BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7399

Length=1125
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011090682.1|  PREDICTED: 40S ribosomal protein S3a               452   2e-156   Sesamum indicum [beniseed]
emb|CDO99096.1|  unnamed protein product                                452   4e-156   Coffea canephora [robusta coffee]
ref|NP_001275164.1|  40S ribosomal protein S3a-like protein             444   5e-153   Solanum tuberosum [potatoes]
sp|P33444.4|RS3A_CATRO  RecName: Full=40S ribosomal protein S3a; ...    444   9e-153   Catharanthus roseus [chatas]
ref|XP_004247589.1|  PREDICTED: 40S ribosomal protein S3a               442   3e-152   Solanum lycopersicum
ref|XP_011073454.1|  PREDICTED: 40S ribosomal protein S3a-like          437   4e-150   Sesamum indicum [beniseed]
ref|XP_002283142.1|  PREDICTED: 40S ribosomal protein S3a-1             435   2e-149   Vitis vinifera
gb|EPS71864.1|  hypothetical protein M569_02887                         435   2e-149   Genlisea aurea
ref|XP_010034641.1|  PREDICTED: 40S ribosomal protein S3a               434   4e-149   Eucalyptus grandis [rose gum]
ref|XP_010553319.1|  PREDICTED: 40S ribosomal protein S3a-1-like        434   5e-149   Tarenaya hassleriana [spider flower]
ref|XP_010938988.1|  PREDICTED: 40S ribosomal protein S3a-like          433   1e-148   Elaeis guineensis
gb|EYU23687.1|  hypothetical protein MIMGU_mgv1a012196mg                433   1e-148   Erythranthe guttata [common monkey flower]
ref|XP_012089233.1|  PREDICTED: 40S ribosomal protein S3a-1             433   2e-148   Jatropha curcas
ref|XP_010942777.1|  PREDICTED: 40S ribosomal protein S3a               432   2e-148   Elaeis guineensis
gb|AFS65104.1|  40S ribosomal protein S3a-like protein                  432   2e-148   Elaeis guineensis
gb|AFK33413.1|  unknown                                                 432   2e-148   Lotus japonicus
gb|KHN30486.1|  40S ribosomal protein S3a                               431   4e-148   Glycine soja [wild soybean]
ref|XP_003610736.1|  40S ribosomal protein S3a-like protein             431   5e-148   Medicago truncatula
ref|NP_001241005.1|  uncharacterized protein LOC100805519               431   6e-148   Glycine max [soybeans]
ref|XP_008438626.1|  PREDICTED: 40S ribosomal protein S3a               431   8e-148   Cucumis melo [Oriental melon]
ref|XP_010274385.1|  PREDICTED: 40S ribosomal protein S3a-like          431   8e-148   Nelumbo nucifera [Indian lotus]
ref|XP_004134125.1|  PREDICTED: 40S ribosomal protein S3a               431   9e-148   Cucumis sativus [cucumbers]
ref|XP_010553762.1|  PREDICTED: 40S ribosomal protein S3a-1-like        431   1e-147   Tarenaya hassleriana [spider flower]
ref|XP_007030615.1|  Ribosomal protein S3Ae                             431   1e-147   
ref|NP_001239858.1|  uncharacterized protein LOC100808747               430   2e-147   Glycine max [soybeans]
ref|XP_004153483.1|  PREDICTED: 40S ribosomal protein S3a-like          429   3e-147   Cucumis sativus [cucumbers]
ref|XP_008449325.1|  PREDICTED: 40S ribosomal protein S3a-like          429   3e-147   Cucumis melo [Oriental melon]
ref|XP_010024230.1|  PREDICTED: 40S ribosomal protein S3a-like          429   4e-147   Eucalyptus grandis [rose gum]
ref|XP_007157117.1|  hypothetical protein PHAVU_002G044200g             429   7e-147   Phaseolus vulgaris [French bean]
ref|XP_010259119.1|  PREDICTED: 40S ribosomal protein S3a-1             428   8e-147   Nelumbo nucifera [Indian lotus]
ref|XP_010550935.1|  PREDICTED: 40S ribosomal protein S3a-2-like        428   9e-147   Tarenaya hassleriana [spider flower]
ref|XP_010090259.1|  40S ribosomal protein S3a                          428   1e-146   Morus notabilis
ref|XP_004496691.1|  PREDICTED: 40S ribosomal protein S3a-like          428   1e-146   Cicer arietinum [garbanzo]
ref|XP_007034836.1|  Ribosomal protein S3Ae isoform 2                   427   2e-146   
gb|ACU18272.1|  unknown                                                 427   2e-146   Glycine max [soybeans]
ref|XP_007034835.1|  Ribosomal protein S3Ae isoform 1                   427   3e-146   Theobroma cacao [chocolate]
ref|XP_011026951.1|  PREDICTED: 40S ribosomal protein S3a-2             427   3e-146   Populus euphratica
gb|KHN02741.1|  40S ribosomal protein S3a                               427   4e-146   Glycine soja [wild soybean]
ref|XP_010272784.1|  PREDICTED: 40S ribosomal protein S3a-like          427   4e-146   Nelumbo nucifera [Indian lotus]
ref|XP_010256142.1|  PREDICTED: 40S ribosomal protein S3a-1-like        426   5e-146   Nelumbo nucifera [Indian lotus]
ref|NP_001241430.1|  uncharacterized protein LOC100813273               426   5e-146   Glycine max [soybeans]
ref|XP_008811659.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    426   6e-146   Phoenix dactylifera
ref|XP_002314671.2|  ribosomal protein S3a                              426   7e-146   Populus trichocarpa [western balsam poplar]
ref|XP_008804511.1|  PREDICTED: 40S ribosomal protein S3a               426   7e-146   Phoenix dactylifera
ref|XP_009779517.1|  PREDICTED: 40S ribosomal protein S3a               426   7e-146   Nicotiana sylvestris
ref|NP_001265990.1|  40S ribosomal protein S3a                          426   8e-146   Cicer arietinum [garbanzo]
gb|ABK56834.1|  RPS3                                                    426   9e-146   Cymbidium hybrid cultivar
ref|XP_009628663.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    426   1e-145   Nicotiana tomentosiformis
ref|XP_011030646.1|  PREDICTED: 40S ribosomal protein S3a-2-like        425   2e-145   Populus euphratica
ref|XP_002512232.1|  40S ribosomal protein S3a, putative                424   3e-145   Ricinus communis
ref|XP_006379849.1|  hypothetical protein POPTR_0008s15610g             424   3e-145   Populus trichocarpa [western balsam poplar]
ref|XP_004235324.1|  PREDICTED: 40S ribosomal protein S3a               424   4e-145   Solanum lycopersicum
ref|XP_002517085.1|  40S ribosomal protein S3a, putative                424   4e-145   Ricinus communis
