BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7414

Length=675
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AIN75626.1|  K+ transport growth defect-like protein                 262   8e-82   Hevea brasiliensis [jebe]
ref|XP_002523783.1|  Vacuolar protein sorting-associated protein ...    261   3e-81   Ricinus communis
ref|XP_008337894.1|  PREDICTED: vacuolar protein sorting-associat...    251   5e-81   
ref|XP_010651908.1|  PREDICTED: vacuolar protein sorting-associat...    251   7e-81   Vitis vinifera
ref|XP_012072805.1|  PREDICTED: protein SUPPRESSOR OF K(+) TRANSP...    258   4e-80   Jatropha curcas
ref|XP_009611775.1|  PREDICTED: vacuolar protein sorting-associat...    257   8e-80   Nicotiana tomentosiformis
gb|EPS68325.1|  hypothetical protein M569_06443                         248   8e-80   Genlisea aurea
ref|XP_010244408.1|  PREDICTED: vacuolar protein sorting-associat...    256   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_007207464.1|  hypothetical protein PRUPE_ppa005989mg             255   4e-79   Prunus persica
ref|XP_009364298.1|  PREDICTED: vacuolar protein sorting-associat...    254   1e-78   Pyrus x bretschneideri [bai li]
ref|XP_002313671.1|  hypothetical protein POPTR_0009s14670g             254   2e-78   Populus trichocarpa [western balsam poplar]
ref|XP_008347699.1|  PREDICTED: vacuolar protein sorting-associat...    253   4e-78   
ref|XP_006848581.1|  PREDICTED: protein SUPPRESSOR OF K(+) TRANSP...    253   4e-78   
ref|XP_008385424.1|  PREDICTED: vacuolar protein sorting-associat...    252   6e-78   Malus domestica [apple tree]
ref|XP_002262762.1|  PREDICTED: vacuolar protein sorting-associat...    252   8e-78   Vitis vinifera
ref|XP_004506158.1|  PREDICTED: vacuolar protein sorting-associat...    251   2e-77   Cicer arietinum [garbanzo]
ref|XP_006417711.1|  hypothetical protein EUTSA_v10007683mg             251   2e-77   Eutrema salsugineum [saltwater cress]
ref|XP_004291618.1|  PREDICTED: protein SUPPRESSOR OF K(+) TRANSP...    251   2e-77   Fragaria vesca subsp. vesca
ref|XP_011044980.1|  PREDICTED: vacuolar protein sorting-associat...    250   3e-77   Populus euphratica
ref|XP_004149260.1|  PREDICTED: protein SUPPRESSOR OF K(+) TRANSP...    250   5e-77   Cucumis sativus [cucumbers]
emb|CDY04504.1|  BnaA07g13300D                                          249   1e-76   
ref|XP_008799318.1|  PREDICTED: vacuolar protein sorting-associat...    241   1e-76   
ref|XP_011088877.1|  PREDICTED: vacuolar protein sorting-associat...    248   2e-76   Sesamum indicum [beniseed]
ref|XP_011090358.1|  PREDICTED: vacuolar protein sorting-associat...    247   5e-76   Sesamum indicum [beniseed]
ref|XP_008458580.1|  PREDICTED: vacuolar protein sorting-associat...    247   1e-75   Cucumis melo [Oriental melon]
ref|XP_011046276.1|  PREDICTED: vacuolar protein sorting-associat...    245   2e-75   Populus euphratica
ref|XP_002305558.1|  hypothetical protein POPTR_0004s19530g             245   4e-75   Populus trichocarpa [western balsam poplar]
ref|XP_011046275.1|  PREDICTED: vacuolar protein sorting-associat...    245   5e-75   Populus euphratica
dbj|BAN84248.1|  vacuolar protein sorting-associated protein 4-like     244   6e-75   Cucumis sativus var. sativus [cucumber]
ref|XP_010313348.1|  PREDICTED: vacuolar protein sorting-associat...    236   6e-75   
emb|CDX95077.1|  BnaC05g05940D                                          244   1e-74   
ref|XP_009148083.1|  PREDICTED: vacuolar protein sorting-associat...    243   3e-74   Brassica rapa
emb|CDX93578.1|  BnaA06g04700D                                          243   3e-74   
ref|XP_008799317.1|  PREDICTED: vacuolar protein sorting-associat...    243   4e-74   Phoenix dactylifera
ref|XP_010916481.1|  PREDICTED: vacuolar protein sorting-associat...    242   7e-74   Elaeis guineensis
ref|XP_010926491.1|  PREDICTED: vacuolar protein sorting-associat...    241   1e-73   Elaeis guineensis
ref|XP_010313347.1|  PREDICTED: vacuolar protein sorting-associat...    234   1e-73   
ref|XP_008782296.1|  PREDICTED: vacuolar protein sorting-associat...    240   4e-73   Phoenix dactylifera
ref|XP_006487969.1|  PREDICTED: vacuolar protein sorting-associat...    239   5e-73   Citrus sinensis [apfelsine]
ref|XP_006424266.1|  hypothetical protein CICLE_v10028483mg             239   6e-73   Citrus clementina [clementine]
gb|KJB35364.1|  hypothetical protein B456_006G111300                    236   2e-72   Gossypium raimondii
ref|XP_010686038.1|  PREDICTED: vacuolar protein sorting-associat...    238   4e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004251046.1|  PREDICTED: vacuolar protein sorting-associat...    237   6e-72   Solanum lycopersicum
ref|XP_004251047.1|  PREDICTED: vacuolar protein sorting-associat...    236   9e-72   Solanum lycopersicum
ref|XP_009758814.1|  PREDICTED: vacuolar protein sorting-associat...    236   2e-71   Nicotiana sylvestris
ref|XP_010089851.1|  Vacuolar protein sorting-associated protein 4      236   2e-71   Morus notabilis
ref|XP_006349118.1|  PREDICTED: vacuolar protein sorting-associat...    235   2e-71   Solanum tuberosum [potatoes]
ref|XP_006349119.1|  PREDICTED: vacuolar protein sorting-associat...    235   3e-71   Solanum tuberosum [potatoes]
gb|KJB35365.1|  hypothetical protein B456_006G111300                    234   4e-71   Gossypium raimondii
gb|KHG02332.1|  Vacuolar sorting-associated protein 4                   234   5e-71   Gossypium arboreum [tree cotton]
ref|XP_009758070.1|  PREDICTED: vacuolar protein sorting-associat...    233   1e-70   Nicotiana sylvestris
ref|XP_009615461.1|  PREDICTED: vacuolar protein sorting-associat...    233   2e-70   Nicotiana tomentosiformis
ref|XP_006409753.1|  hypothetical protein EUTSA_v10016678mg             233   2e-70   Eutrema salsugineum [saltwater cress]
gb|ABD97880.1|  suppressor of K+ transport growth defect-like pro...    233   3e-70   Gossypium hirsutum [American cotton]
ref|XP_010510756.1|  PREDICTED: vacuolar protein sorting-associat...    232   5e-70   Camelina sativa [gold-of-pleasure]
emb|CDX83275.1|  BnaA03g22310D                                          232   5e-70   
ref|XP_007150083.1|  hypothetical protein PHAVU_005G125100g             232   6e-70   Phaseolus vulgaris [French bean]
gb|AAM65285.1|  putative ATPase                                         232   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180328.1|  suppressor of K+ transport growth defect 1 protein    232   6e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KJB55643.1|  hypothetical protein B456_009G086700                    232   7e-70   Gossypium raimondii
ref|XP_010473150.1|  PREDICTED: vacuolar protein sorting-associat...    231   7e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006361450.1|  PREDICTED: vacuolar protein sorting-associat...    222   1e-69   
ref|XP_007132415.1|  hypothetical protein PHAVU_011G092700g             231   1e-69   Phaseolus vulgaris [French bean]
ref|XP_002880982.1|  hypothetical protein ARALYDRAFT_481753             231   1e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_006294248.1|  hypothetical protein CARUB_v10023246mg             231   2e-69   Capsella rubella
ref|XP_010031501.1|  PREDICTED: vacuolar protein sorting-associat...    230   2e-69   Eucalyptus grandis [rose gum]
ref|XP_003540240.1|  PREDICTED: vacuolar protein sorting-associat...    230   2e-69   Glycine max [soybeans]
ref|XP_010557402.1|  PREDICTED: vacuolar protein sorting-associat...    229   4e-69   Tarenaya hassleriana [spider flower]
ref|XP_010271707.1|  PREDICTED: vacuolar protein sorting-associat...    229   5e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010417909.1|  PREDICTED: vacuolar protein sorting-associat...    222   5e-69   Camelina sativa [gold-of-pleasure]
gb|KJB06693.1|  hypothetical protein B456_001G121400                    225   6e-69   Gossypium raimondii
ref|XP_009398151.1|  PREDICTED: vacuolar protein sorting-associat...    229   6e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009133887.1|  PREDICTED: vacuolar protein sorting-associat...    229   8e-69   Brassica rapa
ref|XP_007015856.1|  AAA-type ATPase family protein                     228   2e-68   Theobroma cacao [chocolate]
ref|XP_004487508.1|  PREDICTED: vacuolar protein sorting-associat...    227   3e-68   Cicer arietinum [garbanzo]
ref|XP_009103611.1|  PREDICTED: vacuolar protein sorting-associat...    227   3e-68   Brassica rapa
gb|KJB06696.1|  hypothetical protein B456_001G121400                    225   3e-68   Gossypium raimondii
gb|KJB06695.1|  hypothetical protein B456_001G121400                    224   3e-68   Gossypium raimondii
gb|KHG05324.1|  Vacuolar sorting-associated protein 4                   227   5e-68   Gossypium arboreum [tree cotton]
gb|KJB06694.1|  hypothetical protein B456_001G121400                    225   7e-68   Gossypium raimondii
gb|AFK34253.1|  unknown                                                 226   1e-67   Medicago truncatula
ref|XP_003606122.1|  Vacuolar sorting protein 4b                        226   1e-67   Medicago truncatula
ref|XP_009390240.1|  PREDICTED: vacuolar protein sorting-associat...    226   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003606147.1|  Vacuolar sorting protein 4b                        226   1e-67   
gb|KEH29865.1|  AAA-type ATPase family protein                          226   1e-67   Medicago truncatula
gb|KJB21698.1|  hypothetical protein B456_004G009400                    223   2e-67   Gossypium raimondii
gb|EPS59126.1|  hypothetical protein M569_15684                         224   2e-67   Genlisea aurea
gb|KHG29678.1|  Vacuolar sorting-associated protein 4                   224   3e-67   Gossypium arboreum [tree cotton]
gb|KJB06692.1|  hypothetical protein B456_001G121400                    224   3e-67   Gossypium raimondii
gb|ABK27142.1|  unknown                                                 224   8e-67   Picea sitchensis
ref|XP_010417912.1|  PREDICTED: vacuolar protein sorting-associat...    223   2e-66   Camelina sativa [gold-of-pleasure]
gb|KEH38973.1|  AAA-type ATPase family protein                          220   2e-66   Medicago truncatula
gb|KJB21697.1|  hypothetical protein B456_004G009400                    223   2e-66   Gossypium raimondii
ref|XP_010521667.1|  PREDICTED: vacuolar protein sorting-associat...    222   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_002264023.1|  PREDICTED: vacuolar protein sorting-associat...    221   6e-66   Vitis vinifera
ref|XP_010458060.1|  PREDICTED: vacuolar protein sorting-associat...    221   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_004249979.1|  PREDICTED: vacuolar protein sorting-associat...    221   8e-66   
ref|XP_009390930.1|  PREDICTED: vacuolar protein sorting-associat...    220   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003596788.1|  Vacuolar sorting protein 4b                        220   2e-65   Medicago truncatula
emb|CDP06939.1|  unnamed protein product                                220   2e-65   Coffea canephora [robusta coffee]
ref|XP_010057690.1|  PREDICTED: vacuolar protein sorting-associat...    210   4e-65   Eucalyptus grandis [rose gum]
gb|KHG11803.1|  Vacuolar sorting-associated protein 4                   219   7e-65   Gossypium arboreum [tree cotton]
gb|KHN27655.1|  Vacuolar protein sorting-associated protein 4           219   7e-65   Glycine soja [wild soybean]
gb|KHN21435.1|  Vacuolar protein sorting-associated protein 4           219   8e-65   Glycine soja [wild soybean]
ref|XP_004968156.1|  PREDICTED: vacuolar protein sorting-associat...    216   5e-64   Setaria italica
gb|EYU36954.1|  hypothetical protein MIMGU_mgv1a006685mg                216   1e-63   Erythranthe guttata [common monkey flower]
ref|XP_001765511.1|  predicted protein                                  215   1e-63   
gb|EYU36074.1|  hypothetical protein MIMGU_mgv1a006786mg                215   1e-63   Erythranthe guttata [common monkey flower]
ref|XP_001776057.1|  predicted protein                                  215   2e-63   
ref|XP_009804598.1|  PREDICTED: vacuolar protein sorting-associat...    206   8e-63   Nicotiana sylvestris
ref|XP_010088767.1|  Vacuolar protein sorting-associated protein 4      214   8e-63   
ref|XP_009804599.1|  PREDICTED: vacuolar protein sorting-associat...    206   1e-62   Nicotiana sylvestris
ref|XP_003539822.1|  PREDICTED: vacuolar protein sorting-associat...    212   3e-62   Glycine max [soybeans]
gb|KHN38642.1|  Vacuolar protein sorting-associated protein 4           211   4e-62   Glycine soja [wild soybean]
emb|CDX71438.1|  BnaC04g16730D                                          211   4e-62   
ref|XP_003538127.1|  PREDICTED: vacuolar protein sorting-associat...    211   4e-62   Glycine max [soybeans]
gb|KFK43141.1|  hypothetical protein AALP_AA1G085300                    211   7e-62   Arabis alpina [alpine rockcress]
emb|CDY31186.1|  BnaC03g47050D                                          209   4e-61   Brassica napus [oilseed rape]
ref|XP_009804597.1|  PREDICTED: vacuolar protein sorting-associat...    207   1e-60   Nicotiana sylvestris
ref|XP_009597832.1|  PREDICTED: vacuolar protein sorting-associat...    201   1e-60   Nicotiana tomentosiformis
ref|XP_010045233.1|  PREDICTED: vacuolar protein sorting-associat...    205   9e-60   Eucalyptus grandis [rose gum]
ref|XP_003594930.1|  Vacuolar sorting protein 4b                        200   1e-59   Medicago truncatula
gb|KCW87395.1|  hypothetical protein EUGRSUZ_B03874                     206   2e-59   Eucalyptus grandis [rose gum]
ref|XP_002972719.1|  hypothetical protein SELMODRAFT_267596             204   3e-59   Selaginella moellendorffii
ref|XP_010475617.1|  PREDICTED: vacuolar protein sorting-associat...    204   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_007010359.1|  AAA-type ATPase family protein isoform 3           200   1e-58   
ref|XP_009597831.1|  PREDICTED: vacuolar protein sorting-associat...    201   3e-58   Nicotiana tomentosiformis
gb|AAF21428.2|AF165422_1  salt-induced AAA-Type ATPase                  200   9e-58   Mesembryanthemum crystallinum
ref|XP_002455226.1|  hypothetical protein SORBIDRAFT_03g006580          200   9e-58   Sorghum bicolor [broomcorn]
ref|XP_007010357.1|  AAA-type ATPase family protein isoform 1           200   1e-57   
ref|XP_007010358.1|  AAA-type ATPase family protein isoform 2           199   1e-57   
dbj|BAJ90371.1|  predicted protein                                      199   3e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010488639.1|  PREDICTED: vacuolar protein sorting-associat...    198   7e-57   
ref|XP_010488647.1|  PREDICTED: vacuolar protein sorting-associat...    197   7e-57   Camelina sativa [gold-of-pleasure]
ref|XP_003568377.1|  PREDICTED: vacuolar protein sorting-associat...    196   5e-56   Brachypodium distachyon [annual false brome]
ref|XP_006643734.1|  PREDICTED: vacuolar protein sorting-associat...    194   1e-55   Oryza brachyantha
gb|ACL54383.1|  unknown                                                 194   2e-55   Zea mays [maize]
gb|ACG31815.1|  vacuolar sorting protein 4b                             194   2e-55   Zea mays [maize]
ref|NP_001150145.1|  vacuolar sorting protein 4b                        194   2e-55   Zea mays [maize]
ref|XP_002892451.1|  hypothetical protein ARALYDRAFT_311880             192   2e-55   
gb|ACL54518.1|  unknown                                                 194   3e-55   Zea mays [maize]
ref|XP_008655625.1|  PREDICTED: vacuolar protein sorting-associat...    194   7e-55   Zea mays [maize]
gb|AAN03820.1|AF499028_1  AAA-ATPase-like protein                       191   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010474541.1|  PREDICTED: vacuolar protein sorting-associat...    181   2e-54   Camelina sativa [gold-of-pleasure]
gb|EAY72474.1|  hypothetical protein OsI_00329                          191   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_002988075.1|  hypothetical protein SELMODRAFT_426754             191   3e-54   Selaginella moellendorffii
gb|EAZ10483.1|  hypothetical protein OsJ_00315                          191   3e-54   Oryza sativa Japonica Group [Japonica rice]
gb|KHN21135.1|  Vacuolar protein sorting-associated protein 4A          188   4e-54   Glycine soja [wild soybean]
emb|CDM81003.1|  unnamed protein product                                190   4e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003636695.1|  Vacuolar sorting protein 4b                        181   3e-53   
ref|XP_006379467.1|  hypothetical protein POPTR_0008s023001g            182   1e-52   
ref|XP_006387924.1|  hypothetical protein POPTR_0475s002101g            182   3e-52   
ref|XP_002316504.1|  hypothetical protein POPTR_0010s24370g             184   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_006387925.1|  hypothetical protein POPTR_0475s002101g            181   1e-51   
ref|XP_011032848.1|  PREDICTED: vacuolar protein sorting-associat...    181   1e-50   Populus euphratica
gb|EMS45124.1|  Vacuolar protein sorting-associated protein 4B          182   2e-50   Triticum urartu
ref|XP_011032841.1|  PREDICTED: vacuolar protein sorting-associat...    180   3e-50   Populus euphratica
ref|XP_002524981.1|  Vacuolar sorting protein 4b, putative              169   4e-46   
gb|EAY72476.1|  hypothetical protein OsI_00332                          168   1e-45   Oryza sativa Indica Group [Indian rice]
dbj|BAD61062.1|  putative p60 katanin                                   168   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009614201.1|  PREDICTED: serine/threonine-protein kinase U...    159   2e-44   Nicotiana tomentosiformis
ref|XP_010312541.1|  PREDICTED: vacuolar protein sorting-associat...    163   4e-44   
ref|XP_011024231.1|  PREDICTED: vacuolar protein sorting-associat...    164   5e-44   Populus euphratica
ref|NP_172304.1|  uncharacterized protein                               154   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973792.1|  uncharacterized protein                               154   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010057280.1|  PREDICTED: vacuolar protein sorting-associat...    150   3e-42   Eucalyptus grandis [rose gum]
ref|XP_012074639.1|  PREDICTED: protein SUPPRESSOR OF K(+) TRANSP...    157   8e-42   Jatropha curcas
ref|XP_012074638.1|  PREDICTED: protein SUPPRESSOR OF K(+) TRANSP...    157   9e-42   Jatropha curcas
ref|XP_012074640.1|  PREDICTED: protein SUPPRESSOR OF K(+) TRANSP...    157   9e-42   
ref|XP_012074637.1|  PREDICTED: protein SUPPRESSOR OF K(+) TRANSP...    157   2e-41   Jatropha curcas
ref|XP_005651778.1|  AAA-ATPase of VPS4/SKD1 family                     154   1e-40   Coccomyxa subellipsoidea C-169
gb|KDD74938.1|  AAA+ ATPase                                             147   5e-38   Helicosporidium sp. ATCC 50920
ref|XP_009788117.1|  PREDICTED: uncharacterized protein LOC104235979    142   6e-38   Nicotiana sylvestris
ref|XP_011400523.1|  Vacuolar protein sorting-associated protein 4      144   1e-36   Auxenochlorella protothecoides
ref|XP_008458579.1|  PREDICTED: vacuolar protein sorting-associat...    144   1e-36   Cucumis melo [Oriental melon]
ref|XP_008458578.1|  PREDICTED: vacuolar protein sorting-associat...    144   3e-36   Cucumis melo [Oriental melon]
emb|CBI28349.3|  unnamed protein product                                139   4e-35   Vitis vinifera
ref|XP_011004509.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...    127   8e-33   Populus euphratica
ref|XP_001701670.1|  AAA-ATPase of VPS4/SKD1 family                     133   1e-32   Chlamydomonas reinhardtii
ref|XP_002949582.1|  hypothetical protein VOLCADRAFT_74263              133   1e-32   Volvox carteri f. nagariensis
dbj|BAD28045.1|  putative SKD1 protein                                  127   1e-30   Oryza sativa Japonica Group [Japonica rice]
emb|CBI35240.3|  unnamed protein product                                120   3e-28   Vitis vinifera
emb|CCF53363.1|  probable VPS4-vacuolar sorting protein                 119   8e-28   Ustilago hordei
emb|CDI56953.1|  probable VPS4-vacuolar sorting protein                 118   2e-27   Melanopsichium pennsylvanicum 4
gb|KIM31071.1|  hypothetical protein M408DRAFT_322164                   118   2e-27   Serendipita vermifera MAFF 305830
ref|XP_007510347.1|  predicted protein                                  117   3e-27   Bathycoccus prasinos
ref|XP_007860430.1|  AAA-domain-containing protein                      117   3e-27   Gloeophyllum trabeum ATCC 11539
ref|XP_001419906.1|  predicted protein                                  115   2e-26   Ostreococcus lucimarinus CCE9901
emb|CEG65527.1|  Putative Suppressor protein of bem1/bed5 double ...    114   2e-26   Rhizopus microsporus
ref|XP_011387652.1|  putative AAA family ATPase VPS4                    115   2e-26   Ustilago maydis 521
emb|CCA70633.1|  probable VPS4-vacuolar sorting protein                 115   3e-26   Serendipita indica DSM 11827
ref|XP_003195584.1|  ATPase                                             114   3e-26   Cryptococcus gattii WM276
ref|XP_005847253.1|  hypothetical protein CHLNCDRAFT_134244             114   4e-26   Chlorella variabilis
emb|CEJ02927.1|  Putative Vacuolar protein sorting-associated pro...    113   4e-26   Rhizopus microsporus
emb|CEG65526.1|  Putative Vacuolar protein sorting-associated pro...    114   4e-26   Rhizopus microsporus
ref|XP_008875388.1|  hypothetical protein H310_10718                    114   7e-26   Aphanomyces invadans
gb|KIM39058.1|  hypothetical protein M413DRAFT_447414                   113   8e-26   Hebeloma cylindrosporum h7
ref|XP_009523330.1|  hypothetical protein PHYSODRAFT_491946             113   1e-25   Phytophthora sojae
gb|ESW97071.1|  Vacuolar protein sorting-associated protein 4           113   1e-25   Ogataea parapolymorpha DL-1
ref|XP_002151722.1|  vacuolar sorting ATPase Vps4, putative             113   1e-25   Talaromyces marneffei ATCC 18224
ref|XP_008031909.1|  AAA-domain-containing protein                      113   1e-25   Trametes versicolor FP-101664 SS1
ref|XP_003064827.1|  predicted protein                                  113   1e-25   Micromonas pusilla CCMP1545
ref|XP_002480681.1|  vacuolar sorting ATPase Vps4, putative             112   2e-25   Talaromyces stipitatus ATCC 10500
gb|KIL62198.1|  hypothetical protein M378DRAFT_187396                   112   2e-25   Amanita muscaria Koide BX008
gb|KGO70439.1|  ATPase, AAA-type, core                                  112   2e-25   Penicillium italicum
gb|KIK04193.1|  hypothetical protein K443DRAFT_676154                   112   3e-25   Laccaria amethystina LaAM-08-1
emb|CEF99291.1|  MIT                                                    112   3e-25   Ostreococcus tauri
ref|XP_006379308.1|  hypothetical protein POPTR_0009s14640g             105   4e-25   
gb|AAR28448.1|  Vps4p                                                   111   4e-25   Ogataea angusta
gb|KIY43103.1|  AAA-domain-containing protein                           111   4e-25   Fistulina hepatica ATCC 64428
gb|KDQ52995.1|  hypothetical protein JAAARDRAFT_39707                   111   4e-25   Jaapia argillacea MUCL 33604
emb|CDO71750.1|  hypothetical protein BN946_scf184920.g34               111   5e-25   Trametes cinnabarina
ref|XP_012051846.1|  vacuolar protein-sorting-associated protein 4      111   5e-25   Cryptococcus neoformans var. grubii H99
ref|XP_009269071.1|  Vacuolar protein sorting-associated protein 4      114   5e-25   Wallemia ichthyophaga EXF-994
gb|KEQ97233.1|  hypothetical protein AUEXF2481DRAFT_37765               111   6e-25   Aureobasidium subglaciale EXF-2481
gb|KGO37391.1|  ATPase, AAA-type, core                                  111   6e-25   Penicillium expansum
gb|KKA21983.1|  Microtubule-severing ATPase                             111   6e-25   Rasamsonia emersonii CBS 393.64
emb|CDM34041.1|  Vacuolar protein sorting-associated protein 4          110   6e-25   Penicillium roqueforti FM164
ref|XP_572783.1|  ATPase                                                111   6e-25   Cryptococcus neoformans var. neoformans JEC21
gb|EUC67165.1|  vacuolar sorting ATPase Vps4                            111   6e-25   Rhizoctonia solani AG-3 Rhs1AP
gb|ERZ98427.1|  hypothetical protein GLOINDRAFT_39456                   110   7e-25   
emb|CBQ71883.1|  probable VPS4-vacuolar sorting protein                 111   7e-25   Sporisorium reilianum SRZ2
gb|KIR88114.1|  vacuolar protein-sorting-associated protein 4           110   7e-25   Cryptococcus gattii VGIV IND107
gb|EST07633.1|  AAA+-type ATPase                                        111   7e-25   Kalmanozyma brasiliensis GHG001
dbj|GAC96299.1|  hypothetical protein PHSY_003879                       111   8e-25   Pseudozyma hubeiensis SY62
ref|XP_009830645.1|  hypothetical protein, variant 2                    110   8e-25   Aphanomyces astaci
ref|XP_003007130.1|  vacuolar protein sorting-associated protein        110   9e-25   Verticillium alfalfae VaMs.102
dbj|GAN00855.1|  AAA-domain-containing protein                          110   1e-24   Mucor ambiguus
gb|EFX03346.1|  vacuolar sorting ATPase                                 110   1e-24   Grosmannia clavigera kw1407
ref|XP_009656495.1|  vacuolar protein sorting-associated protein        110   1e-24   Verticillium dahliae VdLs.17
ref|XP_006959508.1|  AAA-domain-containing protein                      110   1e-24   Wallemia mellicola CBS 633.66
ref|XP_009830644.1|  hypothetical protein, variant 1                    110   1e-24   Aphanomyces astaci
gb|KJJ25531.1|  ATPase AAA-type core                                    110   2e-24   
ref|XP_002558404.1|  Pc12g16060                                         109   2e-24   Penicillium rubens Wisconsin 54-1255
gb|EPS30009.1|  hypothetical protein PDE_04959                          109   2e-24   Penicillium oxalicum 114-2
gb|KJA21948.1|  hypothetical protein HYPSUDRAFT_186857                  109   2e-24   Hypholoma sublateritium FD-334 SS-4
dbj|GAM41268.1|  AAA family ATPase                                      112   2e-24   Talaromyces cellulolyticus
ref|XP_009479980.1|  PREDICTED: vacuolar protein sorting-associat...    109   2e-24   Pelecanus crispus
ref|XP_002838514.1|  hypothetical protein                               109   2e-24   Tuber melanosporum Mel28
gb|ETM56233.1|  hypothetical protein L914_00756                         107   3e-24   Phytophthora parasitica
gb|AJV96807.1|  Vps4p                                                   109   3e-24   Saccharomyces cerevisiae YJM195
ref|XP_011105974.1|  vps4p                                              109   3e-24   
ref|XP_002551260.1|  vacuolar protein sorting-associated protein ...    109   3e-24   Candida tropicalis MYA-3404
ref|XP_009830643.1|  hypothetical protein H257_06949                    109   3e-24   Aphanomyces astaci
emb|CDS02833.1|  hypothetical protein LRAMOSA00236                      109   3e-24   Lichtheimia ramosa
ref|XP_003674449.1|  hypothetical protein NCAS_0A15130                  108   3e-24   Naumovozyma castellii CBS 4309
ref|XP_008890402.1|  hypothetical protein, variant 5                    108   3e-24   Phytophthora parasitica INRA-310
ref|XP_007407296.1|  hypothetical protein MELLADRAFT_47487              108   3e-24   Melampsora larici-populina 98AG31
ref|XP_002912064.1|  katanin p60 ATPase domain-containing protein       108   3e-24   Coprinopsis cinerea okayama7#130
gb|KGQ91629.1|  vacuolar protein sorting-associated protein 4           108   4e-24   Candida albicans GC75
gb|KGQ85268.1|  vacuolar protein sorting-associated protein 4           108   4e-24   Candida albicans P94015
ref|XP_008890407.1|  hypothetical protein, variant 7                    108   4e-24   Phytophthora parasitica INRA-310
ref|XP_008890411.1|  hypothetical protein, variant 1                    109   4e-24   Phytophthora parasitica INRA-310
gb|EPB87919.1|  vacuolar protein sorting-associated protein 4           108   4e-24   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_720771.1|  potential vacuolar sorting ATPase                     108   4e-24   
ref|XP_720644.1|  potential vacuolar sorting ATPase                     108   4e-24   Candida albicans SC5314
gb|EGA72798.1|  Vps4p                                                   108   4e-24   Saccharomyces cerevisiae AWRI796
gb|KHC58944.1|  vacuolar protein sorting-associated protein 4           108   4e-24   Candida albicans P75010
gb|AJW04197.1|  Vps4p                                                   108   4e-24   Saccharomyces cerevisiae YJM1399
gb|AJW08561.1|  Vps4p                                                   108   4e-24   Saccharomyces cerevisiae YJM1439
ref|NP_015499.1|  AAA family ATPase VPS4                                108   4e-24   Saccharomyces cerevisiae S288C
ref|XP_001397613.1|  vacuolar protein sorting-associated protein 4      108   4e-24   Aspergillus niger CBS 513.88
ref|XP_001888662.1|  predicted protein                                  108   4e-24   Laccaria bicolor S238N-H82
ref|XP_008890404.1|  hypothetical protein, variant 2                    108   5e-24   Phytophthora parasitica INRA-310
gb|ETI56762.1|  hypothetical protein, variant 4                         108   5e-24   Phytophthora parasitica P1569
gb|EJT42761.1|  VPS4-like protein                                       108   5e-24   Saccharomyces kudriavzevii IFO 1802
emb|CAA63364.1|  END13                                                  108   5e-24   Saccharomyces cerevisiae [brewer's yeast]
emb|CCO26157.1|  Vacuolar protein sorting-associated protein 4 Al...    108   5e-24   Rhizoctonia solani AG-1 IB
gb|ETI56765.1|  hypothetical protein, variant 7                         107   5e-24   Phytophthora parasitica P1569
ref|XP_009324976.1|  PREDICTED: vacuolar protein sorting-associat...    108   5e-24   Pygoscelis adeliae
gb|ETI56759.1|  hypothetical protein, variant 1                         108   6e-24   Phytophthora parasitica P1569
emb|CEL52312.1|  vacuolar protein-sorting-associated protein 4          108   6e-24   Rhizoctonia solani AG-1 IB
gb|KGU27497.1|  vacuolar protein sorting-associated protein 4           108   6e-24   Candida albicans P57055
ref|XP_001227807.1|  conserved hypothetical protein                     108   6e-24   Chaetomium globosum CBS 148.51
ref|XP_007672609.1|  hypothetical protein BAUCODRAFT_145421             108   6e-24   Baudoinia panamericana UAMH 10762
gb|EHM99691.1|  Vps4p                                                   108   6e-24   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|ETI56760.1|  hypothetical protein, variant 2                         108   7e-24   Phytophthora parasitica P1569
ref|XP_002896687.1|  vacuolar protein sorting-associating protein...    108   7e-24   Phytophthora infestans T30-4
dbj|GAK63492.1|  ATPase                                                 108   7e-24   Moesziomyces antarcticus
gb|KDR68737.1|  hypothetical protein GALMADRAFT_256556                  107   8e-24   
ref|XP_006685573.1|  hypothetical protein CANTEDRAFT_113543             107   8e-24   
gb|KIJ21278.1|  hypothetical protein PAXINDRAFT_94923                   107   8e-24   
ref|XP_002504369.1|  predicted protein                                  107   8e-24   
gb|ETS62873.1|  hypothetical protein PaG_02631                          108   9e-24   
ref|XP_007265839.1|  AAA-domain-containing protein                      107   9e-24   
ref|XP_002373452.1|  vacuolar sorting ATPase Vps4, putative             107   9e-24   
gb|EIF47205.1|  vacuolar protein sorting-associated protein vps4        107   9e-24   
ref|XP_007931245.1|  hypothetical protein MYCFIDRAFT_33764              107   1e-23   
gb|KDN65300.1|  putative ATPase                                         107   1e-23   
ref|XP_447529.1|  hypothetical protein                                  107   1e-23   
gb|KEQ69171.1|  AAA-domain-containing protein                           107   1e-23   
ref|XP_002175019.1|  AAA family ATPase Vps4                             107   1e-23   
ref|XP_001270947.1|  vacuolar sorting ATPase Vps4, putative             107   1e-23   
gb|EME39888.1|  hypothetical protein DOTSEDRAFT_47407                   107   2e-23   
gb|KEQ88638.1|  AAA-domain-containing protein                           107   2e-23   
ref|XP_007879254.1|  hypothetical protein PFL1_03543                    107   2e-23   
ref|XP_003323901.2|  vacuolar protein sorting-associated protein 4      106   2e-23   
ref|XP_660665.1|  hypothetical protein AN3061.2                         106   2e-23   
ref|XP_007368467.1|  AAA-domain-containing protein                      106   2e-23   
gb|KJK62744.1|  SpoVK                                                   106   3e-23   
ref|XP_009032318.1|  hypothetical protein AURANDRAFT_18406              106   3e-23   
gb|KIO28383.1|  hypothetical protein M407DRAFT_182013                   106   3e-23   
gb|KIK80045.1|  hypothetical protein PAXRUDRAFT_833772                  106   3e-23   
gb|KDQ29923.1|  hypothetical protein PLEOSDRAFT_38169                   106   3e-23   
gb|EPQ63175.1|  AAA-type ATPase                                         105   4e-23   
gb|EKV06899.1|  Vacuolar sorting ATPase Vps4, putative                  106   4e-23   
emb|CDR41937.1|  CYFA0S08e01794g1_1                                     105   4e-23   
gb|AFK38193.1|  unknown                                                 105   4e-23   
ref|XP_002491488.1|  AAA-type ATPase that is regulated by Vta1p         105   5e-23   
ref|XP_009277514.1|  PREDICTED: vacuolar protein sorting-associat...    106   6e-23   
gb|KIJ38492.1|  hypothetical protein M422DRAFT_210925                   105   6e-23   
ref|XP_007390047.1|  hypothetical protein PHACADRAFT_246626             105   7e-23   
ref|XP_003848708.1|  hypothetical protein MYCGRDRAFT_76672              105   7e-23   
gb|KJX92281.1|  vacuolar protein sorting-associated protein VPS4        105   8e-23   
gb|AJW25780.1|  Vps4p                                                   105   9e-23   
ref|XP_009473813.1|  PREDICTED: vacuolar protein sorting-associat...    105   9e-23   
gb|KIM58237.1|  hypothetical protein SCLCIDRAFT_1100276                 105   9e-23   
gb|EMF08711.1|  vacuolar sorting ATPase Vps4                            104   1e-22   
ref|XP_004180664.1|  hypothetical protein TBLA_0E00840                  104   1e-22   
ref|XP_005481727.1|  PREDICTED: vacuolar protein sorting-associat...    104   1e-22   
gb|KHJ32896.1|  putative aaa-type atpase                                104   1e-22   
gb|KIK43862.1|  hypothetical protein CY34DRAFT_803371                   104   1e-22   
ref|XP_001904385.1|  hypothetical protein                               104   1e-22   
ref|XP_005481726.1|  PREDICTED: vacuolar protein sorting-associat...    104   2e-22   
ref|XP_007780398.1|  vacuolar protein sorting-associated protein 4      104   2e-22   
ref|XP_010125903.1|  PREDICTED: vacuolar protein sorting-associat...    103   2e-22   
ref|XP_010155337.1|  PREDICTED: vacuolar protein sorting-associat...    105   2e-22   
ref|XP_011275550.1|  vacuolar protein-sorting-associated protein 4      103   2e-22   
ref|XP_009911280.1|  PREDICTED: vacuolar protein sorting-associat...    104   2e-22   
emb|CDF90359.1|  ZYBA0S06-06722g1_1                                     103   2e-22   
ref|XP_011120124.1|  hypothetical protein AOL_s00054g506                104   2e-22   
ref|XP_500970.1|  YALI0B16368p                                          103   2e-22   
gb|KKA30851.1|  hypothetical protein TD95_000733                        103   2e-22   
ref|XP_002615154.1|  hypothetical protein CLUG_05169                    103   2e-22   
gb|EJU00906.1|  AAA-domain-containing protein                           103   3e-22   
emb|CDW73141.1|  vacuolar protein sorting-associated protein 4b         103   3e-22   
gb|EJK63640.1|  hypothetical protein THAOC_15690                        102   3e-22   
ref|XP_001586796.1|  hypothetical protein SS1G_11825                    103   3e-22   
ref|XP_006677387.1|  hypothetical protein BATDEDRAFT_32935              103   3e-22   
ref|XP_003672164.1|  hypothetical protein NDAI_0J00290                  103   3e-22   
gb|ESZ96795.1|  putative vacuolar sorting ATPase Vps4                   103   3e-22   
gb|KIP01977.1|  hypothetical protein PHLGIDRAFT_96457                   103   3e-22   
emb|CCD43378.1|  similar to vacuolar protein sorting-associated p...    103   3e-22   
gb|KIK66000.1|  hypothetical protein GYMLUDRAFT_218784                  103   3e-22   
ref|XP_010140532.1|  PREDICTED: vacuolar protein sorting-associat...    103   3e-22   
ref|XP_009262365.1|  hypothetical protein FPSE_10973                    103   3e-22   
ref|XP_009699268.1|  PREDICTED: vacuolar protein sorting-associat...    103   3e-22   
ref|XP_011112819.1|  hypothetical protein H072_7046                     103   3e-22   
gb|EYB28953.1|  hypothetical protein FG05_10964                         103   3e-22   
gb|KIY62200.1|  AAA-domain-containing protein                           103   4e-22   
ref|XP_011325408.1|  vacuolar protein sorting-associated protein 4      103   4e-22   
gb|EYE98175.1|  putative vacuolar sorting ATPase Vps4                   103   4e-22   
ref|XP_007763108.1|  AAA-domain-containing protein                      103   4e-22   
ref|XP_002297087.1|  vacuolar protein sorting-associated protein        103   4e-22   
emb|CCE43971.1|  hypothetical protein CPAR2_501960                      103   4e-22   
ref|XP_006077824.1|  PREDICTED: vacuolar protein sorting-associat...    103   4e-22   
gb|KDN49474.1|  hypothetical protein RSAG8_02176                        102   5e-22   
ref|XP_009541616.1|  AAA+-type ATPase                                   102   6e-22   
gb|KFY31114.1|  hypothetical protein V494_08005                       99.8    6e-22   
ref|XP_003867368.1|  Vps4 protein                                       102   6e-22   
gb|EWG53188.1|  vacuolar protein sorting-associated protein 4           102   6e-22   
ref|XP_004345586.1|  vacuolar protein sorting factor 4B                 102   7e-22   
ref|XP_009571838.1|  PREDICTED: vacuolar protein sorting-associat...    102   7e-22   
gb|EPB81164.1|  vacuolar protein sorting-associated protein 4           102   7e-22   
gb|EWZ31663.1|  vacuolar protein sorting-associated protein 4           102   8e-22   
gb|ENH67133.1|  Vacuolar protein sorting-associated protein 4           102   8e-22   
emb|CCT71690.1|  probable VPS4-vacuolar sorting protein                 102   8e-22   
ref|XP_008608589.1|  hypothetical protein, variant                      101   8e-22   
gb|EWY86039.1|  vacuolar protein sorting-associated protein 4           102   9e-22   
gb|KGK39426.1|  hypothetical protein JL09_g1483                         102   9e-22   
gb|EMT73392.1|  Vacuolar protein sorting-associated protein 4           102   9e-22   
ref|XP_003687255.1|  hypothetical protein TPHA_0I03200                  102   9e-22   
ref|XP_007603151.1|  vacuolar protein sorting-associated protein 4      102   9e-22   
emb|CDH16424.1|  probable Vacuolar protein sorting-associated pro...    102   9e-22   
gb|KIH93876.1|  vacuolar protein-sorting-associated protein 4           102   1e-21   
emb|CCF46405.1|  vacuolar protein sorting-associated protein 4          102   1e-21   
gb|ERS98833.1|  hypothetical protein HMPREF1624_04023                   102   1e-21   
gb|KIJ68861.1|  hypothetical protein HYDPIDRAFT_25109                   102   1e-21   
gb|EGU86025.1|  hypothetical protein FOXB_03429                         102   1e-21   
gb|KIJ59844.1|  hypothetical protein HYDPIDRAFT_32836                   102   1e-21   
ref|XP_007913999.1|  putative vacuolar sorting atpase protein           102   1e-21   
ref|XP_003645318.1|  hypothetical protein Ecym_2804                     101   1e-21   
ref|XP_007323566.1|  hypothetical protein SERLADRAFT_442915             101   1e-21   
gb|KDB18280.1|  vacuolar protein sorting-associated protein VPS4      99.4    1e-21   
gb|EGN92703.1|  hypothetical protein SERLA73DRAFT_172685                101   2e-21   
ref|XP_009633300.1|  PREDICTED: vacuolar protein sorting-associat...    102   2e-21   
gb|ELR03799.1|  vacuolar protein-sorting-associated protein 4           101   2e-21   
ref|XP_004358974.1|  AAA ATPase domain-containing protein               101   2e-21   
ref|XP_008608588.1|  hypothetical protein SDRG_04687                    101   2e-21   
ref|XP_007378040.1|  AAA-domain-containing protein                      101   2e-21   
ref|XP_007336592.1|  katanin p60 ATPase domain-containing protein       101   2e-21   
ref|XP_004196957.1|  Piso0_004191                                       101   2e-21   
gb|EHK44176.1|  hypothetical protein TRIATDRAFT_300488                  101   2e-21   
gb|KDO24087.1|  hypothetical protein SPRG_10874                         101   2e-21   
emb|CEP11868.1|  hypothetical protein                                   101   2e-21   
ref|XP_008087968.1|  P-loop containing nucleoside triphosphate hy...    101   2e-21   
ref|XP_002293134.1|  predicted protein                                  100   2e-21   
ref|XP_005526523.1|  PREDICTED: vacuolar protein sorting-associat...    100   2e-21   
gb|KIN00803.1|  hypothetical protein OIDMADRAFT_53948                   100   2e-21   
gb|EHK23754.1|  hypothetical protein TRIVIDRAFT_82358                   100   2e-21   
emb|CBJ26156.1|  putative; katanin like protein                         101   3e-21   
ref|XP_003238986.1|  vacuolar sorting ATPase Vps4                       100   3e-21   
ref|XP_009958907.1|  PREDICTED: vacuolar protein sorting-associat...    100   3e-21   
ref|XP_001646228.1|  hypothetical protein Kpol_1013p42                  100   3e-21   
ref|XP_008920714.1|  PREDICTED: vacuolar protein sorting-associat...    101   3e-21   
ref|XP_007841204.1|  Vacuolar protein sorting-associated protein 4      100   3e-21   
gb|AAK21278.1|AF338039_1  vacuolar sorting protein 4                  98.6    3e-21   
emb|CCI45481.1|  unnamed protein product                                100   3e-21   
emb|CCI45480.1|  unnamed protein product                                100   4e-21   
gb|EHL01321.1|  putative Vacuolar protein sorting-associated prot...  99.8    4e-21   
emb|CEJ94844.1|  Putative Vacuolar protein sorting-associated pro...    100   4e-21   
gb|KIK22150.1|  hypothetical protein PISMIDRAFT_514048                  100   4e-21   
ref|XP_009934810.1|  PREDICTED: vacuolar protein sorting-associat...    100   4e-21   
ref|XP_005697384.1|  PREDICTED: vacuolar protein sorting-associat...    100   4e-21   
gb|EPE05195.1|  vacuolar sorting atpase                                 100   5e-21   
ref|XP_010411643.1|  PREDICTED: vacuolar protein sorting-associat...    100   5e-21   
dbj|BAE56233.1|  unnamed protein product                                100   5e-21   
ref|XP_007730262.1|  vacuolar protein sorting-associated protein 4      100   5e-21   
ref|XP_010189236.1|  PREDICTED: vacuolar protein sorting-associat...    100   5e-21   
emb|CCU75750.1|  vacuolar protein sorting-associated protein            100   5e-21   
ref|XP_007800248.1|  Vacuolar protein sorting-associated protein 4      100   5e-21   
ref|XP_010287451.1|  PREDICTED: vacuolar protein sorting-associat...    100   5e-21   
ref|XP_001208910.1|  vacuolar protein sorting-associated protein ...  99.8    6e-21   
ref|XP_459738.2|  DEHA2E09922p                                        99.8    6e-21   
gb|AEW08327.1|  hypothetical protein 2_6439_03                        94.0    6e-21   
ref|XP_003683111.1|  hypothetical protein TDEL_0H00410                99.8    6e-21   
ref|XP_003047913.1|  predicted protein                                99.8    6e-21   
ref|XP_003345483.1|  hypothetical protein SMAC_07470                  99.4    7e-21   
dbj|GAO19211.1|  hypothetical protein UVI_067890                      99.8    7e-21   
ref|XP_002420588.1|  AAA ATPase involved in endosome to vacuole t...  99.8    7e-21   
gb|KDQ20433.1|  hypothetical protein BOTBODRAFT_169188                99.8    8e-21   
ref|XP_008635311.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  99.8    9e-21   
gb|KIW61577.1|  hypothetical protein PV05_01681                       99.4    9e-21   
ref|XP_001524815.1|  vacuolar protein sorting-associated protein ...    100   9e-21   
ref|XP_958048.1|  vacuolar protein sorting-associated protein VPS4    99.4    9e-21   
ref|XP_002496486.1|  ZYRO0D01210p                                     99.4    9e-21   
ref|XP_452011.1|  hypothetical protein                                99.0    1e-20   
gb|AFG48942.1|  hypothetical protein 2_6439_03                        93.2    1e-20   
gb|EFX84278.1|  hypothetical protein DAPPUDRAFT_209675                99.4    1e-20   
ref|XP_005041538.1|  PREDICTED: vacuolar protein sorting-associat...  99.4    1e-20   
gb|KFZ01782.1|  hypothetical protein V501_09804                       99.0    1e-20   
gb|EPY54059.1|  AAA family ATPase Vps4                                99.0    1e-20   
ref|XP_009903260.1|  PREDICTED: vacuolar protein sorting-associat...  99.8    1e-20   
gb|KFY74807.1|  hypothetical protein V499_05197                       99.0    1e-20   
gb|EDK41321.2|  hypothetical protein PGUG_05419                       99.0    1e-20   
ref|XP_009567890.1|  PREDICTED: vacuolar protein sorting-associat...  99.8    1e-20   
ref|XP_003654567.1|  hypothetical protein THITE_2117667               99.0    1e-20   
ref|XP_009676011.1|  PREDICTED: vacuolar protein sorting-associat...  99.0    1e-20   
gb|KEF62812.1|  vacuolar protein sorting-associated protein 4         99.0    1e-20   
ref|XP_006968893.1|  vacuolar sorting protein                         98.6    1e-20   
ref|XP_009969612.1|  PREDICTED: vacuolar protein sorting-associat...  99.0    2e-20   
gb|ENH83288.1|  vacuolar sorting atpase                               98.6    2e-20   
ref|XP_010706766.1|  PREDICTED: vacuolar protein sorting-associat...  98.6    2e-20   
emb|CAG07617.1|  unnamed protein product                              97.8    2e-20   
gb|KFY00434.1|  hypothetical protein O988_03306                       98.6    2e-20   
gb|KII94438.1|  hypothetical protein PLICRDRAFT_36714                 98.6    2e-20   
gb|EMG46493.1|  putative vacuolar sorting ATPase                      98.6    2e-20   
gb|KHN97329.1|  vacuolar protein sorting-associated protein VPS4      98.2    2e-20   
gb|KFX94654.1|  hypothetical protein V490_04274                       98.2    2e-20   
ref|XP_009068379.1|  PREDICTED: vacuolar protein sorting-associat...  98.2    2e-20   
ref|XP_002199401.1|  PREDICTED: vacuolar protein sorting-associat...  98.6    2e-20   
gb|KIX00724.1|  hypothetical protein Z518_09789                       98.2    2e-20   
ref|XP_003665024.1|  hypothetical protein MYCTH_2308304               98.2    2e-20   
gb|KIW76477.1|  hypothetical protein Z517_11223                       98.2    2e-20   
ref|XP_010584296.1|  PREDICTED: vacuolar protein sorting-associat...  97.8    2e-20   
gb|KIY03257.1|  hypothetical protein Z520_01724                       98.2    2e-20   
gb|KIW89499.1|  hypothetical protein Z519_09655                       98.2    2e-20   
ref|XP_010584295.1|  PREDICTED: vacuolar protein sorting-associat...  98.2    2e-20   
gb|EPX74576.1|  AAA family ATPase Vps4                                98.2    3e-20   
ref|XP_005425883.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  98.2    3e-20   
ref|XP_007792952.1|  putative vacuolar sorting atpase protein         98.2    3e-20   
gb|KIW27854.1|  hypothetical protein PV07_07555                       98.2    3e-20   
ref|XP_005706154.1|  AAA-type ATPase                                  98.2    3e-20   
ref|XP_010643179.1|  PREDICTED: vacuolar protein sorting-associat...  98.2    3e-20   
gb|KFZ02608.1|  hypothetical protein V500_00070                       97.8    3e-20   
gb|EGT47399.1|  hypothetical protein CAEBREN_09324                    94.4    3e-20   
gb|KID99660.1|  vacuolar protein sorting-associated protein VPS4      97.8    3e-20   
gb|KID75703.1|  vacuolar protein sorting-associated protein VPS4      97.8    3e-20   
gb|KID91744.1|  vacuolar protein sorting-associated protein VPS4      97.8    3e-20   
ref|XP_007298130.1|  AAA-domain-containing protein                    97.8    3e-20   
ref|XP_007806545.1|  vacuolar protein sorting-associated protein ...  97.8    3e-20   
ref|XP_007375433.1|  hypothetical protein SPAPADRAFT_61240            97.8    3e-20   
emb|CCW59737.1|  unnamed protein product                              97.8    3e-20   
gb|KIV96381.1|  hypothetical protein PV10_00262                       97.8    3e-20   
ref|NP_001069624.1|  vacuolar protein sorting-associated protein 4B   97.8    4e-20   
ref|XP_004059553.1|  PREDICTED: vacuolar protein sorting-associat...  97.4    4e-20   
ref|XP_011592911.1|  PREDICTED: vacuolar protein sorting-associat...  97.4    4e-20   
gb|KFO24491.1|  Vacuolar protein sorting-associated protein 4B        97.8    4e-20   
dbj|GAA98091.1|  hypothetical protein E5Q_04773                       97.4    5e-20   
ref|XP_010817218.1|  PREDICTED: vacuolar protein sorting-associat...  97.4    5e-20   
ref|XP_008053296.1|  PREDICTED: vacuolar protein sorting-associat...  96.7    5e-20   
ref|XP_009092162.1|  PREDICTED: vacuolar protein sorting-associat...  97.4    5e-20   
ref|NP_593086.1|  AAA family ATPase Vps4 (predicted)                  97.1    5e-20   
ref|XP_010310697.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar pro...  97.4    6e-20   
ref|XP_004020621.1|  PREDICTED: vacuolar protein sorting-associat...  97.1    6e-20   
ref|XP_009511557.1|  PREDICTED: vacuolar protein sorting-associat...  97.1    6e-20   
emb|CDH10552.1|  probable Vacuolar protein sorting-associated pro...  97.1    6e-20   
gb|KIW10966.1|  hypothetical protein PV08_10265                       97.1    6e-20   
gb|EMD41401.1|  hypothetical protein CERSUDRAFT_109990                97.1    7e-20   
ref|XP_004893337.1|  PREDICTED: vacuolar protein sorting-associat...  97.1    7e-20   



