRL  218



>gb|KDO49015.1| hypothetical protein CISIN_1g015418mg [Citrus sinensis]
 gb|KDO49016.1| hypothetical protein CISIN_1g015418mg [Citrus sinensis]
 gb|KDO49017.1| hypothetical protein CISIN_1g015418mg [Citrus sinensis]
Length=405

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 157/209 (75%), Gaps = 11/209 (5%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  689
             MGG+SSR+ SWRQ S   S+S +++ PQT Y   P  QES NYP Q   P       Q  
Sbjct  1     MGGRSSREASWRQDSSFRSTSSSWD-PQTGYLQSPYGQESQNYPPQTYPPPQTYSTQQYY  59

Query  690   qypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  869
                      +S  H+   R+LDRRYSRIAD+Y SL++VTEALARAGLESSNLIVGIDFTK
Sbjct  60    P--------SSEEHSGNTRKLDRRYSRIADDYKSLDQVTEALARAGLESSNLIVGIDFTK  111

Query  870   SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  1049
             SNEWTGK+SFN RSLH IG GLNPYEQAISIIGKTLA FD+DNLIPC+GFGDASTHDQDV
Sbjct  112   SNEWTGKRSFNRRSLHYIGDGLNPYEQAISIIGKTLAVFDEDNLIPCYGFGDASTHDQDV  171

Query  1050  FSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             FSFY   RFC GFEEVLS+YREI P LKL
Sbjct  172   FSFYSGGRFCYGFEEVLSRYREIVPNLKL  200



>ref|XP_002321646.1| hypothetical protein POPTR_0015s09780g [Populus trichocarpa]
 gb|EEF05773.1| hypothetical protein POPTR_0015s09780g [Populus trichocarpa]
Length=414

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             + AP  RRL+R+YSRI DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SFN 
Sbjct  52    DRAPNSRRLERKYSRIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFNR  111

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSF+PDERFCNG
Sbjct  112   RSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFFPDERFCNG  171

Query  1086  FEEVLSQYREIAPRLKL  1136
             F EVL+QYRE+AP+L+L
Sbjct  172   FAEVLTQYRELAPQLRL  188



>ref|XP_011655384.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Cucumis 
sativus]
Length=471

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+I
Sbjct  87    RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHI  146

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYP-DERFCNGFEEVL  1100
             G   NPY+QAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSF+P +ERFCNGFEEVL
Sbjct  147   GDQPNPYQQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFFPEEERFCNGFEEVL  206

Query  1101  SQYREIAPRLKL  1136
             ++Y+EIAP L+L
Sbjct  207   NRYQEIAPHLRL  218



>gb|AFN89139.1| RING-type ubiquitin ligase [Mesembryanthemum crystallinum]
Length=472

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 127/134 (95%), Gaps = 1/134 (1%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P++RLDRRYSRIAD+Y+SL++VTEALA AGLESSNLIVGIDFTKSNEWTG KSFN +SLH
Sbjct  77    PKKRLDRRYSRIADDYSSLDQVTEALAHAGLESSNLIVGIDFTKSNEWTGAKSFNRKSLH  136

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE-RFCNGFEE  1094
             +IG GLNPY+QAI+IIGKTLAAFDDDNLIPC+GFGDASTHDQDVFSFYPDE R+CNGFEE
Sbjct  137   HIGDGLNPYQQAIAIIGKTLAAFDDDNLIPCYGFGDASTHDQDVFSFYPDEGRYCNGFEE  196

Query  1095  VLSQYREIAPRLKL  1136
             VLS+YREI P L+L
Sbjct  197   VLSRYREIVPNLRL  210



>ref|XP_011042369.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
Length=460

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQ+RLDR+YSRIADNY +L++VT ALA+AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  77    PQKRLDRKYSRIADNYKTLDQVTAALAQAGLESSNLIVGIDFTKSNEWTGARSFNRRSLH  136

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG+G NPYEQAISIIGKTL+AFD+DNLIPC+GFGDASTHDQDVFSF+PDERFCNGFEEV
Sbjct  137   HIGNGQNPYEQAISIIGKTLSAFDEDNLIPCYGFGDASTHDQDVFSFFPDERFCNGFEEV  196

Query  1098  LSQYREIAPRLKL  1136
             L QY+EI P L+L
Sbjct  197   LMQYKEIVPNLRL  209



>ref|XP_006446649.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 ref|XP_006446650.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 ref|XP_006446651.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 gb|ESR59889.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 gb|ESR59890.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
 gb|ESR59891.1| hypothetical protein CICLE_v10015247mg [Citrus clementina]
Length=445

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 157/209 (75%), Gaps = 11/209 (5%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  689
             MGG+SSR+ SWRQ S   S+S +++ PQT Y   P  QES NYP Q   P       Q  
Sbjct  1     MGGRSSREASWRQDSSFRSTSSSWD-PQTGYLQSPYGQESQNYPPQTYPPPQTYSTQQYY  59

Query  690   qypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  869
                      +S  H+   R+LDRRYSRIAD+Y SL++VTEALARAGLESSNLIVGIDFTK
Sbjct  60    P--------SSEEHSGNTRKLDRRYSRIADDYKSLDQVTEALARAGLESSNLIVGIDFTK  111

Query  870   SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  1049
             SNEWTGK+SFN RSLH IG GLNPYEQAISIIGKTLA FD+DNLIPC+GFGDASTHDQDV
Sbjct  112   SNEWTGKRSFNRRSLHYIGDGLNPYEQAISIIGKTLAVFDEDNLIPCYGFGDASTHDQDV  171

Query  1050  FSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             FSFY   RFC GFEEVLS+YREI P LKL
Sbjct  172   FSFYSGGRFCYGFEEVLSRYREIVPNLKL  200



>gb|KEH20743.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=475

 Score =   238 bits (608),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 141/186 (76%), Gaps = 18/186 (10%)
 Frame = +3

Query  582   NYEYPQTAYPPQPQES-YNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDR  758
             NY YPQ+ YP  PQ++ Y  P                          S +++ P R+LDR
Sbjct  62    NYGYPQSTYPYPPQQNPYQRPNHRPPTQA-----------------PSHDYSRPNRKLDR  104

Query  759   RYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLN  938
             RYSRIAD+Y+SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+IG+G N
Sbjct  105   RYSRIADDYHSLDEVTAALSHAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHHIGNGQN  164

Query  939   PYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREI  1118
             PYEQAI+IIGKTL AFD+DNLIPCFGFGDASTHDQDVFSF+ DER CNGFEEVLS+YREI
Sbjct  165   PYEQAIAIIGKTLTAFDEDNLIPCFGFGDASTHDQDVFSFHSDERCCNGFEEVLSKYREI  224

Query  1119  APRLKL  1136
              P L+L
Sbjct  225   VPCLRL  230



>ref|XP_007151612.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
 ref|XP_007151613.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
 gb|ESW23606.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
 gb|ESW23607.1| hypothetical protein PHAVU_004G061800g [Phaseolus vulgaris]
Length=506

 Score =   239 bits (610),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +++LDR+YSRIADNYNS++EVTEALARAGLESSNLI+GID TKSNEWTGK SFN +SLH+
Sbjct  85    EKQLDRKYSRIADNYNSIDEVTEALARAGLESSNLIMGIDCTKSNEWTGKHSFNRKSLHH  144

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+G NPYEQAISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL
Sbjct  145   IGNGPNPYEQAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  204

Query  1101  SQYREIAPRLKL  1136
              +YREI P ++L
Sbjct  205   GRYREIVPNIRL  216



>gb|KCW59705.1| hypothetical protein EUGRSUZ_H02465 [Eucalyptus grandis]
Length=432

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  714   FASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  893
             + S+   P ++RLDR+YSRIADNY SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTG +
Sbjct  60    YGSQTPQPMKKRLDRKYSRIADNYRSLDEVTAALSEAGLESSNLIVGIDFTKSNEWTGAR  119

Query  894   SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  1073
             SF+ RSLH+IG G NPYEQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVFSFYPD+R
Sbjct  120   SFHRRSLHHIGGGRNPYEQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFSFYPDDR  179

Query  1074  FCNGFEEVLSQYREIAPRLKL  1136
             FCNGFEEVL++YRE+ P+LKL
Sbjct  180   FCNGFEEVLARYREVVPQLKL  200



>ref|XP_010089180.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
 gb|EXB37451.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
Length=472

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = +3

Query  726   NHAPPQRR-LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFN  902
             +HA   RR LDRRYSRIADNYNSL+EVT ALA AGLESSNLIVGIDFTKSNEWTG KSFN
Sbjct  87    SHAADGRRGLDRRYSRIADNYNSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGAKSFN  146

Query  903   GRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCN  1082
              +SLH+IG   NPYEQAISIIGKTLAAFD+DNLIPC GFGDASTHDQDVFSFYPDERFCN
Sbjct  147   RKSLHHIGESRNPYEQAISIIGKTLAAFDEDNLIPCLGFGDASTHDQDVFSFYPDERFCN  206

Query  1083  GFEEVLSQYREIAPRLKL  1136
             GFE+VLS+YREI P L+L
Sbjct  207   GFEDVLSRYREIVPHLRL  224



>ref|XP_011625111.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Amborella trichopoda]
 ref|XP_011625112.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Amborella trichopoda]
Length=430

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P+R+L+RRYSRIADNY+SLE+VTEALA+AGLESSNLIVGIDFTKSNEWTG++SFNGR LH
Sbjct  47    PRRKLERRYSRIADNYSSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGRRSFNGRCLH  106

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYPDE+ C GFEE 
Sbjct  107   HIGDTSNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPDEKLCCGFEEA  166

Query  1098  LSQYREIAPRLKL  1136
             LS+YREI P LKL
Sbjct  167   LSRYREIVPYLKL  179



>ref|XP_010029080.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010029081.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010029082.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010029084.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW55926.1| hypothetical protein EUGRSUZ_I01722 [Eucalyptus grandis]
Length=516

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +RRLD+RYS IAD YNS+EEVTEALARAGLESSNL+VGIDFTKSNEWTG KSFN RSLH+
Sbjct  109   RRRLDKRYSTIADGYNSVEEVTEALARAGLESSNLLVGIDFTKSNEWTGAKSFNKRSLHD  168

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             I  GLNPYEQAISII +TLAAFDDDNLIPCFGFGDASTHDQDVFSFYPD+++CNGFEEVL
Sbjct  169   ISDGLNPYEQAISIIWRTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDDKYCNGFEEVL  228

Query  1101  SQYREIAPRLKL  1136
              +YREI P LKL
Sbjct  229   HRYREILPHLKL  240



>ref|XP_010029085.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Eucalyptus grandis]
 gb|KCW55925.1| hypothetical protein EUGRSUZ_I01722 [Eucalyptus grandis]
Length=515

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +RRLD+RYS IAD YNS+EEVTEALARAGLESSNL+VGIDFTKSNEWTG KSFN RSLH+
Sbjct  109   RRRLDKRYSTIADGYNSVEEVTEALARAGLESSNLLVGIDFTKSNEWTGAKSFNKRSLHD  168

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             I  GLNPYEQAISII +TLAAFDDDNLIPCFGFGDASTHDQDVFSFYPD+++CNGFEEVL
Sbjct  169   ISDGLNPYEQAISIIWRTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDDKYCNGFEEVL  228

Query  1101  SQYREIAPRLKL  1136
              +YREI P LKL
Sbjct  229   HRYREILPHLKL  240



>gb|ERN10544.1| hypothetical protein AMTR_s00166p00070360 [Amborella trichopoda]
Length=440

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P+R+L+RRYSRIADNY+SLE+VTEALA+AGLESSNLIVGIDFTKSNEWTG++SFNGR LH
Sbjct  47    PRRKLERRYSRIADNYSSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGRRSFNGRCLH  106

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYPDE+ C GFEE 
Sbjct  107   HIGDTSNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPDEKLCCGFEEA  166

Query  1098  LSQYREIAPRLKL  1136
             LS+YREI P LKL
Sbjct  167   LSRYREIVPYLKL  179



>ref|XP_006591484.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
 gb|KHN44377.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=437

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 154/208 (74%), Gaps = 17/208 (8%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQ-PQESYNYPVQHaypsyappppqeqq  692
             MGGKSS+    R    ++SSS +  Y    YPPQ P  SY  P QH   S +   P    
Sbjct  1     MGGKSSKGSGRRYDFGASSSSRDNSY--GGYPPQSPYTSYQTP-QHPCASASASAPFY--  55

Query  693   ypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKS  872
                        ++A P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKS
Sbjct  56    -----------DYAQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTKS  104

Query  873   NEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVF  1052
             NEWTGK+SFN +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVF
Sbjct  105   NEWTGKRSFNRKSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVF  164

Query  1053  SFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             SF+ +ERFCNGFEEVL++YR+I P LKL
Sbjct  165   SFFSEERFCNGFEEVLTRYRQIIPSLKL  192



>gb|KCW59704.1| hypothetical protein EUGRSUZ_H02465 [Eucalyptus grandis]
Length=456

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  714   FASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  893
             + S+   P ++RLDR+YSRIADNY SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTG +
Sbjct  60    YGSQTPQPMKKRLDRKYSRIADNYRSLDEVTAALSEAGLESSNLIVGIDFTKSNEWTGAR  119

Query  894   SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  1073
             SF+ RSLH+IG G NPYEQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVFSFYPD+R
Sbjct  120   SFHRRSLHHIGGGRNPYEQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFSFYPDDR  179

Query  1074  FCNGFEEVLSQYREIAPRLKL  1136
             FCNGFEEVL++YRE+ P+LKL
Sbjct  180   FCNGFEEVLARYREVVPQLKL  200



>ref|XP_003538591.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006591483.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
Length=463

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 155/209 (74%), Gaps = 17/209 (8%)
 Frame = +3

Query  513   LMGGKSSRDDswrqasrstssswNYEYPQTAYPPQ-PQESYNYPVQHaypsyappppqeq  689
             +MGGKSS+    R    ++SSS +  Y    YPPQ P  SY  P QH   S +   P   
Sbjct  26    VMGGKSSKGSGRRYDFGASSSSRDNSY--GGYPPQSPYTSYQTP-QHPCASASASAPFY-  81

Query  690   qypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  869
                         ++A P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTK
Sbjct  82    ------------DYAQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTK  129

Query  870   SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  1049
             SNEWTGK+SFN +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDV
Sbjct  130   SNEWTGKRSFNRKSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDV  189

Query  1050  FSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             FSF+ +ERFCNGFEEVL++YR+I P LKL
Sbjct  190   FSFFSEERFCNGFEEVLTRYRQIIPSLKL  218



>ref|XP_010100348.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
 gb|EXB82482.1| E3 ubiquitin-protein ligase RGLG2 [Morus notabilis]
Length=448

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQRRL+R+YSRI+D+Y SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  60    PQRRLERKYSRISDDYRSLDEVTSALSHAGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  119

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG+G NPYEQAISIIGKTL+ FDDDNLIPCFGFGDASTHD+DVFSFYP+ERFCNGFEEV
Sbjct  120   HIGNGQNPYEQAISIIGKTLSTFDDDNLIPCFGFGDASTHDKDVFSFYPNERFCNGFEEV  179

Query  1098  LSQYREIAPRLKL  1136
             L++YRE+AP L+L
Sbjct  180   LTRYRELAPDLRL  192



>ref|XP_006438208.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 ref|XP_006438210.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 ref|XP_006438211.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51448.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51450.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
 gb|ESR51451.1| hypothetical protein CICLE_v10031509mg [Citrus clementina]
Length=453

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQRRLDR+YSRI DNY SL++VT ALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  65    PQRRLDRKYSRIDDNYKSLDQVTGALAHAGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  124

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IGHG NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD+  CNGFEEV
Sbjct  125   HIGHGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDDICCNGFEEV  184

Query  1098  LSQYREIAPRLKL  1136
             L++YREI P L+L
Sbjct  185   LTRYREIIPSLRL  197



>ref|XP_006483979.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Citrus sinensis]
 ref|XP_006483980.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Citrus sinensis]
Length=453

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQRRLDR+YSRI DNY SL++VT ALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  65    PQRRLDRKYSRIDDNYKSLDQVTGALAHAGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  124

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IGHG NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD+  CNGFEEV
Sbjct  125   HIGHGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDDICCNGFEEV  184

Query  1098  LSQYREIAPRLKL  1136
             L++YREI P L+L
Sbjct  185   LTRYREIIPSLRL  197



>ref|XP_006470207.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Citrus sinensis]
 ref|XP_006470208.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Citrus sinensis]
Length=445

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 157/209 (75%), Gaps = 11/209 (5%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  689
             MGG+SSR+ SWRQ S   S+S +++ PQT Y   P  QES NYP Q   P       Q  
Sbjct  1     MGGRSSREASWRQDSSFRSTSSSWD-PQTGYLQSPYGQESQNYPPQTYPPPQTYSTQQYY  59

Query  690   qypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTK  869
                      +S  H+   R+LDRRYSRIAD+Y SL++VTEALARAGLESSNLIVGIDFTK
Sbjct  60    P--------SSEEHSGNTRKLDRRYSRIADDYKSLDQVTEALARAGLESSNLIVGIDFTK  111

Query  870   SNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDV  1049
             SNEWTGK+SFN +SLH IG GLNPYEQAISIIGKTLA FD+DNLIPC+GFGDASTHDQDV
Sbjct  112   SNEWTGKRSFNRQSLHYIGDGLNPYEQAISIIGKTLAVFDEDNLIPCYGFGDASTHDQDV  171

Query  1050  FSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             FSFY   RFC GFEEVLS+YREI P LKL
Sbjct  172   FSFYSGGRFCYGFEEVLSRYREIVPNLKL  200



>ref|XP_010524290.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Tarenaya hassleriana]
 ref|XP_010524291.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Tarenaya hassleriana]
Length=375

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             S++H   +++L+R+YSRIAD+Y+SLE+VTEALA AGLESSNLIVG+DFTKSNEWTG KSF
Sbjct  45    SQSHGNGRKKLERKYSRIADDYSSLEQVTEALALAGLESSNLIVGVDFTKSNEWTGAKSF  104

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH  G  LNPYEQAI+IIGKTLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFC
Sbjct  105   NKKSLHFTGISLNPYEQAITIIGKTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFC  164

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL++YREI P+LKL
Sbjct  165   NGFEEVLARYREIVPQLKL  183



>gb|KHN43980.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=433

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             ++A P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  52    DYAQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  111

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFY +ERFCNG
Sbjct  112   KSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYSEERFCNG  171

Query  1086  FEEVLSQYREIAPRLKL  1136
             FEEVL++YR+I P LKL
Sbjct  172   FEEVLTRYRQIIPSLKL  188



>ref|XP_010250995.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Nelumbo nucifera]
Length=450

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P+R+L+RRYSRIADNYNSLE+VTEALA+AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  72    PRRKLERRYSRIADNYNSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGARSFNRRSLH  131

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             ++G   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGFEE 
Sbjct  132   HLGDSQNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDERDCNGFEEA  191

Query  1098  LSQYREIAPRLKL  1136
             L++YRE+ P L+L
Sbjct  192   LTRYREVVPNLRL  204



>ref|XP_010250991.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010250992.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010250993.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Nelumbo nucifera]
Length=451

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P+R+L+RRYSRIADNYNSLE+VTEALA+AGLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  72    PRRKLERRYSRIADNYNSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGARSFNRRSLH  131