gb|KHG05975.1|  40S ribosomal S3a                                       424   5e-145   Gossypium arboreum [tree cotton]
ref|XP_009775368.1|  PREDICTED: 40S ribosomal protein S3a-like          424   6e-145   Nicotiana sylvestris
ref|XP_007137418.1|  hypothetical protein PHAVU_009G125400g             424   6e-145   Phaseolus vulgaris [French bean]
ref|NP_001276152.1|  40S ribosomal protein S3a-like                     424   6e-145   
ref|XP_010524908.1|  PREDICTED: 40S ribosomal protein S3a-2             424   6e-145   Tarenaya hassleriana [spider flower]
ref|XP_009591686.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    424   6e-145   Nicotiana tomentosiformis
ref|XP_006408143.1|  hypothetical protein EUTSA_v10021341mg             423   8e-145   Eutrema salsugineum [saltwater cress]
ref|XP_010675082.1|  PREDICTED: 40S ribosomal protein S3a               423   9e-145   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg                437   1e-144   Erythranthe guttata [common monkey flower]
sp|P49198.2|RS3A_HELAN  RecName: Full=40S ribosomal protein S3a         423   1e-144   Helianthus annuus
ref|XP_006848758.1|  PREDICTED: 40S ribosomal protein S3a               423   1e-144   Amborella trichopoda
ref|XP_006284351.1|  hypothetical protein CARUB_v10005523mg             423   1e-144   Capsella rubella
gb|KJB72261.1|  hypothetical protein B456_011G167500                    422   2e-144   Gossypium raimondii
ref|XP_009618011.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    422   2e-144   Nicotiana tomentosiformis
gb|KJB34507.1|  hypothetical protein B456_006G069600                    422   3e-144   Gossypium raimondii
ref|XP_010546607.1|  PREDICTED: 40S ribosomal protein S3a-1-like        422   3e-144   Tarenaya hassleriana [spider flower]
ref|XP_009394355.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    421   5e-144   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO98656.1|  unnamed protein product                                421   5e-144   Coffea canephora [robusta coffee]
gb|ACJ85751.1|  unknown                                                 421   5e-144   Medicago truncatula
ref|XP_003638196.1|  40S ribosomal protein S3a                          421   5e-144   
ref|XP_010432386.1|  PREDICTED: 40S ribosomal protein S3a-2-like        421   7e-144   Camelina sativa [gold-of-pleasure]
ref|XP_006382773.1|  40S ribosomal protein S3A                          421   7e-144   Populus trichocarpa [western balsam poplar]
ref|XP_010437575.1|  PREDICTED: 40S ribosomal protein S3a-2             421   1e-143   Camelina sativa [gold-of-pleasure]
gb|KHG19560.1|  40S ribosomal S3a                                       421   1e-143   Gossypium arboreum [tree cotton]
ref|XP_011032434.1|  PREDICTED: 40S ribosomal protein S3a               421   1e-143   Populus euphratica
ref|XP_002312545.2|  ribosomal protein S3a                              420   1e-143   
ref|XP_010447045.1|  PREDICTED: 40S ribosomal protein S3a-2-like        420   2e-143   Camelina sativa [gold-of-pleasure]
ref|NP_001066631.1|  Os12g0406200                                       420   2e-143   
sp|Q9MBB3.1|RS3A_DAUCA  RecName: Full=40S ribosomal protein S3a; ...    419   3e-143   Daucus carota [carrots]
ref|NP_195193.1|  40S ribosomal protein S3a-2                           419   3e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382772.1|  hypothetical protein POPTR_0005s05280g             419   3e-143   
dbj|BAA00860.1|  cyc07                                                  418   4e-143   Catharanthus roseus [chatas]
ref|XP_007143300.1|  hypothetical protein PHAVU_007G060700g             419   4e-143   Phaseolus vulgaris [French bean]
ref|XP_010485869.1|  PREDICTED: 40S ribosomal protein S3a-1             419   5e-143   Camelina sativa [gold-of-pleasure]
ref|XP_010419205.1|  PREDICTED: 40S ribosomal protein S3a-1-like        418   8e-143   Camelina sativa [gold-of-pleasure]
ref|XP_006663971.1|  PREDICTED: 40S ribosomal protein S3a-like          417   1e-142   Oryza brachyantha
ref|XP_006663973.1|  PREDICTED: 40S ribosomal protein S3a-like          417   2e-142   Oryza brachyantha
ref|XP_006663974.1|  PREDICTED: 40S ribosomal protein S3a-like          417   2e-142   Oryza brachyantha
gb|ABK93399.1|  unknown                                                 417   3e-142   Populus trichocarpa [western balsam poplar]
ref|XP_009408135.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    417   3e-142   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB38202.1|  hypothetical protein B456_006G241700                    417   3e-142   Gossypium raimondii
ref|XP_002277791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        416   4e-142   Vitis vinifera
ref|XP_012069687.1|  PREDICTED: 40S ribosomal protein S3a               416   5e-142   Jatropha curcas
ref|XP_006412198.1|  hypothetical protein EUTSA_v10026006mg             416   5e-142   Eutrema salsugineum [saltwater cress]
ref|NP_187135.1|  40S ribosomal protein S3a-1                           416   6e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882377.1|  40S ribosomal protein S3A                          416   6e-142   
ref|XP_009400022.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    416   7e-142   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004958212.1|  PREDICTED: 40S ribosomal protein S3a-like          416   7e-142   Setaria italica
ref|XP_004241461.1|  PREDICTED: 40S ribosomal protein S3a               416   7e-142   Solanum lycopersicum
dbj|BAA05057.1|  cyc07                                                  415   7e-142   Catharanthus roseus [chatas]
ref|NP_001049289.1|  Os03g0200500                                       416   8e-142   
ref|XP_003559021.1|  PREDICTED: 40S ribosomal protein S3a-like          416   1e-141   Brachypodium distachyon [annual false brome]
ref|NP_001275123.1|  cyc07-like protein                                 415   1e-141   Solanum tuberosum [potatoes]