>gb|AIN75626.1| K+ transport growth defect-like protein [Hevea brasiliensis]
Length=431

 Score =   262 bits (670),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 132/136 (97%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R KTKPKDGEDGEDPEQ+KLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKTKPKDGEDGEDPEQAKLRAGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            +REKPNVKW+DVAGLE
Sbjct  119  IREKPNVKWNDVAGLE  134



>ref|XP_002523783.1| Vacuolar protein sorting-associated protein VPS4, putative [Ricinus 
communis]
 gb|EEF38509.1| Vacuolar protein sorting-associated protein VPS4, putative [Ricinus 
communis]
Length=431

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 131/136 (96%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R KTKPKDGEDGEDPEQ+KLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKTKPKDGEDGEDPEQTKLRAGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            +REKPNV W+DVAGLE
Sbjct  119  IREKPNVNWNDVAGLE  134



>ref|XP_008337894.1| PREDICTED: vacuolar protein sorting-associated protein 4 [Malus 
domestica]
Length=160

 Score =   251 bits (641),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 132/138 (96%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNAL+YFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALDYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATRPKTKPKDGEGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNV+W+DVAGLE
Sbjct  119  AIIREKPNVQWNDVAGLE  136



>ref|XP_010651908.1| PREDICTED: vacuolar protein sorting-associated protein 4 isoform 
X2 [Vitis vinifera]
Length=162

 Score =   251 bits (640),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 131/138 (95%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+GG   GPASNGDAAVA+R KTKPKDGE  DGEDPEQ+KLR+GLNS
Sbjct  61   EYLRRAEEIRAVLDDGGA--GPASNGDAAVATRPKTKPKDGEGGDGEDPEQAKLRSGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNVKWSDVAGLE
Sbjct  119  AIIREKPNVKWSDVAGLE  136



>ref|XP_012072805.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1 [Jatropha curcas]
 gb|KDP37591.1| hypothetical protein JCGZ_07937 [Jatropha curcas]
Length=431

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 133/136 (98%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R+KTKPKDG+DGEDPEQ+KLR+GLNSAI
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRAKTKPKDGDDGEDPEQAKLRSGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            +REKP+VKW+DVAGLE
Sbjct  119  IREKPDVKWNDVAGLE  134



>ref|XP_009611775.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Nicotiana tomentosiformis]
Length=434

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 132/138 (96%), Gaps = 3/138 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASR--SKTKPKDGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLDE GTGPGP + GDAAVA+R  +KTKPKDGEDGEDPEQSKLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDESGTGPGP-NGGDAAVATRPKTKTKPKDGEDGEDPEQSKLRAGLNS  119

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPN+KW+DVAGLE
Sbjct  120  AIVREKPNIKWNDVAGLE  137



>gb|EPS68325.1| hypothetical protein M569_06443, partial [Genlisea aurea]
Length=161

 Score =   248 bits (633),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 1/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAV EDN+GNYA+AFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT
Sbjct  1    MYSNFKEQAIEYVRQAVAEDNSGNYARAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+GP P  NGDAAVA+R KTKPKDG DGED ++ KLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGSGPAPV-NGDAAVATRPKTKPKDGNDGEDGDKEKLRAGLNSAI  119

Query  628  VREKPNVKWSDVAGLE  675
            +REKPNVKW+DVAGLE
Sbjct  120  IREKPNVKWNDVAGLE  135



>ref|XP_010244408.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Nelumbo nucifera]
Length=433

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 132/138 (96%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY++AFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSRAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLDEGGT  GPASNGDAAVA+R KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDEGGT--GPASNGDAAVATRPKTKPKDGEGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPNVKWSDVAGLE
Sbjct  119  AIVREKPNVKWSDVAGLE  136



>ref|XP_007207464.1| hypothetical protein PRUPE_ppa005989mg [Prunus persica]
 ref|XP_008228931.1| PREDICTED: vacuolar protein sorting-associated protein 4B [Prunus 
mume]
 gb|EMJ08663.1| hypothetical protein PRUPE_ppa005989mg [Prunus persica]
Length=433

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 132/138 (96%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATRPKTKPKDGEGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNVKW+DVAGLE
Sbjct  119  AIIREKPNVKWNDVAGLE  136



>ref|XP_009364298.1| PREDICTED: vacuolar protein sorting-associated protein 4 [Pyrus 
x bretschneideri]
Length=433

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 132/138 (96%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATRPKTKPKDGEGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNV+W+DVAGLE
Sbjct  119  AIIREKPNVQWNDVAGLE  136



>ref|XP_002313671.1| hypothetical protein POPTR_0009s14670g [Populus trichocarpa]
 gb|EEE87626.1| hypothetical protein POPTR_0009s14670g [Populus trichocarpa]
Length=431

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 130/136 (96%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIR VLDEG  GPGP SNGDAAVA+R+KTKPKDGEDG+DPE+ KLRAGLNSAI
Sbjct  61   EYLRRAEEIRTVLDEG--GPGPNSNGDAAVATRAKTKPKDGEDGDDPEKDKLRAGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  119  VREKPNVKWNDVAGLE  134



>ref|XP_008347699.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Malus domestica]
Length=433

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 132/138 (96%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNAL+YFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALDYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATRPKTKPKDGEGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNV+W+DVAGLE
Sbjct  119  AIIREKPNVQWNDVAGLE  136



>ref|XP_006848581.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1 [Amborella trichopoda]
 ref|XP_011625003.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1 [Amborella trichopoda]
 ref|XP_011625004.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1 [Amborella trichopoda]
 ref|XP_011625005.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1 [Amborella trichopoda]
 ref|XP_011625006.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1 [Amborella trichopoda]
 ref|XP_011625007.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1 [Amborella trichopoda]
 gb|ERN10162.1| hypothetical protein AMTR_s00168p00030500 [Amborella trichopoda]
Length=434

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 132/138 (96%), Gaps = 3/138 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFSLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLDEGG G GPA+NGDAAVA+++KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDEGG-GSGPANNGDAAVATKAKTKPKDGEGGDGEDPEQAKLRAGLNS  119

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNVKWSDVAGLE
Sbjct  120  AIIREKPNVKWSDVAGLE  137



>ref|XP_008385424.1| PREDICTED: vacuolar protein sorting-associated protein 4 [Malus 
domestica]
Length=433

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 132/138 (96%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA++ KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATKPKTKPKDGEGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNV+W+DVAGLE
Sbjct  119  AIIREKPNVQWNDVAGLE  136



>ref|XP_002262762.1| PREDICTED: vacuolar protein sorting-associated protein 4 isoform 
X1 [Vitis vinifera]
Length=433

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 131/138 (95%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+GG   GPASNGDAAVA+R KTKPKDGE  DGEDPEQ+KLR+GLNS
Sbjct  61   EYLRRAEEIRAVLDDGGA--GPASNGDAAVATRPKTKPKDGEGGDGEDPEQAKLRSGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNVKWSDVAGLE
Sbjct  119  AIIREKPNVKWSDVAGLE  136