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             ++G   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGFEE 
Sbjct  132   HLGDSQNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDERDCNGFEEA  191

Query  1098  LSQYREIAPRLKL  1136
             L++YRE+ P L+L
Sbjct  192   LTRYREVVPNLRL  204



>ref|XP_011005612.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
Length=452

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             + AP  RRL+R+YSRI DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SFN 
Sbjct  52    DRAPNSRRLERKYSRIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFNR  111

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSF+PDERFCNG
Sbjct  112   RSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFFPDERFCNG  171

Query  1086  FEEVLSQYREIAPRLKL  1136
             F EVL++YRE+AP+L+L
Sbjct  172   FAEVLTRYRELAPQLRL  188



>gb|KJB11578.1| hypothetical protein B456_001G266800 [Gossypium raimondii]
 gb|KJB11579.1| hypothetical protein B456_001G266800 [Gossypium raimondii]
Length=448

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             +R+H   +  L RRYS IAD+YNSL++VTEALA AGLESSNLIVGIDFTKSN WTGK+SF
Sbjct  64    TRDHGNDKTMLQRRYSSIADSYNSLDQVTEALANAGLESSNLIVGIDFTKSNMWTGKRSF  123

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             NG+SLH+IG+ LNPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFYPD RFC
Sbjct  124   NGKSLHHIGNYLNPYEQAISIIGKTLSVFDEDNLIPCFGFGDASTHDQDVFSFYPDNRFC  183

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVLS+YRE+ P L+L
Sbjct  184   NGFEEVLSRYRELVPHLRL  202



>ref|XP_003548557.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Glycine max]
Length=426

 Score =   234 bits (597),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +L+RRYSRI+D+Y+S+++VTEALARAGLESSNLIVG+DFTKSNEWTGK SFN RSLH+IG
Sbjct  61    KLERRYSRISDHYSSIDQVTEALARAGLESSNLIVGVDFTKSNEWTGKNSFNRRSLHHIG  120

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
              GLNPYEQAISIIGK+LAAFD+DNLIPCFGFGDASTHDQDVFSFYP ERFC+GFE+VLS+
Sbjct  121   SGLNPYEQAISIIGKSLAAFDEDNLIPCFGFGDASTHDQDVFSFYPSERFCDGFEDVLSR  180

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  181   YREIVPHLRL  190



>ref|XP_007222138.1| hypothetical protein PRUPE_ppa005724mg [Prunus persica]
 gb|EMJ23337.1| hypothetical protein PRUPE_ppa005724mg [Prunus persica]
Length=446

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 155/219 (71%), Gaps = 32/219 (15%)
 Frame = +3

Query  516   MGGKSSRDDswrq-----asrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyapppp  680
             MGGKSS+D S R      ++ S+SS   Y YPQ + PPQ    Y  P  H  PS      
Sbjct  1     MGGKSSKDSSPRLFSHGGSTASSSSWDQYGYPQPSRPPQ--NPYCTPQHHYAPS------  52

Query  681   qeqqypppsqDFASRNHAP-------PQRRLDRRYSRIADNYNSLEEVTEALARAGLESS  839
                          S NH         P+RRLDR+YS+IADNY+SL+EVT ALA+AGLESS
Sbjct  53    ------------PSFNHVSRPVTVPNPRRRLDRKYSKIADNYSSLDEVTSALAQAGLESS  100

Query  840   NLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGF  1019
             NLIVGIDFTKSNEWTG +SFN +SLH+IG+  NPYEQAISIIGKTL+ FD+DNLIPCFGF
Sbjct  101   NLIVGIDFTKSNEWTGSRSFNRKSLHHIGNVQNPYEQAISIIGKTLSVFDEDNLIPCFGF  160

Query  1020  GDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             GDASTHDQDVFSFY DE +CNGFEEVL++YREI P L+L
Sbjct  161   GDASTHDQDVFSFYQDEHYCNGFEEVLARYREIVPHLRL  199



>ref|XP_010102934.1| hypothetical protein L484_018953 [Morus notabilis]
 gb|EXB94452.1| hypothetical protein L484_018953 [Morus notabilis]
Length=247

 Score =   228 bits (582),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P+RRL+R+YS+I D+Y SL++VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +SLH
Sbjct  61    PKRRLERKYSKIGDDYKSLDQVTQALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLH  120

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG   NPYEQAISIIGKTL++FD+DN+IPCFGFGDASTHDQ+VFSF+PDERFCNGFEEV
Sbjct  121   HIGEEQNPYEQAISIIGKTLSSFDEDNMIPCFGFGDASTHDQEVFSFHPDERFCNGFEEV  180

Query  1098  LSQYREIAPRLKL  1136
             L++YRE+ P+L+L
Sbjct  181   LTRYRELVPQLRL  193



>ref|XP_010026602.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
Length=486

 Score =   236 bits (601),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  714   FASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  893
             + S+   P ++RLDR+YSRIADNY SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTG +
Sbjct  60    YGSQTPQPMKKRLDRKYSRIADNYRSLDEVTAALSEAGLESSNLIVGIDFTKSNEWTGAR  119

Query  894   SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  1073
             SF+ RSLH+IG G NPYEQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVFSFYPD+R
Sbjct  120   SFHRRSLHHIGGGRNPYEQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFSFYPDDR  179

Query  1074  FCNGFEEVLSQYREIAPRLKL  1136
             FCNGFEEVL++YRE+ P+LKL
Sbjct  180   FCNGFEEVLARYREVVPQLKL  200



>gb|AFK35251.1| unknown [Medicago truncatula]
Length=470

 Score =   235 bits (600),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 15/178 (8%)
 Frame = +3

Query  603   AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  782
              YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  61    GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  105

Query  783   YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  962
             Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  106   YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  165

Query  963   IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL++YREI P+LKL
Sbjct  166   IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREIVPQLKL  223



>gb|AES72143.2| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=470

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 15/178 (8%)
 Frame = +3

Query  603   AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  782
              YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  61    GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  105

Query  783   YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  962
             Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  106   YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  165

Query  963   IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL++YREI P+LKL
Sbjct  166   IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREIVPQLKL  223



>ref|XP_003601891.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
 gb|AES72142.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=467

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 15/178 (8%)
 Frame = +3

Query  603   AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  782
              YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  58    GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  102

Query  783   YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  962
             Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  103   YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  162

Query  963   IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL++YREI P+LKL
Sbjct  163   IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREIVPQLKL  220



>ref|XP_004502384.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Cicer arietinum]
Length=470

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 137/183 (75%), Gaps = 25/183 (14%)
 Frame = +3

Query  603   AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRN-----HAPPQRRLDRRYS  767
              YPP PQ+S +Y   H                     FAS +     ++ P+++LDRRYS
Sbjct  63    GYPPHPQQS-SYQTPHH-------------------QFASASAPLYEYSQPKKKLDRRYS  102

Query  768   RIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYE  947
             RIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+ G G NPYE
Sbjct  103   RIADNYRSLDEVTTALANAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHHTGSGQNPYE  162

Query  948   QAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPR  1127
             QAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL++YREI P 
Sbjct  163   QAISIIGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREIVPH  222

Query  1128  LKL  1136
             LKL
Sbjct  223   LKL  225



>ref|XP_010550166.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010550167.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010550168.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010550169.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
Length=452

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  729   HAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  908
             H   +++L+R+YSRIADNY+SL++VTEALARAGLESSNLIVG DFTKSNEWTG KSFN +
Sbjct  78    HGNDRKKLERKYSRIADNYSSLDQVTEALARAGLESSNLIVGFDFTKSNEWTGAKSFNRK  137

Query  909   SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  1088
             SLH IG+G NPYEQAI+IIGKTLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFCNGF
Sbjct  138   SLHFIGNGQNPYEQAITIIGKTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFCNGF  197

Query  1089  EEVLSQYREIAPRLKL  1136
             EEVL++YREI P+LKL
Sbjct  198   EEVLARYREIVPQLKL  213



>ref|XP_004141118.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like isoform X2 
[Cucumis sativus]
Length=444

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 151/221 (68%), Gaps = 34/221 (15%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  689
             MG  +SR++    +S + +   +  Y Q AY P P  Q S +Y  Q              
Sbjct  1     MGAANSREEPSVSSSWNGAYGQSPPYAQEAYAPSPYGQASQSYVPQQ-------------  47

Query  690   qypppsqDFASRNHAPPQ------------RRLDRRYSRIADNYNSLEEVTEALARAGLE  833
                     F+S  + PP+            ++ DRRYSRIADNY SLEEVTEALARAGLE
Sbjct  48    -------SFSSPQYHPPENYHGGAAAADNRKKFDRRYSRIADNYKSLEEVTEALARAGLE  100

Query  834   SSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCF  1013
             SSNLI+GIDFTKSNEWTG +SFN RSLH+I +G NPYEQAISI+GKTL+AFDDDNLIPCF
Sbjct  101   SSNLIIGIDFTKSNEWTGARSFNKRSLHDIRNGPNPYEQAISIVGKTLSAFDDDNLIPCF  160

Query  1014  GFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             GFGDASTHDQDVF FYP+ RFC+GFE+VL++YREI P L+L
Sbjct  161   GFGDASTHDQDVFGFYPEGRFCDGFEDVLNRYREIVPHLRL  201



>gb|AES72144.2| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=470

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 15/178 (8%)
 Frame = +3

Query  603   AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  782
              YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  61    GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  105

Query  783   YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  962
             Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  106   YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  165

Query  963   IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL++YREI P+LKL
Sbjct  166   IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREIVPQLKL  223



>ref|XP_010682022.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Beta vulgaris 
subsp. vulgaris]
Length=471

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++R  R YSRIAD Y SL++VT+ALARAGLESSNLIVGIDFTKSNEWTG KSFN RSLH+
Sbjct  78    KKRFQRMYSRIADEYTSLDQVTQALARAGLESSNLIVGIDFTKSNEWTGAKSFNKRSLHH  137

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG GLNPYEQAISIIGKTLAAFDDDNLIPC+GFGDASTHDQDVFSFYPDE  CNGFEEVL
Sbjct  138   IGDGLNPYEQAISIIGKTLAAFDDDNLIPCYGFGDASTHDQDVFSFYPDESVCNGFEEVL  197

Query  1101  SQYREIAPRLKL  1136
              +YREI P L+L
Sbjct  198   YKYREIVPHLRL  209



>ref|XP_012079951.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Jatropha curcas]
 gb|KDP31007.1| hypothetical protein JCGZ_11383 [Jatropha curcas]
Length=429

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             RRL+R+YS+I DNYNSLE+VT+ALAR+GLESSNLIVGIDFTKSNEWTG +SFN RSLH+I
Sbjct  56    RRLERKYSKIDDNYNSLEQVTDALARSGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHI  115

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
             G  LNPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFCNGFEEVLS
Sbjct  116   GDDLNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCNGFEEVLS  175

Query  1104  QYREIAPRLKL  1136
             +Y+E+ P L+L
Sbjct  176   RYKELVPHLRL  186



>ref|XP_011652307.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like isoform X1 
[Cucumis sativus]
 ref|XP_011652308.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like isoform X1 
[Cucumis sativus]
 gb|KGN59719.1| hypothetical protein Csa_3G840450 [Cucumis sativus]
Length=456

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 151/221 (68%), Gaps = 34/221 (15%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQP--QESYNYPVQHaypsyappppqeq  689
             MG  +SR++    +S + +   +  Y Q AY P P  Q S +Y  Q              
Sbjct  1     MGAANSREEPSVSSSWNGAYGQSPPYAQEAYAPSPYGQASQSYVPQQ-------------  47

Query  690   qypppsqDFASRNHAPPQ------------RRLDRRYSRIADNYNSLEEVTEALARAGLE  833
                     F+S  + PP+            ++ DRRYSRIADNY SLEEVTEALARAGLE
Sbjct  48    -------SFSSPQYHPPENYHGGAAAADNRKKFDRRYSRIADNYKSLEEVTEALARAGLE  100

Query  834   SSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCF  1013
             SSNLI+GIDFTKSNEWTG +SFN RSLH+I +G NPYEQAISI+GKTL+AFDDDNLIPCF
Sbjct  101   SSNLIIGIDFTKSNEWTGARSFNKRSLHDIRNGPNPYEQAISIVGKTLSAFDDDNLIPCF  160

Query  1014  GFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             GFGDASTHDQDVF FYP+ RFC+GFE+VL++YREI P L+L
Sbjct  161   GFGDASTHDQDVFGFYPEGRFCDGFEDVLNRYREIVPHLRL  201



>ref|XP_004504141.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Cicer arietinum]
Length=470

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 136/181 (75%), Gaps = 22/181 (12%)
 Frame = +3

Query  612   PQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAP------PQRRLDRRYSRI  773
             PQPQ +Y YP Q+ Y                      R  AP      P R+LDRRYSRI
Sbjct  61    PQPQSTYPYPQQNPYQR----------------SLHPRTQAPLHDYSRPNRKLDRRYSRI  104

Query  774   ADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQA  953
             AD+Y+SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+IG G NPYEQA
Sbjct  105   ADDYHSLDEVTAALSHAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHHIGIGQNPYEQA  164

Query  954   ISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLK  1133
             I+IIGKTL+AFD+DN+IPCFGFGDASTHDQDVFSF+ DER CNGFEEVLS YREI P L+
Sbjct  165   IAIIGKTLSAFDEDNMIPCFGFGDASTHDQDVFSFHSDERCCNGFEEVLSTYREIVPCLR  224

Query  1134  L  1136
             L
Sbjct  225   L  225



>ref|XP_006601923.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
 ref|XP_006601924.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Glycine max]
Length=434

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             ++  P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  52    DYGQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  111

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFY +ERFCNG
Sbjct  112   KSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYSEERFCNG  171

Query  1086  FEEVLSQYREIAPRLKL  1136
             FEEVL++YR+I P LKL
Sbjct  172   FEEVLTRYRQIIPSLKL  188



>ref|XP_003551971.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
Length=459

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             ++  P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  78    DYGQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  137

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFY +ERFCNG
Sbjct  138   KSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYSEERFCNG  197

Query  1086  FEEVLSQYREIAPRLKL  1136
             FEEVL++YR+I P LKL
Sbjct  198   FEEVLTRYRQIIPSLKL  214



>ref|XP_011071160.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Sesamum indicum]
Length=464

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 25/188 (13%)
 Frame = +3

Query  585   YEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAP----PQRRL  752
             Y YP  +Y   P   Y+ P+ H  P                    + N+AP    P+RR+
Sbjct  53    YSYP--SYSSTPHHPYSTPMHHHIP-------------------VAYNYAPSTPQPRRRM  91

Query  753   DRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHG  932
             DR++SRIADNY +L++VT AL+R+GLESSNLIVGIDFTKSNEWTG KSFN +SLH+IG G
Sbjct  92    DRKFSRIADNYQTLDQVTAALSRSGLESSNLIVGIDFTKSNEWTGAKSFNRKSLHHIGSG  151

Query  933   LNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYR  1112
              NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD RFC GFEEVL +YR
Sbjct  152   PNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDGRFCEGFEEVLRRYR  211

Query  1113  EIAPRLKL  1136
             E+ P+L+L
Sbjct  212   ELVPQLRL  219



>gb|KHN29015.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=826

 Score =   241 bits (616),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 160/214 (75%), Gaps = 27/214 (13%)
 Frame = +3

Query  516   MGGKSS-----RDDswrqasrstssswNYEYPQT--AYPPQPQESYNYPVQHaypsyapp  674
             MGGKSS     R  S   ++ S+SS  +YEYPQ+  AYP Q    Y+ P+ H  P+    
Sbjct  1     MGGKSSKGSERRHVSSYGSAGSSSSWDDYEYPQSPNAYPQQ--NPYHTPLHHRAPAPF--  56

Query  675   ppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  854
                              +++ P+R+LDRRYSRIAD+Y+SL+EVT AL+ AGLESSNLIVG
Sbjct  57    ----------------HDYSQPKRKLDRRYSRIADDYHSLDEVTTALSHAGLESSNLIVG  100

Query  855   IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  1034
             IDFTKSNEWTGK+SFN +SLH+IG G NPYEQAISIIGKTL+ FD+DNLIPCFGFGDAST
Sbjct  101   IDFTKSNEWTGKRSFNRKSLHHIGSGQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDAST  160

Query  1035  HDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             HDQDVFSF+ DERFCNGFEEVLS+YR+I PRL+L
Sbjct  161   HDQDVFSFHSDERFCNGFEEVLSRYRDIVPRLRL  194



>ref|XP_004504140.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Cicer arietinum]
Length=492

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 136/181 (75%), Gaps = 22/181 (12%)
 Frame = +3

Query  612   PQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAP------PQRRLDRRYSRI  773
             PQPQ +Y YP Q+ Y                      R  AP      P R+LDRRYSRI
Sbjct  61    PQPQSTYPYPQQNPYQR----------------SLHPRTQAPLHDYSRPNRKLDRRYSRI  104

Query  774   ADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQA  953
             AD+Y+SL+EVT AL+ AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+IG G NPYEQA
Sbjct  105   ADDYHSLDEVTAALSHAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHHIGIGQNPYEQA  164

Query  954   ISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLK  1133
             I+IIGKTL+AFD+DN+IPCFGFGDASTHDQDVFSF+ DER CNGFEEVLS YREI P L+
Sbjct  165   IAIIGKTLSAFDEDNMIPCFGFGDASTHDQDVFSFHSDERCCNGFEEVLSTYREIVPCLR  224

Query  1134  L  1136
             L
Sbjct  225   L  225



>ref|XP_012085497.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Jatropha curcas]
 ref|XP_012085498.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Jatropha curcas]
 ref|XP_012085499.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Jatropha curcas]
 ref|XP_012085500.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Jatropha curcas]
 ref|XP_012085501.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Jatropha curcas]
 gb|KDP26671.1| hypothetical protein JCGZ_17829 [Jatropha curcas]
Length=466

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQ+RLDR+YSRIAD+Y +L++VT ALA++GLESSNLIVGIDFTKSNEWTG +SFN RSLH
Sbjct  72    PQKRLDRKYSRIADDYKTLDQVTAALAQSGLESSNLIVGIDFTKSNEWTGSRSFNRRSLH  131

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG+G NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFY DER CNGFEEV
Sbjct  132   HIGNGQNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFYEDERICNGFEEV  191

Query  1098  LSQYREIAPRLKL  1136
             L++YREI P+L+L
Sbjct  192   LTRYREIVPQLRL  204



>ref|XP_006601922.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
Length=460

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             ++  P+R+LD++YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  78    DYGQPKRKLDKKYSRIADNYRSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKRSFNR  137

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             +SLH+I  G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFY +ERFCNG
Sbjct  138   KSLHDIRSGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYSEERFCNG  197

Query  1086  FEEVLSQYREIAPRLKL  1136
             FEEVL++YR+I P LKL
Sbjct  198   FEEVLTRYRQIIPSLKL  214



>ref|XP_003601892.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
Length=521

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 15/178 (8%)
 Frame = +3

Query  603   AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  782
              YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  112   GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  156

Query  783   YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  962
             Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  157   YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  216

Query  963   IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL++YREI P+LKL
Sbjct  217   IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREIVPQLKL  274



>ref|XP_007163690.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
 gb|ESW35684.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
Length=438