gb|KHG11221.1|  40S ribosomal S3a                                       414   2e-141   Gossypium arboreum [tree cotton]
gb|ERN01559.1|  hypothetical protein AMTR_s00002p00271660               415   2e-141   Amborella trichopoda
ref|XP_006649574.1|  PREDICTED: 40S ribosomal protein S3a-like          414   2e-141   Oryza brachyantha
ref|NP_001274913.1|  40S ribosomal protein S3a-like                     414   3e-141   Solanum tuberosum [potatoes]
emb|CDX75453.1|  BnaA01g02490D                                          414   3e-141   
ref|XP_010463973.1|  PREDICTED: 40S ribosomal protein S3a-1-like        414   3e-141   Camelina sativa [gold-of-pleasure]
emb|CDX76296.1|  BnaA08g11040D                                          414   3e-141   
ref|XP_004985319.1|  PREDICTED: 40S ribosomal protein S3a-like is...    414   4e-141   Setaria italica
ref|XP_003572000.1|  PREDICTED: 40S ribosomal protein S3a               414   5e-141   Brachypodium distachyon [annual false brome]
gb|ABB55362.1|  cyc07-like                                              414   5e-141   Solanum tuberosum [potatoes]
ref|XP_002869131.1|  40S ribosomal protein S3A                          413   6e-141   Arabidopsis lyrata subsp. lyrata
gb|ABB72808.1|  cyc07-like protein                                      413   8e-141   Solanum tuberosum [potatoes]
ref|XP_009108713.1|  PREDICTED: 40S ribosomal protein S3a-2-like        413   8e-141   Brassica rapa
emb|CDX69078.1|  BnaC01g03750D                                          413   8e-141   
ref|XP_010092425.1|  40S ribosomal protein S3a                          413   1e-140   
ref|NP_001046578.1|  Os02g0287000                                       412   2e-140   
gb|ABK22319.1|  unknown                                                 411   2e-140   Picea sitchensis
ref|XP_008218237.1|  PREDICTED: 40S ribosomal protein S3a-2             412   2e-140   Prunus mume [ume]
ref|XP_009138316.1|  PREDICTED: 40S ribosomal protein S3a-2-like        412   2e-140   Brassica rapa
emb|CDY21109.1|  BnaA01g33400D                                          412   3e-140   Brassica napus [oilseed rape]
gb|EEE56753.1|  hypothetical protein OsJ_06287                          417   3e-140   Oryza sativa Japonica Group [Japonica rice]
emb|CDY50760.1|  BnaAnng10670D                                          412   3e-140   Brassica napus [oilseed rape]
ref|XP_006298355.1|  hypothetical protein CARUB_v10014425mg             412   3e-140   Capsella rubella
ref|XP_003526635.1|  PREDICTED: 40S ribosomal protein S3a-like          411   4e-140   Glycine max [soybeans]
emb|CDY30019.1|  BnaC01g39890D                                          413   4e-140   Brassica napus [oilseed rape]
ref|XP_009110285.1|  PREDICTED: 40S ribosomal protein S3a-2             411   4e-140   Brassica rapa
ref|XP_011621751.1|  PREDICTED: 40S ribosomal protein S3a-1             414   4e-140   
ref|XP_010229024.1|  PREDICTED: 40S ribosomal protein S3a-like          410   8e-140   Brachypodium distachyon [annual false brome]
ref|XP_009406016.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    410   9e-140   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001152574.1|  40S ribosomal protein S3a                          410   1e-139   Zea mays [maize]
emb|CDY40680.1|  BnaC03g33960D                                          410   1e-139   Brassica napus [oilseed rape]
ref|XP_006420004.1|  hypothetical protein CICLE_v10005663mg             410   1e-139   Citrus clementina [clementine]
ref|XP_009124201.1|  PREDICTED: 40S ribosomal protein S3a-2             410   2e-139   Brassica rapa
emb|CDX74165.1|  BnaA03g28820D                                          409   3e-139   
ref|XP_009134791.1|  PREDICTED: 40S ribosomal protein S3a-2-like        409   3e-139   Brassica rapa
ref|XP_002463138.1|  hypothetical protein SORBIDRAFT_02g038370          409   4e-139   Sorghum bicolor [broomcorn]
gb|KFK30101.1|  hypothetical protein AALP_AA7G217000                    409   4e-139   Arabis alpina [alpine rockcress]
dbj|BAJ93929.1|  predicted protein                                      409   4e-139   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO43437.1|  hypothetical protein CISIN_1g040060mg                   408   5e-139   Citrus sinensis [apfelsine]
ref|NP_001141038.1|  hypothetical protein                               409   5e-139   Zea mays [maize]
gb|AFW89330.1|  40S ribosomal protein S3a                               411   7e-139   
gb|KDO37446.1|  hypothetical protein CISIN_1g045491mg                   407   7e-139   Citrus sinensis [apfelsine]
gb|AFW89335.1|  40S ribosomal protein S3a                               411   7e-139   
gb|KEH32959.1|  40S ribosomal protein S3a-1                             407   1e-138   Medicago truncatula
ref|XP_006428321.1|  hypothetical protein CICLE_v10012508mg             407   1e-138   Citrus clementina [clementine]
ref|NP_001149096.1|  40S ribosomal protein S3a                          407   1e-138   Zea mays [maize]
ref|XP_007205738.1|  hypothetical protein PRUPE_ppa010179mg             407   2e-138   Prunus persica
ref|XP_002463137.1|  hypothetical protein SORBIDRAFT_02g038365          407   3e-138   Sorghum bicolor [broomcorn]
gb|KFK37895.1|  hypothetical protein AALP_AA3G043200                    406   5e-138   Arabis alpina [alpine rockcress]
gb|AGT16352.1|  40S ribosomal protein S3a                               406   6e-138   Saccharum hybrid cultivar R570
gb|ACN40078.1|  unknown                                                 405   1e-137   Picea sitchensis
gb|ACG33267.1|  40S ribosomal protein S3a                               405   1e-137   Zea mays [maize]
gb|ACG34058.1|  40S ribosomal protein S3a                               404   2e-137   Zea mays [maize]
ref|XP_004296667.1|  PREDICTED: 40S ribosomal protein S3a               404   3e-137   Fragaria vesca subsp. vesca
ref|NP_001288829.1|  40S ribosomal protein S3a                          404   4e-137   Brassica rapa
gb|KJB38201.1|  hypothetical protein B456_006G241700                    404   4e-137   Gossypium raimondii