>ref|XP_004506158.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Cicer arietinum]
Length=433

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 131/138 (95%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDN+GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNSGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDG--EDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R KTKPK+G   DGEDPEQSKLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATRPKTKPKNGGEGDGEDPEQSKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPNVKW+DVAGLE
Sbjct  119  AIVREKPNVKWNDVAGLE  136



>ref|XP_006417711.1| hypothetical protein EUTSA_v10007683mg [Eutrema salsugineum]
 gb|ESQ36064.1| hypothetical protein EUTSA_v10007683mg [Eutrema salsugineum]
Length=434

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAITHKFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITHKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE---DGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEGG+  GP SNGDAAVA++ KTKPKDGE   DGEDPEQSKLRAGL+
Sbjct  61   EYLRRAEEIRAVLDEGGS--GPRSNGDAAVATKPKTKPKDGEGKGDGEDPEQSKLRAGLD  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAIVREKPNVKWSDVAGLE
Sbjct  119  SAIVREKPNVKWSDVAGLE  137



>ref|XP_004291618.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1 [Fragaria vesca subsp. vesca]
Length=433

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 130/138 (94%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDN GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNNGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATRPKTKPKDGEGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNVKW+DVAGLE
Sbjct  119  AIIREKPNVKWNDVAGLE  136



>ref|XP_011044980.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Populus euphratica]
Length=431

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 128/136 (94%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIR VLDEG  GPGP SNGDAAVA+R KTKPKDGEDG+DPE+ KLRAGLNSAI
Sbjct  61   EYLRRAEEIRTVLDEG--GPGPNSNGDAAVATRPKTKPKDGEDGDDPEKDKLRAGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            VREKPN KW+DVAGLE
Sbjct  119  VREKPNWKWNDVAGLE  134



>ref|XP_004149260.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1 [Cucumis sativus]
 dbj|BAN84246.1| vacuolar protein sorting-associated protein 4-like [Cucumis sativus 
var. sativus]
 dbj|BAN84247.1| vacuolar protein sorting-associated protein 4-like [Cucumis sativus 
var. sativus]
 gb|KGN46961.1| hypothetical protein Csa_6G152960 [Cucumis sativus]
Length=433

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 131/138 (95%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA++ KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATKPKTKPKDGEGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKP+VKW+DVAGLE
Sbjct  119  AIIREKPDVKWNDVAGLE  136



>emb|CDY04504.1| BnaA07g13300D [Brassica napus]
Length=432

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 131/137 (96%), Gaps = 3/137 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV+EDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAITHKFT
Sbjct  1    MYSNFKEQAIEYVKQAVEEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITHKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD-GEDGEDPEQSKLRAGLNSA  624
            EYLRRAEEIRAVLDEG  GPGP SNGDAAVA++ K+KPKD G DGEDPEQSKLRAGL+SA
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPGSNGDAAVATKPKSKPKDGGGDGEDPEQSKLRAGLDSA  118

Query  625  IVREKPNVKWSDVAGLE  675
            IVREKPN+KW+DVAGLE
Sbjct  119  IVREKPNIKWTDVAGLE  135



>ref|XP_008799318.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
isoform X2 [Phoenix dactylifera]
Length=199

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 126/139 (91%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAG Y KAFPLYMNALEYF+THLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGKYVKAFPLYMNALEYFRTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD---GEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEG  GP PA+NGDAAVA+R +TKPKD   G DGEDPEQSKLRAGL 
Sbjct  61   EYLRRAEEIRAVLDEG--GPAPAANGDAAVATRPRTKPKDENSGGDGEDPEQSKLRAGLT  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPNVKWSDVAGLE
Sbjct  119  SAIITEKPNVKWSDVAGLE  137



>ref|XP_011088877.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Sesamum indicum]
Length=431

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 128/136 (94%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAV EDNAGNYA+AFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVAEDNAGNYARAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+  GPASNGDAAVA+R KTKPKDG DGED ++ KLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGS--GPASNGDAAVATRPKTKPKDGNDGEDGDKDKLRAGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            +REKPNVKW+DVAGLE
Sbjct  119  IREKPNVKWNDVAGLE  134



>ref|XP_011090358.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Sesamum indicum]
Length=431

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 127/136 (93%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAV EDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVAEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+  GP SNGDAAVA+R KTKPKDG DGED ++ KLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGS--GPTSNGDAAVATRPKTKPKDGNDGEDGDKEKLRAGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            +REKPNVKW+DVAGLE
Sbjct  119  IREKPNVKWNDVAGLE  134



>ref|XP_008458580.1| PREDICTED: vacuolar protein sorting-associated protein 4 [Cucumis 
melo]
Length=433

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 130/138 (94%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYAKAFSLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA++ KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATKPKTKPKDGEGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKP+VKW+DVAGLE
Sbjct  119  AIIREKPDVKWNDVAGLE  136



>ref|XP_011046276.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X2 [Populus euphratica]
Length=402

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 127/136 (93%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLY NALEYF+THLKYEKNPKI+EAIT KF 
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYKNALEYFRTHLKYEKNPKIREAITQKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEI+ VLDEG  GPGP SNGDAAVA+R KTKPKDGEDG+DPE+ KLRAGLNSAI
Sbjct  61   EYLRRAEEIKTVLDEG--GPGPNSNGDAAVATRPKTKPKDGEDGDDPEKDKLRAGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  119  VREKPNVKWNDVAGLE  134



>ref|XP_002305558.1| hypothetical protein POPTR_0004s19530g [Populus trichocarpa]
 gb|EEE86069.1| hypothetical protein POPTR_0004s19530g [Populus trichocarpa]
Length=431

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 127/136 (93%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLY NALEYF+THLKYEKNPKI+EAIT KF 
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYTNALEYFRTHLKYEKNPKIREAITQKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEI+ VLDEG  GPGP SNGDAAVA+R KTKPKDGEDG+DPE+ KLRAGLNSAI
Sbjct  61   EYLRRAEEIKTVLDEG--GPGPNSNGDAAVATRPKTKPKDGEDGDDPEKDKLRAGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  119  VREKPNVKWNDVAGLE  134



>ref|XP_011046275.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X1 [Populus euphratica]
Length=431

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 127/136 (93%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLY NALEYF+THLKYEKNPKI+EAIT KF 
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYKNALEYFRTHLKYEKNPKIREAITQKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEI+ VLDEG  GPGP SNGDAAVA+R KTKPKDGEDG+DPE+ KLRAGLNSAI
Sbjct  61   EYLRRAEEIKTVLDEG--GPGPNSNGDAAVATRPKTKPKDGEDGDDPEKDKLRAGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  119  VREKPNVKWNDVAGLE  134



>dbj|BAN84248.1| vacuolar protein sorting-associated protein 4-like [Cucumis sativus 
var. sativus]
 dbj|BAN84249.1| vacuolar protein sorting-associated protein 4-like [Cucumis sativus 
var. sativus]
Length=433

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNYAKA PLY+NALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYAKASPLYINALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA++ KTKPKDGE  DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATKPKTKPKDGEGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKP+VKW+DVAGLE
Sbjct  119  AIIREKPDVKWNDVAGLE  136



>ref|XP_010313348.1| PREDICTED: vacuolar protein sorting-associated protein 4 isoform 
X3 [Solanum lycopersicum]
Length=158

 Score =   236 bits (601),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 127/136 (93%), Gaps = 1/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDN GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNGGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+G    + GDAAV ++ KTKPKDGEDGEDPEQSKLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGSG-PGPNGGDAAVIAKPKTKPKDGEDGEDPEQSKLRAGLNSAI  119

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  120  VREKPNVKWNDVAGLE  135



>emb|CDX95077.1| BnaC05g05940D [Brassica napus]
Length=431

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+++K+K KD  DGED EQSKLRAGL+SAI
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATKAKSKGKDNGDGEDKEQSKLRAGLDSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKWSDVAGLE
Sbjct  119  VREKPNVKWSDVAGLE  134



>ref|XP_009148083.1| PREDICTED: vacuolar protein sorting-associated protein 4B [Brassica 
rapa]
Length=430

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 129/136 (95%), Gaps = 3/136 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+++K+K KDG DGED EQSKLRAGL+SAI
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATKAKSKGKDG-DGEDKEQSKLRAGLDSAI  117

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKWSDVAGLE
Sbjct  118  VREKPNVKWSDVAGLE  133



>emb|CDX93578.1| BnaA06g04700D [Brassica napus]
Length=430

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 129/136 (95%), Gaps = 3/136 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+++K+K KDG DGED EQSKLRAGL+SAI
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATKAKSKGKDG-DGEDKEQSKLRAGLDSAI  117

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKWSDVAGLE
Sbjct  118  VREKPNVKWSDVAGLE  133



>ref|XP_008799317.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
isoform X1 [Phoenix dactylifera]
Length=434

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 126/139 (91%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAG Y KAFPLYMNALEYF+THLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGKYVKAFPLYMNALEYFRTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD---GEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEG  GP PA+NGDAAVA+R +TKPKD   G DGEDPEQSKLRAGL 
Sbjct  61   EYLRRAEEIRAVLDEG--GPAPAANGDAAVATRPRTKPKDENSGGDGEDPEQSKLRAGLT  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPNVKWSDVAGLE
Sbjct  119  SAIITEKPNVKWSDVAGLE  137



>ref|XP_010916481.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Elaeis guineensis]
Length=434

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 126/139 (91%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYF+THLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYVKAFPLYMNALEYFRTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE---DGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEG  GPGP +NGDAAVA+R KTKPKDG    DGED EQSKLRAGL+
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPTANGDAAVATRPKTKPKDGNSGGDGEDAEQSKLRAGLS  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPNVKWSDVAGLE
Sbjct  119  SAIITEKPNVKWSDVAGLE  137



>ref|XP_010926491.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Elaeis guineensis]
Length=434

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 127/139 (91%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYF+THLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFRTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE---DGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEG  GPGP +NGDAAVA+R KTK KDG    DGEDPEQ+KLRAGL+
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPTANGDAAVATRPKTKSKDGNSGGDGEDPEQAKLRAGLS  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPNVKW+DVAGLE
Sbjct  119  SAIITEKPNVKWNDVAGLE  137



>ref|XP_010313347.1| PREDICTED: vacuolar protein sorting-associated protein 4 isoform 
X2 [Solanum lycopersicum]
Length=214

 Score =   234 bits (598),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 127/136 (93%), Gaps = 1/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDN GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNGGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+G    + GDAAV ++ KTKPKDGEDGEDPEQSKLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGSG-PGPNGGDAAVIAKPKTKPKDGEDGEDPEQSKLRAGLNSAI  119

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  120  VREKPNVKWNDVAGLE  135



>ref|XP_008782296.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Phoenix dactylifera]
Length=434

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYF+THLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFRTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGE---DGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEG  GPGP +NGDAA A+R KTK KDG    DGEDPEQ+KLRAGL+
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPTANGDAATATRPKTKSKDGNSGGDGEDPEQAKLRAGLS  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPNVKW+DVAGLE
Sbjct  119  SAIITEKPNVKWNDVAGLE  137



>ref|XP_006487969.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Citrus sinensis]
Length=436

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 129/141 (91%), Gaps = 7/141 (5%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK-----DGEDGEDPEQSKLRAG  612
            EYLRRAEEIRAVLD+G  GPGPA NGDAAVA+R KTKPK      G DGEDPEQ+KLRAG
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPAHNGDAAVATRPKTKPKDGGDGGGGDGEDPEQAKLRAG  118

Query  613  LNSAIVREKPNVKWSDVAGLE  675
            LNSAI+REKPNVKW+DVAGLE
Sbjct  119  LNSAIIREKPNVKWNDVAGLE  139



>ref|XP_006424266.1| hypothetical protein CICLE_v10028483mg [Citrus clementina]
 gb|ESR37506.1| hypothetical protein CICLE_v10028483mg [Citrus clementina]
 gb|KDO58056.1| hypothetical protein CISIN_1g042771mg [Citrus sinensis]
Length=436

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 129/141 (91%), Gaps = 7/141 (5%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK-----DGEDGEDPEQSKLRAG  612
            EYLRRAEEIRAVLD+G  GPGPA NGDAAVA+R KTKPK      G DGEDPEQ+KLRAG
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPAHNGDAAVATRPKTKPKDGGDGGGGDGEDPEQAKLRAG  118

Query  613  LNSAIVREKPNVKWSDVAGLE  675
            LNSAI+REKPNVKW+DVAGLE
Sbjct  119  LNSAIIREKPNVKWNDVAGLE  139



>gb|KJB35364.1| hypothetical protein B456_006G111300 [Gossypium raimondii]
Length=345

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD----GEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R K+KPK     G DGEDPEQ+KLRAGL
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKSKPKSGGGEGGDGEDPEQAKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAI+REKPNVKW+DVAGLE
Sbjct  119  NSAIIREKPNVKWNDVAGLE  138



>ref|XP_010686038.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Beta vulgaris subsp. vulgaris]
Length=434

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 128/138 (93%), Gaps = 3/138 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLY NALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYRNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASN-GDAAVASRSKTKPKDGE-DGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLDEGG G GPA+N GDAAVA+R K K KDG+ DGED EQ+KLR+GLNS
Sbjct  61   EYLRRAEEIRAVLDEGG-GSGPATNGGDAAVAARPKAKTKDGDKDGEDAEQAKLRSGLNS  119

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNVKWSDVAGLE
Sbjct  120  AIIREKPNVKWSDVAGLE  137



>ref|XP_004251046.1| PREDICTED: vacuolar protein sorting-associated protein 4 [Solanum 
lycopersicum]
Length=432

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 128/136 (94%), Gaps = 1/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDN+GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNSGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+G    + GDAAV ++ KTKPKDGEDGEDPEQSKLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGSG-PGPNGGDAAVIAKPKTKPKDGEDGEDPEQSKLRAGLNSAI  119

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  120  VREKPNVKWNDVAGLE  135



>ref|XP_004251047.1| PREDICTED: vacuolar protein sorting-associated protein 4 isoform 
X1 [Solanum lycopersicum]
Length=432

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 127/136 (93%), Gaps = 1/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDN GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNGGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+G    + GDAAV ++ KTKPKDGEDGEDPEQSKLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGSG-PGPNGGDAAVIAKPKTKPKDGEDGEDPEQSKLRAGLNSAI  119

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  120  VREKPNVKWNDVAGLE  135



>ref|XP_009758814.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Nicotiana sylvestris]
Length=434

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 130/138 (94%), Gaps = 3/138 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAI+YVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIDYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASR--SKTKPKDGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLDEGGTG    + GDAAVA+R  +KTKPKDGEDGEDPEQSKLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDEGGTG-PGPNGGDAAVATRPKTKTKPKDGEDGEDPEQSKLRAGLNS  119

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPN+KW+DVAGLE
Sbjct  120  AIVREKPNIKWNDVAGLE  137



>ref|XP_010089851.1| Vacuolar protein sorting-associated protein 4 [Morus notabilis]
 gb|EXB38467.1| Vacuolar protein sorting-associated protein 4 [Morus notabilis]
Length=434

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNALEYF+THLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFRTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK---DGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+RSKTKPK   +G DG+DPE+ KLRAGLN
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATRSKTKPKDGGEGGDGDDPEKEKLRAGLN  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+REKPNVKW+DVAGLE
Sbjct  119  SAIIREKPNVKWNDVAGLE  137



>ref|XP_006349118.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Solanum tuberosum]
Length=432

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 128/136 (94%), Gaps = 1/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAI+YVRQAVQEDN+GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIDYVRQAVQEDNSGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+G    + GDAAV ++ KTKPKDGEDGEDPEQSKLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGSG-PGPNGGDAAVIAKPKTKPKDGEDGEDPEQSKLRAGLNSAI  119

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  120  VREKPNVKWNDVAGLE  135



>ref|XP_006349119.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Solanum tuberosum]
Length=432

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 127/136 (93%), Gaps = 1/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIE+VRQAVQEDN GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEFVRQAVQEDNGGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+G    + GDAAV ++ KTKPKDGEDGEDPEQSKLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGSG-PGPNGGDAAVMAKPKTKPKDGEDGEDPEQSKLRAGLNSAI  119

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  120  VREKPNVKWNDVAGLE  135



>gb|KJB35365.1| hypothetical protein B456_006G111300 [Gossypium raimondii]
Length=435

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD----GEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R K+KPK     G DGEDPEQ+KLRAGL
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKSKPKSGGGEGGDGEDPEQAKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAI+REKPNVKW+DVAGLE
Sbjct  119  NSAIIREKPNVKWNDVAGLE  138



>gb|KHG02332.1| Vacuolar sorting-associated protein 4 [Gossypium arboreum]
 gb|KHG19196.1| Vacuolar sorting-associated protein 4 [Gossypium arboreum]
Length=433

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD----GEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R K+KPK     G DGEDPEQ+KLRAGL
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKSKPKSGGGEGGDGEDPEQAKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAI+REKPNVKW+DVAGLE
Sbjct  119  NSAIIREKPNVKWNDVAGLE  138



>ref|XP_009758070.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Nicotiana sylvestris]
 ref|XP_009758071.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Nicotiana sylvestris]
 ref|XP_009758072.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Nicotiana sylvestris]
Length=434

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 126/137 (92%), Gaps = 2/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQA+ YV+QAV+EDNAGNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KF 
Sbjct  1    MYSNFKEQAVAYVKQAVEEDNAGNYAKAFSLYMNALEYFKTHLKYEKNPKIKEAITQKFV  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD-GEDGEDPEQSKLRAGLNSA  624
            EYLRRAEEIRAVLDEGG GP PASNGDAAVASR+K+KPK+ G +G+D E  KLRAGLNSA
Sbjct  61   EYLRRAEEIRAVLDEGGGGP-PASNGDAAVASRAKSKPKNGGAEGDDAENVKLRAGLNSA  119

Query  625  IVREKPNVKWSDVAGLE  675
            I+REKPNVKW+DVAGLE
Sbjct  120  IIREKPNVKWNDVAGLE  136



>ref|XP_009615461.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Nicotiana tomentosiformis]
 ref|XP_009615462.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Nicotiana tomentosiformis]
Length=434

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 126/137 (92%), Gaps = 2/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQA+ YV+QAV+EDNAGNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KF 
Sbjct  1    MYSNFKEQAVAYVKQAVEEDNAGNYAKAFSLYMNALEYFKTHLKYEKNPKIKEAITQKFV  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD-GEDGEDPEQSKLRAGLNSA  624
            EYLRRAEEIRAVLDEGG GP PASNGDAAVASR+K+KPK+ G +G+D E  KLRAGLNSA
Sbjct  61   EYLRRAEEIRAVLDEGGGGP-PASNGDAAVASRAKSKPKNGGAEGDDAENVKLRAGLNSA  119

Query  625  IVREKPNVKWSDVAGLE  675
            I+REKPNVKW+DVAGLE
Sbjct  120  IIREKPNVKWNDVAGLE  136



>ref|XP_006409753.1| hypothetical protein EUTSA_v10016678mg [Eutrema salsugineum]
 gb|ESQ51206.1| hypothetical protein EUTSA_v10016678mg [Eutrema salsugineum]
Length=435

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKP----KDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+R KTKP    + G+DGEDPEQSKLRAGL
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATRPKTKPKDGGEGGKDGEDPEQSKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAIVREKPN+KW+DVAGLE
Sbjct  119  NSAIVREKPNIKWTDVAGLE  138



>gb|ABD97880.1| suppressor of K+ transport growth defect-like protein [Gossypium 
hirsutum]
Length=439

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 8/142 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD------GEDGEDPEQSKLRA  609
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R K+KPK+      G DGEDPEQ+KLRA
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKSKPKNGGGGGEGGDGEDPEQAKLRA  118

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GL+SAI+REKPNVKW+DVAGLE
Sbjct  119  GLDSAIIREKPNVKWNDVAGLE  140



>ref|XP_010510756.1| PREDICTED: vacuolar protein sorting-associated protein 4B [Camelina 
sativa]
Length=435

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 128/140 (91%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKP----KDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+R KTKP      G+DGEDPEQSKLRAGL
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATRPKTKPKDGEGGGKDGEDPEQSKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAIVREKPN+KWSDVAGLE
Sbjct  119  NSAIVREKPNIKWSDVAGLE  138



>emb|CDX83275.1| BnaA03g22310D [Brassica napus]
Length=433

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK--DGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLDEGG+GPGP  NGDAAVA+R K+KPK   GE GED EQSKLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDEGGSGPGP--NGDAAVATRPKSKPKDGGGEGGEDAEQSKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPN+KW+DVAGLE
Sbjct  119  AIVREKPNIKWTDVAGLE  136



>ref|XP_007150083.1| hypothetical protein PHAVU_005G125100g [Phaseolus vulgaris]
 gb|ESW22077.1| hypothetical protein PHAVU_005G125100g [Phaseolus vulgaris]
Length=434

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 130/139 (94%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK---DGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R KTKPK    G DGEDPEQ+KLRAGLN
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVAARPKTKPKDGEGGGDGEDPEQAKLRAGLN  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAIVREKPNVKW+DVAGLE
Sbjct  119  SAIVREKPNVKWNDVAGLE  137



>gb|AAM65285.1| putative ATPase [Arabidopsis thaliana]
Length=434

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 128/140 (91%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKP----KDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+R KTKP      G+DGEDPEQSKLRAGL
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATRPKTKPKDGEGGGKDGEDPEQSKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAIVREKPN+KWSDVAGLE
Sbjct  119  NSAIVREKPNIKWSDVAGLE  138



>ref|NP_180328.1| suppressor of K+ transport growth defect 1 protein [Arabidopsis 
thaliana]
 sp|Q9ZNT0.1|VPS4_ARATH RecName: Full=Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1; Short=AtSKD1; AltName: Full=Protein VACUOLAR PROTEIN 
SORTING 4 [Arabidopsis thaliana]
 gb|AAK32884.1|AF367297_1 F10A12.27/F10A12.27 [Arabidopsis thaliana]
 gb|AAC73040.1| putative ATPase [Arabidopsis thaliana]
 gb|AAM10283.1| F10A12.27/F10A12.27 [Arabidopsis thaliana]
 gb|AAM15184.1| putative ATPase [Arabidopsis thaliana]
 gb|AEC08019.1| suppressor of K+ transport growth defect 1 protein [Arabidopsis 
thaliana]
Length=435

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 128/140 (91%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKP----KDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+R KTKP      G+DGEDPEQSKLRAGL
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATRPKTKPKDGEGGGKDGEDPEQSKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAIVREKPN+KWSDVAGLE
Sbjct  119  NSAIVREKPNIKWSDVAGLE  138



>gb|KJB55643.1| hypothetical protein B456_009G086700 [Gossypium raimondii]
 gb|KJB55644.1| hypothetical protein B456_009G086700 [Gossypium raimondii]
Length=437

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 8/142 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYF+THLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFQTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD------GEDGEDPEQSKLRA  609
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R K+KPK+      G DGEDPEQ+KLRA
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKSKPKNGGGGGEGGDGEDPEQAKLRA  118

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GL+SAI+REKPNVKW+DVAGLE
Sbjct  119  GLDSAIIREKPNVKWNDVAGLE  140



>ref|XP_010473150.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Camelina sativa]
Length=435

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 128/140 (91%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKP----KDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+R KTKP      G+DGEDPEQSKLRAGL
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATRPKTKPKDGEGGGKDGEDPEQSKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAIVREKPN+KWSDVAGLE
Sbjct  119  NSAIVREKPNIKWSDVAGLE  138



>ref|XP_006361450.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Solanum tuberosum]
Length=159

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 124/139 (89%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQA+ YV+QAV+EDNAGNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KF 
Sbjct  1    MYSNFKEQAVAYVKQAVEEDNAGNYAKAFSLYMNALEYFKTHLKYEKNPKIKEAITQKFV  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD---GEDGEDPEQSKLRAGLN  618
            EYLRRAEEIR+VLDEGG   GP SNGDAAVASR+K+KPK+   G +G+D E  KLRAGLN
Sbjct  61   EYLRRAEEIRSVLDEGGG--GPTSNGDAAVASRAKSKPKNGGGGGEGDDSENVKLRAGLN  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAIVREKPNVKW+DVAGLE
Sbjct  119  SAIVREKPNVKWNDVAGLE  137



>ref|XP_007132415.1| hypothetical protein PHAVU_011G092700g [Phaseolus vulgaris]
 gb|ESW04409.1| hypothetical protein PHAVU_011G092700g [Phaseolus vulgaris]
Length=435

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 127/140 (91%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDN GNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVDEDNKGNYAKAFQLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASR--SKTKPKDGE--DGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLD+G +  GP S+GDAAVA+R  +KTKPKDG   DGEDPEQ+KLRAGL
Sbjct  61   EYLRRAEEIRAVLDDGPS--GPPSSGDAAVATRPKTKTKPKDGAGGDGEDPEQAKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAIVREKP+VKW+DVAGLE
Sbjct  119  NSAIVREKPDVKWNDVAGLE  138



>ref|XP_002880982.1| hypothetical protein ARALYDRAFT_481753 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57241.1| hypothetical protein ARALYDRAFT_481753 [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 128/140 (91%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKP----KDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+R KTKP      G+DGEDPEQSKLR+GL
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATRPKTKPKDGEGGGKDGEDPEQSKLRSGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAIVREKPN+KWSDVAGLE
Sbjct  119  NSAIVREKPNIKWSDVAGLE  138



>ref|XP_006294248.1| hypothetical protein CARUB_v10023246mg [Capsella rubella]
 gb|EOA27146.1| hypothetical protein CARUB_v10023246mg [Capsella rubella]
Length=435

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 128/140 (91%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKP----KDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA++ KTKP      G+DGEDPEQSKLRAGL
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATKPKTKPKDGEGGGKDGEDPEQSKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAIVREKPN+KWSDVAGLE
Sbjct  119  NSAIVREKPNIKWSDVAGLE  138



>ref|XP_010031501.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Eucalyptus grandis]
Length=434

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 127/139 (91%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK---DGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R KTKPK    G DG+D E+ KLRAGLN
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKTKPKDGSGGGDGDDAEKEKLRAGLN  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+REKPNVKW+DVAGLE
Sbjct  119  SAIIREKPNVKWNDVAGLE  137



>ref|XP_003540240.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Glycine max]
Length=436

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 130/141 (92%), Gaps = 7/141 (5%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK-----DGEDGEDPEQSKLRAG  612
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R KTKPK      G DGEDPEQ+KLRAG
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVAARPKTKPKDGESGGGGDGEDPEQAKLRAG  118

Query  613  LNSAIVREKPNVKWSDVAGLE  675
            LNSAI+REKPNVKW+DVAGLE
Sbjct  119  LNSAIIREKPNVKWNDVAGLE  139



>ref|XP_010557402.1| PREDICTED: vacuolar protein sorting-associated protein 4B [Tarenaya 
hassleriana]
Length=434

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK---DGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+R K+KPK    G DGEDPEQSKLRAGLN
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATRPKSKPKDGEGGGDGEDPEQSKLRAGLN  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+REKPNVKW+DVAGLE
Sbjct  119  SAIIREKPNVKWTDVAGLE  137



>ref|XP_010271707.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Nelumbo nucifera]
Length=433

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK--DGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLDEGG GPG  SNGD+AVA+R KTK K  DG DGEDPEQ+KLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDEGGAGPG--SNGDSAVATRPKTKSKDGDGGDGEDPEQAKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNVKW+DVAGLE
Sbjct  119  AIIREKPNVKWNDVAGLE  136



>ref|XP_010417909.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Camelina sativa]
Length=196

 Score =   222 bits (565),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 127/141 (90%), Gaps = 7/141 (5%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT-----KPKDGEDGEDPEQSKLRAG  612
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+R KT     +   G+DGEDPEQSKLRAG
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATRPKTKPKDGEGGGGKDGEDPEQSKLRAG  118

Query  613  LNSAIVREKPNVKWSDVAGLE  675
            LNSAIVREKPN+KWSDVAGLE
Sbjct  119  LNSAIVREKPNIKWSDVAGLE  139



>gb|KJB06693.1| hypothetical protein B456_001G121400 [Gossypium raimondii]
Length=303

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 8/142 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK------DGEDGEDPEQSKLRA  609
            EYLRRAEEIR VLDEG  GPGPA+NG AAVA+R K+KPK      +G DGEDP+Q+KLRA
Sbjct  61   EYLRRAEEIRTVLDEG--GPGPATNGGAAVATRPKSKPKDGSGGGEGGDGEDPDQAKLRA  118

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GL+SAI+REKPN+KW+DVAGLE
Sbjct  119  GLDSAIIREKPNIKWNDVAGLE  140



>ref|XP_009398151.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=432

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 124/137 (91%), Gaps = 3/137 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNAGNY KAFPLYMNALEYF+THLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAGNYVKAFPLYMNALEYFRTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK-DGEDGEDPEQSKLRAGLNSA  624
            EYLRRAEEIRAVLDEGG+  GPA+NGDAAVA+R KTKPK D       +Q+KLRAGLNSA
Sbjct  61   EYLRRAEEIRAVLDEGGS--GPAANGDAAVATRPKTKPKDDSGGDGGEDQAKLRAGLNSA  118

Query  625  IVREKPNVKWSDVAGLE  675
            I+REKPNVKW+DVAGLE
Sbjct  119  IIREKPNVKWNDVAGLE  135



>ref|XP_009133887.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Brassica rapa]
Length=433

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 127/138 (92%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK--DGEDGEDPEQSKLRAGLNS  621
            EYLR AEEIRAVLDEGG+GPGP  NGDAAVA+R K+KPK   GE GED EQSKLRAGLNS
Sbjct  61   EYLRPAEEIRAVLDEGGSGPGP--NGDAAVATRPKSKPKDGGGEGGEDAEQSKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPN+KW+DVAGLE
Sbjct  119  AIVREKPNIKWTDVAGLE  136