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             ++A P+R+LDR+YSRIADNY SL+EVT  LA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  57    DNAQPKRKLDRKYSRIADNYRSLDEVTAELANAGLESSNLIVGIDFTKSNEWTGKRSFNR  116

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             +SLH+IG   NPYE AISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSF+ +ERFCNG
Sbjct  117   KSLHDIGSCQNPYEHAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFFSEERFCNG  176

Query  1086  FEEVLSQYREIAPRLKL  1136
             FEEVLS+YREI P LKL
Sbjct  177   FEEVLSRYREITPHLKL  193



>gb|KHN27569.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=426

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +L+RRYSRI+D+Y+S+++VTEALARAGLESSNLIVG+DFT SNEWTGK SFN RSLH+IG
Sbjct  61    KLERRYSRISDHYSSIDQVTEALARAGLESSNLIVGVDFTTSNEWTGKNSFNRRSLHHIG  120

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
              GLNPYEQAISIIGK+LAAFD+DNLIPCFGFGDASTHDQDVFSFYP ERFC+GFE+VLS+
Sbjct  121   SGLNPYEQAISIIGKSLAAFDEDNLIPCFGFGDASTHDQDVFSFYPSERFCDGFEDVLSR  180

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  181   YREIVPHLRL  190



>ref|XP_003601893.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
Length=531

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 15/178 (8%)
 Frame = +3

Query  603   AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRIADN  782
              YPP PQ+S     QH + S + P                  ++ P+++LD+RYSRIADN
Sbjct  122   GYPPHPQQSPYQTPQHQFSSASAPFY---------------ENSQPKKKLDKRYSRIADN  166

Query  783   YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISI  962
             Y SL+EVT ALA AGLESSNLIVGIDFTKSNEWTGK SFN +SLH+IG G NPYEQAISI
Sbjct  167   YQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGKSSFNRKSLHHIGSGQNPYEQAISI  226

Query  963   IGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             IGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY +ER CNGFEEVL++YREI P+LKL
Sbjct  227   IGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYSEERLCNGFEEVLARYREIVPQLKL  284



>ref|XP_002312658.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
 gb|EEE90025.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
Length=434

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 155/215 (72%), Gaps = 20/215 (9%)
 Frame = +3

Query  516   MGGKSS-----RDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyapppp  680
             MGGKSS     RD S   ++ S+SS   Y YP  +  P PQ    +  QH +     P  
Sbjct  1     MGGKSSKGSRGRDYSSYGSANSSSSWNQYGYPPASSYPSPQHDPYWTQQHHHAPAPNP--  58

Query  681   qeqqypppsqDFASRNHAPPQ---RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIV  851
                        +   +  PPQ   +RLDR+YSRIADNY +L++VT ALA+AGLESSNLIV
Sbjct  59    ----------SYPYESQMPPQQPHKRLDRKYSRIADNYQTLDQVTAALAQAGLESSNLIV  108

Query  852   GIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAS  1031
             GIDFTKSNEWTG +SFN RSLH+I +G NPYEQAISIIG+T++AFD+DNLIPCFGFGDAS
Sbjct  109   GIDFTKSNEWTGARSFNRRSLHDIRNGQNPYEQAISIIGRTMSAFDEDNLIPCFGFGDAS  168

Query  1032  THDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             THDQDVFSF+P+ERFCNGFEEVL++Y+EI P L+L
Sbjct  169   THDQDVFSFFPEERFCNGFEEVLTRYKEIVPNLRL  203



>ref|XP_011034033.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Populus euphratica]
Length=472

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 128/140 (91%), Gaps = 3/140 (2%)
 Frame = +3

Query  726   NHAPPQ---RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKS  896
             +H PPQ   +RLDR+YSRIADNY +L++VT ALA+AGLESSNLIVGIDFTKSNEWTG +S
Sbjct  64    SHMPPQQPHKRLDRKYSRIADNYQTLDQVTAALAQAGLESSNLIVGIDFTKSNEWTGARS  123

Query  897   FNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERF  1076
             FN RSLH+IG+  NPYEQAISIIG+T++AFD+DNLIPCFGFGDASTHDQDVFSF+P+ERF
Sbjct  124   FNRRSLHDIGNVQNPYEQAISIIGRTMSAFDEDNLIPCFGFGDASTHDQDVFSFFPEERF  183

Query  1077  CNGFEEVLSQYREIAPRLKL  1136
             CNGFEEVL++Y+EI P L+L
Sbjct  184   CNGFEEVLTRYKEIVPNLRL  203



>ref|XP_007159686.1| hypothetical protein PHAVU_002G258600g [Phaseolus vulgaris]
 gb|ESW31680.1| hypothetical protein PHAVU_002G258600g [Phaseolus vulgaris]
Length=462

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 22/187 (12%)
 Frame = +3

Query  582   NYEYPQT--AYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLD  755
             NY YPQT  AYP Q    Y+ P+ +  P+                     +++ P+RRLD
Sbjct  53    NYGYPQTPNAYPQQ--NIYHTPIHNRVPAPF------------------HDYSQPKRRLD  92

Query  756   RRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGL  935
             RR+SRIAD+YNSL+EVT AL+ AGLESSNLIVGIDFTKSNEWTGK+SFN +SLH+IG   
Sbjct  93    RRFSRIADDYNSLDEVTSALSHAGLESSNLIVGIDFTKSNEWTGKRSFNRKSLHHIGSDH  152

Query  936   NPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYRE  1115
             NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSF+ DE FCNGFEEVLS+YR+
Sbjct  153   NPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFHSDESFCNGFEEVLSRYRD  212

Query  1116  IAPRLKL  1136
             I P L+L
Sbjct  213   IIPCLRL  219



>ref|XP_011034031.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Populus euphratica]
 ref|XP_011034032.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Populus euphratica]
Length=473

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 128/140 (91%), Gaps = 3/140 (2%)
 Frame = +3

Query  726   NHAPPQ---RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKS  896
             +H PPQ   +RLDR+YSRIADNY +L++VT ALA+AGLESSNLIVGIDFTKSNEWTG +S
Sbjct  64    SHMPPQQPHKRLDRKYSRIADNYQTLDQVTAALAQAGLESSNLIVGIDFTKSNEWTGARS  123

Query  897   FNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERF  1076
             FN RSLH+IG+  NPYEQAISIIG+T++AFD+DNLIPCFGFGDASTHDQDVFSF+P+ERF
Sbjct  124   FNRRSLHDIGNVQNPYEQAISIIGRTMSAFDEDNLIPCFGFGDASTHDQDVFSFFPEERF  183

Query  1077  CNGFEEVLSQYREIAPRLKL  1136
             CNGFEEVL++Y+EI P L+L
Sbjct  184   CNGFEEVLTRYKEIVPNLRL  203



>ref|XP_007163691.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
 gb|ESW35685.1| hypothetical protein PHAVU_001G255900g [Phaseolus vulgaris]
Length=464

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  726   NHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNG  905
             ++A P+R+LDR+YSRIADNY SL+EVT  LA AGLESSNLIVGIDFTKSNEWTGK+SFN 
Sbjct  83    DNAQPKRKLDRKYSRIADNYRSLDEVTAELANAGLESSNLIVGIDFTKSNEWTGKRSFNR  142

Query  906   RSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNG  1085
             +SLH+IG   NPYE AISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSF+ +ERFCNG
Sbjct  143   KSLHDIGSCQNPYEHAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFFSEERFCNG  202

Query  1086  FEEVLSQYREIAPRLKL  1136
             FEEVLS+YREI P LKL
Sbjct  203   FEEVLSRYREITPHLKL  219



>ref|XP_006379955.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
 gb|ERP57752.1| hypothetical protein POPTR_0008s18400g [Populus trichocarpa]
Length=473

 Score =   233 bits (594),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 155/215 (72%), Gaps = 20/215 (9%)
 Frame = +3

Query  516   MGGKSS-----RDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyapppp  680
             MGGKSS     RD S   ++ S+SS   Y YP  +  P PQ    +  QH +     P  
Sbjct  1     MGGKSSKGSRGRDYSSYGSANSSSSWNQYGYPPASSYPSPQHDPYWTQQHHHAPAPNP--  58

Query  681   qeqqypppsqDFASRNHAPPQ---RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIV  851
                        +   +  PPQ   +RLDR+YSRIADNY +L++VT ALA+AGLESSNLIV
Sbjct  59    ----------SYPYESQMPPQQPHKRLDRKYSRIADNYQTLDQVTAALAQAGLESSNLIV  108

Query  852   GIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAS  1031
             GIDFTKSNEWTG +SFN RSLH+I +G NPYEQAISIIG+T++AFD+DNLIPCFGFGDAS
Sbjct  109   GIDFTKSNEWTGARSFNRRSLHDIRNGQNPYEQAISIIGRTMSAFDEDNLIPCFGFGDAS  168

Query  1032  THDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             THDQDVFSF+P+ERFCNGFEEVL++Y+EI P L+L
Sbjct  169   THDQDVFSFFPEERFCNGFEEVLTRYKEIVPNLRL  203



>ref|XP_010524288.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Tarenaya hassleriana]
Length=431

 Score =   232 bits (591),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             S++H   +++L+R+YSRIAD+Y+SLE+VTEALA AGLESSNLIVG+DFTKSNEWTG KSF
Sbjct  45    SQSHGNGRKKLERKYSRIADDYSSLEQVTEALALAGLESSNLIVGVDFTKSNEWTGAKSF  104

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH  G  LNPYEQAI+IIGKTLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFC
Sbjct  105   NKKSLHFTGISLNPYEQAITIIGKTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFC  164

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL++YREI P+LKL
Sbjct  165   NGFEEVLARYREIVPQLKL  183



>ref|XP_010524289.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Tarenaya hassleriana]
Length=430

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             S++H   +++L+R+YSRIAD+Y+SLE+VTEALA AGLESSNLIVG+DFTKSNEWTG KSF
Sbjct  45    SQSHGNGRKKLERKYSRIADDYSSLEQVTEALALAGLESSNLIVGVDFTKSNEWTGAKSF  104

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH  G  LNPYEQAI+IIGKTLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFC
Sbjct  105   NKKSLHFTGISLNPYEQAITIIGKTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFC  164

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL++YREI P+LKL
Sbjct  165   NGFEEVLARYREIVPQLKL  183



>ref|XP_004135284.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
 gb|KGN51730.1| hypothetical protein Csa_5G593430 [Cucumis sativus]
Length=433

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 147/207 (71%), Gaps = 19/207 (9%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqy  695
             MGGK+SR+   R+ S   S + +  + Q  YPPQ      YP                  
Sbjct  1     MGGKNSREAGRREFSSYGSGNSS-AWDQYNYPPQSPYVQQYPYTEPS-------------  46

Query  696   pppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSN  875
                  ++ S+    PQRRLDR+YSRIADNY SL+EVT AL +AGLESSNLIVGIDFTKSN
Sbjct  47    -----EYGSQTPQQPQRRLDRKYSRIADNYQSLDEVTAALIKAGLESSNLIVGIDFTKSN  101

Query  876   EWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFS  1055
             EWTG +SFN RSLH+IG+  NPYEQAISIIG+TL++FDDDN+IPCFGFGDASTHDQDVFS
Sbjct  102   EWTGSRSFNRRSLHHIGNEPNPYEQAISIIGQTLSSFDDDNMIPCFGFGDASTHDQDVFS  161

Query  1056  FYPDERFCNGFEEVLSQYREIAPRLKL  1136
             FY D+R CNGFEEVL +YREI P L+L
Sbjct  162   FYHDDRICNGFEEVLHRYREIVPDLRL  188



>ref|XP_007044867.1| Copine family isoform 1 [Theobroma cacao]
 ref|XP_007044868.1| Copine family isoform 1 [Theobroma cacao]
 ref|XP_007044869.1| Copine family isoform 1 [Theobroma cacao]
 gb|EOY00699.1| Copine family isoform 1 [Theobroma cacao]
 gb|EOY00700.1| Copine family isoform 1 [Theobroma cacao]
 gb|EOY00701.1| Copine family isoform 1 [Theobroma cacao]
Length=467

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 157/219 (72%), Gaps = 35/219 (16%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswN-----YEYPQTAYPPQ-----PQESYNYPVQHaypsy  665
             MGGKSS++ S  +   S S+  +        PQ+AYPP+     PQ  Y  P  +     
Sbjct  1     MGGKSSKESSGGRYPTSRSAGSDAWSPYVHPPQSAYPPENSYYTPQHRYGPPPSY-----  55

Query  666   appppqeqqypppsqDFASRNHAPPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESS  839
                            ++ SR    PQ  + L+R+YSRIADNY +L++VT ALA+AGLESS
Sbjct  56    ---------------NYGSRT---PQLHKSLERKYSRIADNYQTLDQVTAALAQAGLESS  97

Query  840   NLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGF  1019
             NLIVGIDFTKSNEWTG +SFN RSLH+IG+G NPYEQAISIIG++L+AFD+DNLIPC+GF
Sbjct  98    NLIVGIDFTKSNEWTGARSFNRRSLHHIGNGQNPYEQAISIIGQSLSAFDEDNLIPCYGF  157

Query  1020  GDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             GDASTHDQDVFSFYP+ERFCNGFEEVL++YREI P+L+L
Sbjct  158   GDASTHDQDVFSFYPEERFCNGFEEVLARYREIVPQLRL  196



>ref|XP_002515058.1| copine, putative [Ricinus communis]
 gb|EEF47612.1| copine, putative [Ricinus communis]
Length=478

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQ+RLDR+YSRIAD+Y +L++VT ALA++GLESSNLIVGIDFTKSNEWTG +S+N RSLH
Sbjct  74    PQKRLDRKYSRIADDYKTLDQVTAALAQSGLESSNLIVGIDFTKSNEWTGARSYNRRSLH  133

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG+G NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSF+ DERFCNGFEEV
Sbjct  134   HIGNGQNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFHQDERFCNGFEEV  193

Query  1098  LSQYREIAPRLKL  1136
             L++YREI P+L+L
Sbjct  194   LTRYREIVPQLRL  206



>ref|XP_003555130.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Glycine max]
 ref|XP_006604100.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Glycine max]
 ref|XP_006604101.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Glycine max]
 ref|XP_006604102.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Glycine max]
 ref|XP_006604103.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X5 
[Glycine max]
 ref|XP_006604104.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X6 
[Glycine max]
Length=428

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +L+RRYSRI+D+Y+S+++V+EALA AGLESSNLIVG+DFTKSNEWTGK SFN RSLH+IG
Sbjct  63    KLERRYSRISDHYSSIDQVSEALALAGLESSNLIVGVDFTKSNEWTGKNSFNRRSLHHIG  122

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
              GLNPYEQAISIIGK+LAAFD+DNLIPCFGFGDASTHDQDVFSFYP ERFC+GFE+VLS+
Sbjct  123   RGLNPYEQAISIIGKSLAAFDEDNLIPCFGFGDASTHDQDVFSFYPSERFCDGFEDVLSR  182

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  183   YREIVPHLRL  192



>emb|CDP12686.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 137/186 (74%), Gaps = 31/186 (17%)
 Frame = +3

Query  588   EYPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQ---RRLDR  758
             +YPQ  Y   PQ SYNY                                PPQ   RRL+R
Sbjct  33    QYPQPGYNYAPQPSYNY----------------------------APAPPPQESRRRLER  64

Query  759   RYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLN  938
             +YSRI D+Y SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +SLH++G G N
Sbjct  65    KYSRIDDDYTSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLHHLGDGQN  124

Query  939   PYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREI  1118
             PYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFC+GFEEVLS+YRE+
Sbjct  125   PYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCDGFEEVLSRYREL  184

Query  1119  APRLKL  1136
              P+L+L
Sbjct  185   VPQLRL  190



>gb|KHN00030.1| E3 ubiquitin-protein ligase RGLG1 [Glycine soja]
Length=428

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +L+RRYSRI+D+Y+S+++V+EALA AGLESSNLIVG+DFTKSNEWTGK SFN RSLH+IG
Sbjct  63    KLERRYSRISDHYSSIDQVSEALALAGLESSNLIVGVDFTKSNEWTGKNSFNRRSLHHIG  122

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
              GLNPYEQAISIIGK+LAAFD+DNLIPCFGFGDASTHDQDVFSFYP ERFC+GFE+VLS+
Sbjct  123   RGLNPYEQAISIIGKSLAAFDEDNLIPCFGFGDASTHDQDVFSFYPSERFCDGFEDVLSR  182

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  183   YREIVPHLRL  192



>gb|KJB51127.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=318

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  62    KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  121

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  122   IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  181

Query  1101  SQYREIAPRLKL  1136
              +YRE+ P LKL
Sbjct  182   RRYRELVPNLKL  193



>ref|XP_008221938.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Prunus mume]
Length=445

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P+RRLDR+YS+IADNY SL+EVT ALA+AGLESSNLIVGIDFTKSNEWTG +SFN +SLH
Sbjct  67    PRRRLDRKYSKIADNYRSLDEVTSALAQAGLESSNLIVGIDFTKSNEWTGSRSFNRKSLH  126

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG+  NPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY DE++CNGFEEV
Sbjct  127   HIGNVQNPYEQAISIIGKTLSVFDEDNLIPCFGFGDASTHDQDVFSFYQDEQYCNGFEEV  186

Query  1098  LSQYREIAPRLKL  1136
             L++YREI P L+L
Sbjct  187   LARYREIVPHLRL  199



>ref|XP_009371747.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Pyrus x bretschneideri]
Length=463

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++  DRRYSRIADNY+SLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH+
Sbjct  75    EKTFDRRYSRIADNYHSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHH  134

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+G NPYE AISIIGKTLAAFD+DNLIPCFGFGDA+THDQDVFSFY D+R+CNGFEEVL
Sbjct  135   IGNGPNPYEHAISIIGKTLAAFDEDNLIPCFGFGDATTHDQDVFSFY-DDRYCNGFEEVL  193

Query  1101  SQYREIAPRLKL  1136
             ++Y+EI P+L+L
Sbjct  194   ARYKEIVPKLRL  205



>ref|XP_006439965.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
 gb|ESR53205.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
Length=309

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH+I
Sbjct  63    RKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHI  122

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
             G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE+FCNGFEEVL 
Sbjct  123   GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLR  182

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  183   RYRELVPHLRL  193



>ref|XP_008341364.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Malus domestica]
 ref|XP_008341365.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Malus domestica]
 ref|XP_008341366.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Malus domestica]
Length=463

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++  DRRYSRIADNY+SLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH+
Sbjct  75    EKTFDRRYSRIADNYHSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHH  134

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+G NPYE AISIIGKTLAAFD+DNLIPCFGFGDA+THDQDVFSFY D+R+CNGFEEVL
Sbjct  135   IGNGPNPYEHAISIIGKTLAAFDEDNLIPCFGFGDATTHDQDVFSFY-DDRYCNGFEEVL  193

Query  1101  SQYREIAPRLKL  1136
             ++Y+EI P+L+L
Sbjct  194   TRYKEIVPKLRL  205



>ref|XP_008446129.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
 ref|XP_008446130.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
Length=435

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  714   FASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  893
             + S+    P+RRLDR+YSRIADNY SL+EVT ALA AGLESSNLIVGIDFTKSNEWTG +
Sbjct  50    YGSQTPQQPRRRLDRKYSRIADNYQSLDEVTAALANAGLESSNLIVGIDFTKSNEWTGSR  109