ref|XP_001761018.1|  predicted protein                                  404   5e-137   
ref|XP_002987274.1|  hypothetical protein SELMODRAFT_271906             403   7e-137   Selaginella moellendorffii
ref|XP_004302028.1|  PREDICTED: 40S ribosomal protein S3a-2             400   7e-136   Fragaria vesca subsp. vesca
gb|KJB28385.1|  hypothetical protein B456_005G045000                    400   8e-136   Gossypium raimondii
ref|XP_001765967.1|  predicted protein                                  399   2e-135   
gb|EEC69140.1|  hypothetical protein OsI_38068                          418   3e-135   Oryza sativa Indica Group [Indian rice]
gb|EEE53089.1|  hypothetical protein OsJ_35850                          416   3e-135   Oryza sativa Japonica Group [Japonica rice]
gb|AAX55706.1|  cyc07                                                   397   5e-135   Vitis vinifera
ref|XP_001767326.1|  predicted protein                                  398   1e-134   
ref|XP_004985318.1|  PREDICTED: 40S ribosomal protein S3a-like is...    399   1e-134   
gb|AAC98779.1|  S-phase-specific ribosomal protein                      396   4e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008224264.1|  PREDICTED: 40S ribosomal protein S3a               395   6e-134   Prunus mume [ume]
gb|KJB28386.1|  hypothetical protein B456_005G045000                    394   2e-133   Gossypium raimondii
gb|EMT30223.1|  40S ribosomal protein S3a                               392   2e-132   
ref|XP_001774632.1|  predicted protein                                  388   8e-131   
ref|XP_001777314.1|  predicted protein                                  387   2e-130   
gb|KCW60693.1|  hypothetical protein EUGRSUZ_H03423                     385   2e-130   Eucalyptus grandis [rose gum]
sp|A7Q5X9.1|RS3A2_VITVI  RecName: Full=40S ribosomal protein S3a-2      385   2e-130   Vitis vinifera
ref|XP_001755439.1|  predicted protein                                  387   3e-130   
gb|KJB28382.1|  hypothetical protein B456_005G045000                    383   5e-129   Gossypium raimondii
ref|XP_008391001.1|  PREDICTED: 40S ribosomal protein S3a-2-like        383   6e-129   Malus domestica [apple tree]
ref|XP_008390932.1|  PREDICTED: 40S ribosomal protein S3a-2-like        382   2e-128   Malus domestica [apple tree]
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg             394   3e-128   
gb|ACU17112.1|  unknown                                                 379   4e-128   Glycine max [soybeans]
ref|XP_009335287.1|  PREDICTED: 40S ribosomal protein S3a-2-like        380   8e-128   Pyrus x bretschneideri [bai li]
gb|AFW89329.1|  hypothetical protein ZEAMMB73_166147                    377   4e-127   
ref|XP_002949135.1|  component of cytosolic 80S ribosome and 40S ...    377   1e-126   Volvox carteri f. nagariensis
gb|KHN21710.1|  40S ribosomal protein S3a                               376   3e-125   Glycine soja [wild soybean]
emb|CDY17474.1|  BnaC03g65890D                                          372   6e-125   Brassica napus [oilseed rape]
ref|XP_001693710.1|  ribosomal protein S3a, component of cytosoli...    371   3e-124   Chlamydomonas reinhardtii
gb|KDO74488.1|  hypothetical protein CISIN_1g024879mg                   367   4e-123   Citrus sinensis [apfelsine]
ref|XP_009406018.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    363   1e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005650618.1|  ribosomal protein S3Ae                             364   1e-121   Coccomyxa subellipsoidea C-169
gb|ABE66401.1|  S phase protein                                         360   3e-121   Striga asiatica [witchweed]
ref|XP_001774288.1|  predicted protein                                  362   6e-121   
gb|KHG19561.1|  40S ribosomal S3a                                       362   7e-121   Gossypium arboreum [tree cotton]
ref|XP_001765908.1|  predicted protein                                  358   1e-119   
gb|EYU30365.1|  hypothetical protein MIMGU_mgv1a021183mg                354   2e-118   Erythranthe guttata [common monkey flower]
gb|EYU26004.1|  hypothetical protein MIMGU_mgv1a019927mg                353   4e-118   Erythranthe guttata [common monkey flower]
emb|CBX25071.1|  40S ribosomal protein S3a                              355   6e-118   Polytomella sp. Pringsheim 198.80
emb|CEG00819.1|  Ribosomal protein S3Ae                                 354   8e-118   Ostreococcus tauri
ref|XP_001422366.1|  Ribosomal protein S3a, component of cytosoli...    353   3e-117   Ostreococcus lucimarinus CCE9901
gb|AAP80855.1|  cyc07                                                   351   7e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002465526.1|  hypothetical protein SORBIDRAFT_01g040570          352   1e-116   
gb|AFW89333.1|  hypothetical protein ZEAMMB73_166147                    348   1e-114   
ref|XP_002505259.1|  predicted protein                                  341   1e-112   Micromonas commoda
ref|XP_007508881.1|  predicted protein                                  341   3e-112   Bathycoccus prasinos
emb|CBI34197.3|  unnamed protein product                                336   4e-111   Vitis vinifera
ref|XP_011395666.1|  40S ribosomal protein S3a                          333   3e-109   Auxenochlorella protothecoides
ref|XP_003060358.1|  predicted protein                                  332   5e-109   Micromonas pusilla CCMP1545
gb|ERZ98268.1|  hypothetical protein GLOINDRAFT_339726                  330   2e-108   
gb|KIY51600.1|  ribosomal protein S3Ae                                  328   1e-107   Fistulina hepatica ATCC 64428
gb|KJB28384.1|  hypothetical protein B456_005G045000                    327   1e-107   Gossypium raimondii
gb|EMD41078.1|  hypothetical protein CERSUDRAFT_80722                   327   4e-107   Gelatoporia subvermispora B
ref|XP_003038024.1|  40S ribosomal protein S1                           327   4e-107   Schizophyllum commune H4-8