>ref|XP_007015856.1| AAA-type ATPase family protein [Theobroma cacao]
 gb|EOY33475.1| AAA-type ATPase family protein [Theobroma cacao]
Length=437

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 131/142 (92%), Gaps = 8/142 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK------DGEDGEDPEQSKLRA  609
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R K+KPK      +G DGEDPEQ+KLRA
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKSKPKDGSGGGEGGDGEDPEQAKLRA  118

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GLNSAI+REKPNVKW+DVAGLE
Sbjct  119  GLNSAIIREKPNVKWNDVAGLE  140



>ref|XP_004487508.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Cicer arietinum]
Length=434

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK---DGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R K+KPK    G DGEDPEQ+KLRAGLN
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATRPKSKPKDGEGGGDGEDPEQAKLRAGLN  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+REKPNVKW+DVAGLE
Sbjct  119  SAIIREKPNVKWNDVAGLE  137



>ref|XP_009103611.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Brassica rapa]
Length=433

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 129/137 (94%), Gaps = 2/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAITHKFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITHKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD-GEDGEDPEQSKLRAGLNSA  624
            +YLRRAEEIRAVLDEGG G   ++ GDAAVA++ K+KPKD G DGEDPEQSKLRAGL+SA
Sbjct  61   DYLRRAEEIRAVLDEGGPG-PGSNGGDAAVATKPKSKPKDGGGDGEDPEQSKLRAGLDSA  119

Query  625  IVREKPNVKWSDVAGLE  675
            IVREKPN+KW+DVAGLE
Sbjct  120  IVREKPNIKWTDVAGLE  136



>gb|KJB06696.1| hypothetical protein B456_001G121400 [Gossypium raimondii]
 gb|KJB06697.1| hypothetical protein B456_001G121400 [Gossypium raimondii]
Length=350

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 8/142 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK------DGEDGEDPEQSKLRA  609
            EYLRRAEEIR VLDEG  GPGPA+NG AAVA+R K+KPK      +G DGEDP+Q+KLRA
Sbjct  61   EYLRRAEEIRTVLDEG--GPGPATNGGAAVATRPKSKPKDGSGGGEGGDGEDPDQAKLRA  118

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GL+SAI+REKPN+KW+DVAGLE
Sbjct  119  GLDSAIIREKPNIKWNDVAGLE  140



>gb|KJB06695.1| hypothetical protein B456_001G121400 [Gossypium raimondii]
Length=344

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 8/142 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK------DGEDGEDPEQSKLRA  609
            EYLRRAEEIR VLDEG  GPGPA+NG AAVA+R K+KPK      +G DGEDP+Q+KLRA
Sbjct  61   EYLRRAEEIRTVLDEG--GPGPATNGGAAVATRPKSKPKDGSGGGEGGDGEDPDQAKLRA  118

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GL+SAI+REKPN+KW+DVAGLE
Sbjct  119  GLDSAIIREKPNIKWNDVAGLE  140



>gb|KHG05324.1| Vacuolar sorting-associated protein 4 [Gossypium arboreum]
Length=438

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 9/143 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDN GNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT +FT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNEGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQRFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD-------GEDGEDPEQSKLR  606
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R K+KPK+       G+ GEDP+Q+KLR
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKSKPKNGGGGGEGGDGGEDPDQAKLR  118

Query  607  AGLNSAIVREKPNVKWSDVAGLE  675
            +GLNSAI+REKPNVKW+DVAGLE
Sbjct  119  SGLNSAIIREKPNVKWNDVAGLE  141



>gb|KJB06694.1| hypothetical protein B456_001G121400 [Gossypium raimondii]
Length=396

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 8/142 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK------DGEDGEDPEQSKLRA  609
            EYLRRAEEIR VLDEG  GPGPA+NG AAVA+R K+KPK      +G DGEDP+Q+KLRA
Sbjct  61   EYLRRAEEIRTVLDEG--GPGPATNGGAAVATRPKSKPKDGSGGGEGGDGEDPDQAKLRA  118

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GL+SAI+REKPN+KW+DVAGLE
Sbjct  119  GLDSAIIREKPNIKWNDVAGLE  140



>gb|AFK34253.1| unknown [Medicago truncatula]
Length=433

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIE+V+QAV EDN+GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEFVKQAVTEDNSGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT--KPKDGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA++ KT  K     +GED EQSKLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATKPKTKGKGGGEGEGEDAEQSKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPNVKW+DVAGLE
Sbjct  119  AIVREKPNVKWNDVAGLE  136



>ref|XP_003606122.1| Vacuolar sorting protein 4b [Medicago truncatula]
 gb|AES88319.1| AAA-type ATPase family protein [Medicago truncatula]
Length=433

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIE+V+QAV EDN+GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEFVKQAVTEDNSGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT--KPKDGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA++ KT  K     +GED EQSKLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATKPKTKGKGGGEGEGEDAEQSKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPNVKW+DVAGLE
Sbjct  119  AIVREKPNVKWNDVAGLE  136



>ref|XP_009390240.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Musa acuminata subsp. malaccensis]
Length=435

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 125/140 (89%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAF LYMNALEYF+THLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFSLYMNALEYFRTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK----DGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEGG+  GPA+NGDAAV +R KTKPK    +G  GEDP+Q+KLRAGL
Sbjct  61   EYLRRAEEIRAVLDEGGS--GPAANGDAAVVARPKTKPKDGDGNGNGGEDPDQAKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
             SAI+ EKPNVKW+DVAGLE
Sbjct  119  TSAIITEKPNVKWNDVAGLE  138



>ref|XP_003606147.1| Vacuolar sorting protein 4b [Medicago truncatula]
Length=441

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIE+V+QAV EDN+GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEFVKQAVTEDNSGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT--KPKDGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA++ KT  K     +GED EQSKLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATKPKTKGKGGGEGEGEDAEQSKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPNVKW+DVAGLE
Sbjct  119  AIVREKPNVKWNDVAGLE  136



>gb|KEH29865.1| AAA-type ATPase family protein [Medicago truncatula]
Length=435

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 125/138 (91%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIE+V+QAV EDN+GNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEFVKQAVTEDNSGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT--KPKDGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA++ KT  K     +GED EQSKLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATKPKTKGKGGGEGEGEDAEQSKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPNVKW+DVAGLE
Sbjct  119  AIVREKPNVKWNDVAGLE  136



>gb|KJB21698.1| hypothetical protein B456_004G009400 [Gossypium raimondii]
Length=366

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 9/143 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDN GNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT +  
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNEGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQRLI  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD-------GEDGEDPEQSKLR  606
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R K+KPK+       G+ GEDP+Q+KLR
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKSKPKNGGGGGEGGDGGEDPDQAKLR  118

Query  607  AGLNSAIVREKPNVKWSDVAGLE  675
            +GLNSAI+REKPNVKW+DVAGLE
Sbjct  119  SGLNSAIIREKPNVKWNDVAGLE  141



>gb|EPS59126.1| hypothetical protein M569_15684 [Genlisea aurea]
Length=405

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 127/136 (93%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAV EDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVAEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG+  G A+NGDAAVA+R KTKPKDG DGED ++ KLRAGL+SAI
Sbjct  61   EYLRRAEEIRAVLDEGGS--GTAANGDAAVAARPKTKPKDGNDGEDGDKEKLRAGLSSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKW+DVAGLE
Sbjct  119  VREKPNVKWNDVAGLE  134



>gb|KHG29678.1| Vacuolar sorting-associated protein 4 [Gossypium arboreum]
Length=435

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 8/142 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK------DGEDGEDPEQSKLRA  609
            EYLRRAEEIR VLDEG  GPGPA+NG AAVA+R K+KPK      +G DGEDP+Q+KLRA
Sbjct  61   EYLRRAEEIRTVLDEG--GPGPATNGGAAVATRPKSKPKDGSGGGEGGDGEDPDQAKLRA  118

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GL+SAI+REKPN+KW+DVAGLE
Sbjct  119  GLDSAIIREKPNIKWNDVAGLE  140



>gb|KJB06692.1| hypothetical protein B456_001G121400 [Gossypium raimondii]
Length=437

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 8/142 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK------DGEDGEDPEQSKLRA  609
            EYLRRAEEIR VLDEG  GPGPA+NG AAVA+R K+KPK      +G DGEDP+Q+KLRA
Sbjct  61   EYLRRAEEIRTVLDEG--GPGPATNGGAAVATRPKSKPKDGSGGGEGGDGEDPDQAKLRA  118

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GL+SAI+REKPN+KW+DVAGLE
Sbjct  119  GLDSAIIREKPNIKWNDVAGLE  140



>gb|ABK27142.1| unknown [Picea sitchensis]
Length=439

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 125/140 (89%), Gaps = 5/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYF+THLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFRTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKP----KDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIR VLDE G G  P++NGDAAVA++ K+KP        DGEDPEQ+KLR+GL
Sbjct  61   EYLRRAEEIRVVLDE-GVGSRPSANGDAAVATKPKSKPGAKGDGDGDGEDPEQAKLRSGL  119

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAI+REKPNVKW+DVAGLE
Sbjct  120  NSAIIREKPNVKWTDVAGLE  139



>ref|XP_010417912.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Camelina sativa]
Length=436

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 127/141 (90%), Gaps = 7/141 (5%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT-----KPKDGEDGEDPEQSKLRAG  612
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+R KT     +   G+DGEDPEQSKLRAG
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATRPKTKPKDGEGGGGKDGEDPEQSKLRAG  118

Query  613  LNSAIVREKPNVKWSDVAGLE  675
            LNSAIVREKPN+KWSDVAGLE
Sbjct  119  LNSAIVREKPNIKWSDVAGLE  139



>gb|KEH38973.1| AAA-type ATPase family protein [Medicago truncatula]
Length=350

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 126/143 (88%), Gaps = 9/143 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV  DNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVDADNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT-------KPKDGEDGEDPEQSKLR  606
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R K+       +   G +GEDPEQ+KLR
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATRPKSKGKDGGGEGGGGGEGEDPEQAKLR  118

Query  607  AGLNSAIVREKPNVKWSDVAGLE  675
            AGLNSAI+REKPNVKW+DVAGLE
Sbjct  119  AGLNSAIIREKPNVKWNDVAGLE  141



>gb|KJB21697.1| hypothetical protein B456_004G009400 [Gossypium raimondii]
Length=438

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 127/143 (89%), Gaps = 9/143 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDN GNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT +  
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNEGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQRLI  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD-------GEDGEDPEQSKLR  606
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R K+KPK+       G+ GEDP+Q+KLR
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKSKPKNGGGGGEGGDGGEDPDQAKLR  118

Query  607  AGLNSAIVREKPNVKWSDVAGLE  675
            +GLNSAI+REKPNVKW+DVAGLE
Sbjct  119  SGLNSAIIREKPNVKWNDVAGLE  141



>ref|XP_010521667.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Tarenaya hassleriana]
Length=433

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTK--PKDGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIR VLDEG  GPGP SNGDAAVA+R K+K   + G DGEDPEQSKLRAGLNS
Sbjct  61   EYLRRAEEIRTVLDEG--GPGPGSNGDAAVATRPKSKKDGEGGGDGEDPEQSKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNV+W+DVAGLE
Sbjct  119  AIIREKPNVRWTDVAGLE  136



>ref|XP_002264023.1| PREDICTED: vacuolar protein sorting-associated protein 4 [Vitis 
vinifera]
 ref|XP_010658766.1| PREDICTED: vacuolar protein sorting-associated protein 4 [Vitis 
vinifera]
 ref|XP_010658767.1| PREDICTED: vacuolar protein sorting-associated protein 4 [Vitis 
vinifera]
 ref|XP_010658768.1| PREDICTED: vacuolar protein sorting-associated protein 4 [Vitis 
vinifera]
 emb|CAN83271.1| hypothetical protein VITISV_001131 [Vitis vinifera]
Length=434

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASN-GDAAVASRSKTKPKD--GEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLD+GGT  GPASN G+A+VA++ KTKPK+  G DG+D EQ+KLRAGLN
Sbjct  61   EYLRRAEEIRAVLDDGGT--GPASNGGNASVAAKPKTKPKNGDGGDGDDAEQAKLRAGLN  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPNV+WSDVAGLE
Sbjct  119  SAIITEKPNVQWSDVAGLE  137



>ref|XP_010458060.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Camelina sativa]
Length=434

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDN GNY KAFPLYMNALEYF+THLKYEKNPKI+EAITHKF 
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNVGNYNKAFPLYMNALEYFRTHLKYEKNPKIREAITHKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD--GEDGEDPEQSKLRAGLNS  621
            EYLRRAEE+RAVLDE G G GP SNG    A+   TKPK   G DGED EQSKLRAGLNS
Sbjct  61   EYLRRAEELRAVLDE-GIGSGPESNGGGGDAAAVATKPKSKPGGDGEDTEQSKLRAGLNS  119

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPNVKW+DVAGLE
Sbjct  120  AIVREKPNVKWTDVAGLE  137



>ref|XP_004249979.1| PREDICTED: vacuolar protein sorting-associated protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010312540.1| PREDICTED: vacuolar protein sorting-associated protein 4 isoform 
X1 [Solanum lycopersicum]
Length=436

 Score =   221 bits (563),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 124/140 (89%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQA+ YV+QAV+EDNAGNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KF 
Sbjct  1    MYSNFKEQAVAYVKQAVEEDNAGNYAKAFSLYMNALEYFKTHLKYEKNPKIKEAITQKFV  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD----GEDGEDPEQSKLRAGL  615
            EYLRRAEEIR+VLDEGG   GP SNGDAAVASR+K+KPK+    G +G+D E  KLRAGL
Sbjct  61   EYLRRAEEIRSVLDEGGG--GPTSNGDAAVASRAKSKPKNGGGGGGEGDDSENVKLRAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAIVREKPNVKW+DVAGLE
Sbjct  119  NSAIVREKPNVKWNDVAGLE  138



>ref|XP_009390930.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Musa acuminata subsp. malaccensis]
Length=433

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYF+THLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYVKAFPLYMNALEYFRTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK--DGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLDEGG+  GPA+NGDAAVA+R KTKPK  DG  G+DP+Q+KLRAGL S
Sbjct  61   EYLRRAEEIRAVLDEGGS--GPAANGDAAVATRPKTKPKDGDGNGGDDPDQAKLRAGLTS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+ EKPNVKW+DVAGLE
Sbjct  119  AIITEKPNVKWNDVAGLE  136



>ref|XP_003596788.1| Vacuolar sorting protein 4b [Medicago truncatula]
 gb|AES67039.1| AAA-type ATPase family protein [Medicago truncatula]
Length=438

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 126/143 (88%), Gaps = 9/143 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV  DNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVDADNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT-------KPKDGEDGEDPEQSKLR  606
            EYLRRAEEIRAVLD+G  GPGPASNGDAAVA+R K+       +   G +GEDPEQ+KLR
Sbjct  61   EYLRRAEEIRAVLDDG--GPGPASNGDAAVATRPKSKGKDGGGEGGGGGEGEDPEQAKLR  118

Query  607  AGLNSAIVREKPNVKWSDVAGLE  675
            AGLNSAI+REKPNVKW+DVAGLE
Sbjct  119  AGLNSAIIREKPNVKWNDVAGLE  141



>emb|CDP06939.1| unnamed protein product [Coffea canephora]
Length=436

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 125/140 (89%), Gaps = 5/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASR----SKTKPKDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEGG G GPA+NGDAAVA+R     K       DGEDPEQ+KLRAGL
Sbjct  61   EYLRRAEEIRAVLDEGG-GSGPAANGDAAVATRPKGKPKDGGGGEGDGEDPEQAKLRAGL  119

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAI+REKPNVKW+DVAGLE
Sbjct  120  NSAIIREKPNVKWNDVAGLE  139



>ref|XP_010057690.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Eucalyptus grandis]
Length=150

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 122/138 (88%), Gaps = 7/138 (5%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNYAKAFPLY+NALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYAKAFPLYLNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK--DGEDGEDPEQSKLRAGLNS  621
            EYLR     RAVL+EGG GPGPASNGDAAVA+R KT+PK   G DG+D E+ KLRAGLNS
Sbjct  61   EYLR-----RAVLNEGGPGPGPASNGDAAVATRPKTEPKDGSGGDGDDAEKEKLRAGLNS  115

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNVK +DVAGLE
Sbjct  116  AIIREKPNVKRNDVAGLE  133



>gb|KHG11803.1| Vacuolar sorting-associated protein 4 [Gossypium arboreum]
Length=437

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 127/142 (89%), Gaps = 8/142 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASR------SKTKPKDGEDGEDPEQSKLRA  609
            EYLRRAEEIRAVLDEG  GPGPASNGDAAVA+R      +     +G DGEDPEQ+KLRA
Sbjct  61   EYLRRAEEIRAVLDEG--GPGPASNGDAAVATRPKNKPKNGGGGGEGGDGEDPEQAKLRA  118

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GLNSAI+REKPNVKW+DVAGLE
Sbjct  119  GLNSAIIREKPNVKWNDVAGLE  140



>gb|KHN27655.1| Vacuolar protein sorting-associated protein 4 [Glycine soja]
Length=462

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 127/158 (80%), Gaps = 22/158 (14%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGP-------------------GPASNGDAAVASRSKT---KP  561
            EYLRRAEEIRAVLD+GG GP                   GPAS+GDAAVA+R KT     
Sbjct  61   EYLRRAEEIRAVLDDGGPGPASNGDRAEEIRAVLDDGPSGPASSGDAAVATRPKTKPKDG  120

Query  562  KDGEDGEDPEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
                DGEDPEQ+KLRAGLNSAI+REKPNVKW+DVAGLE
Sbjct  121  GKDGDGEDPEQAKLRAGLNSAIIREKPNVKWNDVAGLE  158



>gb|KHN21435.1| Vacuolar protein sorting-associated protein 4 [Glycine soja]
Length=462

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 127/158 (80%), Gaps = 22/158 (14%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGP-------------------GPASNGDAAVASRSKT---KP  561
            EYLRRAEEIRAVLD+GG GP                   GPAS+GDAAVA+R KT     
Sbjct  61   EYLRRAEEIRAVLDDGGPGPASNGDRAEEIRAVLDDGPSGPASSGDAAVATRPKTKPKDG  120

Query  562  KDGEDGEDPEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
                DGEDPEQ+KLRAGLNSAI+REKPNVKW+DVAGLE
Sbjct  121  GKDGDGEDPEQAKLRAGLNSAIIREKPNVKWNDVAGLE  158



>ref|XP_004968156.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Setaria italica]
Length=435

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 121/139 (87%), Gaps = 4/139 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIREAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT---KPKDGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEGG GPG A+  DAAVA+R KT       G  G+D EQSKLRAGLN
Sbjct  61   EYLRRAEEIRAVLDEGGAGPG-ANGSDAAVATRPKTKGKDGDGGNGGDDSEQSKLRAGLN  119

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPNVKW+DVAGLE
Sbjct  120  SAIITEKPNVKWNDVAGLE  138



>gb|EYU36954.1| hypothetical protein MIMGU_mgv1a006685mg [Erythranthe guttata]
Length=435

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 126/139 (91%), Gaps = 4/139 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAV EDNAGNYA+AFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVAEDNAGNYARAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQS---KLRAGLN  618
            EYLRRAEEIRAVLDEGG+G   A+ GDAAVA+R KTKPKDG+DG D + +   KLR+GLN
Sbjct  61   EYLRRAEEIRAVLDEGGSGHS-ANGGDAAVATRPKTKPKDGKDGNDGDDADKEKLRSGLN  119

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAIVREKPNVKW+DVAGLE
Sbjct  120  SAIVREKPNVKWNDVAGLE  138



>ref|XP_001765511.1| predicted protein [Physcomitrella patens]
 gb|EDQ69772.1| predicted protein [Physcomitrella patens]
Length=442

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 119/144 (83%), Gaps = 10/144 (7%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAV EDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVAEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASR--------SKTKPKDGEDGEDPEQSKL  603
            EYLRRAEEIRAVLD+G T  GP++NGDAAV ++                 D EDPEQ KL
Sbjct  61   EYLRRAEEIRAVLDDGPT--GPSANGDAAVQAKPKSKSGKKDGGGGDGDGDSEDPEQQKL  118

Query  604  RAGLNSAIVREKPNVKWSDVAGLE  675
            R+GLNSAI+REKPNV+W+DVAGLE
Sbjct  119  RSGLNSAIIREKPNVRWADVAGLE  142



>gb|EYU36074.1| hypothetical protein MIMGU_mgv1a006786mg [Erythranthe guttata]
Length=432

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 122/136 (90%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYS+FKEQAIEY R+AV EDNAGNYA AFPLYMNALEYF+THLKYEKNPKIK+AI  KF 
Sbjct  1    MYSSFKEQAIEYARKAVAEDNAGNYANAFPLYMNALEYFRTHLKYEKNPKIKDAIMQKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYL RAEEIRAVLDEG  GPGPA+NGDAAVA+R KTKPKDG DGED ++ K RAGLNSAI
Sbjct  61   EYLHRAEEIRAVLDEG--GPGPAANGDAAVAARPKTKPKDGSDGEDGDKDKFRAGLNSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            VREKPNVKWSDVAGLE
Sbjct  119  VREKPNVKWSDVAGLE  134



>ref|XP_001776057.1| predicted protein [Physcomitrella patens]
 gb|EDQ59102.1| predicted protein [Physcomitrella patens]
Length=443

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 119/145 (82%), Gaps = 11/145 (8%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAV EDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVAEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASR---------SKTKPKDGEDGEDPEQSK  600
            EYLRRAEEIRAVLD+G T  GP +NGDAAV ++            +     D EDPEQ K
Sbjct  61   EYLRRAEEIRAVLDDGPT--GPTANGDAAVQAKPKSKAGKKDGGGRGDGDGDSEDPEQQK  118

Query  601  LRAGLNSAIVREKPNVKWSDVAGLE  675
            LR+GLNSAI+REKPNV+W+DVAGLE
Sbjct  119  LRSGLNSAIIREKPNVRWADVAGLE  143



>ref|XP_009804598.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
isoform X2 [Nicotiana sylvestris]
Length=211

 Score =   206 bits (525),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 119/136 (88%), Gaps = 4/136 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDE G G GP SNG  AV ++ K    +   GEDPE+ KLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDE-GVGSGPGSNG--AVVAKPKDG-GEDGGGEDPEKDKLRAGLNSAI  116

Query  628  VREKPNVKWSDVAGLE  675
            +REKPNVKW+DVAGLE
Sbjct  117  IREKPNVKWNDVAGLE  132



>ref|XP_010088767.1| Vacuolar protein sorting-associated protein 4 [Morus notabilis]
 gb|EXB36950.1| Vacuolar protein sorting-associated protein 4 [Morus notabilis]
Length=449

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 118/138 (86%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY+NFKE AIEYV+QAVQEDNAGNY+KAF LYMNALEYFKTHLKYEKNPKIKEAIT KF 
Sbjct  1    MYANFKEHAIEYVKQAVQEDNAGNYSKAFCLYMNALEYFKTHLKYEKNPKIKEAITQKFV  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK--DGEDGEDPEQSKLRAGLNS  621
            EYLRRAEE+RA+LD G +  GP SNG AA  +  K K K  D +DGED EQ+KLRAGL+S
Sbjct  61   EYLRRAEEVRAILDSGAS--GPKSNGGAAADAPQKPKSKGGDAKDGEDREQAKLRAGLDS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+REKPNVKWSDVAGLE
Sbjct  119  AIIREKPNVKWSDVAGLE  136



>ref|XP_009804599.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
isoform X3 [Nicotiana sylvestris]
Length=209

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 119/136 (88%), Gaps = 4/136 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDE G G GP SNG  AV ++ K    +   GEDPE+ KLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDE-GVGSGPGSNG--AVVAKPKDG-GEDGGGEDPEKDKLRAGLNSAI  116

Query  628  VREKPNVKWSDVAGLE  675
            +REKPNVKW+DVAGLE
Sbjct  117  IREKPNVKWNDVAGLE  132



>ref|XP_003539822.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Glycine max]
Length=434

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 122/139 (88%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDN GNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVDEDNKGNYAKAFQLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT---KPKDGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLD+G +  GPAS+GDAAVA+R KT         DGEDPEQ+KLRAGLN
Sbjct  61   EYLRRAEEIRAVLDDGPS--GPASSGDAAVATRPKTKPKDGGKDGDGEDPEQAKLRAGLN  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAIVREKPNVKW+DVAGLE
Sbjct  119  SAIVREKPNVKWNDVAGLE  137



>gb|KHN38642.1| Vacuolar protein sorting-associated protein 4 [Glycine soja]
Length=434

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 122/139 (88%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDN GNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVDEDNKGNYAKAFQLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT---KPKDGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLD+G +  GPAS+GDAAVA+R KT         DGEDPEQ+KLRAGLN
Sbjct  61   EYLRRAEEIRAVLDDGPS--GPASSGDAAVATRPKTKPKDGGKDGDGEDPEQAKLRAGLN  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAIVREKPNVKW+DVAGLE
Sbjct  119  SAIVREKPNVKWNDVAGLE  137



>emb|CDX71438.1| BnaC04g16730D [Brassica napus]
Length=429

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 123/137 (90%), Gaps = 6/137 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSN KEQAIEYV+QAVQEDN GNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNLKEQAIEYVKQAVQEDNGGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD-GEDGEDPEQSKLRAGLNSA  624
            EYLRRAEEIRAVLDEGG G   ++ GDAAV    K+KPK+ G DGEDPEQSKLRAGL+SA
Sbjct  61   EYLRRAEEIRAVLDEGGPG-PGSNGGDAAV----KSKPKEGGGDGEDPEQSKLRAGLDSA  115

Query  625  IVREKPNVKWSDVAGLE  675
            IVREKPN+KW+DVAGLE
Sbjct  116  IVREKPNIKWTDVAGLE  132



>ref|XP_003538127.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Glycine max]
Length=434

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 122/139 (88%), Gaps = 5/139 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDN GNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVDEDNKGNYAKAFQLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT---KPKDGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLD+G +  GPAS+GDAAVA+R KT         DGEDPEQ+KLRAGLN
Sbjct  61   EYLRRAEEIRAVLDDGPS--GPASSGDAAVATRPKTKPKDGGKDGDGEDPEQAKLRAGLN  118

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAIVREKPNVKW+DVAGLE
Sbjct  119  SAIVREKPNVKWNDVAGLE  137



>gb|KFK43141.1| hypothetical protein AALP_AA1G085300 [Arabis alpina]
Length=433

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 129/138 (93%), Gaps = 4/138 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT+KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITNKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK--DGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLD GG+  GP SNGDAAVA++ KTKPK  +G DG+DPEQSKLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDGGGS--GPGSNGDAAVATKPKTKPKDGEGGDGDDPEQSKLRAGLNS  118

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPNVKWSDVAGLE
Sbjct  119  AIVREKPNVKWSDVAGLE  136



>emb|CDY31186.1| BnaC03g47050D [Brassica napus]
Length=434

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 126/138 (91%), Gaps = 3/138 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK--DGEDGEDPEQSKLRAGLNS  621
            EYLRRAEEIRAVLDEGG+G   ++ GDAAVA+R K+KPK   GE GED EQSKLRAGLNS
Sbjct  61   EYLRRAEEIRAVLDEGGSG-PGSNGGDAAVAARPKSKPKDGGGEGGEDAEQSKLRAGLNS  119

Query  622  AIVREKPNVKWSDVAGLE  675
            AIVREKPNVKW+DVAGLE
Sbjct  120  AIVREKPNVKWTDVAGLE  137



>ref|XP_009804597.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
isoform X1 [Nicotiana sylvestris]
Length=429

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 119/136 (88%), Gaps = 4/136 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDE G G GP SNG  AV ++ K    +   GEDPE+ KLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDE-GVGSGPGSNG--AVVAKPKDG-GEDGGGEDPEKDKLRAGLNSAI  116

Query  628  VREKPNVKWSDVAGLE  675
            +REKPNVKW+DVAGLE
Sbjct  117  IREKPNVKWNDVAGLE  132



>ref|XP_009597832.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
isoform X2 [Nicotiana tomentosiformis]
Length=218

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 121/139 (87%), Gaps = 3/139 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNA NYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAENYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK---DGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEGG     ++ GD AV ++ KTKPK   +   GEDPE+ KLRAGLN
Sbjct  61   EYLRRAEEIRAVLDEGGGSGPGSNGGDGAVVAKPKTKPKDGGEDGGGEDPEKDKLRAGLN  120

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+REKPNVKW+DVAGLE
Sbjct  121  SAIIREKPNVKWNDVAGLE  139



>ref|XP_010045233.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Eucalyptus grandis]
Length=437

 Score =   205 bits (522),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 119/140 (85%), Gaps = 4/140 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEY RQAVQEDNAGNYAKAF LYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYARQAVQEDNAGNYAKAFALYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLD---EGGTGPGPASNGDAAVASRSKTKPKD-GEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVL+    GG G G +S GD A ASR   +PKD GE G+D E+ KLRAGL
Sbjct  61   EYLRRAEEIRAVLEGGGGGGGGSGSSSGGDPAAASRPNARPKDGGEGGDDAEKEKLRAGL  120

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAIVREKPNVKW DVAGLE
Sbjct  121  NSAIVREKPNVKWGDVAGLE  140



>ref|XP_003594930.1| Vacuolar sorting protein 4b [Medicago truncatula]
 gb|AES65181.1| MIT domain protein [Medicago truncatula]
Length=272

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 8/130 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNYA+AFPLYMNALEYFKTHLKYEKNP+IKEAIT KF+
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYARAFPLYMNALEYFKTHLKYEKNPEIKEAITQKFS  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK-DGE-----DGEDPEQSKLRA  609
            EYLRRAEEIR VLD+G   PGPASNGDAAV  R +TKPK DGE     DGEDPE+SK+RA
Sbjct  61   EYLRRAEEIRFVLDDG--MPGPASNGDAAVTLRPETKPKNDGERDGEGDGEDPEKSKVRA  118