Query  894   SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  1073
             SFN RSLH+IG+  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFY D+R
Sbjct  110   SFNRRSLHHIGNEPNPYEQAISIIGQTLSAFDEDNLIPCFGFGDASTHDQDVFSFYHDDR  169

Query  1074  FCNGFEEVLSQYREIAPRLKL  1136
              CNGFEEVL +YREI P L+L
Sbjct  170   ICNGFEEVLHRYREIVPNLRL  190



>ref|XP_008464939.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis melo]
 ref|XP_008464940.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis melo]
 ref|XP_008464941.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis melo]
Length=445

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             ++ DRRYSRIADNY SLEEVT ALARAGLESSNLI+GIDFTKSNEWTG +SFN RSLH+I
Sbjct  72    KKFDRRYSRIADNYKSLEEVTGALARAGLESSNLIIGIDFTKSNEWTGARSFNKRSLHDI  131

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
              +G NPYEQAISI+GKTL+AFDDDNLIPCFGFGDA THDQDVFSFYP+ RFCNGFE+VL+
Sbjct  132   RNGPNPYEQAISIVGKTLSAFDDDNLIPCFGFGDAFTHDQDVFSFYPEGRFCNGFEDVLN  191

Query  1104  QYREIAPRLKL  1136
             +YREI P L+L
Sbjct  192   RYREIVPHLRL  202



>gb|KEH22094.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=404

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +L R+YSRIADNYNS++EVTEAL RAGLESSNLIVG+DFTKSNEWTGK SF  +SLH+ G
Sbjct  76    KLQRKYSRIADNYNSIDEVTEALGRAGLESSNLIVGVDFTKSNEWTGKNSFRRQSLHHTG  135

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
               LNPYEQAISIIGKT+A FDDDNLIPCFGFGDASTHDQDVFSFYPD  FCNGFE+VLS+
Sbjct  136   SDLNPYEQAISIIGKTMAEFDDDNLIPCFGFGDASTHDQDVFSFYPDGSFCNGFEDVLSR  195

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  196   YREIVPHLRL  205



>ref|XP_002282202.2| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650735.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650741.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650743.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650748.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650751.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010650756.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 emb|CBI16816.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +3

Query  717   ASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKS  896
             A   H  PQ  LDRRYSRIADNYNSL++VT ALA+AGLESSNLIVGIDFTKSNEWTG +S
Sbjct  59    AQTPHRHPQ--LDRRYSRIADNYNSLDQVTAALAQAGLESSNLIVGIDFTKSNEWTGSRS  116

Query  897   FNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERF  1076
             FN +SLH+IG G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQD+FSFY DER 
Sbjct  117   FNRKSLHHIGRGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDIFSFYQDERP  176

Query  1077  CNGFEEVLSQYREIAPRLKL  1136
             CNGFEEVL +YRE+ P L+L
Sbjct  177   CNGFEEVLMRYRELVPSLRL  196



>ref|XP_010927545.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Elaeis guineensis]
Length=388

 Score =   228 bits (581),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RLDRRYS+I D+Y+S+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+IG
Sbjct  79    RLDRRYSKITDDYSSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFHGRSLHHIG  138

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQD+FSFYPDER C+GF E L++
Sbjct  139   DIPNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDIFSFYPDERSCDGFTEALAR  198

Query  1107  YREIAPRLKL  1136
             YRE+ PRL+L
Sbjct  199   YRELVPRLRL  208



>ref|XP_010026980.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
 ref|XP_010026984.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
 ref|XP_010026991.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Eucalyptus 
grandis]
 gb|KCW83242.1| hypothetical protein EUGRSUZ_B00181 [Eucalyptus grandis]
Length=438

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 127/136 (93%), Gaps = 2/136 (1%)
 Frame = +3

Query  735   PP--QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  908
             PP  +R+L+R++S+I D+Y SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +
Sbjct  60    PPHSERKLERKFSKINDDYTSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGGRSFNRK  119

Query  909   SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  1088
             SLH+IG G NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSF+PDE+FCNGF
Sbjct  120   SLHHIGDGQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFFPDEKFCNGF  179

Query  1089  EEVLSQYREIAPRLKL  1136
             EEVL++YRE+ P+L+L
Sbjct  180   EEVLTRYRELVPQLRL  195



>gb|KHG28566.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=456

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  726   NHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFN  902
             +HAP  +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+
Sbjct  73    SHAPESKRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFH  132

Query  903   GRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCN  1082
              RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCN
Sbjct  133   RRSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCN  192

Query  1083  GFEEVLSQYREIAPRLKL  1136
             GFEEVL +YRE+ P LKL
Sbjct  193   GFEEVLRRYRELVPNLKL  210



>ref|XP_006399953.1| hypothetical protein EUTSA_v10013466mg [Eutrema salsugineum]
 gb|ESQ41406.1| hypothetical protein EUTSA_v10013466mg [Eutrema salsugineum]
Length=465

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             S+++   ++RL+R+YSRI+DNY+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG KSF
Sbjct  79    SQSYGSDKKRLERKYSRISDNYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGAKSF  138

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH IG   NPYEQAI+IIG++LAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFC
Sbjct  139   NRKSLHFIGSSPNPYEQAITIIGRSLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFC  198

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL++Y+EI P+LKL
Sbjct  199   NGFEEVLARYKEIVPQLKL  217



>gb|ACA04857.1| putative copine I [Picea abies]
Length=220

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             + +L RRYSRIADNYNSL+EVT ALA+AGLESSNLIVGIDFTKSNEWTG KSFN RSLH 
Sbjct  66    KNKLQRRYSRIADNYNSLDEVTAALAQAGLESSNLIVGIDFTKSNEWTGAKSFNHRSLHR  125

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGD STHDQ+ FSFYPD R CNGFEE L
Sbjct  126   IGDTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDVSTHDQNAFSFYPDNRLCNGFEEAL  185

Query  1101  SQYREIAPRLKL  1136
               YRE+ P L+L
Sbjct  186   RHYREMVPHLRL  197



>ref|XP_009370343.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Pyrus x bretschneideri]
 ref|XP_009370344.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Pyrus x bretschneideri]
Length=463

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++  DRRYSRIADNY+SLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH+
Sbjct  75    EKTFDRRYSRIADNYHSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHH  134

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+G NPYE AISIIGKTLAAFD+DNLIPCFGFGDA+THDQDVFSFY D R+CNGFEEVL
Sbjct  135   IGNGPNPYEHAISIIGKTLAAFDEDNLIPCFGFGDATTHDQDVFSFYED-RYCNGFEEVL  193

Query  1101  SQYREIAPRLKL  1136
             ++Y+EI P+L+L
Sbjct  194   ARYKEIVPKLRL  205



>ref|XP_006408532.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 ref|XP_006408533.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 ref|XP_006408534.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 gb|ESQ49985.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 gb|ESQ49986.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
 gb|ESQ49987.1| hypothetical protein EUTSA_v10020651mg [Eutrema salsugineum]
Length=472

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  717   ASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKS  896
             AS++H    ++ DRRYS+I+DNY SL++V+EAL RAGLESSNLIVGIDFTKSNEWTG  S
Sbjct  97    ASQSHGSDGKKFDRRYSKISDNYASLDQVSEALGRAGLESSNLIVGIDFTKSNEWTGANS  156

Query  897   FNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERF  1076
             FN +SLH+I + LNPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RF
Sbjct  157   FNRKSLHHISNTLNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRF  216

Query  1077  CNGFEEVLSQYREIAPRLKL  1136
             CNGFEEVL++YREI P+LKL
Sbjct  217   CNGFEEVLARYREIVPQLKL  236



>ref|XP_002318092.2| hypothetical protein POPTR_0012s09190g [Populus trichocarpa]
 gb|EEE96312.2| hypothetical protein POPTR_0012s09190g [Populus trichocarpa]
Length=433

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  732   APPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRS  911
             AP  RRL+R+YS+I DNYNSL +VTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ RS
Sbjct  54    APNSRRLERKYSKIDDNYNSLVQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFSHRS  113

Query  912   LHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFE  1091
             LH+IG   NPYEQAI IIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFCNGFE
Sbjct  114   LHHIGDDQNPYEQAIYIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCNGFE  173

Query  1092  EVLSQYREIAPRLKL  1136
             EVL +YRE+ P L+L
Sbjct  174   EVLRRYRELVPCLRL  188



>gb|KHG28565.1| E3 ubiquitin-protein ligase RGLG2 [Gossypium arboreum]
Length=463

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  726   NHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFN  902
             +HAP  +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+
Sbjct  73    SHAPESKRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFH  132

Query  903   GRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCN  1082
              RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCN
Sbjct  133   RRSLHHIGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCN  192

Query  1083  GFEEVLSQYREIAPRLKL  1136
             GFEEVL +YRE+ P LKL
Sbjct  193   GFEEVLRRYRELVPNLKL  210



>gb|KHG03783.1| E3 ubiquitin-protein ligase RGLG2 -like protein [Gossypium arboreum]
Length=488

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 153/223 (69%), Gaps = 44/223 (20%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswN----YEYP-QTAYPPQPQESYNYPVQHaypsyapppp  680
             MGGKSS+D S R    S S   +    Y YP Q+ YPPQ    Y  P  H          
Sbjct  1     MGGKSSKDSSGRAYPTSRSGGSDSWSRYGYPPQSGYPPQ--TPYYTPQHH----------  48

Query  681   qeqqypppsqDFASRNHAPPQ------RRLDR-----RYSRIADNYNSLEEVTEALARAG  827
                             HAPP       + L+R     +YSRIADNY +L++VT ALA+AG
Sbjct  49    ----------------HAPPHSSNYGLQTLNRGHKIVKYSRIADNYETLDQVTAALAQAG  92

Query  828   LESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIP  1007
             LESSNLIVGIDFTKSNEWTG +SFN +SLH+IG+G NPYEQAISIIG++L+AFD+DNLIP
Sbjct  93    LESSNLIVGIDFTKSNEWTGARSFNRKSLHHIGNGQNPYEQAISIIGQSLSAFDEDNLIP  152

Query  1008  CFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             C+GFGDASTHDQDVFSFYP+ERFCNGFEEVL++YREI P+L+L
Sbjct  153   CYGFGDASTHDQDVFSFYPEERFCNGFEEVLARYREIVPQLRL  195



>ref|XP_011040451.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014652.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014653.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014654.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
 ref|XP_011014655.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Populus euphratica]
Length=433

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  732   APPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRS  911
             AP  RRL+R+YS+I DNYNSL +VTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ RS
Sbjct  54    APNSRRLERKYSKIDDNYNSLVQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFSHRS  113

Query  912   LHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFE  1091
             LH+IG   NPYEQAI IIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFCNGFE
Sbjct  114   LHHIGDDQNPYEQAIYIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCNGFE  173

Query  1092  EVLSQYREIAPRLKL  1136
             EVL +YRE+ P L+L
Sbjct  174   EVLRRYRELVPCLRL  188



>gb|EYU22544.1| hypothetical protein MIMGU_mgv1a006738mg [Erythranthe guttata]
Length=433

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 126/143 (88%), Gaps = 4/143 (3%)
 Frame = +3

Query  720   SRNHAPP----QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG  887
             S  HAPP     RRLDRR+ RIADNY +L++VT AL+++GLESSNLIVGIDFTKSNEWTG
Sbjct  44    SYTHAPPAPQPNRRLDRRFIRIADNYQTLDQVTSALSKSGLESSNLIVGIDFTKSNEWTG  103

Query  888   KKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPD  1067
              KSFN +SLH+IG G NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHD+DVFSFYPD
Sbjct  104   AKSFNRKSLHHIGSGPNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDRDVFSFYPD  163

Query  1068  ERFCNGFEEVLSQYREIAPRLKL  1136
              RFC+GFEEVL +YR++ P+L+L
Sbjct  164   GRFCDGFEEVLRRYRDLVPQLRL  186



>ref|XP_010420077.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010420078.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
Length=464

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YSRI+DNY+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  88    KKRLERKYSRISDNYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  147

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFCNGFEEVL
Sbjct  148   IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFCNGFEEVL  207

Query  1101  SQYREIAPRLKL  1136
             ++Y+EI P+LKL
Sbjct  208   ARYKEIVPQLKL  219



>ref|XP_006439964.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
 gb|ESR53204.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
Length=409

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH+I
Sbjct  63    RKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHI  122

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
             G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE+FCNGFEEVL 
Sbjct  123   GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLR  182

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  183   RYRELVPHLRL  193



>gb|KJB51128.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=413

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  62    KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  121

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  122   IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  181

Query  1101  SQYREIAPRLKL  1136
              +YRE+ P LKL
Sbjct  182   RRYRELVPNLKL  193



>gb|KJB51125.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=406

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  62    KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  121

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  122   IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  181

Query  1101  SQYREIAPRLKL  1136
              +YRE+ P LKL
Sbjct  182   RRYRELVPNLKL  193



>ref|XP_010927546.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Elaeis guineensis]
Length=349

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RLDRRYS+I D+Y+S+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+IG
Sbjct  79    RLDRRYSKITDDYSSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFHGRSLHHIG  138

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQD+FSFYPDER C+GF E L++
Sbjct  139   DIPNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDIFSFYPDERSCDGFTEALAR  198

Query  1107  YREIAPRLKL  1136
             YRE+ PRL+L
Sbjct  199   YRELVPRLRL  208



>gb|KJB51126.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=439

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  62    KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  121

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  122   IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  181

Query  1101  SQYREIAPRLKL  1136
              +YRE+ P LKL
Sbjct  182   RRYRELVPNLKL  193



>ref|XP_006476914.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Citrus sinensis]
Length=449

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 157/214 (73%), Gaps = 20/214 (9%)
 Frame = +3

Query  504   VIELMGGKSSRDDswrqas--rstssswNYEYPQTAYPPQPQESYNYPVQHaypsyappp  677
             VIELMGG  S+ +S RQ S   S+ S  ++ YPQ   PP  Q S  Y  Q  Y + +   
Sbjct  11    VIELMGGIISKRESSRQPSFGSSSYSWNHHNYPQQ--PPYGQPSQEYAPQQYYATPSQ--  66

Query  678   pqeqqypppsqDFASRNHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  854
                         ++ R  AP   R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVG
Sbjct  67    -----------SYSGR--APESTRKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVG  113

Query  855   IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  1034
             IDFTKSNEWTG +SF  RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDAST
Sbjct  114   IDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDAST  173

Query  1035  HDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             HDQ+VFSFYPDE+FCNGFEEVL +YRE+ P L+L
Sbjct  174   HDQEVFSFYPDEKFCNGFEEVLRRYRELVPHLRL  207



>ref|XP_003622329.1| E3 ubiquitin-protein ligase RGLG2 [Medicago truncatula]
 gb|AES78547.1| E3 ubiquitin-protein ligase RGLG2-like protein [Medicago truncatula]
Length=445

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +L R+YSRIADNYNS++EVTEAL RAGLESSNLIVG+DFTKSNEWTGK SF  +SLH+ G
Sbjct  76    KLQRKYSRIADNYNSIDEVTEALGRAGLESSNLIVGVDFTKSNEWTGKNSFRRQSLHHTG  135

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
               LNPYEQAISIIGKT+A FDDDNLIPCFGFGDASTHDQDVFSFYPD  FCNGFE+VLS+
Sbjct  136   SDLNPYEQAISIIGKTMAEFDDDNLIPCFGFGDASTHDQDVFSFYPDGSFCNGFEDVLSR  195

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  196   YREIVPHLRL  205



>gb|KJB51129.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=450

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  75    KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  134

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  135   IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  194

Query  1101  SQYREIAPRLKL  1136
              +YRE+ P LKL
Sbjct  195   RRYRELVPNLKL  206



>ref|XP_007037786.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 ref|XP_007037787.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY22287.1| RING domain ligase2 isoform 1 [Theobroma cacao]
 gb|EOY22288.1| RING domain ligase2 isoform 1 [Theobroma cacao]
Length=456

 Score =   228 bits (580),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             RRL+R+YS+I DNYNSLE+VTEALARAGLESSNLIVGID+TKSNEWTG +SF+ RSLH+I
Sbjct  82    RRLERKYSKIDDNYNSLEQVTEALARAGLESSNLIVGIDYTKSNEWTGARSFHRRSLHHI  141

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
             G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL 
Sbjct  142   GDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVLR  201

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  202   RYRELVPNLRL  212



>gb|KDO69439.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
Length=460

 Score =   228 bits (580),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 157/214 (73%), Gaps = 20/214 (9%)
 Frame = +3

Query  504   VIELMGGKSSRDDswrqas--rstssswNYEYPQTAYPPQPQESYNYPVQHaypsyappp  677
             VIELMGG  S+ +S RQ S   S+ S  ++ YPQ   PP  Q S  Y  Q  Y + +   
Sbjct  22    VIELMGGIISKRESSRQPSFGSSSYSWNHHNYPQQ--PPYGQPSQEYAPQQYYATPSQ--  77

Query  678   pqeqqypppsqDFASRNHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  854
                         ++ R  AP   R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVG
Sbjct  78    -----------SYSGR--APESTRKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVG  124

Query  855   IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  1034
             IDFTKSNEWTG +SF  RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDAST
Sbjct  125   IDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDAST  184

Query  1035  HDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             HDQ+VFSFYPDE+FCNGFEEVL +YRE+ P L+L
Sbjct  185   HDQEVFSFYPDEKFCNGFEEVLRRYRELVPHLRL  218



>ref|XP_010912939.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Elaeis guineensis]
Length=472

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +LDRRYS+IADNYNSLE+VTEALA++GLESSNLIVGIDFTKSNEWTGK SFN RSLH+I 
Sbjct  98    KLDRRYSKIADNYNSLEQVTEALAQSGLESSNLIVGIDFTKSNEWTGKHSFNRRSLHSIS  157

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGF E L++
Sbjct  158   DTKNPYEQAISIIGQTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDERPCNGFPEALAR  217

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  218   YREIVPHLRL  227



>gb|KJB51124.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
 gb|KJB51131.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
 gb|KJB51132.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
 gb|KJB51133.1| hypothetical protein B456_008G202700 [Gossypium raimondii]
Length=437

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +RRL+R++S+I DNYNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+
Sbjct  62    KRRLERKFSKIDDNYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHH  121

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE FCNGFEEVL
Sbjct  122   IGDEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDETFCNGFEEVL  181

Query  1101  SQYREIAPRLKL  1136
              +YRE+ P LKL
Sbjct  182   RRYRELVPNLKL  193



>gb|KDO69440.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
Length=466

 Score =   228 bits (580),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 157/214 (73%), Gaps = 20/214 (9%)
 Frame = +3

Query  504   VIELMGGKSSRDDswrqas--rstssswNYEYPQTAYPPQPQESYNYPVQHaypsyappp  677
             VIELMGG  S+ +S RQ S   S+ S  ++ YPQ   PP  Q S  Y  Q  Y + +   
Sbjct  28    VIELMGGIISKRESSRQPSFGSSSYSWNHHNYPQQ--PPYGQPSQEYAPQQYYATPSQ--  83

Query  678   pqeqqypppsqDFASRNHAP-PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  854
                         ++ R  AP   R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVG
Sbjct  84    -----------SYSGR--APESTRKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVG  130

Query  855   IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  1034
             IDFTKSNEWTG +SF  RSLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDAST
Sbjct  131   IDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDAST  190

Query  1035  HDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             HDQ+VFSFYPDE+FCNGFEEVL +YRE+ P L+L
Sbjct  191   HDQEVFSFYPDEKFCNGFEEVLRRYRELVPHLRL  224