gb|KDD76342.1|  ribosomal protein S3Ae                                  327   5e-107   Helicosporidium sp. ATCC 50920
ref|XP_007862325.1|  40S ribosomal protein S1                           326   1e-106   Gloeophyllum trabeum ATCC 11539
ref|XP_007382215.1|  S-phase-specific ribosomal protein cyc07           325   3e-106   Punctularia strigosozonata HHB-11173 SS5
ref|XP_001837102.1|  40S ribosomal protein S1                           325   3e-106   Coprinopsis cinerea okayama7#130
gb|ABW23199.1|  ribosomal protein rps3a                                 325   3e-106   Eurythoe complanata
ref|XP_007843081.1|  40s ribosomal protein s3ae                         325   4e-106   
gb|KIK65348.1|  hypothetical protein GYMLUDRAFT_38796                   324   4e-106   Gymnopus luxurians FD-317 M1
sp|Q764D2.1|RS3A_LENED  RecName: Full=40S ribosomal protein S1; A...    324   5e-106   Lentinula edodes
ref|XP_007315533.1|  hypothetical protein SERLADRAFT_382295             324   5e-106   Serpula lacrymans var. lacrymans S7.9
gb|KIK48635.1|  hypothetical protein CY34DRAFT_797777                   324   5e-106   Suillus luteus UH-Slu-Lm8-n1
gb|EXX58553.1|  ribosomal 40S subunit protein S1A                       324   6e-106   Rhizophagus irregularis DAOM 197198w
gb|ABI52667.1|  40S ribosomal protein S3a                               324   8e-106   Argas monolakensis
gb|KIM46265.1|  hypothetical protein M413DRAFT_441346                   323   9e-106   Hebeloma cylindrosporum h7
ref|XP_002428136.1|  40S ribosomal protein S3A, putative                323   1e-105   Pediculus humanus corporis [human body lice]
ref|XP_007392195.1|  hypothetical protein PHACADRAFT_250267             323   1e-105   Phanerochaete carnosa HHB-10118-sp
gb|KIK30608.1|  hypothetical protein PISMIDRAFT_670675                  323   1e-105   Pisolithus microcarpus 441
sp|B0CY45.2|RS3A_LACBS  RecName: Full=40S ribosomal protein S1          323   2e-105   Laccaria bicolor S238N-H82
gb|EPS95373.1|  hypothetical protein FOMPIDRAFT_157719                  323   2e-105   Fomitopsis pinicola FP-58527 SS1
gb|KIM68608.1|  hypothetical protein SCLCIDRAFT_1208801                 322   2e-105   Scleroderma citrinum Foug A
ref|XP_002475466.1|  40S ribosomal protein S3A                          322   3e-105   
ref|XP_007767741.1|  ribosomal protein S3Ae                             322   3e-105   Coniophora puteana RWD-64-598 SS2
ref|XP_008671813.1|  PREDICTED: 40S ribosomal protein S3a-like          322   3e-105   Zea mays [maize]
emb|CCM04869.1|  predicted protein                                      322   3e-105   Fibroporia radiculosa
ref|XP_001877091.1|  40S ribosomal protein S1                           322   4e-105   Laccaria bicolor S238N-H82
gb|KIK06774.1|  hypothetical protein K443DRAFT_674057                   322   4e-105   Laccaria amethystina LaAM-08-1
gb|KJA29982.1|  hypothetical protein HYPSUDRAFT_81601                   322   4e-105   Hypholoma sublateritium FD-334 SS-4
gb|KIY73683.1|  putative S-phase-specific ribosomal protein cyc07       321   7e-105   Cylindrobasidium torrendii FP15055 ss-10
gb|KIJ70171.1|  hypothetical protein HYDPIDRAFT_104846                  321   8e-105   Hydnomerulius pinastri MD-312
gb|KDQ14611.1|  hypothetical protein BOTBODRAFT_65919                   321   9e-105   Botryobasidium botryosum FD-172 SS1
gb|KIJ20179.1|  hypothetical protein PAXINDRAFT_166304                  320   2e-104   Paxillus involutus ATCC 200175
ref|XP_007268611.1|  40S ribosomal protein S1                           320   2e-104   Fomitiporia mediterranea MF3/22
gb|KII94785.1|  hypothetical protein PLICRDRAFT_33595                   320   2e-104   Plicaturopsis crispa FD-325 SS-3
sp|Q9XEG7.3|RS3A_TORRU  RecName: Full=40S ribosomal protein S3a         320   3e-104   Syntrichia ruralis
emb|CDO74072.1|  hypothetical protein BN946_scf185043.g122              320   3e-104   Trametes cinnabarina
gb|KIM90711.1|  hypothetical protein PILCRDRAFT_811171                  319   4e-104   Piloderma croceum F 1598
ref|XP_005710608.1|  40S ribosomal protein S3A                          320   4e-104   Chondrus crispus [carageen]
gb|KIP10648.1|  hypothetical protein PHLGIDRAFT_84595                   318   8e-104   Phlebiopsis gigantea 11061_1 CR5-6
gb|KDQ64848.1|  hypothetical protein JAAARDRAFT_28494                   318   9e-104   Jaapia argillacea MUCL 33604
ref|XP_008035602.1|  40S ribosomal protein S1                           318   1e-103   Trametes versicolor FP-101664 SS1
ref|XP_007302916.1|  S-phase-specific ribosomal protein cyc07           318   1e-103   Stereum hirsutum FP-91666 SS1
gb|KIO12878.1|  hypothetical protein M404DRAFT_699665                   318   1e-103   Pisolithus tinctorius Marx 270
ref|XP_007329524.1|  hypothetical protein AGABI1DRAFT_106559            318   2e-103   Agaricus bisporus var. burnettii JB137-S8
gb|KJB28383.1|  hypothetical protein B456_005G045000                    317   2e-103   Gossypium raimondii
gb|KIM33406.1|  hypothetical protein M408DRAFT_153936                   318   2e-103   Serendipita vermifera MAFF 305830
gb|KDN43521.1|  40S ribosomal protein S1                                318   3e-103   Rhizoctonia solani AG-8 WAC10335
gb|ELW69964.1|  40S ribosomal protein S3a                               318   3e-103   Tupaia chinensis
ref|XP_008047613.1|  PREDICTED: 40S ribosomal protein S3a               318   3e-103   Carlito syrichta
gb|KDR83823.1|  hypothetical protein GALMADRAFT_676836                  317   3e-103   Galerina marginata CBS 339.88
dbj|BAF83764.1|  unnamed protein product                                318   3e-103   Homo sapiens [man]
sp|Q5G5C4.1|RS3A_PERAM  RecName: Full=40S ribosomal protein S3a         317   3e-103   Periplaneta americana
ref|XP_010773841.1|  PREDICTED: 40S ribosomal protein S3a               317   3e-103   Notothenia coriiceps [yellowbelly rockcod]
gb|EAW77577.1|  hCG33299, isoform CRA_a                                 317   4e-103   Homo sapiens [man]
gb|KFP00832.1|  40S ribosomal protein S3a                               316   5e-103   Calypte anna