Query  610  GLNSAIVREK  639
            G NSA  +E+
Sbjct  119  GFNSAFFKEQ  128


 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = +1

Query  280  FKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLR  459
            FKEQAIEYV+QAVQEDNAGNYAKAFPLYMN LEYFKTHLKYEKNPKI+EAIT K T YLR
Sbjct  125  FKEQAIEYVKQAVQEDNAGNYAKAFPLYMNTLEYFKTHLKYEKNPKIREAITQKCTGYLR  184

Query  460  RAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDG--EDGEDPEQSKLRAGLNSAIVR  633
            RAEEIR VL +G   P PAS+GD AVA R + K ++G    GEDPEQ KLRAGLNS IV 
Sbjct  185  RAEEIRFVLGDG--LPRPASDGDVAVALRQEMKQENGGERSGEDPEQDKLRAGLNSTIVM  242

Query  634  EKPN  645
            EKPN
Sbjct  243  EKPN  246



>gb|KCW87395.1| hypothetical protein EUGRSUZ_B03874 [Eucalyptus grandis]
Length=509

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 120/142 (85%), Gaps = 4/142 (3%)
 Frame = +1

Query  262  RRMYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHK  441
            R MYSNFKEQAIEY RQAVQEDNAGNYAKAF LYMNALEYFKTHLKYEKNPKI+EAIT K
Sbjct  71   RAMYSNFKEQAIEYARQAVQEDNAGNYAKAFALYMNALEYFKTHLKYEKNPKIREAITQK  130

Query  442  FTEYLRRAEEIRAVLD---EGGTGPGPASNGDAAVASRSKTKPKD-GEDGEDPEQSKLRA  609
            FTEYLRRAEEIRAVL+    GG G G +S GD A ASR   +PKD GE G+D E+ KLRA
Sbjct  131  FTEYLRRAEEIRAVLEGGGGGGGGSGSSSGGDPAAASRPNARPKDGGEGGDDAEKEKLRA  190

Query  610  GLNSAIVREKPNVKWSDVAGLE  675
            GLNSAIVREKPNVKW DVAGLE
Sbjct  191  GLNSAIVREKPNVKWGDVAGLE  212



>ref|XP_002972719.1| hypothetical protein SELMODRAFT_267596 [Selaginella moellendorffii]
 gb|EFJ25940.1| hypothetical protein SELMODRAFT_267596 [Selaginella moellendorffii]
Length=440

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 4/140 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVVEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVL--DEGGTGPGPASNGDAAVASRSKTKPKDGE--DGEDPEQSKLRAGL  615
            EYLRRAEEIRAV+     G G    + GDA +A+++K+  K GE  DGEDPEQ+KLR+GL
Sbjct  61   EYLRRAEEIRAVIDDGGPGGGGAAPNGGDAGLATKAKSSKKGGEDGDGEDPEQAKLRSGL  120

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAI+REKP+VKWSDVAGLE
Sbjct  121  NSAIIREKPDVKWSDVAGLE  140



>ref|XP_010475617.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Camelina sativa]
Length=438

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 122/141 (87%), Gaps = 5/141 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDN GNY KAFPLYMNALEYFKTHLKYEKNPKI+EAITHKF 
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNVGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITHKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVAS--RSKTKP-KDGED--GEDPEQSKLRAG  612
            EYLRRAEE+RAVLDEGG+GPG    G  A A   + K+KP KDG D  GED EQSKLRAG
Sbjct  61   EYLRRAEELRAVLDEGGSGPGSNGGGGDAAAVAKKPKSKPRKDGGDGYGEDTEQSKLRAG  120

Query  613  LNSAIVREKPNVKWSDVAGLE  675
            LNSAIVREKPNVKW+DVAGLE
Sbjct  121  LNSAIVREKPNVKWTDVAGLE  141



>ref|XP_007010359.1| AAA-type ATPase family protein isoform 3 [Theobroma cacao]
 gb|EOY19169.1| AAA-type ATPase family protein isoform 3 [Theobroma cacao]
Length=343

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKE AIEYV+QAV+ED+AGNY+KA  LYMNALEYFKTHLKYEKNPKIKEAI  KF 
Sbjct  1    MYSNFKEHAIEYVKQAVREDDAGNYSKAIHLYMNALEYFKTHLKYEKNPKIKEAIMQKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRA+LD GG+ P   SN D   A+  KTK  +G+D ED EQ+KLRAGL S I
Sbjct  61   EYLRRAEEIRAILDNGGSLPN--SNRDVGDATWPKTKDGEGKDKEDSEQAKLRAGLYSVI  118

Query  628  VREKPNVKWSDVAGLE  675
            ++EKP+VKWSDVAGLE
Sbjct  119  IKEKPDVKWSDVAGLE  134



>ref|XP_009597831.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
isoform X1 [Nicotiana tomentosiformis]
Length=436

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 121/139 (87%), Gaps = 3/139 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYVRQAVQEDNA NYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVRQAVQEDNAENYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK---DGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEGG     ++ GD AV ++ KTKPK   +   GEDPE+ KLRAGLN
Sbjct  61   EYLRRAEEIRAVLDEGGGSGPGSNGGDGAVVAKPKTKPKDGGEDGGGEDPEKDKLRAGLN  120

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+REKPNVKW+DVAGLE
Sbjct  121  SAIIREKPNVKWNDVAGLE  139



>gb|AAF21428.2|AF165422_1 salt-induced AAA-Type ATPase [Mesembryanthemum crystallinum]
Length=434

 Score =   200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY+KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYSKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASR-SKTKPKDGEDGEDPEQSKLRAGLNSA  624
            EYLRRAEEIRAVLDEGG     A+ GDAAVA+R        G DGED EQ+KLR+GLNSA
Sbjct  61   EYLRRAEEIRAVLDEGGGAGPAANGGDAAVAARPKGKPKDGGGDGEDAEQAKLRSGLNSA  120

Query  625  IVREKPNVKWSDVAGLE  675
            I+REKPNVKW+DVAGLE
Sbjct  121  IIREKPNVKWNDVAGLE  137



>ref|XP_002455226.1| hypothetical protein SORBIDRAFT_03g006580 [Sorghum bicolor]
 gb|EES00346.1| hypothetical protein SORBIDRAFT_03g006580 [Sorghum bicolor]
Length=436

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 120/140 (86%), Gaps = 5/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT----KPKDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAVLDEGG G   ++ GDAAVA+R KT        G  G+D EQSKLRAGL
Sbjct  61   EYLRRAEEIRAVLDEGGAG-PGSNGGDAAVATRPKTKGKDNGDGGNGGDDSEQSKLRAGL  119

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAI+ EKPNVKW+DVAGLE
Sbjct  120  NSAIITEKPNVKWNDVAGLE  139



>ref|XP_007010357.1| AAA-type ATPase family protein isoform 1 [Theobroma cacao]
 gb|EOY19167.1| AAA-type ATPase family protein isoform 1 [Theobroma cacao]
Length=431

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKE AIEYV+QAV+ED+AGNY+KA  LYMNALEYFKTHLKYEKNPKIKEAI  KF 
Sbjct  1    MYSNFKEHAIEYVKQAVREDDAGNYSKAIHLYMNALEYFKTHLKYEKNPKIKEAIMQKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRA+LD GG+ P   SN D   A+  KTK  +G+D ED EQ+KLRAGL S I
Sbjct  61   EYLRRAEEIRAILDNGGSLPN--SNRDVGDATWPKTKDGEGKDKEDSEQAKLRAGLYSVI  118

Query  628  VREKPNVKWSDVAGLE  675
            ++EKP+VKWSDVAGLE
Sbjct  119  IKEKPDVKWSDVAGLE  134



>ref|XP_007010358.1| AAA-type ATPase family protein isoform 2 [Theobroma cacao]
 gb|EOY19168.1| AAA-type ATPase family protein isoform 2 [Theobroma cacao]
Length=439

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKE AIEYV+QAV+ED+AGNY+KA  LYMNALEYFKTHLKYEKNPKIKEAI  KF 
Sbjct  1    MYSNFKEHAIEYVKQAVREDDAGNYSKAIHLYMNALEYFKTHLKYEKNPKIKEAIMQKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRA+LD GG+ P   SN D   A+  KTK  +G+D ED EQ+KLRAGL S I
Sbjct  61   EYLRRAEEIRAILDNGGSLPN--SNRDVGDATWPKTKDGEGKDKEDSEQAKLRAGLYSVI  118

Query  628  VREKPNVKWSDVAGLE  675
            ++EKP+VKWSDVAGLE
Sbjct  119  IKEKPDVKWSDVAGLE  134



>dbj|BAJ90371.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 121/141 (86%), Gaps = 5/141 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDE-GGTGPGPASNGDAAVASRSKT----KPKDGEDGEDPEQSKLRAG  612
            EYLRRAEEIRAVLDE GG  PG  + GDAAVA+R KT       DG  G+D EQSKLRAG
Sbjct  61   EYLRRAEEIRAVLDEGGGGPPGAPNGGDAAVATRPKTKGKDAGGDGAGGDDSEQSKLRAG  120

Query  613  LNSAIVREKPNVKWSDVAGLE  675
            LNSAI+ EKPN+KW+DVAGLE
Sbjct  121  LNSAIITEKPNIKWNDVAGLE  141



>ref|XP_010488639.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
isoform X1 [Camelina sativa]
Length=439

 Score =   198 bits (503),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDN GNY KAFPLYMNALEYFKTHLKYEKNPKI+EAITHKF 
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNVGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITHKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSK-TKPKDGEDGEDPEQSKLRAGLNSA  624
            EYLRRAEE+RAVLDEGG+GPG    GDAA A  +K  K     DG+DPEQSKLRAGLNSA
Sbjct  61   EYLRRAEELRAVLDEGGSGPGSNGGGDAAAAVAAKPKKDGGDGDGDDPEQSKLRAGLNSA  120

Query  625  IVREKPNVKWSDVAGLE  675
            IVREKPNVKW+DVAGLE
Sbjct  121  IVREKPNVKWTDVAGLE  137



>ref|XP_010488647.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
isoform X2 [Camelina sativa]
Length=436

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDN GNY KAFPLYMNALEYFKTHLKYEKNPKI+EAITHKF 
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNVGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITHKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSK-TKPKDGEDGEDPEQSKLRAGLNSA  624
            EYLRRAEE+RAVLDEGG+GPG    GDAA A  +K  K     DG+DPEQSKLRAGLNSA
Sbjct  61   EYLRRAEELRAVLDEGGSGPGSNGGGDAAAAVAAKPKKDGGDGDGDDPEQSKLRAGLNSA  120

Query  625  IVREKPNVKWSDVAGLE  675
            IVREKPNVKW+DVAGLE
Sbjct  121  IVREKPNVKWTDVAGLE  137



>ref|XP_003568377.1| PREDICTED: vacuolar protein sorting-associated protein 4 [Brachypodium 
distachyon]
Length=438

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 122/141 (87%), Gaps = 5/141 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDE-GGTGPGPASNGDAAVASRSKT----KPKDGEDGEDPEQSKLRAG  612
            EYLRRAEEIRAVLDE GG GPG  + GDAAVA++ K+        G+ G+D EQSKLRAG
Sbjct  61   EYLRRAEEIRAVLDEGGGGGPGAPNGGDAAVATKPKSKGKDGGGGGDGGDDSEQSKLRAG  120

Query  613  LNSAIVREKPNVKWSDVAGLE  675
            LNSAI+ EKPN+KW+DVAGLE
Sbjct  121  LNSAIITEKPNIKWNDVAGLE  141



>ref|XP_006643734.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Oryza brachyantha]
Length=433

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 119/137 (87%), Gaps = 2/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT-KPKDGEDGEDPEQSKLRAGLNSA  624
            EYLRRAEEIRAVLDEGG G   A+ GDAAVA+R KT        G+D EQSKLRAGLNSA
Sbjct  61   EYLRRAEEIRAVLDEGGGG-PGANGGDAAVATRPKTKGKDGDGGGDDSEQSKLRAGLNSA  119

Query  625  IVREKPNVKWSDVAGLE  675
            I+ EKPN+KW+DVAGLE
Sbjct  120  IITEKPNIKWNDVAGLE  136



>gb|ACL54383.1| unknown [Zea mays]
 gb|ACN28720.1| unknown [Zea mays]
 gb|ACR36202.1| unknown [Zea mays]
Length=435

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 120/139 (86%), Gaps = 4/139 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT---KPKDGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEGG G   A+ GDAAVA+R KT       G  G+D EQSKLRAGLN
Sbjct  61   EYLRRAEEIRAVLDEGGAG-PGANGGDAAVATRPKTKGKDGDGGNGGDDSEQSKLRAGLN  119

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPNVKW+DVAGLE
Sbjct  120  SAIITEKPNVKWNDVAGLE  138



>gb|ACG31815.1| vacuolar sorting protein 4b [Zea mays]
Length=435

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 120/139 (86%), Gaps = 4/139 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT---KPKDGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEGG G   A+ GDAAVA+R KT       G  G+D EQSKLRAGLN
Sbjct  61   EYLRRAEEIRAVLDEGGAG-PGANGGDAAVATRPKTKGKDGDGGNGGDDSEQSKLRAGLN  119

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPNVKW+DVAGLE
Sbjct  120  SAIITEKPNVKWNDVAGLE  138



>ref|NP_001150145.1| vacuolar sorting protein 4b [Zea mays]
 gb|ACG38020.1| vacuolar sorting protein 4b [Zea mays]
Length=435

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 120/139 (86%), Gaps = 4/139 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT---KPKDGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEGG G   A+ GDAAVA+R KT       G  G+D EQSKLRAGLN
Sbjct  61   EYLRRAEEIRAVLDEGGAG-PGANGGDAAVATRPKTKGKDGDGGNGGDDSEQSKLRAGLN  119

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPN+KW+DVAGLE
Sbjct  120  SAIITEKPNIKWNDVAGLE  138



>ref|XP_002892451.1| hypothetical protein ARALYDRAFT_311880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68710.1| hypothetical protein ARALYDRAFT_311880 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 109/128 (85%), Gaps = 9/128 (7%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI++ I+ KF 
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIRDTISDKFN  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EY+ RAEEIRAVLDE  +G G  SNGDAAVA    TKPKDG DG    +SKLRAGLNSAI
Sbjct  61   EYILRAEEIRAVLDEVRSGTG--SNGDAAVA----TKPKDGGDG---AESKLRAGLNSAI  111

Query  628  VREKPNVK  651
            VREKPNVK
Sbjct  112  VREKPNVK  119



>gb|ACL54518.1| unknown [Zea mays]
 tpg|DAA53540.1| TPA: LOW QUALITY PROTEIN: vacuolar sorting protein 4b [Zea mays]
Length=435

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 120/139 (86%), Gaps = 4/139 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT---KPKDGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEGG G   A+ GDAAVA+R KT       G  G+D EQSKLRAGLN
Sbjct  61   EYLRRAEEIRAVLDEGGAG-PGANGGDAAVATRPKTKGKDGDGGNGGDDSEQSKLRAGLN  119

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPN+KW+DVAGLE
Sbjct  120  SAIITEKPNIKWNDVAGLE  138



>ref|XP_008655625.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Zea mays]
 gb|AFW80013.1| vacuolar sorting protein 4b [Zea mays]
Length=522

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 120/139 (86%), Gaps = 4/139 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  88   MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  147

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT---KPKDGEDGEDPEQSKLRAGLN  618
            EYLRRAEEIRAVLDEGG G   A+ GDAAVA+R KT       G  G+D EQSKLRAGLN
Sbjct  148  EYLRRAEEIRAVLDEGGAG-PGANGGDAAVATRPKTKGKDGDGGNGGDDSEQSKLRAGLN  206

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPNVKW+DVAGLE
Sbjct  207  SAIITEKPNVKWNDVAGLE  225



>gb|AAN03820.1|AF499028_1 AAA-ATPase-like protein [Oryza sativa Japonica Group]
Length=408

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG G G      A               G+D EQSKLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGGGGGANGGDAAVATRPKTKGKDGEGGGDDSEQSKLRAGLNSAI  120

Query  628  VREKPNVKWSDVAGLE  675
            + EKPN+KW+DVAGLE
Sbjct  121  ITEKPNIKWNDVAGLE  136



>ref|XP_010474541.1| PREDICTED: vacuolar protein sorting-associated protein 4-like, 
partial [Camelina sativa]
Length=97

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 93/99 (94%), Gaps = 2/99 (2%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNY KAFPLYMNALEYFKTHLKYEKNPKI+EAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVHEDNAGNYNKAFPLYMNALEYFKTHLKYEKNPKIREAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPK  564
            EYLRRAEEIRAVLDEGG+GPG  SNGDAAVA+R KTKPK
Sbjct  61   EYLRRAEEIRAVLDEGGSGPG--SNGDAAVATRPKTKPK  97



>gb|EAY72474.1| hypothetical protein OsI_00329 [Oryza sativa Indica Group]
Length=433

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG G G      A               G+D EQSKLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGGGGGANGGDAAVATRPKTKGKDGEGGGDDSEQSKLRAGLNSAI  120

Query  628  VREKPNVKWSDVAGLE  675
            + EKPN+KW+DVAGLE
Sbjct  121  ITEKPNIKWNDVAGLE  136



>ref|XP_002988075.1| hypothetical protein SELMODRAFT_426754 [Selaginella moellendorffii]
 gb|EFJ10867.1| hypothetical protein SELMODRAFT_426754 [Selaginella moellendorffii]
Length=440

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 119/140 (85%), Gaps = 4/140 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVVEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDA----AVASRSKTKPKDGEDGEDPEQSKLRAGL  615
            EYLRRAEEIRAV+D+GG G G A+        A  ++S  K  D  DGEDPEQ+KLR+GL
Sbjct  61   EYLRRAEEIRAVIDDGGPGGGGAAPNGGDAGLATKAKSSKKGGDDGDGEDPEQAKLRSGL  120

Query  616  NSAIVREKPNVKWSDVAGLE  675
            NSAI+REKP+VKWSDVAGLE
Sbjct  121  NSAIIREKPDVKWSDVAGLE  140



>gb|EAZ10483.1| hypothetical protein OsJ_00315 [Oryza sativa Japonica Group]
Length=433

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG G G      A               G+D EQSKLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGGGGGANGGDAAVATRPKTKGKDGEGGGDDSEQSKLRAGLNSAI  120

Query  628  VREKPNVKWSDVAGLE  675
            + EKPN+KW+DVAGLE
Sbjct  121  ITEKPNIKWNDVAGLE  136



>gb|KHN21135.1| Vacuolar protein sorting-associated protein 4A [Glycine soja]
Length=337

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 111/139 (80%), Gaps = 17/139 (12%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAV EDN GNYAKAF LYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVDEDNKGNYAKAFQLYMNALEYFKTHLKYEKNPKIKEAITQKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT---KPKDGEDGEDPEQSKLRAGLN  618
            EYLRR+              GPAS+GDAAVA+R KT         DGEDPEQ+KLRAGLN
Sbjct  61   EYLRRS--------------GPASSGDAAVATRPKTKPKDGGKDGDGEDPEQAKLRAGLN  106

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAIVREKPNVKW+DVAGLE
Sbjct  107  SAIVREKPNVKWNDVAGLE  125



>emb|CDM81003.1| unnamed protein product [Triticum aestivum]
Length=427

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 115/136 (85%), Gaps = 6/136 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLDEGG GP  A N      ++ K    DG  G+D +QSKLRAGLNSAI
Sbjct  61   EYLRRAEEIRAVLDEGGGGPPGAPN------TKGKDGGGDGAGGDDSDQSKLRAGLNSAI  114

Query  628  VREKPNVKWSDVAGLE  675
            + EKPN+KW+DVAGLE
Sbjct  115  ITEKPNIKWNDVAGLE  130



>ref|XP_003636695.1| Vacuolar sorting protein 4b [Medicago truncatula]
 gb|KEH19355.1| vacuolar sorting-associated-like protein [Medicago truncatula]
Length=196

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = +1

Query  280  FKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLR  459
            FKEQAIEYV+QAVQEDNAGNYAKAFPLYMN LEYFKTHLKYEKNPKI+EAIT K T YLR
Sbjct  49   FKEQAIEYVKQAVQEDNAGNYAKAFPLYMNTLEYFKTHLKYEKNPKIREAITQKCTGYLR  108

Query  460  RAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDG--EDGEDPEQSKLRAGLNSAIVR  633
            RAEEIR VL +G   P PAS+GD AVA R + K ++G    GEDPEQ KLRAGLNS IV 
Sbjct  109  RAEEIRFVLGDG--LPRPASDGDVAVALRQEMKQENGGERSGEDPEQDKLRAGLNSTIVM  166

Query  634  EKPN  645
            EKPN
Sbjct  167  EKPN  170


 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 6/51 (12%)
 Frame = +1

Query  505  PGPASNGDAAVASRSKTKPK-DGE-----DGEDPEQSKLRAGLNSAIVREK  639
            PGPASNGDAAV  R +TKPK DGE     DGEDPE+SK+RAG NSA  +E+
Sbjct  2    PGPASNGDAAVTLRPETKPKNDGERDGEGDGEDPEKSKVRAGFNSAFFKEQ  52



>ref|XP_006379467.1| hypothetical protein POPTR_0008s023001g, partial [Populus trichocarpa]
 gb|ERP57264.1| hypothetical protein POPTR_0008s023001g, partial [Populus trichocarpa]
Length=284

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 110/140 (79%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY NF E  IEY +QAV+ED+AGNY KAF LYMNALEYF+  LKYEKNP+I++ I  K  
Sbjct  1    MYCNFMEHGIEYAKQAVKEDDAGNYRKAFQLYMNALEYFQAQLKYEKNPQIEKTIRQKCM  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT--KPKDG--EDGEDPEQSKLRAGL  615
             YLRRAEEIR+VLD G +   PASNGDA+VA+R KT  KPKDG  +  EDPE +KL+ GL
Sbjct  61   GYLRRAEEIRSVLDNGRS--MPASNGDASVAARPKTSPKPKDGGRKGKEDPELAKLKGGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            +S I+REKPNVKWSDVAGLE
Sbjct  119  DSVIIREKPNVKWSDVAGLE  138



>ref|XP_006387924.1| hypothetical protein POPTR_0475s002101g [Populus trichocarpa]
 gb|ERP46838.1| hypothetical protein POPTR_0475s002101g [Populus trichocarpa]
Length=286

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 109/140 (78%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY NF E  IEY  QAV+ED+AGNY KAF LYMNALEYF+  LKYEKNP+I++ I  K  
Sbjct  1    MYCNFMEHGIEYATQAVKEDDAGNYRKAFQLYMNALEYFQAQLKYEKNPQIEKTIRQKCM  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT--KPKDG--EDGEDPEQSKLRAGL  615
             YLRRAEEIR+VLD G +   PASNGDA+VA+R KT  KPKDG  +  EDPE +KL+ GL
Sbjct  61   GYLRRAEEIRSVLDNGRS--MPASNGDASVAARPKTSPKPKDGGRKGKEDPELAKLKGGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            +S I+REKPNVKWSDVAGLE
Sbjct  119  DSVIIREKPNVKWSDVAGLE  138



>ref|XP_002316504.1| hypothetical protein POPTR_0010s24370g [Populus trichocarpa]
 gb|EEF02675.1| hypothetical protein POPTR_0010s24370g [Populus trichocarpa]
Length=431

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 114/140 (81%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNF E  IEY +QAV+ED+ GNY+KAF LYMNALEYF+  LKYEKN +I++ I  +  
Sbjct  1    MYSNFMEHGIEYAKQAVKEDDTGNYSKAFQLYMNALEYFQAQLKYEKNQQIEKTIRERCL  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT--KPKD--GEDGEDPEQSKLRAGL  615
             YL+RAEEIRAVLD GG+   PASNGDA+VA++ K+  KPKD  G+D EDPE++KL+AGL
Sbjct  61   GYLKRAEEIRAVLDNGGS--VPASNGDASVAAQPKSSPKPKDGGGKDKEDPEKAKLKAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            +S I+REKPNVKWSDVAGLE
Sbjct  119  DSVIIREKPNVKWSDVAGLE  138



>ref|XP_006387925.1| hypothetical protein POPTR_0475s002101g, partial [Populus trichocarpa]
 gb|ERP46839.1| hypothetical protein POPTR_0475s002101g, partial [Populus trichocarpa]
Length=342

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 109/140 (78%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY NF E  IEY  QAV+ED+AGNY KAF LYMNALEYF+  LKYEKNP+I++ I  K  
Sbjct  1    MYCNFMEHGIEYATQAVKEDDAGNYRKAFQLYMNALEYFQAQLKYEKNPQIEKTIRQKCM  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT--KPKDG--EDGEDPEQSKLRAGL  615
             YLRRAEEIR+VLD G +   PASNGDA+VA+R KT  KPKDG  +  EDPE +KL+ GL
Sbjct  61   GYLRRAEEIRSVLDNGRS--MPASNGDASVAARPKTSPKPKDGGRKGKEDPELAKLKGGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            +S I+REKPNVKWSDVAGLE
Sbjct  119  DSVIIREKPNVKWSDVAGLE  138



>ref|XP_011032848.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X2 [Populus euphratica]
Length=398

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY NF E  IEY +QAV+ED+AGNY KAF LYMNALEYF+  LKYEKNP+I++ I  K  
Sbjct  1    MYCNFMEHGIEYAKQAVKEDDAGNYRKAFQLYMNALEYFQAQLKYEKNPQIEKTIRQKCL  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT--KPKDG--EDGEDPEQSKLRAGL  615
             YLRRAEEIR+VLD G +   PASNGD +VA+R KT  KPKDG  +  EDPE +KL+ GL
Sbjct  61   GYLRRAEEIRSVLDNGRS--MPASNGDTSVAARPKTSPKPKDGGRKGKEDPELAKLKEGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            +S I+REKPNVKWSDVAGLE
Sbjct  119  DSVIIREKPNVKWSDVAGLE  138



>gb|EMS45124.1| Vacuolar protein sorting-associated protein 4B [Triticum urartu]
Length=505

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 101/139 (73%), Gaps = 33/139 (24%)
 Frame = +1

Query  259  SRRMYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITH  438
            + +MYSNFKEQAIEYV+QAVQEDNAGNY KAFPLYMNALEYFKTHLKYEKNPKIKEAIT 
Sbjct  34   TTQMYSNFKEQAIEYVKQAVQEDNAGNYVKAFPLYMNALEYFKTHLKYEKNPKIKEAITA  93

Query  439  KFTEYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLN  618
            KFTEYLRRAEEIRA                                 +D EQSKLRAGLN
Sbjct  94   KFTEYLRRAEEIRA---------------------------------DDSEQSKLRAGLN  120

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ EKPN+KW+DVAGLE
Sbjct  121  SAIITEKPNIKWNDVAGLE  139



>ref|XP_011032841.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X1 [Populus euphratica]
 ref|XP_011032842.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X1 [Populus euphratica]
 ref|XP_011032843.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X1 [Populus euphratica]
 ref|XP_011032845.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X1 [Populus euphratica]
 ref|XP_011032846.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X1 [Populus euphratica]
 ref|XP_011032847.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X1 [Populus euphratica]
Length=434

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 109/140 (78%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY NF E  IEY +QAV+ED+AGNY KAF LYMNALEYF+  LKYEKNP+I++ I  K  
Sbjct  1    MYCNFMEHGIEYAKQAVKEDDAGNYRKAFQLYMNALEYFQAQLKYEKNPQIEKTIRQKCL  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT--KPKDG--EDGEDPEQSKLRAGL  615
             YLRRAEEIR+VLD G +   PASNGD +VA+R KT  KPKDG  +  EDPE +KL+ GL
Sbjct  61   GYLRRAEEIRSVLDNGRS--MPASNGDTSVAARPKTSPKPKDGGRKGKEDPELAKLKEGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            +S I+REKPNVKWSDVAGLE
Sbjct  119  DSVIIREKPNVKWSDVAGLE  138



>ref|XP_002524981.1| Vacuolar sorting protein 4b, putative [Ricinus communis]
 gb|EEF37388.1| Vacuolar sorting protein 4b, putative [Ricinus communis]
Length=428

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 103/140 (74%), Gaps = 4/140 (3%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY NF E   EY RQAV+ED+AGNY KAF LYMNALEYF THLKYEKNP++K+ I  K  
Sbjct  1    MYCNFLEHGAEYARQAVKEDDAGNYVKAFQLYMNALEYFHTHLKYEKNPQVKKTIRQKSL  60

Query  448  EYLRRAEEIRAVLDEGGTGP----GPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGL  615
             YL RAEEIRA+LD GG+ P    GPA   +A    + K K  +G+D ED EQ+KL AGL
Sbjct  61   GYLTRAEEIRAILDNGGSVPTSNGGPALAAEAKTKPKPKPKGGEGKDKEDSEQAKLMAGL  120

Query  616  NSAIVREKPNVKWSDVAGLE  675
            +S I+REKPNVKW+DVAGLE
Sbjct  121  DSVIIREKPNVKWNDVAGLE  140



>gb|EAY72476.1| hypothetical protein OsI_00332 [Oryza sativa Indica Group]
Length=452

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 96/136 (71%), Gaps = 24/136 (18%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDN GNY KAFPLYMNALEYFKTHLKYEK+PKIK+AI  KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNGGNYVKAFPLYMNALEYFKTHLKYEKDPKIKDAIAAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLD G  G                        G D EQ+K R    SAI
Sbjct  61   EYLRRAEEIRAVLD-GHIG-----------------------GGGDSEQAKPRGMPRSAI  96

Query  628  VREKPNVKWSDVAGLE  675
            V  KP+VKWSDVAGLE
Sbjct  97   VAAKPSVKWSDVAGLE  112



>dbj|BAD61062.1| putative p60 katanin [Oryza sativa Japonica Group]
 gb|EEE53841.1| hypothetical protein OsJ_00317 [Oryza sativa Japonica Group]
Length=478