>ref|XP_010519134.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010519135.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010519136.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
 ref|XP_010519137.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Tarenaya hassleriana]
Length=430

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +++L+R+YS+I D+Y+SL++VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+
Sbjct  61    KKKLERKYSKINDDYSSLDQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHH  120

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYE+AI+I+GKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFCNGFEEVL
Sbjct  121   IGDSQNPYEEAIAIVGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCNGFEEVL  180

Query  1101  SQYREIAPRLKL  1136
             S+YRE+ P L+L
Sbjct  181   SRYRELVPHLRL  192



>gb|EPS73512.1| hypothetical protein M569_01244 [Genlisea aurea]
Length=425

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 147/213 (69%), Gaps = 32/213 (15%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqy  695
             MGGK S++    + S   S+  ++ +     PP  Q SY Y                   
Sbjct  1     MGGKGSKNAVSGRYSSYVSNQNSWNHQSYPQPPPAQPSYGY-------------------  41

Query  696   pppsqDFASRNHA----PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGI  857
                     SRN A    PPQ  RRL+R++S+I DNYNSL++VT+ALARAGLESSNLIVGI
Sbjct  42    -------GSRNPAYDAPPPQAKRRLERKFSKIDDNYNSLDQVTDALARAGLESSNLIVGI  94

Query  858   DFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTH  1037
             DFTKSNEWTG +SF+ R LH+IG   NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTH
Sbjct  95    DFTKSNEWTGARSFHRRCLHHIGDEQNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTH  154

Query  1038  DQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             DQ+VF FYPDERFC GFEEVL++YRE+ P+L+L
Sbjct  155   DQEVFGFYPDERFCEGFEEVLTRYRELVPQLRL  187



>ref|XP_006476915.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Citrus sinensis]
 ref|XP_006476916.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Citrus sinensis]
 ref|XP_006476917.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X4 
[Citrus sinensis]
Length=435

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH+I
Sbjct  63    RKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHI  122

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
             G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE+FCNGFEEVL 
Sbjct  123   GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLR  182

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  183   RYRELVPHLRL  193



>ref|XP_006439963.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
 gb|ESR53203.1| hypothetical protein CICLE_v10020205mg [Citrus clementina]
Length=435

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH+I
Sbjct  63    RKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHI  122

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
             G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE+FCNGFEEVL 
Sbjct  123   GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLR  182

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  183   RYRELVPHLRL  193



>gb|KDO69441.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
 gb|KDO69442.1| hypothetical protein CISIN_1g012303mg [Citrus sinensis]
Length=435

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R+L+R+YS+I DNY+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH+I
Sbjct  63    RKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHI  122

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
             G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDE+FCNGFEEVL 
Sbjct  123   GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLR  182

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  183   RYRELVPHLRL  193



>gb|ABK24359.1| unknown [Picea sitchensis]
Length=423

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +++L RRYSRIADNYNSL+EVT ALA+AGLESSNLIVGIDFTKSNEWTG +SFN RSLH+
Sbjct  47    KQKLQRRYSRIADNYNSLDEVTAALAQAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHH  106

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ VFSFYPD+R CNGFEE L
Sbjct  107   IGDTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQHVFSFYPDDRLCNGFEEAL  166

Query  1101  SQYREIAPRLKL  1136
              +YREI P L+L
Sbjct  167   RRYREIVPHLRL  178



>ref|XP_010927542.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Elaeis guineensis]
 ref|XP_010927543.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Elaeis guineensis]
Length=454

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RLDRRYS+I D+Y+S+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+IG
Sbjct  79    RLDRRYSKITDDYSSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFHGRSLHHIG  138

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQD+FSFYPDER C+GF E L++
Sbjct  139   DIPNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDIFSFYPDERSCDGFTEALAR  198

Query  1107  YREIAPRLKL  1136
             YRE+ PRL+L
Sbjct  199   YRELVPRLRL  208



>emb|CDX70564.1| BnaC03g06480D [Brassica napus]
Length=471

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             S +H   ++RL+R+YS+I+D+Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SF
Sbjct  83    SYSHGNDKKRLERKYSKISDDYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSF  142

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFC
Sbjct  143   NRKSLHYIGNNPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFC  202

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL +Y+EI P+LKL
Sbjct  203   NGFEEVLGRYKEIVPQLKL  221



>ref|NP_001240870.1| uncharacterized protein LOC100809850 [Glycine max]
 ref|XP_006577852.1| PREDICTED: uncharacterized protein LOC100809850 isoform X1 [Glycine 
max]
 gb|ACU22839.1| unknown [Glycine max]
Length=427

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 122/136 (90%), Gaps = 1/136 (1%)
 Frame = +3

Query  732   APPQ-RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  908
             AP Q + LDR+YSRI D+Y SL++VT+ALA+AGLESSNLIVGIDFTKSNEWTG +SF  R
Sbjct  51    APEQGKSLDRKYSRIGDDYKSLDQVTDALAKAGLESSNLIVGIDFTKSNEWTGGRSFQRR  110

Query  909   SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  1088
              LH+IGH  NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFC GF
Sbjct  111   CLHHIGHEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCRGF  170

Query  1089  EEVLSQYREIAPRLKL  1136
             EEVL +YRE+ P+LKL
Sbjct  171   EEVLERYRELVPQLKL  186



>ref|XP_008379181.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Malus domestica]
 ref|XP_008379182.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Malus domestica]
Length=484

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +++ DRRYSRIAD+YNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ +SLH+
Sbjct  95    EKKFDRRYSRIADSYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLHH  154

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             +G+  NPYE AISIIGKTLA FD+DNLIPCFGFGDASTHDQDVFSFY D+R+CNGFEEVL
Sbjct  155   VGNTPNPYEHAISIIGKTLAVFDEDNLIPCFGFGDASTHDQDVFSFY-DDRYCNGFEEVL  213

Query  1101  SQYREIAPRLKL  1136
             ++YREI P+L+L
Sbjct  214   TRYREIVPKLRL  225



>ref|XP_011101825.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Sesamum indicum]
Length=372

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  774   ADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQA  953
             A +  S ++VTEALARAGLESSNLIVGIDFTKSNEWTGK+S+NGRSLH+IG GLNPYEQA
Sbjct  9     ALSLCSGDQVTEALARAGLESSNLIVGIDFTKSNEWTGKRSYNGRSLHHIGSGLNPYEQA  68

Query  954   ISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLK  1133
             ISI+GKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS+YREI P LK
Sbjct  69    ISIVGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSRYREIVPHLK  128

Query  1134  L  1136
             L
Sbjct  129   L  129



>ref|XP_004236287.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Solanum lycopersicum]
 ref|XP_010319032.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Solanum lycopersicum]
Length=437

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 126/136 (93%), Gaps = 2/136 (1%)
 Frame = +3

Query  735   PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  908
             PP+  +RL+R++S+I D+YNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +
Sbjct  51    PPESRKRLERKFSKIDDDYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRK  110

Query  909   SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  1088
             SLH+IG G NPYEQAISIIG+TL+ FD+DNLIPC+GFGDASTHDQ+VFSFYPDE+FCNGF
Sbjct  111   SLHHIGDGQNPYEQAISIIGRTLSKFDEDNLIPCYGFGDASTHDQEVFSFYPDEKFCNGF  170

Query  1089  EEVLSQYREIAPRLKL  1136
             EEVL +YRE+ P+L+L
Sbjct  171   EEVLGRYRELVPQLRL  186



>ref|XP_006297977.1| hypothetical protein CARUB_v10014021mg [Capsella rubella]
 ref|XP_006297978.1| hypothetical protein CARUB_v10014021mg [Capsella rubella]
 gb|EOA30875.1| hypothetical protein CARUB_v10014021mg [Capsella rubella]
 gb|EOA30876.1| hypothetical protein CARUB_v10014021mg [Capsella rubella]
Length=364

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +3

Query  735   PPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSL  914
             P +++ DRRYS+I+DNY+SL++V+EAL RAGLESSNLIVGIDFTKSNEWTG  SFN ++L
Sbjct  92    PDRKKFDRRYSKISDNYSSLDQVSEALGRAGLESSNLIVGIDFTKSNEWTGANSFNKKNL  151

Query  915   HNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEE  1094
             H++ +  NPYEQAI+I+G+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFCNGFEE
Sbjct  152   HHLSNTPNPYEQAITIVGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFCNGFEE  211

Query  1095  VLSQYREIAPRLKL  1136
             VL++YREI P+LKL
Sbjct  212   VLARYREIVPQLKL  225



>ref|XP_007137991.1| hypothetical protein PHAVU_009G171800g [Phaseolus vulgaris]
 gb|ESW09985.1| hypothetical protein PHAVU_009G171800g [Phaseolus vulgaris]
Length=428

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = +3

Query  732   APPQ-RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  908
             AP Q +R D +YSRI DNY SL++VTEALA AGLESSNLIVGIDFTKSNEWTG +SF  R
Sbjct  52    APEQGKRSDGKYSRIGDNYKSLDQVTEALANAGLESSNLIVGIDFTKSNEWTGARSFQRR  111

Query  909   SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  1088
              LH+IGH  NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSFYPDERFC GF
Sbjct  112   CLHHIGHEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDERFCQGF  171

Query  1089  EEVLSQYREIAPRLKL  1136
             EEVL +YRE+ P+LKL
Sbjct  172   EEVLGRYRELVPQLKL  187



>ref|XP_010492244.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010492245.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010492246.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
 ref|XP_010492247.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Camelina sativa]
Length=470

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YSRI+DNY+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  94    KKRLERKYSRISDNYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  153

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  154   IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  213

Query  1101  SQYREIAPRLKL  1136
             ++Y+EI P+LKL
Sbjct  214   ARYKEIVPQLKL  225



>ref|XP_006351421.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Solanum tuberosum]
 ref|XP_006351422.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Solanum tuberosum]
Length=439

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 126/136 (93%), Gaps = 2/136 (1%)
 Frame = +3

Query  735   PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  908
             PP+  +RL+R++S+I D+YNSLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +
Sbjct  53    PPESRKRLERKFSKIDDDYNSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGTRSFHRK  112

Query  909   SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  1088
             SLH+IG G NPYEQAISIIG+TL+ FD+DNLIPC+GFGDASTHDQ+VFSFYPDE+FCNGF
Sbjct  113   SLHHIGDGQNPYEQAISIIGRTLSKFDEDNLIPCYGFGDASTHDQEVFSFYPDEKFCNGF  172

Query  1089  EEVLSQYREIAPRLKL  1136
             EEVL +YRE+ P+L+L
Sbjct  173   EEVLGRYRELVPQLRL  188



>gb|KCW52958.1| hypothetical protein EUGRSUZ_J02261 [Eucalyptus grandis]
Length=431

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  771   IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  950
             IAD+YNSL+EVTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+IG GLNPYEQ
Sbjct  70    IADDYNSLDEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHHIGDGLNPYEQ  129

Query  951   AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRL  1130
             AISIIGKTLA FD+DNLIPC+GFGDASTHDQDVFSFYP +RFCNGFEEVLS+YREI P L
Sbjct  130   AISIIGKTLAVFDEDNLIPCYGFGDASTHDQDVFSFYPADRFCNGFEEVLSRYREIVPHL  189

Query  1131  KL  1136
             +L
Sbjct  190   RL  191



>ref|XP_002298557.2| hypothetical protein POPTR_0001s35660g [Populus trichocarpa]
 gb|EEE83362.2| hypothetical protein POPTR_0001s35660g [Populus trichocarpa]
Length=447

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  771   IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  950
             IAD+Y SL +VTEALARAGLESSNLIVGIDFTKSNEWTG +S+N R LH+IG G NPYEQ
Sbjct  81    IADDYKSLHQVTEALARAGLESSNLIVGIDFTKSNEWTGARSYNRRCLHHIGDGFNPYEQ  140

Query  951   AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRL  1130
             AISIIGKTLAAFD+DNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS+YREI P L
Sbjct  141   AISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSRYREIVPNL  200

Query  1131  KL  1136
             +L
Sbjct  201   RL  202



>ref|XP_010932261.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Elaeis guineensis]
 ref|XP_010932262.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Elaeis guineensis]
Length=456

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RLDRRYS+I D+YNS+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH++G
Sbjct  81    RLDRRYSKITDDYNSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHHVG  140

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGF E L++
Sbjct  141   DIPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDERPCNGFSEALAR  200

Query  1107  YREIAPRLKL  1136
             YRE+ P L+L
Sbjct  201   YRELIPHLRL  210



>ref|XP_010453560.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Camelina sativa]
 ref|XP_010453561.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Camelina sativa]
 ref|XP_010453562.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Camelina sativa]
Length=464

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YSRI+DNY+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  85    KKRLERKYSRISDNYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  144

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  145   IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  204

Query  1101  SQYREIAPRLKL  1136
             ++Y+EI P+LKL
Sbjct  205   ARYKEIVPQLKL  216



>ref|XP_004138080.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis sativus]
Length=432

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YSRI DNYNSL++VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+
Sbjct  61    RKRLERKYSRIDDNYNSLDQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHH  120

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAI+IIG+TL++FD+DN+IPCFGFGDASTHDQ+VFSFY DERFCNGFEEVL
Sbjct  121   IGEEQNPYEQAIAIIGQTLSSFDEDNMIPCFGFGDASTHDQEVFSFYSDERFCNGFEEVL  180

Query  1101  SQYREIAPRLKL  1136
              +Y+E+ P L+L
Sbjct  181   GRYKELVPHLRL  192



>gb|KJB61002.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61003.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61004.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61005.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61006.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61007.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61008.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
 gb|KJB61009.1| hypothetical protein B456_009G335200 [Gossypium raimondii]
Length=468

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 150/222 (68%), Gaps = 42/222 (19%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYPPQ----PQESYNYPVQHaypsyappppq  683
             MGGKSS+D S R    S S   +  + +  YPPQ    PQ  Y  P  H           
Sbjct  1     MGGKSSKDSSGRAYPTSRSGGSD-SWSRYGYPPQSGYPPQTPYYTPRHH-----------  48

Query  684   eqqypppsqDFASRNHAPPQ------RRLDR-----RYSRIADNYNSLEEVTEALARAGL  830
                            HAPP       + L R     +YSRIADNY +L++VT ALA+AGL
Sbjct  49    ---------------HAPPHSSNYGLQTLHRGHKIVKYSRIADNYETLDQVTAALAQAGL  93

Query  831   ESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPC  1010
             ESSNLIVGIDFTKSNEWTG +SFN +SLH+IG+G NPYEQAISIIG++L+AFD+DN IPC
Sbjct  94    ESSNLIVGIDFTKSNEWTGARSFNRKSLHHIGNGQNPYEQAISIIGQSLSAFDEDNFIPC  153

Query  1011  FGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             +GFGDASTHDQDVFSFYP+ERFCNGFEEVL++YREI P+L+L
Sbjct  154   YGFGDASTHDQDVFSFYPEERFCNGFEEVLARYREIVPQLRL  195



>ref|XP_009131405.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Brassica 
rapa]
Length=471

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 142/182 (78%), Gaps = 5/182 (3%)
 Frame = +3

Query  606   YPPQPQESYNYP-----VQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSR  770
             YP    ESYNYP       H  P YA PPP       P     S +H   ++RL+R++S+
Sbjct  40    YPQYGPESYNYPPTPSYAPHPPPEYAQPPPAPSYSTQPYSQPPSYSHGNDKKRLERKFSK  99

Query  771   IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  950
             I+D Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH IG+  NPYEQ
Sbjct  100   ISDEYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHYIGNNPNPYEQ  159

Query  951   AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRL  1130
             AI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFCNGFEEVL +Y+EI P+L
Sbjct  160   AITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFCNGFEEVLGRYKEIVPQL  219

Query  1131  KL  1136
             KL
Sbjct  220   KL  221



>ref|XP_009131403.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Brassica 
rapa]
Length=472

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 142/182 (78%), Gaps = 5/182 (3%)
 Frame = +3

Query  606   YPPQPQESYNYP-----VQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSR  770
             YP    ESYNYP       H  P YA PPP       P     S +H   ++RL+R++S+
Sbjct  40    YPQYGPESYNYPPTPSYAPHPPPEYAQPPPAPSYSTQPYSQPPSYSHGNDKKRLERKFSK  99

Query  771   IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  950
             I+D Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH IG+  NPYEQ
Sbjct  100   ISDEYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHYIGNNPNPYEQ  159

Query  951   AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRL  1130
             AI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFCNGFEEVL +Y+EI P+L
Sbjct  160   AITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFCNGFEEVLGRYKEIVPQL  219

Query  1131  KL  1136
             KL
Sbjct  220   KL  221



>ref|XP_007215340.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
 ref|XP_007215341.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
 gb|EMJ16539.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
 gb|EMJ16540.1| hypothetical protein PRUPE_ppa005347mg [Prunus persica]
Length=465

 Score =   225 bits (574),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 151/211 (72%), Gaps = 12/211 (6%)
 Frame = +3

Query  516   MGGKSSRDDswrqasrstssswNYEYPQTAYP----PQPQESYNYPVQHaypsyappppq  683
             MGG+SS++ S+RQ S S S+S ++ YPQ   P    P  QES +YP           P  
Sbjct  1     MGGRSSKEGSFRQNSSSRSTSSSWSYPQVQSPYVQSPYAQESQSYPPPQQAYPATSQPYY  60

Query  684   eqqypppsqDFASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDF  863
                      D+       P   L+R+YS I+D+Y SLEEVTEALARAGLESSNLIVGIDF
Sbjct  61    PPSQ-----DYGGARATRP--TLERKYSIISDSYKSLEEVTEALARAGLESSNLIVGIDF  113

Query  864   TKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQ  1043
             TKSNEWTG KSFN +SLH+IG G NPYE AISIIGKTLA FD+DNLIPCFGFGDASTHDQ
Sbjct  114   TKSNEWTGSKSFNRKSLHHIGSGQNPYEHAISIIGKTLAVFDEDNLIPCFGFGDASTHDQ  173

Query  1044  DVFSFYPDERFCNGFEEVLSQYREIAPRLKL  1136
             DVFSFY D R+CNGFEEVL++YREI P L+L
Sbjct  174   DVFSFYSD-RYCNGFEEVLTRYREIVPHLRL  203



>ref|XP_008464499.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
 ref|XP_008464500.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
 ref|XP_008464501.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Cucumis melo]
Length=430

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YSRI DNYNSL++VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN RSLH+
Sbjct  59    RKRLERKYSRIDDNYNSLDQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHH  118

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAI+IIG+TL++FD+DN+IPCFGFGDASTHDQ+VFSFY DERFCNGFEEVL
Sbjct  119   IGDEQNPYEQAIAIIGQTLSSFDEDNMIPCFGFGDASTHDQEVFSFYSDERFCNGFEEVL  178

Query  1101  SQYREIAPRLKL  1136
              +Y+E+ P L+L
Sbjct  179   GRYKELVPHLRL  190



>ref|XP_002884269.1| hypothetical protein ARALYDRAFT_896079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60528.1| hypothetical protein ARALYDRAFT_896079 [Arabidopsis lyrata subsp. 
lyrata]
Length=430

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             S++H   +++ DRRYS+I+DNY+SL +V+EAL RAGLESSNLIVGIDFTKSNEWTG KSF
Sbjct  56    SQSHDADRKKFDRRYSKISDNYSSLLQVSEALGRAGLESSNLIVGIDFTKSNEWTGAKSF  115