ref|XP_004655919.1|  PREDICTED: 40S ribosomal protein S3a               317   5e-103   Jaculus jaculus
ref|XP_008492080.1|  PREDICTED: 40S ribosomal protein S3a               316   5e-103   Calypte anna
ref|XP_002598366.1|  hypothetical protein BRAFLDRAFT_69722              317   5e-103   Branchiostoma floridae
emb|CCO27311.1|  40S ribosomal protein S1 AltName: Full=Protein c...    317   5e-103   Rhizoctonia solani AG-1 IB
ref|XP_009040503.1|  hypothetical protein AURANDRAFT_38843              317   5e-103   Aureococcus anophagefferens
ref|XP_006735747.1|  PREDICTED: 40S ribosomal protein S3a-like is...    316   5e-103   Leptonychotes weddellii
gb|AAT76631.1|  ribosomal protein S3a                                   316   6e-103   Felis catus [cat]
ref|XP_009896517.1|  PREDICTED: 40S ribosomal protein S3a               317   6e-103   Picoides pubescens
ref|XP_001366653.1|  PREDICTED: 40S ribosomal protein S3a               317   6e-103   Monodelphis domestica
gb|AGM32131.1|  40S ribosomal protein S3a                               317   8e-103   
ref|NP_058849.1|  40S ribosomal protein S3a                             316   8e-103   
gb|EMC77645.1|  40S ribosomal protein S3a                               315   8e-103   
ref|XP_004017251.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    316   1e-102   
dbj|BAE88391.1|  unnamed protein product                                316   1e-102   
gb|KDR16079.1|  40S ribosomal protein S3a                               316   1e-102   
ref|XP_009075160.1|  PREDICTED: 40S ribosomal protein S3a               315   1e-102   
ref|XP_004323125.1|  PREDICTED: 40S ribosomal protein S3a-like          316   1e-102   
ref|NP_001134789.1|  40S ribosomal protein S3a                          316   1e-102   
ref|XP_003923833.1|  PREDICTED: 40S ribosomal protein S3a               316   1e-102   
gb|KFO84143.1|  40S ribosomal protein S3a                               315   1e-102   
gb|AAH66926.1|  Ribosomal protein S3A                                   316   1e-102   
ref|NP_000997.1|  40S ribosomal protein S3a isoform 1                   316   1e-102   
gb|AAA35682.1|  ribosmal protein small subunit                          316   1e-102   
gb|ABY28374.1|  ribosomal protein S3a                                   316   1e-102   
ref|XP_009977023.1|  PREDICTED: 40S ribosomal protein S3a               315   1e-102   
dbj|BAE87927.1|  unnamed protein product                                316   1e-102   
gb|KFW97162.1|  40S ribosomal protein S3a                               315   1e-102   
gb|EFB26537.1|  hypothetical protein PANDA_001716                       315   1e-102   
ref|XP_010203978.1|  PREDICTED: 40S ribosomal protein S3a               315   1e-102   
ref|XP_008633930.1|  PREDICTED: 40S ribosomal protein S3a               316   1e-102   
ref|XP_006884543.1|  PREDICTED: 40S ribosomal protein S3a-like          316   1e-102   
ref|XP_005415772.1|  PREDICTED: 40S ribosomal protein S3a               315   1e-102   
ref|XP_010016125.1|  PREDICTED: 40S ribosomal protein S3a               315   1e-102   
ref|XP_006040183.1|  PREDICTED: 40S ribosomal protein S3a-like          316   1e-102   
ref|XP_005149010.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    316   1e-102   
gb|KFR12636.1|  40S ribosomal protein S3a                               315   1e-102   
ref|XP_001514859.1|  PREDICTED: 40S ribosomal protein S3a               316   1e-102   
gb|KFM10230.1|  40S ribosomal protein S3a                               315   1e-102   
ref|XP_009281624.1|  PREDICTED: 40S ribosomal protein S3a               315   2e-102   
gb|KFP91786.1|  40S ribosomal protein S3a                               315   2e-102   
ref|XP_005809444.1|  PREDICTED: 40S ribosomal protein S3a-like          316   2e-102   
ref|XP_004055608.1|  PREDICTED: 40S ribosomal protein S3a-like          315   2e-102   
sp|P61246.1|RS3A_FELCA  RecName: Full=40S ribosomal protein S3a         315   2e-102   
ref|NP_001185510.1|  40S ribosomal protein S3a                          315   2e-102   
ref|XP_005045047.1|  PREDICTED: 40S ribosomal protein S3a               315   2e-102   
ref|XP_006460029.1|  hypothetical protein AGABI2DRAFT_191800            315   2e-102   
ref|XP_003797009.1|  PREDICTED: 40S ribosomal protein S3a-like is...    315   2e-102   
ref|XP_005436755.1|  PREDICTED: 40S ribosomal protein S3a               315   2e-102   
ref|XP_008933878.1|  PREDICTED: 40S ribosomal protein S3a               315   2e-102   
ref|XP_010311392.1|  PREDICTED: 40S ribosomal protein S3a               315   2e-102   
ref|XP_009969079.1|  PREDICTED: 40S ribosomal protein S3a               315   2e-102   
ref|XP_006174472.1|  PREDICTED: 40S ribosomal protein S3a               315   2e-102   
gb|EUC65367.1|  40s ribosomal protein s3ae                              315   2e-102   
ref|XP_009873775.1|  PREDICTED: 40S ribosomal protein S3a               315   2e-102   
ref|XP_007338149.1|  40S ribosomal protein S1                           315   2e-102   
sp|Q6DV02.3|RS3A_GECJA  RecName: Full=40S ribosomal protein S3a         315   2e-102   
ref|NP_058655.3|  40S ribosomal protein S3a                             315   2e-102   
ref|XP_006779434.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    315   2e-102   
dbj|BAE32029.1|  unnamed protein product                                315   2e-102   
ref|XP_003221796.1|  PREDICTED: 40S ribosomal protein S3a               315   2e-102   
ref|XP_006985395.1|  PREDICTED: 40S ribosomal protein S3a-like          315   2e-102   
ref|XP_008931489.1|  PREDICTED: 40S ribosomal protein S3a               315   3e-102   
ref|XP_007364341.1|  40S ribosomal protein S1                           315   3e-102   
ref|XP_004411050.1|  PREDICTED: 40S ribosomal protein S3a-like          316   3e-102   
emb|CCA67212.1|  probable ribosomal protein 10, cytosolic               315   3e-102   
ref|XP_003797010.1|  PREDICTED: 40S ribosomal protein S3a-like is...    315   3e-102   