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 95/136 (70%), Gaps = 21/136 (15%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIEYV+QAVQEDN GNY KAFPLYMNALEYFKTHLKYEK+PKIK+AI  KFT
Sbjct  1    MYSNFKEQAIEYVKQAVQEDNGGNYVKAFPLYMNALEYFKTHLKYEKDPKIKDAIAAKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYLRRAEEIRAVLD           G                   D EQ+K R  L SAI
Sbjct  61   EYLRRAEEIRAVLD-----------GHIGGGGGGG----------DSEQAKPRGMLRSAI  99

Query  628  VREKPNVKWSDVAGLE  675
            V  KP+VKWSDVAGLE
Sbjct  100  VAAKPSVKWSDVAGLE  115



>ref|XP_009614201.1| PREDICTED: serine/threonine-protein kinase ULK3-like [Nicotiana 
tomentosiformis]
Length=215

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 98/122 (80%), Gaps = 7/122 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFK  AIEYV++AVQEDNAGNYAKAFPLYMNALEYFKTHLKYEK+PKIKEAI  KFT
Sbjct  1    MYSNFKALAIEYVKEAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKDPKIKEAINKKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYL RA EIRAVLD+ GTG   +S GDAA      T+PKDGE+GEDPE SKL   LN   
Sbjct  61   EYLHRAGEIRAVLDDNGTG-SGSSGGDAA------TRPKDGENGEDPEPSKLTTELNFVP  113

Query  628  VR  633
            +R
Sbjct  114  IR  115


 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +1

Query  277  NFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYL  456
            +FKEQAI YV+QAVQEDN GNY KAF LYMNALEYFKT+LKYEKNPK+KEAIT KF EYL
Sbjct  116  SFKEQAIVYVKQAVQEDNDGNYNKAFSLYMNALEYFKTYLKYEKNPKMKEAITMKFNEYL  175

Query  457  RRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDG  579
             RAE+IRA+LDEG     P+ +GDAA+A+R KTK +DGE G
Sbjct  176  CRAEKIRAMLDEGER--APSLSGDAAMATRPKTKSEDGEGG  214



>ref|XP_010312541.1| PREDICTED: vacuolar protein sorting-associated protein 4 isoform 
X2 [Solanum lycopersicum]
Length=404

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 94/108 (87%), Gaps = 6/108 (6%)
 Frame = +1

Query  364  MNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRAEEIRAVLDEGGTGPGPASNGDAAVAS  543
            MNALEYFKTHLKYEKNPKIKEAIT KF EYLRRAEEIR+VLDEGG   GP SNGDAAVAS
Sbjct  1    MNALEYFKTHLKYEKNPKIKEAITQKFVEYLRRAEEIRSVLDEGGG--GPTSNGDAAVAS  58

Query  544  RSKTKPKD----GEDGEDPEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
            R+K+KPK+    G +G+D E  KLRAGLNSAIVREKPNVKW+DVAGLE
Sbjct  59   RAKSKPKNGGGGGGEGDDSENVKLRAGLNSAIVREKPNVKWNDVAGLE  106



>ref|XP_011024231.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
[Populus euphratica]
Length=435

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 109/140 (78%), Gaps = 6/140 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNF E  IEY ++AV+ED+ GNY+KAF LYMNALEYF+  LKYEKN +I++ I  +  
Sbjct  1    MYSNFMEHGIEYAKRAVKEDDTGNYSKAFQLYMNALEYFQAQLKYEKNQQIEKTIRERCL  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTK----PKDGEDGEDPEQSKLRAGL  615
             YL+RAEEIRAVLD GG+   PASNGDA+VA++ KT        G+D  DPE++KL+AGL
Sbjct  61   GYLKRAEEIRAVLDNGGS--VPASNGDASVAAQPKTSPKPKDGGGKDKGDPEKAKLKAGL  118

Query  616  NSAIVREKPNVKWSDVAGLE  675
            +S I+REKPNVKWSDVAGLE
Sbjct  119  DSVIIREKPNVKWSDVAGLE  138



>ref|NP_172304.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF18249.1|AC011438_11 T23G18.12 [Arabidopsis thaliana]
 gb|AAO64203.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28268.1| uncharacterized protein AT1G08270 [Arabidopsis thaliana]
Length=126

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 90/104 (87%), Gaps = 5/104 (5%)
 Frame = +1

Query  364  MNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRAEEIRAVLDEGGTGPGPASNGDAAVAS  543
            MNALEYFK +LKYEKNP+I++AIT KF EYLRRAEEIRAVL E G+G G  SNGDAAVA+
Sbjct  1    MNALEYFKIYLKYEKNPRIRDAITDKFYEYLRRAEEIRAVLVEVGSGKG--SNGDAAVAT  58

Query  544  RSKTKPKDGEDGEDPEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
            + KTKPKDG DG   E+SKLRAGLNSAI+REKPNVKW+ VAGLE
Sbjct  59   KPKTKPKDGGDG---EESKLRAGLNSAIIREKPNVKWTVVAGLE  99



>ref|NP_973792.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE28267.1| uncharacterized protein AT1G08270 [Arabidopsis thaliana]
Length=132

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 90/104 (87%), Gaps = 5/104 (5%)
 Frame = +1

Query  364  MNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRAEEIRAVLDEGGTGPGPASNGDAAVAS  543
            MNALEYFK +LKYEKNP+I++AIT KF EYLRRAEEIRAVL E G+G G  SNGDAAVA+
Sbjct  1    MNALEYFKIYLKYEKNPRIRDAITDKFYEYLRRAEEIRAVLVEVGSGKG--SNGDAAVAT  58

Query  544  RSKTKPKDGEDGEDPEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
            + KTKPKDG DG   E+SKLRAGLNSAI+REKPNVKW+ VAGLE
Sbjct  59   KPKTKPKDGGDG---EESKLRAGLNSAIIREKPNVKWTVVAGLE  99



>ref|XP_010057280.1| PREDICTED: vacuolar protein sorting-associated protein 4-like 
[Eucalyptus grandis]
Length=118

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 91/106 (86%), Gaps = 7/106 (7%)
 Frame = +1

Query  364  MNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRAEEIRAVLDEGGTGPGPASNGDAAVAS  543
            MNALEYFKTHLKYEKNPKI+EAIT KFTEYLR     RAVL+EGG GPGPASNGDAAVA+
Sbjct  1    MNALEYFKTHLKYEKNPKIREAITQKFTEYLR-----RAVLNEGGPGPGPASNGDAAVAT  55

Query  544  RSKTKPK--DGEDGEDPEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
            R KTKPK   G DG+D E+ KLRAGLNSAI+REKPNVK +DVAGLE
Sbjct  56   RPKTKPKDGSGGDGDDAEKEKLRAGLNSAIIREKPNVKRNDVAGLE  101



>ref|XP_012074639.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1-like isoform X3 [Jatropha curcas]
Length=394

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY NF E   EY + AV+ED+AGNYAKAF LY NALEYF+ HLKYEKNP+I + I  K  
Sbjct  1    MYCNFIEHGAEYAKHAVKEDDAGNYAKAFQLYKNALEYFQAHLKYEKNPQIAKTIKEKCM  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNG-DAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSA  624
             YLRRAEEI A+LD  G+ P    +G D     +SK K  +G+D EDPE +KLRAGL+S 
Sbjct  61   GYLRRAEEIGAILDNEGSVPTSNGSGTDPKAKPKSKPKDVEGKD-EDPELAKLRAGLDSV  119

Query  625  IVREKPNVKWSDVAGLE  675
            I+REKPNVKW+DVAGLE
Sbjct  120  IIREKPNVKWNDVAGLE  136



>ref|XP_012074638.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1-like isoform X2 [Jatropha curcas]
Length=406

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY NF E   EY + AV+ED+AGNYAKAF LY NALEYF+ HLKYEKNP+I + I  K  
Sbjct  1    MYCNFIEHGAEYAKHAVKEDDAGNYAKAFQLYKNALEYFQAHLKYEKNPQIAKTIKEKCM  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNG-DAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSA  624
             YLRRAEEI A+LD  G+ P    +G D     +SK K  +G+D EDPE +KLRAGL+S 
Sbjct  61   GYLRRAEEIGAILDNEGSVPTSNGSGTDPKAKPKSKPKDVEGKD-EDPELAKLRAGLDSV  119

Query  625  IVREKPNVKWSDVAGLE  675
            I+REKPNVKW+DVAGLE
Sbjct  120  IIREKPNVKWNDVAGLE  136



>ref|XP_012074640.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1-like isoform X4 [Jatropha curcas]
Length=394

 Score =   157 bits (396),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY NF E   EY + AV+ED+AGNYAKAF LY NALEYF+ HLKYEKNP+I + I  K  
Sbjct  1    MYCNFIEHGAEYAKHAVKEDDAGNYAKAFQLYKNALEYFQAHLKYEKNPQIAKTIKEKCM  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNG-DAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSA  624
             YLRRAEEI A+LD  G+ P    +G D     +SK K  +G+D EDPE +KLRAGL+S 
Sbjct  61   GYLRRAEEIGAILDNEGSVPTSNGSGTDPKAKPKSKPKDVEGKD-EDPELAKLRAGLDSV  119

Query  625  IVREKPNVKWSDVAGLE  675
            I+REKPNVKW+DVAGLE
Sbjct  120  IIREKPNVKWNDVAGLE  136



>ref|XP_012074637.1| PREDICTED: protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 
1-like isoform X1 [Jatropha curcas]
 gb|KDP35843.1| hypothetical protein JCGZ_10324 [Jatropha curcas]
Length=433

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MY NF E   EY + AV+ED+AGNYAKAF LY NALEYF+ HLKYEKNP+I + I  K  
Sbjct  1    MYCNFIEHGAEYAKHAVKEDDAGNYAKAFQLYKNALEYFQAHLKYEKNPQIAKTIKEKCM  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNG-DAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSA  624
             YLRRAEEI A+LD  G+ P    +G D     +SK K  +G+D EDPE +KLRAGL+S 
Sbjct  61   GYLRRAEEIGAILDNEGSVPTSNGSGTDPKAKPKSKPKDVEGKD-EDPELAKLRAGLDSV  119

Query  625  IVREKPNVKWSDVAGLE  675
            I+REKPNVKW+DVAGLE
Sbjct  120  IIREKPNVKWNDVAGLE  136



>ref|XP_005651778.1| AAA-ATPase of VPS4/SKD1 family [Coccomyxa subellipsoidea C-169]
 gb|EIE27234.1| AAA-ATPase of VPS4/SKD1 family [Coccomyxa subellipsoidea C-169]
Length=434

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 99/138 (72%), Gaps = 6/138 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKE+AIEYV++AV EDNAGNY KAF LY  ALEYF THLKYEKNP+ KEAIT KF 
Sbjct  1    MYSNFKEKAIEYVKEAVAEDNAGNYQKAFDLYKIALEYFSTHLKYEKNPRAKEAITAKFK  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGE--DPEQSKLRAGLNS  621
            EYL RAE I+ +LD   T    A+NG        K++P  G  GE  + E+ KLR+ L +
Sbjct  61   EYLDRAEFIKGLLDGQQTVEPSAANGTVG----QKSRPPGGGGGEKDESEKDKLRSSLGN  116

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+ E+PNVKW DVAGLE
Sbjct  117  AIMVERPNVKWDDVAGLE  134



>gb|KDD74938.1| AAA+ ATPase [Helicosporidium sp. ATCC 50920]
Length=434

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFK+ AIE V+QA +EDNAGNYAKAF LYMNAL+YF THLKYEKNP  K+AIT K  
Sbjct  1    MYSNFKDTAIELVKQATEEDNAGNYAKAFQLYMNALDYFTTHLKYEKNPSAKKAITTKVR  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            +Y+ RAE +++VLD       P S  + A A  S  +   G    + E  KL++ L SAI
Sbjct  61   DYVTRAEYLKSVLDGEQAAEPPVSQPNGAQA--SGRREAGGSSAREEELDKLKSSLGSAI  118

Query  628  VREKPNVKWSDVAGLE  675
            + EKPNV+W DVAGLE
Sbjct  119  LEEKPNVRWEDVAGLE  134



>ref|XP_009788117.1| PREDICTED: uncharacterized protein LOC104235979 [Nicotiana sylvestris]
 ref|XP_009788118.1| PREDICTED: uncharacterized protein LOC104235979 [Nicotiana sylvestris]
Length=208

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 91/122 (75%), Gaps = 12/122 (10%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKEQAIE++RQ   EDN GNYAKAF LYMNALEYFKTHL   KN +IKEAI     
Sbjct  1    MYSNFKEQAIEHLRQ---EDNVGNYAKAFTLYMNALEYFKTHL---KNLEIKEAIYQTIN  54

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNG-DAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSA  624
            EYL RAEEIRA+LDE GT  G +SNG D A+A + K K KDGEDGED   S+LR G NS 
Sbjct  55   EYLHRAEEIRAMLDESGT--GSSSNGRDMAMAVKPKMKLKDGEDGED---SELRTGPNSV  109

Query  625  IV  630
            ++
Sbjct  110  VI  111


 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 77/106 (73%), Gaps = 14/106 (13%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEK-NPKIKEAITHKFTE  450
            SNFK+QAI YVRQA      GNYAKAFPLYMNALEYF+  LKYEK +PK K AI+ KF E
Sbjct  112  SNFKDQAIAYVRQA------GNYAKAFPLYMNALEYFRAQLKYEKDDPKTKMAISQKFDE  165

Query  451  YLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDP  588
            YL RA+EIR VLD   T P   + GDA VA+R    PKDGEDG+DP
Sbjct  166  YLHRAKEIRMVLD--WTEPS-LNEGDAVVATR----PKDGEDGDDP  204



>ref|XP_011400523.1| Vacuolar protein sorting-associated protein 4 [Auxenochlorella 
protothecoides]
 gb|KFM27540.1| Vacuolar protein sorting-associated protein 4 [Auxenochlorella 
protothecoides]
Length=437

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 97/140 (69%), Gaps = 8/140 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNFKE+AIE V+QA +EDNAGNY KAF LYM +L+YF THLKYEKNP  K AIT K  
Sbjct  1    MYSNFKEKAIELVKQATEEDNAGNYQKAFQLYMASLDYFTTHLKYEKNPSAKSAITVKVR  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAV----ASRSKTKPKDGEDGEDPEQSKLRAGL  615
            +Y+ RAE +RAVLD G T   P  +GDA V    A+    KP      ED +  KL++ L
Sbjct  61   DYIARAEYLRAVLD-GQTPEDP--SGDAGVGGSQAAAGVKKPGAAAGKED-DLEKLKSSL  116

Query  616  NSAIVREKPNVKWSDVAGLE  675
             +AI+ EKPNVKW DVAGLE
Sbjct  117  GNAILEEKPNVKWDDVAGLE  136



>ref|XP_008458579.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X2 [Cucumis melo]
Length=425

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 93/131 (71%), Gaps = 17/131 (13%)
 Frame = +1

Query  283  KEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLRR  462
            K+QAI+ V++AVQEDNAGNYAKAFP+YM ALE FKT LKYEKNP+IKEAIT KF +YL R
Sbjct  12   KDQAIKMVKEAVQEDNAGNYAKAFPIYMEALENFKTVLKYEKNPEIKEAITLKFNQYLCR  71

Query  463  AEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVREKP  642
            AEEI A+  +GG  PG +S+G                 G DPE +K+   L+  I+++KP
Sbjct  72   AEEISALFGDGGL-PGTSSSG----------------YGVDPEHAKMLTDLHYVIIKKKP  114

Query  643  NVKWSDVAGLE  675
            +VKW DVAGLE
Sbjct  115  DVKWIDVAGLE  125



>ref|XP_008458578.1| PREDICTED: vacuolar protein sorting-associated protein 4B-like 
isoform X1 [Cucumis melo]
Length=526

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 93/131 (71%), Gaps = 17/131 (13%)
 Frame = +1

Query  283  KEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLRR  462
            K+QAI+ V++AVQEDNAGNYAKAFP+YM ALE FKT LKYEKNP+IKEAIT KF +YL R
Sbjct  113  KDQAIKMVKEAVQEDNAGNYAKAFPIYMEALENFKTVLKYEKNPEIKEAITLKFNQYLCR  172

Query  463  AEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVREKP  642
            AEEI A+  +GG  PG +S+G                 G DPE +K+   L+  I+++KP
Sbjct  173  AEEISALFGDGGL-PGTSSSG----------------YGVDPEHAKMLTDLHYVIIKKKP  215

Query  643  NVKWSDVAGLE  675
            +VKW DVAGLE
Sbjct  216  DVKWIDVAGLE  226


 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            MYSNF++Q +EY +QAV+E+N GNY KAFPLYMNALEY K  LKYEK+P +KE+I+ KFT
Sbjct  1    MYSNFRDQGLEYAKQAVEEENVGNYGKAFPLYMNALEYLKAALKYEKDPNVKESISQKFT  60

Query  448  EYLRRAEEIRAVLDEGG-TGPGPASNGDAAVASRSKTKPK  564
             YLRRAEEIRA+LD GG   P   S+  AA++S      K
Sbjct  61   LYLRRAEEIRALLDHGGDAAPHLNSSATAAISSEKTVDSK  100



>emb|CBI28349.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 77/106 (73%), Gaps = 28/106 (26%)
 Frame = +1

Query  364  MNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRAEEIRAVLDEGGTGPGPASNGDAAVAS  543
            MNALEYFKTHLKYEKNPKIKEAIT KFTEYLRRAEEIRA                     
Sbjct  1    MNALEYFKTHLKYEKNPKIKEAITQKFTEYLRRAEEIRA---------------------  39

Query  544  RSKTKPKDGE--DGEDPEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
                 PKDGE  DGEDPEQ+KLR+GLNSAI+REKPNVKWSDVAGLE
Sbjct  40   -----PKDGEGGDGEDPEQAKLRSGLNSAIIREKPNVKWSDVAGLE  80



>ref|XP_011004509.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar protein sorting-associated 
protein 4, partial [Populus euphratica]
Length=142

 Score =   127 bits (318),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 3/93 (3%)
 Frame = +1

Query  397  KYEKNPKIKEAITHKFTEYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGED  576
            + EKN KI EAIT KF +Y+RRAEEI  V DEGG  PGP SNGDAAVA R +TKP DGED
Sbjct  21   RLEKNHKICEAITKKFADYVRRAEEIGTVPDEGG--PGPNSNGDAAVARRPRTKPGDGED  78

Query  577  GEDPEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
            G+DPE+ KLRAGLNSAI REKP+VKWS+VAG+E
Sbjct  79   GDDPEE-KLRAGLNSAIEREKPDVKWSEVAGIE  110



>ref|XP_001701670.1| AAA-ATPase of VPS4/SKD1 family [Chlamydomonas reinhardtii]
 gb|EDP06645.1| AAA-ATPase of VPS4/SKD1 family [Chlamydomonas reinhardtii]
Length=436

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 93/138 (67%), Gaps = 7/138 (5%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            +Y  FKE+AIE+ +QAV ED A NY KA  LY+ +LEYFKT+LKYEKN K +EA+  KF 
Sbjct  3    VYIGFKEKAIEFAKQAVTEDEANNYEKALQLYLASLEYFKTYLKYEKNEKCREAVMAKFK  62

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKT-KPKDGEDGED-PEQSKLRAGLNS  621
            EYL RAE ++ V    GT  G   N D+  A+  K  KP   +D ED  E+ KL+AGL  
Sbjct  63   EYLARAEYLKGV---NGTENG--GNNDSGTAAAQKVRKPGQAKDEEDNKEKEKLKAGLTG  117

Query  622  AIVREKPNVKWSDVAGLE  675
            AI+ EKPNVKW DVAGLE
Sbjct  118  AILTEKPNVKWDDVAGLE  135



>ref|XP_002949582.1| hypothetical protein VOLCADRAFT_74263 [Volvox carteri f. nagariensis]
 gb|EFJ49134.1| hypothetical protein VOLCADRAFT_74263 [Volvox carteri f. nagariensis]
Length=435

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 94/137 (69%), Gaps = 6/137 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            +Y  FKE+AIE+ +QAV ED A NY KA  LY+++LEYFKT+LKYEKN K +EA+  KF 
Sbjct  3    VYITFKEKAIEFAKQAVVEDEANNYDKALQLYLSSLEYFKTYLKYEKNEKCREAVMAKFK  62

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGED-PEQSKLRAGLNSA  624
            EYL RAE ++ V    GT  G   +G A  A++   KP   +D ED  E+ KL+AGL  A
Sbjct  63   EYLARAEYLKGV---NGTDTGGNDSGTA--AAQKVRKPGQNKDEEDNKEKEKLKAGLTGA  117

Query  625  IVREKPNVKWSDVAGLE  675
            I+ EKPNV+W DVAGLE
Sbjct  118  ILTEKPNVRWDDVAGLE  134



>dbj|BAD28045.1| putative SKD1 protein [Oryza sativa Japonica Group]
 gb|EAZ21821.1| hypothetical protein OsJ_05463 [Oryza sativa Japonica Group]
Length=433

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 93/136 (68%), Gaps = 5/136 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            M    KEQ I  VR+AV+ED+AGN+A+A PLY++AL+Y   HLKYE+NP++++AIT K  
Sbjct  1    MDGGMKEQGILLVRKAVEEDDAGNHARALPLYVHALDYLAAHLKYERNPRVRDAITAKLA  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
             Y+ RAEEIR  L       G  +   AA A   K K   GED  D  ++KLRAGL+SAI
Sbjct  61   GYIARAEEIRDALLPAA---GDDATPPAAAAEEGKAKCGGGEDESD--RAKLRAGLHSAI  115

Query  628  VREKPNVKWSDVAGLE  675
            V EKPNV+WSDV+GL+
Sbjct  116  VSEKPNVRWSDVSGLD  131



>emb|CBI35240.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 75/104 (72%), Gaps = 21/104 (20%)
 Frame = +1

Query  364  MNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRAEEIRAVLDEGGTGPGPASNGDAAVAS  543
            MNALEYFKTHLKYEKNPKIKEAIT KFTEYLRRAEEIRAVLD+GGT  G   +       
Sbjct  1    MNALEYFKTHLKYEKNPKIKEAITQKFTEYLRRAEEIRAVLDDGGTDGGDGDDA------  54

Query  544  RSKTKPKDGEDGEDPEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
                           EQ+KLRAGLNSAI+ EKPNV+WSDVAGLE
Sbjct  55   ---------------EQAKLRAGLNSAIITEKPNVQWSDVAGLE  83



>emb|CCF53363.1| probable VPS4-vacuolar sorting protein [Ustilago hordei]
Length=474

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S+F  +AIE V++A+ ED   NY +A+ LY N+L+YF   +KYEKN K+K+ I  KFTEY
Sbjct  4    SDFLNKAIEIVQKAIDEDVKQNYQEAYKLYQNSLDYFMMAMKYEKNDKLKDLIRKKFTEY  63

Query  454  LRRAEEIRAVL---DEGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAGLNS  621
            L RAE+++  L   +E  +     +NG       S    KDGED + DPE  KLRAGL+S
Sbjct  64   LDRAEKLKEHLAKSNEDRSRAAVGANGAEKGVGGSTGGKKDGEDDDIDPETKKLRAGLSS  123

Query  622  AIVREKPNVKWSDVAGL  672
            A++ E PNV+W DVAGL
Sbjct  124  AVLSETPNVRWDDVAGL  140



>emb|CDI56953.1| probable VPS4-vacuolar sorting protein [Melanopsichium pennsylvanicum 
4]
Length=475

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 88/137 (64%), Gaps = 4/137 (3%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S+F  +AIE V++A+ ED   NY +A+ LY N+L+YF   +KYEKN K+K+ I  KFTEY
Sbjct  4    SDFLNKAIEIVQKAIDEDVKQNYQEAYKLYQNSLDYFMMAMKYEKNDKLKDLIRKKFTEY  63

Query  454  LRRAEEIRAVL---DEGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAGLNS  621
            L RAE+++  L    E  +     +NG       S    KDGED + DPE  KLRAGL+S
Sbjct  64   LDRAEKLKEHLAKSSEDRSRAAVGANGAEKGVGGSTGGRKDGEDDDVDPETRKLRAGLSS  123

Query  622  AIVREKPNVKWSDVAGL  672
            A++ E PNV+W DVAGL
Sbjct  124  AVLSETPNVRWDDVAGL  140



>gb|KIM31071.1| hypothetical protein M408DRAFT_322164 [Serendipita vermifera 
MAFF 305830]
Length=438

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 85/134 (63%), Gaps = 7/134 (5%)
 Frame = +1

Query  277  NFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYL  456
            NF ++AIE V++A+ ED   NYA+A+  Y NAL+YF   LKYEKN K++  I  K  EYL
Sbjct  5    NFLDRAIEIVQKAIDEDVNQNYAEAYKQYQNALDYFMMALKYEKNDKLRVLIRKKVDEYL  64

Query  457  RRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDG-EDGEDPEQSKLRAGLNSAIVR  633
             RAE+++A + +        S     + S  K     G EDG+DPE  KLRAGL+SAI+ 
Sbjct  65   DRAEKLKAHIAKA------ESKTPGVIGSNGKVSASGGEEDGDDPEVKKLRAGLSSAIIS  118

Query  634  EKPNVKWSDVAGLE  675
            E PNVKW DVAGLE
Sbjct  119  ETPNVKWDDVAGLE  132



>ref|XP_007510347.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18692.1| predicted protein [Bathycoccus prasinos]
Length=451

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 88/146 (60%), Gaps = 19/146 (13%)
 Frame = +1

Query  280  FKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLR  459
             +++AI  V++AV+ED AGNY  AF LYM +L++FK +LKYEKNP++++ I  KF EYL 
Sbjct  7    IRDKAISIVKEAVKEDKAGNYETAFTLYMQSLDHFKCYLKYEKNPRMQDTIKGKFNEYLE  66

Query  460  RAEEIRAVLDE------GGTGPG--------PASNGDAAVASRSKTKPKDGEDGEDPEQS  597
            RAEE+  ++ E        T  G        P SNG A   +   T  +D       EQ 
Sbjct  67   RAEELHKIVAEQKNATDQATESGNPEAMKARPGSNGAATTNAGGSTSKEDS-----AEQL  121

Query  598  KLRAGLNSAIVREKPNVKWSDVAGLE  675
            K++  L  AIV EKPNVKWSDVAGL+
Sbjct  122  KMKQQLGGAIVTEKPNVKWSDVAGLD  147



>ref|XP_007860430.1| AAA-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ61144.1| AAA-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=429

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +1

Query  286  EQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRA  465
            ++AIE V++A++ED   NYA+A+  Y NAL+YF   LKYEKNP  K  I  K  EYL RA
Sbjct  6    DRAIEIVQRAIEEDTRQNYAEAYKQYNNALDYFMLALKYEKNPSSKTLIRTKCEEYLARA  65

Query  466  EEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVREKPN  645
            E ++  L+E  T     + G   V S  K K  D EDG DPE  KLRAGL SAI+ EKPN
Sbjct  66   ETLKKHLEEVETKKAKRAVGANGV-SNGKKKEGDEEDG-DPEVKKLRAGLTSAILMEKPN  123

Query  646  VKWSDVAGLE  675
            VKW DVAGLE
Sbjct  124  VKWDDVAGLE  133



>ref|XP_001419906.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98199.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=442

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 88/134 (66%), Gaps = 5/134 (4%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++ +++AI +VR+AV+ED AG Y  AF LY+ ALE+F  +LKYEKNP++ E +  K+ EY
Sbjct  5    ASIRDKAIAFVREAVREDQAGAYEAAFKLYLVALEHFGVYLKYEKNPRMAETVRGKYKEY  64

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVR  633
            L RAEE++ ++ +G       S   A+ A R K+   DG    D E +K++  L  AIV 
Sbjct  65   LVRAEELQKIV-QGRKNAKEVSGTGASGAQREKSGDADG----DAELAKMKGQLGGAIVT  119

Query  634  EKPNVKWSDVAGLE  675
            EKPNVKW DVAGL+
Sbjct  120  EKPNVKWDDVAGLQ  133



>emb|CEG65527.1| Putative Suppressor protein of bem1/bed5 double mutants [Rhizopus 
microsporus]
Length=332

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 19/144 (13%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S+F  +AIE V++A +ED+ GNY +A+  Y NALEYF T +KYEKN ++KE I  +F EY
Sbjct  4    SDFLSKAIEIVKKATEEDHKGNYKEAYTHYQNALEYFMTAIKYEKNDRLKEPIRKRFIEY  63

Query  454  LRRAEEIRAVLDE---------GGTGPGPASNGDAAVASRSKTKPKDGE-DGEDPEQSKL  603
            L RAE ++  L+          G  G     NG A         P + E D +DP+  K+
Sbjct  64   LDRAEMLKEFLNNQEKKQKEPVGANGTPKKKNGAA---------PSNNETDEDDPDLKKM  114

Query  604  RAGLNSAIVREKPNVKWSDVAGLE  675
            +A L SAI+ EKPNV+W DVAGLE
Sbjct  115  KASLTSAILTEKPNVQWDDVAGLE  138



>ref|XP_011387652.1| putative AAA family ATPase VPS4 [Ustilago maydis 521]
 gb|KIS70498.1| putative AAA family ATPase VPS4 [Ustilago maydis 521]
Length=474

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 87/137 (64%), Gaps = 4/137 (3%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S+F  +AIE V++A+ ED   NY +A+ LY N+L+YF   +KYEKN K+K+ I  KFTEY
Sbjct  4    SDFLNKAIEIVQKAIDEDVKQNYQEAYKLYQNSLDYFMMAMKYEKNDKLKDLIRKKFTEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNG----DAAVASRSKTKPKDGEDGEDPEQSKLRAGLNS  621
            L RAE+++  L +       A+ G    +  V   +  K +  +D  DPE  KLRAGL+S
Sbjct  64   LDRAEKLKEHLAKSSEDRNRAAVGANGAEKGVGGSTGGKKEGDDDDVDPETKKLRAGLSS  123