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH++ +  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDA+THDQDVFSFYP+ RFC
Sbjct  116   NRKSLHHLSNTPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDATTHDQDVFSFYPEGRFC  175

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL++YREI P LKL
Sbjct  176   NGFEEVLARYREIVPHLKL  194



>gb|KGN63523.1| hypothetical protein Csa_1G002920 [Cucumis sativus]
Length=475

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  726   NHAPPQR-RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFN  902
               AP  R RL+R+YSRI DNYNSL++VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN
Sbjct  98    TQAPETRKRLERKYSRIDDNYNSLDQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFN  157

Query  903   GRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCN  1082
              RSLH+IG   NPYEQAI+IIG+TL++FD+DN+IPCFGFGDASTHDQ+VFSFY DERFCN
Sbjct  158   RRSLHHIGEEQNPYEQAIAIIGQTLSSFDEDNMIPCFGFGDASTHDQEVFSFYSDERFCN  217

Query  1083  GFEEVLSQYREIAPRLKL  1136
             GFEEVL +Y+E+ P L+L
Sbjct  218   GFEEVLGRYKELVPHLRL  235



>ref|XP_009419388.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Musa acuminata 
subsp. malaccensis]
Length=468

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R LDRRYSRI+DNYNSL++VTEAL++AGLESSNLIVG+DFTKSNEWTGK SF GRSLH+I
Sbjct  80    RTLDRRYSRISDNYNSLDQVTEALSQAGLESSNLIVGVDFTKSNEWTGKHSFRGRSLHHI  139

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
             G   NPYEQA+SIIG+TL+AFD+DNLIPCFGFGDASTHDQD+FSFYPDER CNGF E L 
Sbjct  140   GDSPNPYEQAMSIIGRTLSAFDEDNLIPCFGFGDASTHDQDIFSFYPDERPCNGFSEALE  199

Query  1104  QYREIAPRLKL  1136
             +Y+E+ P L+L
Sbjct  200   RYKELVPHLRL  210



>ref|XP_008797006.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
 ref|XP_008797015.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
Length=454

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 136/184 (74%), Gaps = 13/184 (7%)
 Frame = +3

Query  585   YEYPQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRY  764
             YE P     P P + Y  PVQ    +  PPP                     +RRLDRRY
Sbjct  38    YEAPGYQNYPPPSQRYGEPVQAYPQTPPPPPQTPPAGGS-------------RRRLDRRY  84

Query  765   SRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPY  944
             S+I D+YNS+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+IG   NPY
Sbjct  85    SKITDDYNSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFHGRSLHHIGDIPNPY  144

Query  945   EQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAP  1124
             EQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVFSFYPDER CNGF E L++YRE+ P
Sbjct  145   EQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFSFYPDERSCNGFTEALARYRELVP  204

Query  1125  RLKL  1136
              L+L
Sbjct  205   CLRL  208



>emb|CDX78576.1| BnaA03g04880D [Brassica napus]
Length=471

 Score =   225 bits (573),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             S +H   ++RL+R++S+I+D Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SF
Sbjct  83    SYSHGNDKKRLERKFSKISDEYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSF  142

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFC
Sbjct  143   NRKSLHYIGNNPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFC  202

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL +Y+EI P+LKL
Sbjct  203   NGFEEVLGRYKEIVPQLKL  221



>ref|XP_006287685.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
 ref|XP_006287686.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
 gb|EOA20583.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
 gb|EOA20584.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
Length=357

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YSRI+D+Y+SLE+VTEALARAGLESSNLIVG+DFTKSNEWTG +SFN +SLH 
Sbjct  87    KKRLERKYSRISDDYSSLEQVTEALARAGLESSNLIVGMDFTKSNEWTGARSFNRKSLHF  146

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  147   IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  206

Query  1101  SQYREIAPRLKL  1136
             ++Y+EI P+LKL
Sbjct  207   ARYKEIVPQLKL  218



>ref|XP_010485387.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
Length=462

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = +3

Query  726   NHAPPQ----RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  893
             N+ PPQ    ++ DRRYS+I+DNY+SL++V+EAL RAGLESSNLIVGIDFTKSNEWTG  
Sbjct  91    NNPPPQSPDRKKFDRRYSKISDNYSSLDQVSEALGRAGLESSNLIVGIDFTKSNEWTGAN  150

Query  894   SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  1073
             SFN ++LH++ +  NPYEQAI+I+G+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ R
Sbjct  151   SFNKKNLHHLSNTPNPYEQAITIVGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGR  210

Query  1074  FCNGFEEVLSQYREIAPRLKL  1136
             FCNGFEEVL++YREI P+LKL
Sbjct  211   FCNGFEEVLARYREIVPQLKL  231



>gb|EEE53061.1| hypothetical protein OsJ_35797 [Oryza sativa Japonica Group]
Length=355

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +L+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK+SFNG SLH+IG
Sbjct  165   KLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKRSFNGMSLHHIG  224

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAI+IIG+TL+AFD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L++
Sbjct  225   DSPNPYEQAITIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  284

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  285   YREIVPHLRL  294



>emb|CDY09854.1| BnaC09g43070D [Brassica napus]
Length=466

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             S++H   ++RL+R+YS+I+D Y+SLE+VTEALA AGLESSNLIVGIDFTKSNEWTG +SF
Sbjct  81    SQSHGNNKKRLERKYSKISDEYSSLEQVTEALAGAGLESSNLIVGIDFTKSNEWTGARSF  140

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFC
Sbjct  141   NRKSLHFIGNSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFC  200

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL +Y+EI P+LKL
Sbjct  201   NGFEEVLGRYKEIVPQLKL  219



>ref|XP_010531508.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RGLG2 
[Tarenaya hassleriana]
Length=449

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             SR  +  +++ +R+YSRIADNY SL+EVT AL +AGLESSNLIVGIDFTKSNEWTG +SF
Sbjct  63    SRTQSQSRKQFERKYSRIADNYRSLDEVTVALLQAGLESSNLIVGIDFTKSNEWTGARSF  122

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH+IG   NPYEQAISIIGKTL+AFD+DNLIPC+GFGDA+THDQDVFSFYP+++FC
Sbjct  123   NRKSLHHIGSTPNPYEQAISIIGKTLSAFDEDNLIPCYGFGDATTHDQDVFSFYPEDKFC  182

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL +YREI P+L+L
Sbjct  183   NGFEEVLVRYREIVPQLRL  201



>emb|CDY37509.1| BnaA05g33740D [Brassica napus]
Length=460

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +3

Query  720   SRNHAPP--QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  893
             S+ HA P  +++ DRRYS+I+DNY SL++V+EAL RAGLESSNLI+GIDFTKSNEWTG K
Sbjct  80    SQTHAAPSDRKKFDRRYSKISDNYASLDQVSEALGRAGLESSNLILGIDFTKSNEWTGAK  139

Query  894   SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  1073
             SF+ +SLH+I + LNPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R
Sbjct  140   SFSKKSLHHISNTLNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGR  199

Query  1074  FCNGFEEVLSQYREIAPRLKL  1136
              CNGFE+VL++YR+I P LKL
Sbjct  200   SCNGFEQVLARYRDIVPHLKL  220



>ref|XP_009121662.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Brassica rapa]
 ref|XP_009121663.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Brassica rapa]
 ref|XP_009121664.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Brassica rapa]
Length=466

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YS+I+D Y+SLE+VTEALA AGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  88    KKRLERKYSKISDEYSSLEQVTEALAGAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  147

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF PD+RFCNGFEEVL
Sbjct  148   IGNSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPDDRFCNGFEEVL  207

Query  1101  SQYREIAPRLKL  1136
              +Y+EI P+LKL
Sbjct  208   GRYKEIVPQLKL  219



>emb|CDX69581.1| BnaA10g19300D [Brassica napus]
Length=466

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YS+I+D Y+SLE+VTEALA AGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  88    KKRLERKYSKISDEYSSLEQVTEALAGAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  147

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF PD+RFCNGFEEVL
Sbjct  148   IGNSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPDDRFCNGFEEVL  207

Query  1101  SQYREIAPRLKL  1136
              +Y+EI P+LKL
Sbjct  208   GRYKEIVPQLKL  219



>emb|CDY49066.1| BnaC05g48940D [Brassica napus]
Length=460

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +3

Query  720   SRNHAPP--QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  893
             S+ HA P  +++ DRRYS+I+DNY SL++V+EAL RAGLESSNLI+GIDFTKSNEWTG K
Sbjct  80    SQTHAAPSDRKKFDRRYSKISDNYVSLDQVSEALGRAGLESSNLILGIDFTKSNEWTGAK  139

Query  894   SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  1073
             SF+ +SLH+I + LNPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R
Sbjct  140   SFSKKSLHHISNTLNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGR  199

Query  1074  FCNGFEEVLSQYREIAPRLKL  1136
              CNGFE+VL++YR+I P LKL
Sbjct  200   SCNGFEQVLARYRDIVPHLKL  220



>ref|XP_009147449.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like isoform X2 
[Brassica rapa]
Length=456

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +3

Query  720   SRNHAPP--QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  893
             S+ HA P  +++ DRRYS+I+DNY SL++V+EAL RAGLESSNLI+GIDFTKSNEWTG K
Sbjct  80    SQTHAAPSDRKKFDRRYSKISDNYASLDQVSEALGRAGLESSNLILGIDFTKSNEWTGAK  139

Query  894   SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  1073
             SF+ +SLH+I + LNPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R
Sbjct  140   SFSKKSLHHISNTLNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGR  199

Query  1074  FCNGFEEVLSQYREIAPRLKL  1136
              CNGFE+VL++YR+I P LKL
Sbjct  200   SCNGFEQVLARYRDIVPHLKL  220



>gb|ERN19129.1| hypothetical protein AMTR_s00061p00153710 [Amborella trichopoda]
Length=384

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             R+  RYS IADNY SL +VTEALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH+IG
Sbjct  45    RVQGRYSHIADNYQSLGQVTEALAHAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHIG  104

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
             +  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDA+THDQDVFSFYPDER CNGFEE L +
Sbjct  105   NTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDATTHDQDVFSFYPDERMCNGFEEALGR  164

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  165   YREIVPNLRL  174



>ref|XP_010033344.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Eucalyptus grandis]
Length=435

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  771   IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  950
             IAD+YNSL+EVTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+IG GLNPYEQ
Sbjct  70    IADDYNSLDEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHHIGDGLNPYEQ  129

Query  951   AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRL  1130
             AISIIGKTLA FD+DNLIPC+GFGDASTHDQDVFSFYP +RFCNGFEEVLS+YREI P L
Sbjct  130   AISIIGKTLAVFDEDNLIPCYGFGDASTHDQDVFSFYPADRFCNGFEEVLSRYREIVPHL  189

Query  1131  KL  1136
             +L
Sbjct  190   RL  191



>ref|NP_186814.1| E3 ubiquitin-protein ligase RGLG1 [Arabidopsis thaliana]
 sp|Q9SS90.1|RGLG1_ARATH RecName: Full=E3 ubiquitin-protein ligase RGLG1; AltName: Full=RING 
domain ligase 1 [Arabidopsis thaliana]
 gb|AAF01562.1|AC009325_32 unknown protein [Arabidopsis thaliana]
 gb|AEE73699.1| E3 ubiquitin-protein ligase RGLG1 [Arabidopsis thaliana]
Length=489

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             S++    +++ DRRYS+I+DNY+SL +V+EAL RAGLESSNLIVGIDFTKSNEWTG KSF
Sbjct  116   SQSQVADRKKFDRRYSKISDNYSSLLQVSEALGRAGLESSNLIVGIDFTKSNEWTGAKSF  175

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH++ +  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFC
Sbjct  176   NRKSLHHLSNTPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFC  235

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL++YREI P+LKL
Sbjct  236   NGFEEVLARYREIVPQLKL  254



>ref|XP_010033343.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW52956.1| hypothetical protein EUGRSUZ_J02261 [Eucalyptus grandis]
 gb|KCW52957.1| hypothetical protein EUGRSUZ_J02261 [Eucalyptus grandis]
Length=446

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  771   IADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQ  950
             IAD+YNSL+EVTEALARAGLESSNLIVGIDFTKSNEWTG +SF+ RSLH+IG GLNPYEQ
Sbjct  70    IADDYNSLDEVTEALARAGLESSNLIVGIDFTKSNEWTGARSFHRRSLHHIGDGLNPYEQ  129

Query  951   AISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRL  1130
             AISIIGKTLA FD+DNLIPC+GFGDASTHDQDVFSFYP +RFCNGFEEVLS+YREI P L
Sbjct  130   AISIIGKTLAVFDEDNLIPCYGFGDASTHDQDVFSFYPADRFCNGFEEVLSRYREIVPHL  189

Query  1131  KL  1136
             +L
Sbjct  190   RL  191



>ref|XP_011628239.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Amborella trichopoda]
Length=397

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             R+  RYS IADNY SL +VTEALA AGLESSNLIVGIDFTKSNEWTG +SFN RSLH+IG
Sbjct  45    RVQGRYSHIADNYQSLGQVTEALAHAGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHIG  104

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
             +  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDA+THDQDVFSFYPDER CNGFEE L +
Sbjct  105   NTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDATTHDQDVFSFYPDERMCNGFEEALGR  164

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  165   YREIVPNLRL  174



>ref|XP_011071995.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Sesamum indicum]
Length=431

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 126/136 (93%), Gaps = 2/136 (1%)
 Frame = +3

Query  735   PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  908
             PP+  R+L+R+YSRI DNY++L++VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +
Sbjct  52    PPESKRKLERKYSRIDDNYHTLDQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRK  111

Query  909   SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  1088
             SLH+IG   NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VFSF+PDERFC+GF
Sbjct  112   SLHHIGDEQNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQEVFSFFPDERFCDGF  171

Query  1089  EEVLSQYREIAPRLKL  1136
             EEVL++YRE+ P+L+L
Sbjct  172   EEVLTRYRELVPQLRL  187



>ref|XP_006287684.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
 gb|EOA20582.1| hypothetical protein CARUB_v10000894mg [Capsella rubella]
Length=466

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YSRI+D+Y+SLE+VTEALARAGLESSNLIVG+DFTKSNEWTG +SFN +SLH 
Sbjct  87    KKRLERKYSRISDDYSSLEQVTEALARAGLESSNLIVGMDFTKSNEWTGARSFNRKSLHF  146

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  147   IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  206

Query  1101  SQYREIAPRLKL  1136
             ++Y+EI P+LKL
Sbjct  207   ARYKEIVPQLKL  218



>ref|NP_196946.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 ref|NP_850818.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 ref|NP_974779.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 ref|NP_974780.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 sp|Q9LY87.1|RGLG2_ARATH RecName: Full=E3 ubiquitin-protein ligase RGLG2; AltName: Full=RING 
domain ligase 2 [Arabidopsis thaliana]
 emb|CAB87781.1| putative protein [Arabidopsis thaliana]
 gb|AAM20448.1| putative protein [Arabidopsis thaliana]
 gb|AAN15568.1| putative protein [Arabidopsis thaliana]
 gb|AAZ14078.1| At5g14420 [Arabidopsis thaliana]
 gb|AED92028.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 gb|AED92029.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 gb|AED92030.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
 gb|AED92031.1| E3 ubiquitin-protein ligase RGLG2 [Arabidopsis thaliana]
Length=468

 Score =   223 bits (568),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YS+I+D+Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  89    KKRLERKYSKISDDYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  148

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  149   IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  208

Query  1101  SQYREIAPRLKL  1136
             S+Y+EI P+LKL
Sbjct  209   SRYKEIVPQLKL  220



>ref|XP_010496283.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Camelina sativa]
 ref|XP_010496284.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Camelina sativa]
 ref|XP_010496285.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Camelina sativa]
Length=449

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +++ DRRYS+I+DNY+SL +V+EAL RAGLESSNLIVGIDFTKSNEWTG KSFN ++LH+
Sbjct  87    RKKFDRRYSKISDNYSSLAQVSEALGRAGLESSNLIVGIDFTKSNEWTGAKSFNKKNLHH  146

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             + +  NPYEQAI+I+G+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+ RFCNGFEEVL
Sbjct  147   LSNTPNPYEQAITIVGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFCNGFEEVL  206

Query  1101  SQYREIAPRLKL  1136
             ++YREI P+LKL
Sbjct  207   ARYREIVPQLKL  218



>ref|XP_009147448.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like isoform X1 
[Brassica rapa]
Length=489

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 126/141 (89%), Gaps = 2/141 (1%)
 Frame = +3

Query  720   SRNHAPP--QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKK  893
             S+ HA P  +++ DRRYS+I+DNY SL++V+EAL RAGLESSNLI+GIDFTKSNEWTG K
Sbjct  113   SQTHAAPSDRKKFDRRYSKISDNYASLDQVSEALGRAGLESSNLILGIDFTKSNEWTGAK  172

Query  894   SFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDER  1073
             SF+ +SLH+I + LNPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R
Sbjct  173   SFSKKSLHHISNTLNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGR  232

Query  1074  FCNGFEEVLSQYREIAPRLKL  1136
              CNGFE+VL++YR+I P LKL
Sbjct  233   SCNGFEQVLARYRDIVPHLKL  253



>emb|CDX91935.1| BnaC03g32370D [Brassica napus]
Length=457

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +++ DRRYS+I+DNY SL++V+EAL RAGLESSNLIVGIDFTKSNEWTG KSFN +SLH+
Sbjct  88    RKKFDRRYSKISDNYASLDQVSEALGRAGLESSNLIVGIDFTKSNEWTGAKSFNKKSLHH  147

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             I +  NPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R CNGFE+VL
Sbjct  148   ISNTPNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGRSCNGFEQVL  207

Query  1101  SQYREIAPRLKL  1136
             ++YREI P LKL
Sbjct  208   ARYREIVPHLKL  219



>ref|XP_006664503.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Oryza brachyantha]
Length=449

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RL+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK SFNG SLH+IG
Sbjct  68    RLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKNSFNGMSLHHIG  127

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
             +  NPYEQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L++
Sbjct  128   NSPNPYEQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  187

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  188   YREIVPHLRL  197



>ref|XP_002873665.1| hypothetical protein ARALYDRAFT_488284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49924.1| hypothetical protein ARALYDRAFT_488284 [Arabidopsis lyrata subsp. 
lyrata]
Length=466

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YS+I+D+Y+SLE+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  86    KKRLERKYSKISDDYSSLEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  145

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  146   IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  205

Query  1101  SQYREIAPRLKL  1136
             ++Y+EI P+LKL
Sbjct  206   ARYKEIVPQLKL  217



>ref|XP_002511290.1| copine, putative [Ricinus communis]
 gb|EEF51892.1| copine, putative [Ricinus communis]
Length=433

 Score =   222 bits (565),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             RRL+R+YS+I DNYNSLE+VT+ALAR+GLESSNLIVGIDFTKSNEWTG +SFN RSLH+I
Sbjct  56    RRLERKYSKIDDNYNSLEQVTDALARSGLESSNLIVGIDFTKSNEWTGARSFNRRSLHHI  115

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
             G   NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VFSF  DE FCNGFEEVL 
Sbjct  116   GDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFNSDESFCNGFEEVLR  175

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  176   RYRELVPHLRL  186



>ref|XP_010904547.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Elaeis guineensis]
Length=468