ref|XP_003417586.1|  PREDICTED: 40S ribosomal protein S3a               315   3e-102   
ref|XP_007437219.1|  PREDICTED: 40S ribosomal protein S3a-like          315   3e-102   
gb|EOB04964.1|  40S ribosomal protein S3a                               314   3e-102   
ref|XP_009099772.1|  PREDICTED: 40S ribosomal protein S3a               314   4e-102   
ref|XP_005014766.1|  PREDICTED: 40S ribosomal protein S3a               314   4e-102   
dbj|BAB22611.1|  unnamed protein product                                315   4e-102   
ref|NP_001008075.1|  40S ribosomal protein S3a                          315   4e-102   
gb|KIL70132.1|  hypothetical protein M378DRAFT_605469                   314   4e-102   
ref|NP_001291168.1|  ribosomal protein S3A                              315   4e-102   
ref|NP_001075886.1|  ribosomal protein S3A                              315   4e-102   
ref|XP_008285008.1|  PREDICTED: 40S ribosomal protein S3a               315   4e-102   
sp|O43999.3|RS3A_EIMTE  RecName: Full=40S ribosomal protein S3a; ...    314   5e-102   
ref|XP_005307414.1|  PREDICTED: 40S ribosomal protein S3a               314   5e-102   
sp|A2Q0R8.1|RS3A_SOLSE  RecName: Full=40S ribosomal protein S3a         314   5e-102   
ref|XP_009509149.1|  PREDICTED: 40S ribosomal protein S3a               314   5e-102   
dbj|BAE30393.1|  unnamed protein product                                314   5e-102   
ref|XP_008852472.1|  PREDICTED: 40S ribosomal protein S3a               314   6e-102   
gb|ETE70827.1|  40S ribosomal protein S3a                               314   6e-102   
ref|XP_005330207.1|  PREDICTED: 40S ribosomal protein S3a-like          314   6e-102   
ref|XP_003205487.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    314   6e-102   
ref|XP_003267670.1|  PREDICTED: 40S ribosomal protein S3a-like          314   7e-102   
ref|NP_001270826.1|  40S ribosomal protein S3a                          314   7e-102   
gb|ACQ58827.1|  40S ribosomal protein S3a                               314   7e-102   
sp|Q4PM31.1|RS3A_IXOSC  RecName: Full=40S ribosomal protein S3a         314   8e-102   
ref|XP_011708862.1|  PREDICTED: 40S ribosomal protein S3a               314   8e-102   
ref|XP_008314924.1|  PREDICTED: 40S ribosomal protein S3a               314   8e-102   
ref|XP_007469965.1|  PREDICTED: 40S ribosomal protein S3a               314   9e-102   
ref|XP_006262711.1|  PREDICTED: 40S ribosomal protein S3a               314   9e-102   
ref|XP_005955989.1|  PREDICTED: 40S ribosomal protein S3a-like is...    314   9e-102   
gb|KFH70745.1|  40S ribosomal protein S1                                313   9e-102   
gb|EAX04989.1|  ribosomal protein S3A, isoform CRA_b                    313   1e-101   
ref|XP_007230303.1|  PREDICTED: 40S ribosomal protein S3a               313   1e-101   
ref|XP_009480002.1|  PREDICTED: 40S ribosomal protein S3a               314   1e-101   
ref|NP_001104210.1|  40S ribosomal protein S3a-B                        313   1e-101   
ref|NP_001080325.1|  40S ribosomal protein S3a-A                        313   1e-101   
ref|XP_010410434.1|  PREDICTED: 40S ribosomal protein S3a               313   1e-101   
ref|XP_005500910.1|  PREDICTED: 40S ribosomal protein S3a               314   1e-101   
gb|ELW50426.1|  40S ribosomal protein S3a                               315   1e-101   
gb|KDQ29255.1|  hypothetical protein PLEOSDRAFT_1089059                 313   1e-101   
dbj|BAE27060.1|  unnamed protein product                                313   2e-101   
ref|XP_009544052.1|  hypothetical protein HETIRDRAFT_458158             313   2e-101   
ref|XP_011421732.1|  PREDICTED: 40S ribosomal protein S3a-like          313   2e-101   
ref|NP_001279332.1|  ribosomal protein S3A                              313   2e-101   
ref|XP_005707378.1|  40S ribosomal protein S3A isoform 2                313   2e-101   
ref|XP_007902210.1|  PREDICTED: 40S ribosomal protein S3a               313   2e-101   
gb|EKC30815.1|  40S ribosomal protein S3a                               314   2e-101   
ref|XP_003945196.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    313   2e-101   
sp|Q6EV04.1|RS3A_BIPLU  RecName: Full=40S ribosomal protein S3a         313   2e-101   
ref|XP_008619762.1|  40S ribosomal protein S3a-2                        313   2e-101   
ref|XP_006629554.1|  PREDICTED: 40S ribosomal protein S3a-like          313   2e-101   
ref|XP_001501524.2|  PREDICTED: 40S ribosomal protein S3a               317   2e-101   
gb|KIJ56726.1|  hypothetical protein M422DRAFT_72882                    312   3e-101   
ref|NP_956353.1|  40S ribosomal protein S3a                             313   3e-101   
gb|KDO28449.1|  40S ribosomal protein S3a-2                             312   3e-101   
ref|XP_010559325.1|  PREDICTED: 40S ribosomal protein S3a               314   3e-101   
ref|XP_011421723.1|  PREDICTED: 40S ribosomal protein S3a-like          312   3e-101   
ref|XP_005996413.1|  PREDICTED: 40S ribosomal protein S3a               312   4e-101   
ref|XP_005542823.1|  PREDICTED: 40S ribosomal protein S3a-like          312   4e-101   
ref|XP_004349214.1|  ribosomal protein S3a                              312   4e-101   
ref|XP_005954137.1|  PREDICTED: 40S ribosomal protein S3a-like is...    312   5e-101   
ref|XP_005871471.1|  PREDICTED: 40S ribosomal protein S3a               316   5e-101   
ref|XP_003473456.1|  PREDICTED: 40S ribosomal protein S3a-like          312   5e-101   
ref|XP_005692628.1|  PREDICTED: 40S ribosomal protein S3a-like          311   5e-101   
ref|XP_005954900.1|  PREDICTED: 40S ribosomal protein S3a-like          311   5e-101   
ref|XP_003972467.1|  PREDICTED: 40S ribosomal protein S3a               312   5e-101   
ref|XP_002901276.1|  40S ribosomal protein S3a                          311   6e-101   
sp|Q98TX2.3|RS3A_OPHHA  RecName: Full=40S ribosomal protein S3a         311   6e-101   
ref|XP_009328112.1|  PREDICTED: 40S ribosomal protein S3a               313   8e-101   
emb|CAD91420.1|  ribosomal protein S3a                                  311   9e-101   