Query  622  AIVREKPNVKWSDVAGL  672
            A++ E PNV+W DVAGL
Sbjct  124  AVLSETPNVRWDDVAGL  140



>emb|CCA70633.1| probable VPS4-vacuolar sorting protein [Piriformospora indica 
DSM 11827]
Length=484

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 87/133 (65%), Gaps = 4/133 (3%)
 Frame = +1

Query  277  NFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYL  456
            NF ++AIE V++A+ ED   NYA+A+  Y NAL+YF   LKYEKN K++  I  K  EYL
Sbjct  50   NFLDRAIEIVQKAIDEDVNQNYAEAYKQYQNALDYFMMALKYEKNDKLRVLIRKKVDEYL  109

Query  457  RRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVRE  636
             RAE+++A + +  T    A+ G    +S   T     +DG+DPE  KLRAGL+SAIV E
Sbjct  110  DRAEKLKAHIAKAETAKTAAAIG----SSGKTTSGGKEDDGDDPEVKKLRAGLSSAIVHE  165

Query  637  KPNVKWSDVAGLE  675
             PNVKW DVAGLE
Sbjct  166  TPNVKWDDVAGLE  178



>ref|XP_003195584.1| ATPase [Cryptococcus gattii WM276]
 gb|ADV23797.1| ATPase, putative [Cryptococcus gattii WM276]
 gb|KIR45354.1| vacuolar protein-sorting-associated protein 4 [Cryptococcus gattii 
CA1280]
 gb|KIR56769.1| vacuolar protein-sorting-associated protein 4 [Cryptococcus gattii 
Ru294]
 gb|KIR59357.1| vacuolar protein-sorting-associated protein 4 [Cryptococcus gattii 
CA1873]
 gb|KIR81508.1| vacuolar protein-sorting-associated protein 4 [Cryptococcus gattii 
EJB2]
 gb|KIY31794.1| vacuolar protein-sorting-associated protein 4 [Cryptococcus gattii 
E566]
 gb|KJE02249.1| vacuolar protein-sorting-associated protein 4 [Cryptococcus gattii 
NT-10]
Length=439

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            SNF ++AI  V++A+ ED   NYA+A+  Y +AL+YF   +KYEKN K+KE I  KFTEY
Sbjct  4    SNFLDKAIALVQKAIDEDVKQNYAEAYKQYQDALDYFMMAMKYEKNDKLKELIRKKFTEY  63

Query  454  LRRAEEIRAVL--DEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            L RAE+++  +   E        S   A+  S +      G+DG+DPE  K+R GL  AI
Sbjct  64   LDRAEKLKEHIAKSEEKRSKAKVSATGASAGSTAGGPDVKGDDGDDPEIKKMRQGLQGAI  123

Query  628  VREKPNVKWSDVAGL  672
            + E PNVKW DVAGL
Sbjct  124  LSESPNVKWEDVAGL  138



>ref|XP_005847253.1| hypothetical protein CHLNCDRAFT_134244 [Chlorella variabilis]
 gb|EFN55151.1| hypothetical protein CHLNCDRAFT_134244 [Chlorella variabilis]
Length=428

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 87/135 (64%), Gaps = 7/135 (5%)
 Frame = +1

Query  286  EQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRA  465
            ++ IE  ++AV+EDN  N+A A  LY  ALEYF THLKY+KNPK +E I++KF EYL RA
Sbjct  2    QKGIELAKEAVEEDNKQNWAAALELYKRALEYFSTHLKYDKNPKSREMISNKFKEYLDRA  61

Query  466  EEIRAVLDEGGTGPGPASNGDAAVASRSKTKP-----KDGEDGEDPEQSKLRAGLNSAIV  630
            E I+ +LD  G  P   ++G    A+    +P       G DG+  E  K+++ L +AI+
Sbjct  62   EYIKGILD--GRQPAEEASGQNGAAAAKGPRPGGGGGGGGGDGKQDELDKMKSSLGNAIL  119

Query  631  REKPNVKWSDVAGLE  675
             EKPNVKW DVAGLE
Sbjct  120  EEKPNVKWDDVAGLE  134



>emb|CEJ02927.1| Putative Vacuolar protein sorting-associated protein 4 [Rhizopus 
microsporus]
 emb|CEI87686.1| Putative Vacuolar protein sorting-associated protein 4 [Rhizopus 
microsporus]
Length=332

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 19/144 (13%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S+F  +AIE V++A +ED+ GNY +A+  Y NALEYF T +KYEKN ++KE I  +F EY
Sbjct  4    SDFLSKAIEIVKKATEEDHKGNYKEAYTHYQNALEYFMTAIKYEKNDRLKEPIRKRFIEY  63

Query  454  LRRAEEIRAVLDE---------GGTGPGPASNGDAAVASRSKTKPKDGE-DGEDPEQSKL  603
            L RAE ++  L+          G  G     NG A         P + E D +DP+  K+
Sbjct  64   LDRAEMLKEFLNNQEKKQKEPVGANGTPKKKNGAA---------PSNNETDEDDPDLKKM  114

Query  604  RAGLNSAIVREKPNVKWSDVAGLE  675
            +A L SAI+ EKPNV+W DVAGLE
Sbjct  115  KASLASAILTEKPNVQWDDVAGLE  138



>emb|CEG65526.1| Putative Vacuolar protein sorting-associated protein 4 [Rhizopus 
microsporus]
Length=440

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 19/144 (13%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S+F  +AIE V++A +ED+ GNY +A+  Y NALEYF T +KYEKN ++KE I  +F EY
Sbjct  4    SDFLSKAIEIVKKATEEDHKGNYKEAYTHYQNALEYFMTAIKYEKNDRLKEPIRKRFIEY  63

Query  454  LRRAEEIRAVLDE---------GGTGPGPASNGDAAVASRSKTKPKDGE-DGEDPEQSKL  603
            L RAE ++  L+          G  G     NG A         P + E D +DP+  K+
Sbjct  64   LDRAEMLKEFLNNQEKKQKEPVGANGTPKKKNGAA---------PSNNETDEDDPDLKKM  114

Query  604  RAGLNSAIVREKPNVKWSDVAGLE  675
            +A L SAI+ EKPNV+W DVAGLE
Sbjct  115  KASLTSAILTEKPNVQWDDVAGLE  138



>ref|XP_008875388.1| hypothetical protein H310_10718 [Aphanomyces invadans]
 gb|ETV96077.1| hypothetical protein H310_10718 [Aphanomyces invadans]
Length=460

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 83/137 (61%), Gaps = 8/137 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            M + F  QAI+ V QA+QED   NY  AF LY  +LE+F   +KYEKNP  KE I  +  
Sbjct  1    MDNKFIPQAIQLVTQAIQEDTNKNYEAAFKLYKQSLEHFMIGVKYEKNPTSKEIIMKRVE  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAGLNSA  624
             Y+ RAE++R +L EG   P   + G  A       K KD ED + D E++KLR  L SA
Sbjct  61   GYMTRAEQLREML-EGQAKPKVVAAGGTA------EKEKDDEDNDGDAEKNKLRGALASA  113

Query  625  IVREKPNVKWSDVAGLE  675
            +V EKPNVKW DVAGLE
Sbjct  114  VVSEKPNVKWDDVAGLE  130



>gb|KIM39058.1| hypothetical protein M413DRAFT_447414 [Hebeloma cylindrosporum 
h7]
Length=437

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 81/135 (60%), Gaps = 1/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            SN  ++AIE V++A+ ED   NYA+A+  Y NAL+YF   LKYEKN K K  I  K  EY
Sbjct  2    SNHLDRAIELVQKAIDEDVKHNYAEAYKHYQNALDYFMLALKYEKNEKSKTLIKSKILEY  61

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDG-EDGEDPEQSKLRAGLNSAIV  630
            L RAE ++  L     G        +  A+    K KDG ED +DPE  KLRAGL  AI+
Sbjct  62   LGRAETLKQHLTTEKRGKSAIGVNGSGGAAGPTGKSKDGEEDDQDPETKKLRAGLAGAIL  121

Query  631  REKPNVKWSDVAGLE  675
             E PNVKW DVAGLE
Sbjct  122  TETPNVKWDDVAGLE  136



>ref|XP_009523330.1| hypothetical protein PHYSODRAFT_491946 [Phytophthora sojae]
 gb|EGZ20613.1| hypothetical protein PHYSODRAFT_491946 [Phytophthora sojae]
Length=460

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 83/136 (61%), Gaps = 6/136 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            M + F  QAIE V QA+ EDN+ NY +AF LY  ALE+F   +KYEKNP  KE I  +  
Sbjct  1    MENKFIPQAIEIVTQAINEDNSKNYQEAFRLYKKALEHFMVGVKYEKNPTSKEIIMKRVE  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
             Y+ RAE++R +L E    P P     AA     K + K+ +D  D E +KLR  L SA+
Sbjct  61   GYMTRAEQLRGML-EKENAPKPV----AAAVDMDKGE-KEDDDETDAETAKLRGSLASAV  114

Query  628  VREKPNVKWSDVAGLE  675
            V EKPNVKW DVAGL+
Sbjct  115  VSEKPNVKWDDVAGLD  130



>gb|ESW97071.1| Vacuolar protein sorting-associated protein 4 [Ogataea parapolymorpha 
DL-1]
Length=439

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 87/139 (63%), Gaps = 10/139 (7%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S F ++ ++ V++A++ D+A  Y +A+ LY N L+Y    LKYEKNPK KE I  KFTEY
Sbjct  5    SEFLDKGVDLVKKAIEADSASKYDEAYRLYYNGLDYLMLALKYEKNPKSKETIRSKFTEY  64

Query  454  LRRAEEIRAVLD----EGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAGLN  618
            L RAE+++  LD    +  TG   A++G     S    K   GED + D +  KLR  L 
Sbjct  65   LSRAEQLKEYLDKKQQQDQTGEASATSG-----SVKAKKTSGGEDDDNDSDTKKLRGALA  119

Query  619  SAIVREKPNVKWSDVAGLE  675
            S+I+ E+PNV+WSD+AGLE
Sbjct  120  SSILSERPNVQWSDIAGLE  138



>ref|XP_002151722.1| vacuolar sorting ATPase Vps4, putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA20722.1| vacuolar sorting ATPase Vps4, putative [Talaromyces marneffei 
ATCC 18224]
 gb|KFX43406.1| Vacuolar protein sorting-associated protein 4 [Talaromyces marneffei 
PM1]
Length=433

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+ V++A++ DNAG Y KA+  Y  ALE F   LK+EKNPK KE I  K  EY
Sbjct  4    TDFLGRAIDTVKKAIEHDNAGEYEKAYQGYYAALELFMLALKWEKNPKSKEMIRAKTGEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVR  633
            + RAE+++  L        P++ G     +    K K+ EDGED E  KLR  L  AI+ 
Sbjct  64   MDRAEKLKNHLANADNKKKPSAVGANGKVANGSGKGKEDEDGEDAEAKKLRGALQGAILS  123

Query  634  EKPNVKWSDVAGLE  675
            EKPNV+W DVAGLE
Sbjct  124  EKPNVRWEDVAGLE  137



>ref|XP_008031909.1| AAA-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW65200.1| AAA-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=432

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 84/133 (63%), Gaps = 3/133 (2%)
 Frame = +1

Query  286  EQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRA  465
            ++AIE V++A++ED A NY +A+ LY NAL+YF   LKYEKN K K  I  KFTEYL RA
Sbjct  6    DRAIEIVQRAIEEDKANNYDEAYKLYSNALDYFMLALKYEKNEKSKTLIKGKFTEYLNRA  65

Query  466  EEIRAVL---DEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVRE  636
            E ++  L   D+        +NG A        K KD +D  DPE  KLRAGL  AIV E
Sbjct  66   ETLKEYLSNKDDKRAKKAVGANGLANGGPGGGGKKKDDDDETDPEVKKLRAGLLGAIVSE  125

Query  637  KPNVKWSDVAGLE  675
            KPNVKW DVAGLE
Sbjct  126  KPNVKWEDVAGLE  138



>ref|XP_003064827.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51161.1| predicted protein [Micromonas pusilla CCMP1545]
Length=448

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 85/138 (62%), Gaps = 8/138 (6%)
 Frame = +1

Query  280  FKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLR  459
             +E+AI  V++AV+ D A  YA AF LY +AL++F  +LKYEKNP +++ I  KFTEYL 
Sbjct  10   IREKAIALVKEAVERDKASEYAAAFKLYTSALDHFTVYLKYEKNPMMQQTIKTKFTEYLE  69

Query  460  RAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD-------GEDGEDPEQSKLRAGLN  618
            RAEE++ ++D         +N +A+     K +PKD           ED E SK+R  L 
Sbjct  70   RAEELKKLMDADDAAADGRTNPNAS-PELIKARPKDTKKGGVGKGGAEDDEMSKMRGALG  128

Query  619  SAIVREKPNVKWSDVAGL  672
             AIV EKP+VKW DVAGL
Sbjct  129  GAIVTEKPDVKWDDVAGL  146



>ref|XP_002480681.1| vacuolar sorting ATPase Vps4, putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED20247.1| vacuolar sorting ATPase Vps4, putative [Talaromyces stipitatus 
ATCC 10500]
Length=433

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+ V++A++ DNAG Y KA+  Y  ALE F   LK+EKNPK KE I  K  EY
Sbjct  4    TDFLGRAIDTVKKAIEHDNAGEYEKAYQGYYAALELFMLALKWEKNPKSKEMIRAKTGEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVR  633
            + RAE+++  L        P++ G     +    K K+ EDGED E  KLR  L  AI+ 
Sbjct  64   MDRAEKLKNHLANADNKKKPSAVGANGKVANGGGKGKEDEDGEDAEAKKLRGALQGAILS  123

Query  634  EKPNVKWSDVAGLE  675
            EKPNV+W DVAGLE
Sbjct  124  EKPNVRWEDVAGLE  137



>gb|KIL62198.1| hypothetical protein M378DRAFT_187396 [Amanita muscaria Koide 
BX008]
Length=432

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 83/133 (62%), Gaps = 3/133 (2%)
 Frame = +1

Query  286  EQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRA  465
            ++AIE V++A++ED   NYA+A+ LY N+L+YF   +KYEKN K K+ I  K  EYL RA
Sbjct  8    DKAIEIVQRAIEEDTNHNYAEAYKLYQNSLDYFMLAMKYEKNEKSKQLIRSKTEEYLNRA  67

Query  466  EEIRAVLD--EGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAGLNSAIVRE  636
            E+++  L   E   G                 + KDGED E DPE  KLR+GL+SAI+ E
Sbjct  68   EKLKDHLTSHEEKRGRAAVGLNGTGGGIGGGGRKKDGEDDEVDPEVKKLRSGLSSAILSE  127

Query  637  KPNVKWSDVAGLE  675
            KPNV W DVAGLE
Sbjct  128  KPNVSWDDVAGLE  140



>gb|KGO70439.1| ATPase, AAA-type, core [Penicillium italicum]
Length=433

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AIE V++A++ DN G Y KA+ +Y +ALE F   LK+EKNPK KE I  K  EY
Sbjct  4    TDFLGRAIETVKKAIENDNDGEYEKAYQMYYSALELFMLALKWEKNPKSKEMIRSKAGEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPA-SNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIV  630
            + RAE+++  L E    P    +NG  A  S  K   +D ++GED +  KLR+ L  AI+
Sbjct  64   MDRAEKLKNHLAEDRKKPSAVGANGKVAQGS-GKGGKEDDDNGEDADAKKLRSALQGAIL  122

Query  631  REKPNVKWSDVAGLE  675
             EKPNVKW DVAGLE
Sbjct  123  SEKPNVKWEDVAGLE  137



>gb|KIK04193.1| hypothetical protein K443DRAFT_676154 [Laccaria amethystina LaAM-08-1]
Length=438

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 85/133 (64%), Gaps = 3/133 (2%)
 Frame = +1

Query  286  EQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRA  465
            ++AIE V++A+ ED   NY +A+ LY N+L+YF   LKYEKN K K+ I  K  EYL RA
Sbjct  8    DRAIEIVQRAIDEDVKQNYPEAYKLYQNSLDYFMLALKYEKNEKSKQLIKTKIHEYLGRA  67

Query  466  EEIRAVLDEGGTGPGPASNG--DAAVASRSKTKPKDGE-DGEDPEQSKLRAGLNSAIVRE  636
            E ++  L       G ++ G   +  A+    K KDGE D +DPE  KLRAGL SAI+ E
Sbjct  68   ETLKGHLMSSEEKRGKSAIGLNGSGGATGPGGKKKDGEDDDQDPETKKLRAGLASAILSE  127

Query  637  KPNVKWSDVAGLE  675
            KPN+KW DVAGLE
Sbjct  128  KPNIKWDDVAGLE  140



>emb|CEF99291.1| MIT [Ostreococcus tauri]
Length=442

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 85/134 (63%), Gaps = 5/134 (4%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S  +++AI YV++AV+ED  G Y  AF LY+ ALE+F  +LKYEKN ++ E +  K+ EY
Sbjct  5    SAIRDKAIAYVKEAVREDQGGEYEAAFKLYLTALEHFGVYLKYEKNARMAETVRGKYKEY  64

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVR  633
            L RAEE++ ++   G   G   +G +A  ++   KPK      D E +K++  L  AIV 
Sbjct  65   LERAEELQKIVR--GQKEGREVSGTSASGAQ---KPKGAASDADGELAKMKGQLGGAIVT  119

Query  634  EKPNVKWSDVAGLE  675
            EKPNVKW DVAGL+
Sbjct  120  EKPNVKWDDVAGLQ  133



>ref|XP_006379308.1| hypothetical protein POPTR_0009s14640g, partial [Populus trichocarpa]
 gb|ERP57105.1| hypothetical protein POPTR_0009s14640g, partial [Populus trichocarpa]
Length=75

 Score =   105 bits (261),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 62/90 (69%), Gaps = 24/90 (27%)
 Frame = +1

Query  406  KNPKIKEAITHKFTEYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGED  585
            KNPKI+EAIT KFTEYLRRAEEI  VLDEG  GPGP SNGDAA                 
Sbjct  1    KNPKIREAITKKFTEYLRRAEEIGTVLDEG--GPGPNSNGDAA-----------------  41

Query  586  PEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
                 LRAGLNSAIVREKP+VKWSDVAGLE
Sbjct  42   -----LRAGLNSAIVREKPDVKWSDVAGLE  66



>gb|AAR28448.1| Vps4p [Ogataea angusta]
Length=439

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 86/139 (62%), Gaps = 10/139 (7%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S F ++ ++ V++A++ D+   Y +A+ LY N L+Y    LKYEKNPK KE I  KFTEY
Sbjct  5    SEFLDKGVDLVKKAIEADSTSKYDEAYRLYYNGLDYLMLALKYEKNPKSKETIRSKFTEY  64

Query  454  LRRAEEIRAVLD----EGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAGLN  618
            L RAE+++  LD    +  TG   A++G     S    K   GED + D +  KLR  L 
Sbjct  65   LSRAEQLKEYLDKKQQQDQTGEASATSG-----SVKAKKTSGGEDDDNDSDTKKLRGALA  119

Query  619  SAIVREKPNVKWSDVAGLE  675
            S+I+ E+PNV+WSD+AGLE
Sbjct  120  SSILSERPNVQWSDIAGLE  138



>gb|KIY43103.1| AAA-domain-containing protein [Fistulina hepatica ATCC 64428]
Length=439

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = +1

Query  286  EQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRA  465
            ++AIE V++A+  D    Y +A+ LY N+L+YF   LKYEKNPK KE I  K  EYL RA
Sbjct  8    DRAIEMVQRAIDADTKQQYGEAYKLYQNSLDYFMLALKYEKNPKSKELIRTKVVEYLSRA  67

Query  466  EEIRAVL--DEGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAGLNSAIVRE  636
            E ++A L  ++G      A+       +  K    DG+D + DPE  KLRAG+  AI+ E
Sbjct  68   ETLKAHLTKEQGAKAAVAANGSSGGTGATGKKASSDGDDPDMDPEMKKLRAGITGAILTE  127

Query  637  KPNVKWSDVAGLE  675
             PNV+W DVAGLE
Sbjct  128  TPNVRWDDVAGLE  140



>gb|KDQ52995.1| hypothetical protein JAAARDRAFT_39707 [Jaapia argillacea MUCL 
33604]
Length=434

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 86/140 (61%), Gaps = 9/140 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            M +N  ++AI+ V++A+ +D  GNY +A+  Y NAL+YF   LKYEKN K K+ I  K  
Sbjct  1    MSTNSLDRAIDLVQRAIDDDIKGNYEEAYKQYQNALDYFMLALKYEKNEKSKQLIKAKID  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGED----GEDPEQSKLRAGL  615
            EYL RAE ++  + +        +    AV +    K KDGE+     +DPE  KLRAGL
Sbjct  61   EYLTRAETLKQFIMK-----KTETKAKRAVGANGVVKKKDGEEDSGGDQDPEVKKLRAGL  115

Query  616  NSAIVREKPNVKWSDVAGLE  675
             SAI+ +KPNV+W DVAGLE
Sbjct  116  TSAILMDKPNVRWDDVAGLE  135



>emb|CDO71750.1| hypothetical protein BN946_scf184920.g34 [Trametes cinnabarina]
Length=417

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 85/133 (64%), Gaps = 3/133 (2%)
 Frame = +1

Query  286  EQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRA  465
            ++AIE V++A++ED A NY +A+ LY NAL+YF   LKYEKN K K  I  KFTEYL RA
Sbjct  6    DRAIEIVQRAIEEDKANNYEEAYKLYSNALDYFMLALKYEKNEKSKTLIKQKFTEYLHRA  65

Query  466  EEIRAVL---DEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVRE  636
            E ++  L   ++        +NG A   S    K KD +D  DPE  KLRAGL  AIV E
Sbjct  66   ETLKEYLTSKEDKRAKKAIGANGMANGGSAGSGKKKDDDDDTDPEVKKLRAGLLGAIVTE  125

Query  637  KPNVKWSDVAGLE  675
            KPNVKW DVAGLE
Sbjct  126  KPNVKWEDVAGLE  138



>ref|XP_012051846.1| vacuolar protein-sorting-associated protein 4 [Cryptococcus neoformans 
var. grubii H99]
 gb|AFR97229.1| vacuolar protein-sorting-associated protein 4 [Cryptococcus neoformans 
var. grubii H99]
Length=439

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 83/135 (61%), Gaps = 2/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            SNF ++AI  V++A+ ED   NYA+A+  Y +AL+YF   +KYEKN K+KE I  KFTEY
Sbjct  4    SNFLDKAIALVQKAIDEDVKQNYAEAYKQYQDALDYFMMAMKYEKNDKLKELIRKKFTEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD--GEDGEDPEQSKLRAGLNSAI  627
            L RAE+++  + +       A       A  S     D  G+DG+DPE  K+R GL  AI
Sbjct  64   LDRAEKLKEHIAKSEEKRSKAKVSATGAAGGSTAGGPDVKGDDGDDPEIKKMRQGLQGAI  123

Query  628  VREKPNVKWSDVAGL  672
            + E PNVKW DVAGL
Sbjct  124  LSESPNVKWEDVAGL  138



>ref|XP_009269071.1| Vacuolar protein sorting-associated protein 4 [Wallemia ichthyophaga 
EXF-994]
 gb|EOR00007.1| Vacuolar protein sorting-associated protein 4 [Wallemia ichthyophaga 
EXF-994]
Length=1399

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 86/137 (63%), Gaps = 7/137 (5%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            SNF ++AI+ V  A++ED   NYA+A  LY+NAL+YF   LKYEKNP +K  I  K  +Y
Sbjct  5    SNFLDKAIDLVSNAIEEDVKTNYAEALRLYLNALDYFMMALKYEKNPSLKTMIRGKLVDY  64

Query  454  LRRAEEIR---AVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSA  624
            + RAE+++   A  DE    P  ++N     AS +  +P    + +D E  KLRAGL+S+
Sbjct  65   ITRAEKLKQHIAKSDENKKQPLGSTN----TASANSGQPNKEAENDDAETKKLRAGLSSS  120

Query  625  IVREKPNVKWSDVAGLE  675
            I+ E PNV W DVAGLE
Sbjct  121  ILHETPNVSWDDVAGLE  137



>gb|KEQ97233.1| hypothetical protein AUEXF2481DRAFT_37765 [Aureobasidium subglaciale 
EXF-2481]
Length=434

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 84/135 (62%), Gaps = 1/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+ V++A+++D AG Y KA+  Y  ALE F   LK+EKN K KE I  K  EY
Sbjct  4    TDFLGRAIDVVKKAIEQDTAGEYEKAYQQYYAALELFMLALKWEKNAKSKEMIRAKAAEY  63

Query  454  LRRAEEIRAVLDEGGTG-PGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIV  630
            + RAE+++  L E  T    P++ G    AS    K KD +D +DPE  KLR  L  AI+
Sbjct  64   MERAEKLKNHLAEQDTNRKKPSAMGANGKASNGAAKGKDDDDEQDPESKKLRGALAGAIL  123

Query  631  REKPNVKWSDVAGLE  675
             +KPN+KW DVAGLE
Sbjct  124  TDKPNIKWEDVAGLE  138



>gb|KGO37391.1| ATPase, AAA-type, core [Penicillium expansum]
 gb|KGO42165.1| ATPase, AAA-type, core [Penicillium expansum]
 gb|KGO56207.1| ATPase, AAA-type, core [Penicillium expansum]
Length=433

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+ V++A++ DN G Y KA+ +Y +ALE F   LK+EKNPK KE I  K  EY
Sbjct  4    TDFLGRAIDTVKKAIENDNDGEYEKAYQMYYSALELFMLALKWEKNPKSKEMIRSKAGEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPA-SNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIV  630
            + RAE+++  L E    P    +NG  A  S  K   +D ++GED E  KLR+ L  AI+
Sbjct  64   MDRAEKLKNHLAEDRKKPSAVGANGKVAQGS-GKGGKEDDDNGEDAEAKKLRSALQGAIL  122

Query  631  REKPNVKWSDVAGLE  675
             +KPNVKW DVAGLE
Sbjct  123  SDKPNVKWEDVAGLE  137



>gb|KKA21983.1| Microtubule-severing ATPase [Rasamsonia emersonii CBS 393.64]
Length=433

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+ V++A+  DNAG Y KA+ LY +ALE F   LK+EKNPK KE I  K  EY
Sbjct  4    TDFLGRAIDTVKKAIDHDNAGEYEKAYQLYYSALELFMLALKWEKNPKSKEMIRAKTGEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVR  633
            + RAE+++  L        P++       ++   K K+ +D ED E  KLR  L  AI+ 
Sbjct  64   MDRAEKLKNHLANSENRKKPSAVSANGKVAQGSGKAKEDDDSEDAEAKKLRGALQGAILS  123

Query  634  EKPNVKWSDVAGLE  675
            EKPNV+W DVAGLE
Sbjct  124  EKPNVRWEDVAGLE  137



>emb|CDM34041.1| Vacuolar protein sorting-associated protein 4 [Penicillium roqueforti 
FM164]
Length=433

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+ V++A++ DN G Y KA+ +Y +ALE F   LK+EKNPK KE I  K  EY
Sbjct  4    TDFLGRAIDTVKKAIENDNDGEYEKAYQMYYSALELFMLALKWEKNPKSKEMIRSKAGEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPA-SNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIV  630
            + RAE+++  L E    P    +NG  A  S  K   +D ++GED +  KLR+ L  AI+
Sbjct  64   MDRAEKLKNHLAEDRKKPSAVGANGKVAQGS-GKGGKEDDDNGEDADAKKLRSALQGAIL  122

Query  631  REKPNVKWSDVAGLE  675
             EKPNVKW DVAGLE
Sbjct  123  SEKPNVKWEDVAGLE  137



>ref|XP_572783.1| ATPase [Cryptococcus neoformans var. neoformans JEC21]
 ref|XP_773997.1| hypothetical protein CNBH0440 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL19350.1| hypothetical protein CNBH0440 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW45476.1| ATPase, putative [Cryptococcus neoformans var. neoformans JEC21]
Length=439

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 83/135 (61%), Gaps = 2/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            SNF ++AI  V++A+ ED   NYA+A+  Y +AL+YF   +KYEKN K+KE I  KFTEY
Sbjct  4    SNFLDKAIALVQKAIDEDVKQNYAEAYKQYQDALDYFMMAMKYEKNDKLKELIRKKFTEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD--GEDGEDPEQSKLRAGLNSAI  627
            L RAE+++  + +       A       A  S     D  G+DG+DPE  K+R GL  AI
Sbjct  64   LDRAEKLKEHIAKSEEKRSKAKVSATGAAGGSTAGGPDVKGDDGDDPEIKKMRQGLQGAI  123

Query  628  VREKPNVKWSDVAGL  672
            + E PNVKW DVAGL
Sbjct  124  LSESPNVKWEDVAGL  138



>gb|EUC67165.1| vacuolar sorting ATPase Vps4 [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP55539.1| vacuolar sorting ATPase Vps4 [Rhizoctonia solani 123E]
Length=443

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 86/139 (62%), Gaps = 6/139 (4%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            SNF ++AIE V++A++ED   NY +A+  Y NAL+YF   LKYEKN ++K  I +K  EY
Sbjct  4    SNFLDRAIELVQKAIEEDVNQNYQEAYNQYKNALDYFMMALKYEKNDRLKSLIRNKVDEY  63

Query  454  LRRAEEIR---AVLDEGGTGPGPASNG--DAAVASRSKTKPKDGEDGEDPEQSKLRAGLN  618
            L RAE+++   A  DE        +NG          K    D EDG DP+  KLRAGL+
Sbjct  64   LERAEKLKEHIAKSDEKRARAAVGANGRETGGSGGVGKKGSNDDEDG-DPDVKKLRAGLS  122