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +LD+RYS+I D+YNSLEEVTEALA+AGLESSNLIVGIDFTKSNEWTGK SFN  SLH I 
Sbjct  99    KLDKRYSKITDHYNSLEEVTEALAKAGLESSNLIVGIDFTKSNEWTGKHSFNHHSLHYIS  158

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFYPDER CNGF E L++
Sbjct  159   DIQNPYEQAISIIGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYPDERPCNGFAEALAR  218

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  219   YREIVPHLRL  228



>ref|XP_009125973.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 ref|XP_009125974.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 ref|XP_009125975.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Brassica rapa]
 emb|CDX85597.1| BnaA02g02160D [Brassica napus]
Length=451

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YS+I+D+Y+SL++VT+ALA AGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  72    KKRLERKYSKISDDYSSLDQVTKALAHAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  131

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P+ERFCNGFEEVL
Sbjct  132   IGNTPNPYEQAIAIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEERFCNGFEEVL  191

Query  1101  SQYREIAPRLKL  1136
              +Y+EI P+LKL
Sbjct  192   GRYKEIVPQLKL  203



>ref|XP_003526988.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Glycine max]
Length=428

 Score =   221 bits (564),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 121/140 (86%), Gaps = 1/140 (1%)
 Frame = +3

Query  720   SRNHAPPQ-RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKS  896
             S   AP Q + LDR+Y RI D+Y SL++VT+ALA+AGLESSNLIVG DFTKSNEWTG +S
Sbjct  48    SGGRAPEQVKSLDRKYLRIGDDYKSLKQVTDALAKAGLESSNLIVGFDFTKSNEWTGARS  107

Query  897   FNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERF  1076
             F  R LH+IGH  NPYEQAISIIGKTL++FD+DNLIPCFGFGDASTHDQ+VF FYPDERF
Sbjct  108   FQRRCLHHIGHEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFCFYPDERF  167

Query  1077  CNGFEEVLSQYREIAPRLKL  1136
             C+GFEEVL +YRE+ P+LKL
Sbjct  168   CHGFEEVLERYRELVPQLKL  187



>emb|CDX91062.1| BnaC02g05350D [Brassica napus]
Length=452

 Score =   222 bits (565),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  720   SRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSF  899
             S+++   ++RL+R+YS+I+D+Y+SL++VTEALA AGLESSNLIVGIDFTKSNEWTG +SF
Sbjct  66    SQSYGNDKKRLERKYSKISDDYSSLDQVTEALAHAGLESSNLIVGIDFTKSNEWTGARSF  125

Query  900   NGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFC  1079
             N +SLH IG+  NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF P++RFC
Sbjct  126   NRKSLHFIGNTSNPYEQAIAIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNPEDRFC  185

Query  1080  NGFEEVLSQYREIAPRLKL  1136
             NGFEEVL +Y+EI P+LKL
Sbjct  186   NGFEEVLGRYKEIVPQLKL  204



>ref|XP_004309992.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Fragaria vesca 
subsp. vesca]
Length=433

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P+RRLDRR+S+IAD+Y SL+EVT ALA+AGLESSNLIVGIDFTKSN+WTG +SF  +SLH
Sbjct  55    PKRRLDRRFSQIADDYRSLDEVTNALAQAGLESSNLIVGIDFTKSNDWTGSRSFGRKSLH  114

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             ++G   NPYEQAISIIGKTL+AFD+DNLIPC+GFGDASTHDQDVFSFYPD+  C GFEEV
Sbjct  115   HMGTSQNPYEQAISIIGKTLSAFDEDNLIPCYGFGDASTHDQDVFSFYPDDCVCTGFEEV  174

Query  1098  LSQYREIAPRLKL  1136
             L++YREI P L+L
Sbjct  175   LTRYREIVPALRL  187



>ref|XP_008230495.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Prunus mume]
Length=460

 Score =   222 bits (565),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = +3

Query  750   LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGH  929
             L+R+YS I+D+Y SLEEVTEALARAGLESSNLIVGIDFTKSNEWTG KSFN +SLH+IG+
Sbjct  71    LERKYSIISDSYKSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGSKSFNRKSLHDIGN  130

Query  930   GLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQY  1109
             G NPYE AISIIGKTLA FD+DNLIPCFGFGDASTHDQDVFSFY D R+CNGFEEVL++Y
Sbjct  131   GQNPYEHAISIIGKTLAVFDEDNLIPCFGFGDASTHDQDVFSFYYD-RYCNGFEEVLTRY  189

Query  1110  REIAPRLKL  1136
             REI P L+L
Sbjct  190   REIVPHLRL  198



>ref|XP_008807474.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
 ref|XP_008807475.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
 ref|XP_008807476.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
Length=468

 Score =   222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RLDRRYS+I D+YNS+E+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SF+ RSLH+IG
Sbjct  86    RLDRRYSKITDDYNSVEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFHRRSLHHIG  145

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQDVFSF+PDER CNGF E L++
Sbjct  146   DIPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQDVFSFHPDERPCNGFSEALAR  205

Query  1107  YREIAPRLKL  1136
             YRE+ P L+L
Sbjct  206   YRELVPHLRL  215



>ref|XP_010435648.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
 ref|XP_010435649.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
 ref|XP_010435650.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Camelina sativa]
Length=450

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 125/143 (87%), Gaps = 6/143 (4%)
 Frame = +3

Query  726   NHAPPQ------RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG  887
             ++ PPQ      ++ DRRYS+I+DNY+SL +V+EAL RAGLESSNLIVGIDFTKSNEWTG
Sbjct  77    SNPPPQSADSDRKKFDRRYSKISDNYSSLAQVSEALGRAGLESSNLIVGIDFTKSNEWTG  136

Query  888   KKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPD  1067
               SFN ++LH++ +  NPYEQAI+I+G+TLAAFD+DNLIPC+GFGDASTHDQDVFSFYP+
Sbjct  137   ANSFNKKNLHHLSNTPNPYEQAITIVGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPE  196

Query  1068  ERFCNGFEEVLSQYREIAPRLKL  1136
              RFCNGFEEVL++YREI P+LKL
Sbjct  197   GRFCNGFEEVLARYREIVPQLKL  219



>ref|XP_007209145.1| hypothetical protein PRUPE_ppa005852mg [Prunus persica]
 gb|EMJ10344.1| hypothetical protein PRUPE_ppa005852mg [Prunus persica]
Length=440

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 130/155 (84%), Gaps = 13/155 (8%)
 Frame = +3

Query  711   DFASRNH-APP-----------QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  854
             D+  + H APP           ++RL+R+YS+I D+YNSLE+VT+ALARAGLESSNLIVG
Sbjct  43    DYGQQQHFAPPPQSHGSAWPGSKKRLERKYSKIDDDYNSLEQVTDALARAGLESSNLIVG  102

Query  855   IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  1034
             IDFTKSNEWTG +SF+ +SLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDAST
Sbjct  103   IDFTKSNEWTGARSFHRKSLHHIGEEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDAST  162

Query  1035  HDQDVFSFYPDE-RFCNGFEEVLSQYREIAPRLKL  1136
             HDQ+VFSFYPDE  FCNGFEEVL +YRE+ P+L+L
Sbjct  163   HDQEVFSFYPDEGSFCNGFEEVLRRYRELVPQLRL  197



>ref|XP_009795957.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
 ref|XP_009795958.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
sylvestris]
Length=432

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 126/136 (93%), Gaps = 2/136 (1%)
 Frame = +3

Query  735   PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  908
             PP+  +RL+R+YS+I D+Y+SLE+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +
Sbjct  53    PPESRKRLERKYSKIDDDYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRK  112

Query  909   SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  1088
             SLH+IG   NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VF+FYPD+++CNGF
Sbjct  113   SLHHIGDQQNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQEVFAFYPDDKYCNGF  172

Query  1089  EEVLSQYREIAPRLKL  1136
             EEVLS+YRE+ P+L+L
Sbjct  173   EEVLSRYRELVPQLRL  188



>ref|XP_006646587.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Oryza brachyantha]
Length=397

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RLDRRYSRIAD+Y+S+++VT+ALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH I 
Sbjct  20    RLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHYIS  79

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
             +  NPYEQAISIIG+TL+ FD+DN+IPCFGFGDASTHDQDVF FYPDER CNGF E L Q
Sbjct  80    NVPNPYEQAISIIGQTLSKFDEDNMIPCFGFGDASTHDQDVFCFYPDERPCNGFSEALDQ  139

Query  1107  YREIAPRLKL  1136
             YRE+ P L+L
Sbjct  140   YRELVPHLRL  149



>emb|CDX74310.1| BnaA03g27370D [Brassica napus]
Length=458

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +++ DRRYS+I+DNY SL++V+EALARAGLESSNLI+GIDFTKSNEWTG KSFN +SLH+
Sbjct  89    RKKFDRRYSKISDNYASLDQVSEALARAGLESSNLILGIDFTKSNEWTGAKSFNKKSLHH  148

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             I +  NPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R CNGFE+VL
Sbjct  149   ISNTPNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGRSCNGFEQVL  208

Query  1101  SQYREIAPRLKL  1136
             ++YR+I P LKL
Sbjct  209   ARYRDIVPHLKL  220



>gb|EYU44842.1| hypothetical protein MIMGU_mgv1a024648mg, partial [Erythranthe 
guttata]
Length=376

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             PQ  LD  YSRIADNYNSL EVTEAL RAGLESSNLIVGIDFT SNEWTG  SF GRSLH
Sbjct  31    PQENLDTWYSRIADNYNSLHEVTEALKRAGLESSNLIVGIDFTASNEWTGMNSFGGRSLH  90

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             + G+G NPYEQAI I+GKTL+AFD+DNLIPCFGFGDASTHD+DVFSF PD +F NGF  V
Sbjct  91    HTGNGPNPYEQAIYIVGKTLSAFDEDNLIPCFGFGDASTHDEDVFSFSPDHKFSNGFVHV  150

Query  1098  LSQYREIAPRLKL  1136
             LSQYR+I P LKL
Sbjct  151   LSQYRDILPHLKL  163



>gb|ACR36132.1| unknown [Zea mays]
 tpg|DAA54942.1| TPA: copine family protein [Zea mays]
Length=541

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RL+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK  FNG SLHNI 
Sbjct  160   RLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKNCFNGMSLHNIS  219

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVF+FYPDER CNGF+E L++
Sbjct  220   DNPNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFAFYPDERPCNGFQEALAR  279

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  280   YREIVPHLRL  289



>ref|XP_004970988.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Setaria italica]
Length=464

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R+LDRRYSRIAD+YNS+++VT+ALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+I
Sbjct  83    RQLDRRYSRIADDYNSVDQVTDALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHHI  142

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
                 NPYEQAISIIG+T++ FD+DNLIPCFGFGDASTHDQDVF FYPDER CNGF E L 
Sbjct  143   SSTPNPYEQAISIIGQTMSKFDEDNLIPCFGFGDASTHDQDVFCFYPDERPCNGFSEALH  202

Query  1104  QYREIAPRLKL  1136
             +YREI P L+L
Sbjct  203   RYREIVPHLRL  213



>ref|XP_009134597.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Brassica rapa]
 ref|XP_009134598.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1 [Brassica rapa]
Length=458

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             +++ DRRYS+I+DNY SL++V+EALARAGLESSNLI+GIDFTKSNEWTG KSFN +SLH+
Sbjct  89    RKKFDRRYSKISDNYASLDQVSEALARAGLESSNLILGIDFTKSNEWTGAKSFNKKSLHH  148

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             I +  NPYEQAI+IIG+TLAAFD+DNLIPCFGFGDASTHDQDVFSFYP+ R CNGFE+VL
Sbjct  149   ISNTPNPYEQAITIIGRTLAAFDEDNLIPCFGFGDASTHDQDVFSFYPEGRSCNGFEQVL  208

Query  1101  SQYREIAPRLKL  1136
             ++YR+I P LKL
Sbjct  209   ARYRDIVPHLKL  220



>gb|KJB31093.1| hypothetical protein B456_005G175700 [Gossypium raimondii]
Length=439

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 137/181 (76%), Gaps = 14/181 (8%)
 Frame = +3

Query  594   PQTAYPPQPQESYNYPVQHaypsyappppqeqqypppsqDFASRNHAPPQRRLDRRYSRI  773
             PQ+AYP   Q++Y Y  QH   + +P             ++  +      R ++R+YSRI
Sbjct  34    PQSAYP---QQNYYYTPQHPSYAPSPSY-----------NYVQQTPGCVHRTMERKYSRI  79

Query  774   ADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQA  953
              DNY +L++VT ALA+AGLESSNLIVGIDFTKSNEWTG  SFN RSLH+IGHG NPYEQA
Sbjct  80    DDNYQTLDQVTAALAQAGLESSNLIVGIDFTKSNEWTGAMSFNHRSLHHIGHGQNPYEQA  139

Query  954   ISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQYREIAPRLK  1133
             I+II ++L+A D+DNLIPC+GFGDASTHDQDVFSFYP+E FC GFEEVL++YREI P+L+
Sbjct  140   ITIIERSLSALDEDNLIPCYGFGDASTHDQDVFSFYPEEIFCEGFEEVLARYREIVPQLR  199

Query  1134  L  1136
             L
Sbjct  200   L  200



>emb|CAN81848.1| hypothetical protein VITISV_036819 [Vitis vinifera]
Length=440

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 122/145 (84%), Gaps = 7/145 (5%)
 Frame = +3

Query  717   ASRNHAPPQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK--  890
             A   H  PQ  LDRRYSRIADNYNSL++VT ALA+AGLESSNLIVGIDFTKSNEWTG   
Sbjct  59    AQTPHRHPQ--LDRRYSRIADNYNSLDQVTAALAQAGLESSNLIVGIDFTKSNEWTGLIP  116

Query  891   ---KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFY  1061
                 SFN +SLH+IG G NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQD+FSFY
Sbjct  117   SAFLSFNRKSLHHIGRGQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDIFSFY  176

Query  1062  PDERFCNGFEEVLSQYREIAPRLKL  1136
              DER CNGFEEVL +YRE+ P L+L
Sbjct  177   QDERPCNGFEEVLMRYRELVPSLRL  201



>ref|XP_009403629.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Musa acuminata 
subsp. malaccensis]
Length=460

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             Q + + +YSRIAD+Y+SLE+VTEAL+RAGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+
Sbjct  86    QPKAEAKYSRIADDYSSLEQVTEALSRAGLESSNLIVGIDFTKSNEWTGKLSFHGRSLHS  145

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAISIIG+TL+AFD+DN+IPCFGFGDA+THD DVFSFYP ER CNGFEE L
Sbjct  146   IGAATNPYEQAISIIGRTLSAFDEDNMIPCFGFGDATTHDGDVFSFYPGERPCNGFEEAL  205

Query  1101  SQYREIAPRLKL  1136
              +YREI P L+L
Sbjct  206   ERYREITPHLRL  217



>dbj|BAH19894.1| AT5G14420 [Arabidopsis thaliana]
Length=468

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YS+I+D+Y+S E+VTEALARAGLESSNLIVGIDFTKSNEWTG +SFN +SLH 
Sbjct  89    KKRLERKYSKISDDYSSWEQVTEALARAGLESSNLIVGIDFTKSNEWTGARSFNRKSLHF  148

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVL  1100
             IG   NPYEQAI+IIG+TLAAFD+DNLIPC+GFGDASTHDQDVFSF  ++RFCNGFEEVL
Sbjct  149   IGSSPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFNSEDRFCNGFEEVL  208

Query  1101  SQYREIAPRLKL  1136
             S+Y+EI P+LKL
Sbjct  209   SRYKEIVPQLKL  220



>ref|XP_008786705.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Phoenix dactylifera]
Length=475

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%), Gaps = 3/138 (2%)
 Frame = +3

Query  726   NHAPPQR-RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFN  902
             +HA   R +LDRRYS+IADNY+SLE+VTEALA+AGLESSNLIVGIDFTKSNEWTGK SFN
Sbjct  95    SHATSSRPKLDRRYSKIADNYSSLEQVTEALAQAGLESSNLIVGIDFTKSNEWTGKHSFN  154

Query  903   GRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCN  1082
              RSLH+IG   NPYEQAISIIG+T++AFD+DNLIPCFGFGDASTHDQDVFSFY  ER CN
Sbjct  155   RRSLHSIGDTKNPYEQAISIIGQTMSAFDEDNLIPCFGFGDASTHDQDVFSFY--ERPCN  212

Query  1083  GFEEVLSQYREIAPRLKL  1136
             GF E L++YREI P L+L
Sbjct  213   GFAEALTRYREIVPHLRL  230



>ref|XP_010044533.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Eucalyptus grandis]
 ref|XP_010044535.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Eucalyptus grandis]
 ref|XP_010044536.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X3 
[Eucalyptus grandis]
 gb|KCW86618.1| hypothetical protein EUGRSUZ_B03245 [Eucalyptus grandis]
 gb|KCW86619.1| hypothetical protein EUGRSUZ_B03245 [Eucalyptus grandis]
 gb|KCW86620.1| hypothetical protein EUGRSUZ_B03245 [Eucalyptus grandis]
Length=439

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 2/134 (1%)
 Frame = +3

Query  741   QRR--LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSL  914
             QRR  ++ +YSRIADNY+SL EVT ALA+AGLESSNLIVGIDFTKSNEWTG +SF+ +SL
Sbjct  67    QRRKIVNTKYSRIADNYHSLHEVTSALAQAGLESSNLIVGIDFTKSNEWTGARSFHRQSL  126

Query  915   HNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEE  1094
             H+I HG NPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY D RFCNGFEE
Sbjct  127   HDIDHGQNPYEQAISIIGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYQDNRFCNGFEE  186

Query  1095  VLSQYREIAPRLKL  1136
             VL +Y+E+ P L+L
Sbjct  187   VLMRYKEVVPHLRL  200



>ref|NP_001150002.1| copine family protein [Zea mays]
 gb|ACG37466.1| copine family protein [Zea mays]
Length=541

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RL+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK  FNG SLHNI 
Sbjct  160   RLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKNCFNGISLHNIS  219

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVF+FYPDER CNGF+E L++
Sbjct  220   DNPNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFAFYPDERPCNGFQEALAR  279

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  280   YREIVPHLRL  289



>gb|AFW76346.1| hypothetical protein ZEAMMB73_695996, partial [Zea mays]
Length=339

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +3

Query  717   ASRNHAPPQR--RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  890
             +S N   P+   RL R+YS+I D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK
Sbjct  45    SSENSVQPETHARLQRKYSKIGDDYRSLSQVTEALAQAGLESSNLIVGIDFTKSNEWTGK  104

Query  891   KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  1070
              SFN R LH+IG+  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ 
Sbjct  105   ISFNRRCLHDIGNTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPEN  164

Query  1071  RFCNGFEEVLSQYREIAPRLKL  1136
             R CNGFEE L +YREI P L+L
Sbjct  165   RPCNGFEEALDRYREIVPTLRL  186



>ref|XP_010044531.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Eucalyptus grandis]
Length=465

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 2/134 (1%)
 Frame = +3

Query  741   QRR--LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSL  914
             QRR  ++ +YSRIADNY+SL EVT ALA+AGLESSNLIVGIDFTKSNEWTG +SF+ +SL
Sbjct  93    QRRKIVNTKYSRIADNYHSLHEVTSALAQAGLESSNLIVGIDFTKSNEWTGARSFHRQSL  152