Query  619  SAIVREKPNVKWSDVAGLE  675
            SAI+ E PNVKW DVAGLE
Sbjct  123  SAILTETPNVKWDDVAGLE  141



>gb|ERZ98427.1| hypothetical protein GLOINDRAFT_39456 [Rhizophagus irregularis 
DAOM 181602]
Length=426

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 83/140 (59%), Gaps = 6/140 (4%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
             +F  +AIE V++A  EDN GNY +A+  Y NAL+YF   +KYEKN + KE+I  KFTEY
Sbjct  4    CDFLAKAIEIVKKATDEDNKGNYEQAYKYYNNALDYFMHAMKYEKNERTKESIRKKFTEY  63

Query  454  LRRAEEIRAVL---DEGGTGPGPASNGD---AAVASRSKTKPKDGEDGEDPEQSKLRAGL  615
            L RAE+++  L   D+        +NG           K    + +D ED E  KL++ L
Sbjct  64   LNRAEKLKEFLANQDDSRQKKAIGANGSEKGGGGGKGRKKNGSEDDDNEDAETKKLQSAL  123

Query  616  NSAIVREKPNVKWSDVAGLE  675
             SAI+ +KPNV W DVAGLE
Sbjct  124  TSAILSQKPNVHWDDVAGLE  143



>emb|CBQ71883.1| probable VPS4-vacuolar sorting protein [Sporisorium reilianum 
SRZ2]
Length=474

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 4/137 (3%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S+F  +AIE V++A+ ED   NY +A+ LY N+L+YF   +KYEKN K+K+ I  KFTEY
Sbjct  4    SDFLNKAIEIVQKAIDEDVKQNYQEAYKLYQNSLDYFMMAMKYEKNDKLKDLIRKKFTEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNG----DAAVASRSKTKPKDGEDGEDPEQSKLRAGLNS  621
            L RAE+++  L +     G A+ G    +  V   +  K    +D  DPE  KLRAGL+S
Sbjct  64   LDRAEKLKEHLAKSSEDRGRAAVGANGAEKGVGGSTGGKKDGDDDDVDPETKKLRAGLSS  123

Query  622  AIVREKPNVKWSDVAGL  672
            A++ E PNV+W DVAGL
Sbjct  124  AVLSETPNVRWDDVAGL  140



>gb|KIR88114.1| vacuolar protein-sorting-associated protein 4 [Cryptococcus gattii 
IND107]
Length=439

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 85/135 (63%), Gaps = 2/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            SNF ++AI  V++A+ ED   NYA+A+  Y +AL+YF   +KYEKN K+KE I  KFTEY
Sbjct  4    SNFLDKAIALVQKAIDEDVKQNYAEAYKQYQDALDYFMMAMKYEKNDKLKELIRKKFTEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD--GEDGEDPEQSKLRAGLNSAI  627
            L RAE+++  + +       A    A  ++ S     D  G+DG+DPE  K+R GL  AI
Sbjct  64   LDRAEKLKEHIAKSEEKRSKAKVSAAGASAGSTAGGPDVKGDDGDDPEIKKMRQGLQGAI  123

Query  628  VREKPNVKWSDVAGL  672
            + E PNVKW DVAGL
Sbjct  124  LSESPNVKWEDVAGL  138



>gb|EST07633.1| AAA+-type ATPase [Pseudozyma brasiliensis GHG001]
Length=474

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 4/137 (3%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S+F  +AIE V++A+ ED   NY +A+ LY N+L+YF   +KYEKN K+K+ I  KFTEY
Sbjct  4    SDFLNKAIEIVQKAIDEDVKQNYQEAYKLYQNSLDYFMMAMKYEKNDKLKDLIRKKFTEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNG----DAAVASRSKTKPKDGEDGEDPEQSKLRAGLNS  621
            L RAE+++  L +     G A+ G    +  V   +  K    +D  DPE  KLRAGL+S
Sbjct  64   LDRAEKLKEHLAKSSEDRGRAAVGANGAEKGVGGSTGGKKDGDDDDVDPETKKLRAGLSS  123

Query  622  AIVREKPNVKWSDVAGL  672
            A++ E PNV+W DVAGL
Sbjct  124  AVLSETPNVRWDDVAGL  140



>dbj|GAC96299.1| hypothetical protein PHSY_003879 [Pseudozyma hubeiensis SY62]
Length=474

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 4/137 (3%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S+F  +AIE V++A+ ED   NY +A+ LY N+L+YF   +KYEKN K+K+ I  KFTEY
Sbjct  4    SDFLNKAIEIVQKAIDEDVKQNYQEAYKLYQNSLDYFMMAMKYEKNDKLKDLIRKKFTEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNG----DAAVASRSKTKPKDGEDGEDPEQSKLRAGLNS  621
            L RAE+++  L +     G A+ G    +  V   +  K    +D  DPE  KLRAGL+S
Sbjct  64   LDRAEKLKEHLAKSSEDRGRAAVGANGAEKGVGGSTGGKKDGDDDDVDPETKKLRAGLSS  123

Query  622  AIVREKPNVKWSDVAGL  672
            A++ E PNV+W DVAGL
Sbjct  124  AVLSETPNVRWDDVAGL  140



>ref|XP_009830645.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 gb|ETV79709.1| hypothetical protein, variant 2 [Aphanomyces astaci]
Length=384

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 82/137 (60%), Gaps = 8/137 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            M + F  QAI+ V QA+QED   NY  AF LY  +LE+F   +KYEKNP  K  I  +  
Sbjct  14   MDNKFIPQAIQLVTQAIQEDTNKNYEAAFKLYQQSLEHFMIGVKYEKNPTSKAIIMKRVE  73

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAGLNSA  624
             Y+ RAE++R +L EG   P   + G  A       K KD E+ + D E++KLR  L SA
Sbjct  74   GYMTRAEQLRELL-EGQAKPKVVAAGGTA------EKEKDDEETDGDAEKNKLRGALASA  126

Query  625  IVREKPNVKWSDVAGLE  675
            +V EKPNVKW DVAGLE
Sbjct  127  VVSEKPNVKWDDVAGLE  143



>ref|XP_003007130.1| vacuolar protein sorting-associated protein [Verticillium alfalfae 
VaMs.102]
 gb|EEY17160.1| vacuolar protein sorting-associated protein [Verticillium alfalfae 
VaMs.102]
Length=404

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 86/134 (64%), Gaps = 6/134 (4%)
 Frame = +1

Query  277  NFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYL  456
            +F  +A+  V+QA++ DNAG Y KAF LY  +LE F   +KYEKN K K+ I  K  EY+
Sbjct  6    DFLGRAVNTVKQAIEADNAGEYEKAFNLYKQSLEVFVLAIKYEKNAKSKDLIRAKTAEYM  65

Query  457  RRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTK-PKDGEDGEDPEQSKLRAGLNSAIVR  633
             RAE+++  L+E       AS G  AV +  K K  KDGEDGED    KL+  L+ AI++
Sbjct  66   DRAEKLKNHLNEAEA--KKASGGKGAVGANGKGKEDKDGEDGED---KKLKNALSGAILQ  120

Query  634  EKPNVKWSDVAGLE  675
            E+PNV+W DVAGLE
Sbjct  121  ERPNVRWEDVAGLE  134



>dbj|GAN00855.1| AAA-domain-containing protein [Mucor ambiguus]
Length=442

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 85/141 (60%), Gaps = 11/141 (8%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+  ++A +ED   NY +A+ LY N LEYF T ++YEKN ++KE I  K  EY
Sbjct  4    TDFLSRAIDIAKKATEEDRNENYKEAYNLYQNCLEYFMTAIRYEKNDRLKERIREKLVEY  63

Query  454  LRRAEEIRAVLD------EGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAG  612
            L RAE ++  L+      +  T   P  NG    A+  KTK   G D E D +  K+RA 
Sbjct  64   LDRAETLKTFLNTQEENSKQSTSNSPTKNG----ATAGKTKKVGGSDEEDDADMKKMRAN  119

Query  613  LNSAIVREKPNVKWSDVAGLE  675
            L+ AI+ EKPNV W+DVAGLE
Sbjct  120  LSGAILTEKPNVSWNDVAGLE  140



>gb|EFX03346.1| vacuolar sorting ATPase [Grosmannia clavigera kw1407]
Length=427

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 86/140 (61%), Gaps = 6/140 (4%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AIE VR+A++ DN+  Y KA+ LY +ALE F   LK+EKNP+ KE I  K TEY
Sbjct  4    TDFLGRAIEQVRKAIEADNSAEYEKAYQLYYSALEMFMLALKWEKNPRSKEMIRQKTTEY  63

Query  454  LRRAEEIRAVL---DEGGTGPGPASNGDAAVASRSKTKP---KDGEDGEDPEQSKLRAGL  615
            + RAE++++ L   D     PG      A+ A   K K      G DG D +  KLR+ L
Sbjct  64   MDRAEKLKSHLSDVDAKRKKPGMVGANGASTAGTGKGKQGGEDAGGDGIDEDSKKLRSAL  123

Query  616  NSAIVREKPNVKWSDVAGLE  675
              AI++++PNVKW DVAGLE
Sbjct  124  AGAILQDRPNVKWDDVAGLE  143



>ref|XP_009656495.1| vacuolar protein sorting-associated protein [Verticillium dahliae 
VdLs.17]
 gb|EGY20155.1| vacuolar protein sorting-associated protein [Verticillium dahliae 
VdLs.17]
Length=430

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 86/134 (64%), Gaps = 6/134 (4%)
 Frame = +1

Query  277  NFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYL  456
            +F  +A+  V+QA++ DNAG Y KAF LY  +LE F   +KYEKN K K+ I  K  EY+
Sbjct  6    DFLGRAVNTVKQAIEADNAGEYEKAFNLYKQSLEVFVLAIKYEKNAKSKDLIRAKTAEYM  65

Query  457  RRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTK-PKDGEDGEDPEQSKLRAGLNSAIVR  633
             RAE+++  L+E       AS G  AV +  K K  KDGEDGED    KL+  L+ AI++
Sbjct  66   DRAEKLKNHLNEAEA--KKASGGKGAVGANGKGKEDKDGEDGED---KKLKNALSGAILQ  120

Query  634  EKPNVKWSDVAGLE  675
            E+PNV+W DVAGLE
Sbjct  121  ERPNVRWEDVAGLE  134



>ref|XP_006959508.1| AAA-domain-containing protein [Wallemia sebi CBS 633.66]
 gb|EIM20482.1| AAA-domain-containing protein [Wallemia sebi CBS 633.66]
Length=437

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 85/137 (62%), Gaps = 7/137 (5%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            SNF ++AI+ V  A++ED   NYA+A  LY+NAL+YF   LKYEKNP +K  I  K  +Y
Sbjct  6    SNFLDKAIDLVSNAIEEDVKTNYAEALRLYLNALDYFMMALKYEKNPSLKTMIRGKLVDY  65

Query  454  LRRAEEIR---AVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSA  624
            + RAE+++   A  DE    P  ++N        +  +P    + +D E  KLRAGL+++
Sbjct  66   ITRAEKLKQHIAKSDENKKQPLGSTNSGGT----NPGQPGKESENDDAETKKLRAGLSNS  121

Query  625  IVREKPNVKWSDVAGLE  675
            I++E PNV W DVAGLE
Sbjct  122  ILQETPNVSWDDVAGLE  138



>ref|XP_009830644.1| hypothetical protein, variant 1 [Aphanomyces astaci]
 gb|ETV79708.1| hypothetical protein, variant 1 [Aphanomyces astaci]
Length=403

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 82/137 (60%), Gaps = 8/137 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            M + F  QAI+ V QA+QED   NY  AF LY  +LE+F   +KYEKNP  K  I  +  
Sbjct  14   MDNKFIPQAIQLVTQAIQEDTNKNYEAAFKLYQQSLEHFMIGVKYEKNPTSKAIIMKRVE  73

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAGLNSA  624
             Y+ RAE++R +L EG   P   + G  A       K KD E+ + D E++KLR  L SA
Sbjct  74   GYMTRAEQLRELL-EGQAKPKVVAAGGTA------EKEKDDEETDGDAEKNKLRGALASA  126

Query  625  IVREKPNVKWSDVAGLE  675
            +V EKPNVKW DVAGLE
Sbjct  127  VVSEKPNVKWDDVAGLE  143



>gb|KJJ25531.1| ATPase AAA-type core [Penicillium solitum]
Length=433

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+ V++A++ DN G Y KA+ +Y +ALE F   LK+EKNPK KE I  K  EY
Sbjct  4    TDFLGRAIDTVKKAIENDNDGEYEKAYQMYYSALELFMLALKWEKNPKSKEMIRSKAGEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPA-SNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIV  630
            + RAE+++  L E    P    +NG  A  S  K   +D ++GED +  KLR+ L  AI+
Sbjct  64   MDRAEKLKNHLAEDRKKPSAVGANGKVAQGS-GKGGKEDDDNGEDADAKKLRSALQGAIL  122

Query  631  REKPNVKWSDVAGLE  675
             +KPNVKW DVAGLE
Sbjct  123  SDKPNVKWEDVAGLE  137



>ref|XP_002558404.1| Pc12g16060 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP81233.1| Pc12g16060 [Penicillium rubens Wisconsin 54-1255]
Length=433

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+ V++A++ DN G Y KA+ +Y +ALE F   LK+EKNPK KE I  K  EY
Sbjct  4    TDFLGRAIDTVKKAIENDNDGEYEKAYQMYYSALELFMLALKWEKNPKSKEMIRSKAGEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPA-SNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIV  630
            + RAE+++  L E    P    +NG  A  S  K   +D ++GED +  KLR+ L  AI+
Sbjct  64   MDRAEKLKNHLAEDRKKPSAVGANGKVAQGS-GKGGKEDDDNGEDADAKKLRSALQGAIL  122

Query  631  REKPNVKWSDVAGLE  675
             +KPNVKW DVAGLE
Sbjct  123  SDKPNVKWEDVAGLE  137



>gb|EPS30009.1| hypothetical protein PDE_04959 [Penicillium oxalicum 114-2]
Length=434

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 84/136 (62%), Gaps = 3/136 (2%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+ V++A++ DN G Y KA+ LY +ALE F   LK+EKNPK KE I  K  EY
Sbjct  4    TDFLGRAIDTVKKAIENDNEGEYEKAYQLYYSALELFMLALKWEKNPKSKEMIRAKTGEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPA--SNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            + RAE+++  L         A  +NG  A  S    K  DG DGED E  KLR+ L  AI
Sbjct  64   MDRAEKLKNHLASADKKKPSAVGANGKIAPGSGKGGKEDDG-DGEDAEAKKLRSALQGAI  122

Query  628  VREKPNVKWSDVAGLE  675
            + +KPNVKW DVAGLE
Sbjct  123  LSDKPNVKWEDVAGLE  138



>gb|KJA21948.1| hypothetical protein HYPSUDRAFT_186857 [Hypholoma sublateritium 
FD-334 SS-4]
Length=434

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            +N  ++AI+ V++A+ ED   NYA+A+  Y N+L+YF   LKYE+N K K+ I  K  EY
Sbjct  4    TNNLDRAIDIVQKAIDEDTKHNYAEAYKYYQNSLDYFMLALKYERNEKSKQLIKAKINEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD-GEDGEDPEQSKLRAGLNSAIV  630
            L RAE ++  L     G           AS    K K+ G+D EDPE  KLRAGL  AI+
Sbjct  64   LGRAETLKEHLMSEKRGKSAVGVNGGGGASGPTGKSKEGGDDDEDPETKKLRAGLAGAIL  123

Query  631  REKPNVKWSDVAGLE  675
             EKPNVKW DVAGLE
Sbjct  124  TEKPNVKWDDVAGLE  138



>dbj|GAM41268.1| AAA family ATPase [Talaromyces cellulolyticus]
Length=1428

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI+ V++A++ DNAG Y KA+  Y  ALE F   LK+EKNPK KE I  K  EY
Sbjct  4    TDFLGRAIDTVKKAIEHDNAGEYEKAYQGYYAALELFMLALKWEKNPKSKEMIRAKTGEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVR  633
            + RAE+++  L        P++ G     +    K K+ EDGED E  KLR  L  AI+ 
Sbjct  64   MDRAEKLKNHLANADNKKKPSAVGANGKVANGSGKGKEDEDGEDAEAKKLRGALQGAILS  123

Query  634  EKPNVKWSDVAGLE  675
            EKPNV+W DVAGLE
Sbjct  124  EKPNVRWEDVAGLE  137



>ref|XP_009479980.1| PREDICTED: vacuolar protein sorting-associated protein 4B, partial 
[Pelecanus crispus]
Length=470

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 91/152 (60%), Gaps = 9/152 (6%)
 Frame = +1

Query  238  CLLTHA*SRRMYSNFK---EQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYE-  405
            CL  HA   R+  NF    ++AI+   +A QED AGNY +AF LY +A++YF   +KYE 
Sbjct  19   CLFDHAKCSRVALNFSLVLQKAIDLASKAAQEDKAGNYEEAFRLYQHAVQYFLHVVKYEA  78

Query  406  KNPKIKEAITHKFTEYLRRAEEIRAVLDEG-GTGPGPASNGDAAVASRSKTKPKDGE-DG  579
            +  K K++I  K TEYL RAE+++  L +   T P P         +  K    DGE + 
Sbjct  79   QGDKAKQSIRTKCTEYLDRAEKLKEYLKKREKTAPKPVKESGP---TDGKGNDSDGEGES  135

Query  580  EDPEQSKLRAGLNSAIVREKPNVKWSDVAGLE  675
            EDPE+ KL+  L  AIV E+PNVKWSDVAGLE
Sbjct  136  EDPEKKKLQNQLQGAIVMERPNVKWSDVAGLE  167



>ref|XP_002838514.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ82705.1| unnamed protein product [Tuber melanosporum]
Length=432

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            ++F  +AI  V++A++ED AGNY  A+  Y +ALE F   LK+EKNPK+KE+I  K  EY
Sbjct  4    TDFVGKAITIVKRAIEEDTAGNYEAAYTQYYSALECFMLALKWEKNPKMKESIRAKAAEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVR  633
            + RAE+++  L+E      P+  G     +    K +  ED  DPE  KLR  L  AI+ 
Sbjct  64   MERAEKLKTHLEESKGKKKPSKVGVNGKENGGGQKGRH-EDAIDPENKKLRGALAGAILT  122

Query  634  EKPNVKWSDVAGLE  675
            EKPN++W DVAGLE
Sbjct  123  EKPNIRWEDVAGLE  136



>gb|ETM56233.1| hypothetical protein L914_00756 [Phytophthora parasitica]
Length=280

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 84/136 (62%), Gaps = 6/136 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            M + F  QAIE V +A+ EDN+ NY +AF LY  ALE+F   +KYEKNP  KE I  +  
Sbjct  1    MENRFIPQAIEIVTEAINEDNSKNYQEAFRLYKKALEHFMIGVKYEKNPTSKEIIMKRVE  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
             Y+ RAE++R +L E  T P P     AAV    K   K+ +D  D E +KLR  L SA+
Sbjct  61   GYMTRAEQLRGML-EKETAPKPV----AAVVDMDKGD-KEDDDETDAETAKLRGSLASAV  114

Query  628  VREKPNVKWSDVAGLE  675
            V EKPNVKW DVAGL+
Sbjct  115  VSEKPNVKWDDVAGLD  130



>gb|AJV96807.1| Vps4p [Saccharomyces cerevisiae YJM195]
Length=437

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 80/135 (59%), Gaps = 2/135 (1%)
 Frame = +1

Query  277  NFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYL  456
            +F  + IE V++A+  D A  Y +A+  Y N L+Y    LKYEKNPK K+ I  KFTEYL
Sbjct  5    DFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYL  64

Query  457  RRAEEIRAVL--DEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIV  630
             RAE+++  L  +E        S G  +     K   ++GED    ++ KLR  L+SAI+
Sbjct  65   NRAEQLKKHLESEEANAAKKSPSAGSGSNGGNKKISQEEGEDNGGEDKKKLRGALSSAIL  124

Query  631  REKPNVKWSDVAGLE  675
             EKPNVKW DVAGLE
Sbjct  125  SEKPNVKWEDVAGLE  139



>ref|XP_011105974.1| vps4p [Saccharomyces arboricola H-6]
 gb|EJS41238.1| vps4p [Saccharomyces arboricola H-6]
Length=437

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 79/135 (59%), Gaps = 2/135 (1%)
 Frame = +1

Query  277  NFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYL  456
            +F  + IE V++A+  D A  Y +A+  Y N L+Y    LKYEKNPK K+ I  KFTEYL
Sbjct  5    DFLSKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYL  64

Query  457  RRAEEIRAVL--DEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIV  630
             RAE+++  L  +E        S G  +     K   ++GED    +  KLR  L+SAI+
Sbjct  65   NRAEQLKKHLENEEASGDKKSPSAGSGSANGNKKISQEEGEDNNGEDNKKLRGALSSAIL  124

Query  631  REKPNVKWSDVAGLE  675
             EKPNVKW DVAGLE
Sbjct  125  SEKPNVKWEDVAGLE  139



>ref|XP_002551260.1| vacuolar protein sorting-associated protein VPS4 [Candida tropicalis 
MYA-3404]
 gb|EER31106.1| vacuolar protein sorting-associated protein VPS4 [Candida tropicalis 
MYA-3404]
Length=432

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 82/136 (60%), Gaps = 2/136 (1%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            M S+F  + IE V++A+  D A  Y +A+ LY N L+Y    +KYEKN K KE I  KFT
Sbjct  1    MSSDFLSKGIELVQKAIDADTATRYEEAYKLYYNGLDYLMLAIKYEKNSKSKELIKSKFT  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
            EYL RAE+++  L++        + G    +++SK +  +G D E  +  KLR  L  AI
Sbjct  61   EYLTRAEQLKDHLEK--QNKSNTAEGSVNGSTKSKKQGSEGNDEEGEDTKKLRGALAGAI  118

Query  628  VREKPNVKWSDVAGLE  675
            + EKPNVKW D+AGLE
Sbjct  119  LSEKPNVKWDDIAGLE  134



>ref|XP_009830643.1| hypothetical protein H257_06949 [Aphanomyces astaci]
 gb|ETV79707.1| hypothetical protein H257_06949 [Aphanomyces astaci]
Length=473

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 82/137 (60%), Gaps = 8/137 (6%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            M + F  QAI+ V QA+QED   NY  AF LY  +LE+F   +KYEKNP  K  I  +  
Sbjct  14   MDNKFIPQAIQLVTQAIQEDTNKNYEAAFKLYQQSLEHFMIGVKYEKNPTSKAIIMKRVE  73

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGE-DPEQSKLRAGLNSA  624
             Y+ RAE++R +L EG   P   + G  A       K KD E+ + D E++KLR  L SA
Sbjct  74   GYMTRAEQLRELL-EGQAKPKVVAAGGTA------EKEKDDEETDGDAEKNKLRGALASA  126

Query  625  IVREKPNVKWSDVAGLE  675
            +V EKPNVKW DVAGLE
Sbjct  127  VVSEKPNVKWDDVAGLE  143



>emb|CDS02833.1| hypothetical protein LRAMOSA00236 [Absidia idahoensis var. thermophila]
Length=437

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 83/134 (62%), Gaps = 2/134 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S F ++AI+ V++A  ED+ GNY +A+  Y NAL+YF T +KYEKN ++K++I  +F EY
Sbjct  4    SEFLQKAIDIVKKATDEDHKGNYREAYGHYQNALDYFMTAIKYEKNDRLKDSIRKRFIEY  63

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVR  633
            L RAE ++  LD            +     + K   +  ED +DPE  K+RA L S I+ 
Sbjct  64   LNRAEILKEFLDSQDEKKDEEVGTNGTTKKKKKGVAE--EDDDDPEMKKMRANLASVILT  121

Query  634  EKPNVKWSDVAGLE  675
            EKPNV+W DVAGLE
Sbjct  122  EKPNVRWGDVAGLE  135



>ref|XP_003674449.1| hypothetical protein NCAS_0A15130 [Naumovozyma castellii CBS 
4309]
 emb|CCC68071.1| hypothetical protein NCAS_0A15130 [Naumovozyma castellii CBS 
4309]
Length=434

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 82/139 (59%), Gaps = 12/139 (9%)
 Frame = +1

Query  277  NFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYL  456
            +F  + IE V++A+  D A  Y +A+  Y N L+Y    LKYEKN K KE I  KFTEYL
Sbjct  5    DFLSKGIELVQKAIDYDTATQYEEAYTAYYNGLDYLMLALKYEKNAKSKELIRAKFTEYL  64

Query  457  RRAEEIRAVLD------EGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLN  618
             RAE+++  L+      EG  G   +SNG     S+   K  + ED ED +  KLR  L+
Sbjct  65   NRAEQLKQHLEANEKGKEGSVGTNSSSNG----GSKDAKKISNDEDNEDSK--KLRGALS  118

Query  619  SAIVREKPNVKWSDVAGLE  675
             AI+ EKPNVKW DVAGLE
Sbjct  119  GAILSEKPNVKWEDVAGLE  137



>ref|XP_008890402.1| hypothetical protein, variant 5 [Phytophthora parasitica INRA-310]
 ref|XP_008890406.1| hypothetical protein, variant 4 [Phytophthora parasitica INRA-310]
 gb|ETN24332.1| hypothetical protein, variant 4 [Phytophthora parasitica INRA-310]
 gb|ETN24333.1| hypothetical protein, variant 5 [Phytophthora parasitica INRA-310]
Length=368

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 85/136 (63%), Gaps = 6/136 (4%)
 Frame = +1

Query  268  MYSNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFT  447
            M + F  QAIE V +A++EDN+ NY +AF LY  ALE+F   +KYEKNP  KE I  +  
Sbjct  1    MENRFIPQAIEIVTEAIKEDNSKNYQEAFRLYKKALEHFMIGVKYEKNPTSKEIIMKRVE  60

Query  448  EYLRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAI  627
             Y+ RAE++R +L E  T P P     AAV    K   K+ +D  D E +KLR  L SA+
Sbjct  61   GYMTRAEQLRGML-EKETAPKPV----AAVVDMDKGD-KEDDDETDAETAKLRGSLASAV  114

Query  628  VREKPNVKWSDVAGLE  675
            V EKPNVKW DVAGL+
Sbjct  115  VSEKPNVKWDDVAGLD  130



>ref|XP_007407296.1| hypothetical protein MELLADRAFT_47487 [Melampsora larici-populina 
98AG31]
 gb|EGG09569.1| hypothetical protein MELLADRAFT_47487 [Melampsora larici-populina 
98AG31]
Length=440

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 79/135 (59%), Gaps = 1/135 (1%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            SNF ++A E VR A+ ED   N+ ++  LY NAL+YF    KYEKNPK+K+ I  K  EY
Sbjct  5    SNFLDKACEIVRTAIDEDLKQNWEESLKLYKNALDYFHMAYKYEKNPKLKDLIKTKMEEY  64

Query  454  LRRAEEIRAVLDEG-GTGPGPASNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIV  630
            L RAE+++  +        G  + G     S +  +P    +G+D E  KLR  LN AI+
Sbjct  65   LERAEKLKTHIQSSENHKQGKQAVGANGKQSGNDDQPTQNGEGDDAETKKLRGALNGAIL  124

Query  631  REKPNVKWSDVAGLE  675
             E PNVKW DVAGLE
Sbjct  125  AETPNVKWEDVAGLE  139



>ref|XP_002912064.1| katanin p60 ATPase domain-containing protein [Coprinopsis cinerea 
okayama7#130]
 gb|EFI28570.1| katanin p60 ATPase domain-containing protein [Coprinopsis cinerea 
okayama7#130]
Length=434

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 82/131 (63%), Gaps = 3/131 (2%)
 Frame = +1

Query  286  EQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEYLRRA  465
            ++AI+ V +A++ DN  NY +A+ LY NAL+YF   +KYEKN K+K+ I  K  EYL RA
Sbjct  8    DRAIDIVGKAIEADNKANYEEAYKLYQNALDYFMLAMKYEKNAKLKDLIKSKVVEYLNRA  67

Query  466  EEIRAVLDEGGTGPGPA-SNGDAAVASRSKTKPKDGEDGEDPEQSKLRAGLNSAIVREKP  642
            E +++ L     G     +NG +  A  S    +D  D  D E  KLRAGL+ AI+ E+P
Sbjct  68   ETLKSHLSAEKKGKAAVGANGTSGAAGPSGKGKED--DDIDAETKKLRAGLSGAILSERP  125

Query  643  NVKWSDVAGLE  675
            NVKW DVAGLE
Sbjct  126  NVKWDDVAGLE  136



>gb|KGQ91629.1| vacuolar protein sorting-associated protein 4 [Candida albicans 
GC75]
Length=439

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 85/140 (61%), Gaps = 9/140 (6%)
 Frame = +1

Query  274  SNFKEQAIEYVRQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITHKFTEY  453
            S+F  + I+ V++A+  D A  Y +A+ LY N L+Y    +KYEKNPK KE +  KFTEY
Sbjct  5    SDFLSKGIDLVQKAIDADTATRYEEAYKLYYNGLDYLMLAIKYEKNPKSKELVKSKFTEY  64

Query  454  LRRAEEIRAVLDEGGTGPGPASNGDAAVASRSKTKPKD------GEDGEDPEQSKLRAGL  615
            L RAE+++  L++        S  +++V   +K K  +      G+D +D +  KLR  L
Sbjct  65   LTRAEQLKDHLEKQAQN---KSTAESSVNGSTKAKKSNGDGNGSGDDNDDADTKKLRGAL  121

Query  616  NSAIVREKPNVKWSDVAGLE  675
              AI+ EKPNVKWSD+AGL+
Sbjct  122  AGAILSEKPNVKWSDIAGLD  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1133412046677