Query  915   HNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEE  1094
             H+I HG NPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY D RFCNGFEE
Sbjct  153   HDIDHGQNPYEQAISIIGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYQDNRFCNGFEE  212

Query  1095  VLSQYREIAPRLKL  1136
             VL +Y+E+ P L+L
Sbjct  213   VLMRYKEVVPHLRL  226



>ref|XP_010044532.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Eucalyptus grandis]
Length=463

 Score =   220 bits (560),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 2/134 (1%)
 Frame = +3

Query  741   QRR--LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSL  914
             QRR  ++ +YSRIADNY+SL EVT ALA+AGLESSNLIVGIDFTKSNEWTG +SF+ +SL
Sbjct  91    QRRKIVNTKYSRIADNYHSLHEVTSALAQAGLESSNLIVGIDFTKSNEWTGARSFHRQSL  150

Query  915   HNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEE  1094
             H+I HG NPYEQAISIIGKTL+ FD+DNLIPCFGFGDASTHDQDVFSFY D RFCNGFEE
Sbjct  151   HDIDHGQNPYEQAISIIGKTLSTFDEDNLIPCFGFGDASTHDQDVFSFYQDNRFCNGFEE  210

Query  1095  VLSQYREIAPRLKL  1136
             VL +Y+E+ P L+L
Sbjct  211   VLMRYKEVVPHLRL  224



>ref|XP_008239359.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Prunus mume]
Length=440

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 130/155 (84%), Gaps = 13/155 (8%)
 Frame = +3

Query  711   DFASRNH-APP-----------QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVG  854
             D+  + H APP           ++RL+R+YS+I D+YNSLE+VT+ALARAGLESSNLIVG
Sbjct  43    DYGQQQHFAPPPQSHGSAWPGSKKRLERKYSKIDDDYNSLEQVTDALARAGLESSNLIVG  102

Query  855   IDFTKSNEWTGKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDAST  1034
             IDFTKSNEWTG +SF+ +SLH+IG   NPYEQAISIIGKTL++FD+DNLIPCFGFGDAST
Sbjct  103   IDFTKSNEWTGARSFHRKSLHHIGEEQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDAST  162

Query  1035  HDQDVFSFYPDE-RFCNGFEEVLSQYREIAPRLKL  1136
             HDQ+VFSFYP+E  FCNGFEEVL +YRE+ P+L+L
Sbjct  163   HDQEVFSFYPEEGSFCNGFEEVLRRYRELVPQLRL  197



>ref|XP_009608151.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
tomentosiformis]
 ref|XP_009608152.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nicotiana 
tomentosiformis]
Length=432

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 125/136 (92%), Gaps = 2/136 (1%)
 Frame = +3

Query  735   PPQ--RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGR  908
             PP+  +RL+R+YS+I D+Y+S+E+VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +
Sbjct  53    PPESRKRLERKYSKIDDDYHSIEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRK  112

Query  909   SLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGF  1088
             SLH+IG   NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VF FYPD+++CNGF
Sbjct  113   SLHHIGDQQNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQEVFGFYPDDKYCNGF  172

Query  1089  EEVLSQYREIAPRLKL  1136
             EEVLS+YRE+ P+L+L
Sbjct  173   EEVLSRYRELVPQLRL  188



>ref|XP_004962600.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Setaria italica]
Length=540

 Score =   221 bits (564),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RL+R+YS+I D Y+S +EV EALA+AGLESSNLI+GIDFTKSNEWTGK SFNG SLH+IG
Sbjct  159   RLERKYSKIVDQYHSFDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKNSFNGMSLHHIG  218

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIG+TL+AFD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L++
Sbjct  219   ETPNPYEQAISIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  278

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  279   YREIVPHLRL  288



>dbj|BAD35623.1| unknown protein [Oryza sativa Japonica Group]
Length=415

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RL R+YSRI D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK SFN R LH+IG
Sbjct  59    RLQRKYSRIGDDYRSLNQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFNRRCLHDIG  118

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
             +  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ R CNGFEE L +
Sbjct  119   NTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPENRPCNGFEEALER  178

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  179   YREIVPTLRL  188



>ref|XP_010682339.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682340.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   219 bits (559),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P++ L+R+YSRIADNY +L+EVT ALA AGLESSNLIVGIDFTKSNEWTG KSFN RSLH
Sbjct  77    PKKTLERKYSRIADNYRTLDEVTAALAHAGLESSNLIVGIDFTKSNEWTGAKSFNRRSLH  136

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG+  NPYE+AI+IIGKTL+ FD+DNLIPC+GFGDASTHDQDVFSFY D+R C GFEEV
Sbjct  137   HIGNDPNPYEEAIAIIGKTLSVFDEDNLIPCYGFGDASTHDQDVFSFYEDDRPCQGFEEV  196

Query  1098  LSQYREIAPRLKL  1136
             +S+YRE+ P+L+L
Sbjct  197   MSRYRELVPQLRL  209



>tpg|DAA56240.1| TPA: hypothetical protein ZEAMMB73_877987 [Zea mays]
Length=460

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R+LDRRYSRIAD+Y+S+++VT+ALA+AGLESSNLIVG+DFTKSNEWTGK SF+GRSLH+I
Sbjct  80    RQLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGVDFTKSNEWTGKFSFHGRSLHHI  139

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
              +  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQDVF F PDER CNGFEE L 
Sbjct  140   SNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQDVFCFSPDERPCNGFEEALD  199

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  200   RYRELVPHLRL  210



>tpg|DAA56239.1| TPA: hypothetical protein ZEAMMB73_877987 [Zea mays]
Length=461

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R+LDRRYSRIAD+Y+S+++VT+ALA+AGLESSNLIVG+DFTKSNEWTGK SF+GRSLH+I
Sbjct  80    RQLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGVDFTKSNEWTGKFSFHGRSLHHI  139

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
              +  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQDVF F PDER CNGFEE L 
Sbjct  140   SNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQDVFCFSPDERPCNGFEEALD  199

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  200   RYRELVPHLRL  210



>ref|NP_001146212.1| uncharacterized protein LOC100279782 [Zea mays]
 gb|ACL53475.1| unknown [Zea mays]
 gb|ACL54587.1| unknown [Zea mays]
Length=460

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R+LDRRYSRIAD+Y+S+++VT+ALA+AGLESSNLIVG+DFTKSNEWTGK SF+GRSLH+I
Sbjct  80    RQLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGVDFTKSNEWTGKFSFHGRSLHHI  139

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
              +  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQDVF F PDER CNGFEE L 
Sbjct  140   SNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQDVFCFSPDERPCNGFEEALD  199

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  200   RYRELVPHLRL  210



>ref|XP_002458953.1| hypothetical protein SORBIDRAFT_03g043290 [Sorghum bicolor]
 gb|EES04073.1| hypothetical protein SORBIDRAFT_03g043290 [Sorghum bicolor]
Length=459

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  744   RRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNI  923
             R+LDRRYSRIAD+Y+S+++VT+ALA+AGLESSNLIVGIDFTKSNEWTGK SF+GRSLH+I
Sbjct  79    RQLDRRYSRIADDYHSVDQVTDALAQAGLESSNLIVGIDFTKSNEWTGKFSFHGRSLHHI  138

Query  924   GHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLS  1103
              +  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQDVF F PDER CNGFEE L 
Sbjct  139   SNTPNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQDVFCFSPDERPCNGFEEALD  198

Query  1104  QYREIAPRLKL  1136
             +YRE+ P L+L
Sbjct  199   RYRELVPHLRL  209



>ref|NP_001066593.1| Os12g0288400 [Oryza sativa Japonica Group]
 gb|ABA97133.2| copine, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29612.1| Os12g0288400 [Oryza sativa Japonica Group]
 dbj|BAG92271.1| unnamed protein product [Oryza sativa Japonica Group]
Length=546

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +L+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK+SFNG SLH+IG
Sbjct  165   KLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKRSFNGMSLHHIG  224

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAI+IIG+TL+AFD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L++
Sbjct  225   DSPNPYEQAITIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  284

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  285   YREIVPHLRL  294



>ref|XP_010682336.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682337.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682338.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=491

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 124/144 (86%), Gaps = 7/144 (5%)
 Frame = +3

Query  726   NHAPP-------QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWT  884
             N+APP       ++ L+R+YSRIADNY +L+EVT ALA AGLESSNLIVGIDFTKSNEWT
Sbjct  90    NYAPPPPSATRPKKTLERKYSRIADNYRTLDEVTAALAHAGLESSNLIVGIDFTKSNEWT  149

Query  885   GKKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYP  1064
             G KSFN RSLH+IG+  NPYE+AI+IIGKTL+ FD+DNLIPC+GFGDASTHDQDVFSFY 
Sbjct  150   GAKSFNRRSLHHIGNDPNPYEEAIAIIGKTLSVFDEDNLIPCYGFGDASTHDQDVFSFYE  209

Query  1065  DERFCNGFEEVLSQYREIAPRLKL  1136
             D+R C GFEEV+S+YRE+ P+L+L
Sbjct  210   DDRPCQGFEEVMSRYRELVPQLRL  233



>emb|CDP13252.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P ++ D RYSRIADNY +L++VT AL+ AGLESSNLIVGID TKSNEWTG +SF  +SLH
Sbjct  56    PYQKSDSRYSRIADNYETLDQVTAALSEAGLESSNLIVGIDVTKSNEWTGARSFKHKSLH  115

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             ++G+  NPYEQAISIIGKTL+AFD+DNLIPCFGFGDASTHDQDVFSFYPD R CNGFEEV
Sbjct  116   HMGNVQNPYEQAISIIGKTLSAFDEDNLIPCFGFGDASTHDQDVFSFYPDARSCNGFEEV  175

Query  1098  LSQYREIAPRLKL  1136
             L +YRE+ PRL+L
Sbjct  176   LRRYRELVPRLRL  188



>gb|EEC69114.1| hypothetical protein OsI_38028 [Oryza sativa Indica Group]
Length=573

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             +L+R+YS+I D Y SL+EV EALA+AGLESSNLI+GIDFTKSNEWTGK+SFNG SLH+IG
Sbjct  192   KLERKYSKIVDQYRSLDEVIEALAQAGLESSNLIIGIDFTKSNEWTGKRSFNGMSLHHIG  251

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAI+IIG+TL+AFD+DNLIPC+GFGDASTHDQDVF+FYPDER CNGF+E L++
Sbjct  252   DSPNPYEQAITIIGQTLSAFDEDNLIPCYGFGDASTHDQDVFAFYPDERPCNGFQEALAR  311

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  312   YREIVPHLRL  321



>ref|XP_009412691.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 4/143 (3%)
 Frame = +3

Query  720   SRNHAPPQRR----LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTG  887
             S ++ PP  R    +DRRYSRI+DNY++LE+VTEALA+AGLESSNLIVGID TKSNEWTG
Sbjct  46    SESYPPPGSRPRPTIDRRYSRISDNYHTLEQVTEALAQAGLESSNLIVGIDLTKSNEWTG  105

Query  888   KKSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPD  1067
             K SF GRSLH+IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHD+DVFSF PD
Sbjct  106   KFSFGGRSLHHIGDTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDRDVFSFCPD  165

Query  1068  ERFCNGFEEVLSQYREIAPRLKL  1136
              R CNGF++ L QYRE+ P L+L
Sbjct  166   GRPCNGFQDTLVQYRELLPHLRL  188



>ref|XP_004299159.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Fragaria vesca 
subsp. vesca]
Length=448

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 124/133 (93%), Gaps = 1/133 (1%)
 Frame = +3

Query  741   QRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHN  920
             ++RL+R+YS+I DNYNSL++VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF+ +SLH+
Sbjct  67    KKRLERKYSKIDDNYNSLDQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFHRKSLHH  126

Query  921   IGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE-RFCNGFEEV  1097
             IG   NPYEQAI+IIGKTL++FD+DN+IPC+GFGDASTHDQ+VFSFYPDE  +CNGFEEV
Sbjct  127   IGDEQNPYEQAIAIIGKTLSSFDEDNMIPCYGFGDASTHDQEVFSFYPDEDTYCNGFEEV  186

Query  1098  LSQYREIAPRLKL  1136
             LS+YRE+ P+L+L
Sbjct  187   LSRYRELVPQLRL  199



>ref|XP_002279018.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010663074.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 ref|XP_010663075.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2 [Vitis vinifera]
 emb|CBI14914.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 118/142 (83%), Gaps = 5/142 (4%)
 Frame = +3

Query  726   NHAPPQRR-----LDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  890
             NH PP          R+YS+I DNYNSL++VT ALA+AGLESSNLIVGIDFTKSNEWTG 
Sbjct  48    NHPPPTYGGQNPGSKRKYSKIEDNYNSLDQVTSALAQAGLESSNLIVGIDFTKSNEWTGA  107

Query  891   KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  1070
             +SF  RSLH++G   NPYEQAISIIGKTL+ FDDDNLIPCFGFGDASTHD+DVFSFY DE
Sbjct  108   RSFYRRSLHHVGDDQNPYEQAISIIGKTLSKFDDDNLIPCFGFGDASTHDRDVFSFYSDE  167

Query  1071  RFCNGFEEVLSQYREIAPRLKL  1136
             RFCNGFEEVL +YRE+ P L+L
Sbjct  168   RFCNGFEEVLKRYRELVPHLRL  189



>gb|EYU22209.1| hypothetical protein MIMGU_mgv1a006782mg [Erythranthe guttata]
Length=432

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  738   PQRRLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLH  917
             P R+ D++YSRI DNY++L++VT+ALARAGLESSNLIVGIDFTKSNEWTG +SF  RSLH
Sbjct  56    PNRKPDKKYSRIDDNYHTLDQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLH  115

Query  918   NIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEV  1097
             +IG   NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VFSF+ D+RFC GFEEV
Sbjct  116   HIGDEQNPYEQAISIIGRTLSKFDEDNLIPCFGFGDASTHDQEVFSFFSDDRFCEGFEEV  175

Query  1098  LSQYREIAPRLKL  1136
             +S+YRE+ P+L+L
Sbjct  176   MSRYRELVPQLRL  188



>ref|XP_004965913.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X1 
[Setaria italica]
 ref|XP_004965914.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like isoform X2 
[Setaria italica]
Length=445

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +3

Query  717   ASRNHAPPQR--RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  890
             +S N+  P+   RL R+YSRI D+Y SL +VT+ALA+AGLESSNLIVGIDFTKSNEWTGK
Sbjct  42    SSENNVQPETHARLQRKYSRIGDDYRSLSQVTDALAQAGLESSNLIVGIDFTKSNEWTGK  101

Query  891   KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  1070
              SFN R LH+IG   NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ 
Sbjct  102   MSFNRRCLHDIGSTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPEN  161

Query  1071  RFCNGFEEVLSQYREIAPRLKL  1136
             R CNGFEE L +YREI P L+L
Sbjct  162   RPCNGFEEALERYREIVPTLRL  183



>ref|NP_001058043.1| Os06g0608800 [Oryza sativa Japonica Group]
 dbj|BAD35622.1| putative copine I [Oryza sativa Japonica Group]
 dbj|BAF19957.1| Os06g0608800 [Oryza sativa Japonica Group]
 dbj|BAG90577.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94670.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RL R+YSRI D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK SFN R LH+IG
Sbjct  59    RLQRKYSRIGDDYRSLNQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFNRRCLHDIG  118

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
             +  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ R CNGFEE L +
Sbjct  119   NTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPENRPCNGFEEALER  178

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  179   YREIVPTLRL  188



>gb|EEC80951.1| hypothetical protein OsI_23663 [Oryza sativa Indica Group]
 gb|ACN85164.1| copine-1 [Oryza nivara]
Length=447

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RL R+YSRI D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK SFN R LH+IG
Sbjct  59    RLQRKYSRIGDDYRSLNQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFNRRCLHDIG  118

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
             +  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ R CNGFEE L +
Sbjct  119   NTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPENRPCNGFEEALER  178

Query  1107  YREIAPRLKL  1136
             YREI P L+L
Sbjct  179   YREIVPTLRL  188



>ref|XP_008650441.1| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Zea mays]
Length=409

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +3

Query  717   ASRNHAPPQR--RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  890
             +S N   P+   RL R+YS+I D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK
Sbjct  45    SSENSVQPETHARLQRKYSKIGDDYRSLSQVTEALAQAGLESSNLIVGIDFTKSNEWTGK  104

Query  891   KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  1070
              SFN R LH+IG+  NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYP+ 
Sbjct  105   ISFNRRCLHDIGNTPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPEN  164

Query  1071  RFCNGFEEVLSQYREIAPRLKL  1136
             R CNGFEE L +YREI P L+L
Sbjct  165   RPCNGFEEALDRYREIVPTLRL  186



>ref|XP_010252862.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nelumbo nucifera]
 ref|XP_010252863.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nelumbo nucifera]
 ref|XP_010252864.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nelumbo nucifera]
 ref|XP_010252865.1| PREDICTED: E3 ubiquitin-protein ligase RGLG2-like [Nelumbo nucifera]
Length=432

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  747   RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGKKSFNGRSLHNIG  926
             RL ++Y+RI DNYNS+E+VT+ALA++GLESSNLIVGIDFTKSNEWTG +SF+ RSLH++G
Sbjct  45    RLQKKYTRIPDNYNSIEQVTDALAQSGLESSNLIVGIDFTKSNEWTGARSFDRRSLHHLG  104

Query  927   HGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDERFCNGFEEVLSQ  1106
                NPYEQAISIIG+TL+AFD+DNLIPCFGFGDASTHDQ+VFSFYPD R CNGFEE L++
Sbjct  105   DSPNPYEQAISIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPDNRPCNGFEEALTR  164

Query  1107  YREIAPRLKL  1136
             YRE+ PRL+L
Sbjct  165   YRELVPRLRL  174



>ref|NP_001147447.1| copine-1 [Zea mays]
 ref|XP_008658552.1| PREDICTED: copine-1 isoform X1 [Zea mays]
 ref|XP_008658554.1| PREDICTED: copine-1 isoform X1 [Zea mays]
 gb|ACG27560.1| copine-1 [Zea mays]
 gb|AFW87255.1| copine-1 isoform 1 [Zea mays]
 gb|AFW87256.1| copine-1 isoform 2 [Zea mays]
Length=445

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +3

Query  717   ASRNHAPPQR--RLDRRYSRIADNYNSLEEVTEALARAGLESSNLIVGIDFTKSNEWTGK  890
             +S N+  P+   RL R+YSRI D+Y SL +VTEALA+AGLESSNLIVGIDFTKSNEWTGK
Sbjct  44    SSENNVQPETHARLQRKYSRIGDDYRSLSQVTEALAQAGLESSNLIVGIDFTKSNEWTGK  103

Query  891   KSFNGRSLHNIGHGLNPYEQAISIIGKTLAAFDDDNLIPCFGFGDASTHDQDVFSFYPDE  1070
              SFN R LH+IG+  NPYEQAISIIG+TL+ FD+DNLIPCFGFGDASTHDQ+VFSFYP+ 
Sbjct  104   ISFNRRCLHDIGNTPNPYEQAISIIGRTLSVFDEDNLIPCFGFGDASTHDQEVFSFYPEN  163

Query  1071  RFCNGFEEVLSQYREIAPRLKL  1136
             R CNGFEE L +YREI P L+L
Sbjct  164   RPCNGFEEALDRYREIVPTLRL  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3086125308960