gb|ABS44871.1|  ribosomal protein S3Ae                                  311   9e-101   
gb|AFM88910.1|  40S ribosomal protein S3a                               311   9e-101   
ref|XP_003773191.1|  PREDICTED: 40S ribosomal protein S3a               317   1e-100   
ref|XP_006879080.1|  PREDICTED: 40S ribosomal protein S3a-like          311   1e-100   
emb|CDR40922.1|  RHTO0S05e08922g1_1                                     311   1e-100   
gb|AFM85626.1|  40S ribosomal protein S3a                               311   1e-100   
sp|Q4T8S6.3|RS3A_TETNG  RecName: Full=40S ribosomal protein S3a         311   1e-100   
ref|XP_001601315.1|  PREDICTED: 40S ribosomal protein S3a               311   1e-100   
pdb|4KZX|B  Chain B, Rabbit 40s Ribosomal Subunit In Complex With...    311   1e-100   
ref|XP_001099771.1|  PREDICTED: 40S ribosomal protein S3a-like          311   1e-100   
ref|XP_011911817.1|  PREDICTED: 40S ribosomal protein S3a-like          310   1e-100   
gb|ADO29317.1|  40S ribosomal protein s3a                               310   2e-100   
ref|XP_005967889.1|  PREDICTED: 40S ribosomal protein S3a-like          310   2e-100   
ref|XP_003740510.1|  PREDICTED: 40S ribosomal protein S3a-like          310   2e-100   
ref|XP_007528141.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    310   2e-100   
gb|AFM90263.1|  40S ribosomal protein S3a                               310   2e-100   
gb|KDE09348.1|  40S ribosomal protein S1                                310   2e-100   
gb|ACD61705.1|  ribosomal protein S3                                    310   2e-100   
ref|NP_001098311.1|  40S ribosomal protein S3a                          310   2e-100   
ref|XP_007635341.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    310   3e-100   
gb|AAT44427.1|  V-Fos transformation effector-like protein              309   3e-100   
ref|XP_003449725.1|  PREDICTED: 40S ribosomal protein S3a-like          310   3e-100   
tpg|DAA12651.1|  TPA: ribosomal protein S3a-like                        310   3e-100   
ref|XP_010727857.1|  PREDICTED: 40S ribosomal protein S3a isoform X1    310   4e-100   
ref|XP_009520284.1|  hypothetical protein PHYSODRAFT_285013             309   4e-100   
gb|KIV90937.1|  40S ribosomal protein S1                                309   4e-100   
ref|NP_001131091.1|  40S ribosomal protein S3a                          309   4e-100   
ref|XP_008588996.1|  PREDICTED: 40S ribosomal protein S3a-like          311   5e-100   
emb|CBJ29379.1|  conserved unknown protein                              309   5e-100   
ref|XP_008900376.1|  40S ribosomal protein S3a                          309   5e-100   
ref|XP_006958032.1|  40S ribosomal protein S1                           308   6e-100   
gb|AFM88988.1|  ribosomal protein S3a                                   309   6e-100   
ref|XP_009827334.1|  hypothetical protein H257_04494                    309   7e-100   
ref|XP_009024124.1|  hypothetical protein HELRODRAFT_185887             308   8e-100   
ref|XP_002744350.1|  PREDICTED: 40S ribosomal protein S3a               309   8e-100   
ref|XP_006693334.1|  hypothetical protein CTHT_0028780                  308   1e-99    
ref|XP_007874563.1|  hypothetical protein PNEG_02550                    308   1e-99    
ref|XP_003433155.1|  PREDICTED: 40S ribosomal protein S3a-like          308   1e-99    
ref|XP_004045861.1|  PREDICTED: 40S ribosomal protein S3a-like is...    308   1e-99    
gb|AGQ03805.1|  ribosomal protein S3A                                   308   1e-99    
gb|AAK95185.1|  40S ribosomal protein S3a                               308   2e-99    
gb|EJT50838.1|  40s ribosomal protein s3ae-a (s1-a)                     308   2e-99    
ref|XP_001931333.1|  40S ribosomal protein S1                           307   3e-99    
ref|XP_008872125.1|  hypothetical protein H310_08228                    307   3e-99    
gb|EAX04994.1|  ribosomal protein S3A, isoform CRA_g                    307   4e-99    
ref|XP_009269707.1|  40S ribosomal protein S1                           307   4e-99    
ref|XP_007686274.1|  hypothetical protein COCMIDRAFT_90741              306   4e-99    
gb|EMS23756.1|  40S ribosomal protein s1                                308   4e-99    
ref|XP_005978767.1|  PREDICTED: 40S ribosomal protein S3a-like          306   5e-99    
ref|XP_005641295.1|  PREDICTED: 40S ribosomal protein S3a-like          306   5e-99    
sp|A2R9S1.1|RS3A_ASPNC  RecName: Full=40S ribosomal protein S1          306   5e-99    
ref|XP_007927383.1|  hypothetical protein MYCFIDRAFT_87079              306   5e-99    
dbj|BAN20332.1|  ribosomal protein S3A                                  306   5e-99    
sp|A6YPJ8.1|RS3A_TRIIF  RecName: Full=40S ribosomal protein S3a         306   6e-99    
gb|AFM88390.1|  ribosomal protein S3a                                   306   7e-99    
gb|KEQ76235.1|  ribosomal protein S3Ae                                  306   8e-99    
ref|XP_009210953.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    306   9e-99    
ref|XP_002463139.1|  hypothetical protein SORBIDRAFT_02g038380          304   1e-98    
ref|XP_007696626.1|  hypothetical protein COCSADRAFT_34493              305   1e-98    
gb|KEQ61803.1|  ribosomal protein S3Ae                                  305   1e-98    
ref|XP_008555289.1|  PREDICTED: 40S ribosomal protein S3a               306   1e-98    
ref|XP_008023145.1|  hypothetical protein SETTUDRAFT_176044             305   1e-98    
ref|XP_007707649.1|  hypothetical protein COCCADRAFT_83997              305   1e-98    
gb|EMD91948.1|  hypothetical protein COCHEDRAFT_1173335                 305   1e-98    
ref|XP_011495909.1|  PREDICTED: 40S ribosomal protein S3a               305   1e-98    
ref|XP_004412479.1|  PREDICTED: 40S ribosomal protein S3a-like          305   2e-98    
gb|KJJ35027.1|  hypothetical protein P034_06448279                      305   2e-98    
ref|XP_004337280.1|  40S ribosomal protein S3a, putative                305   2e-98    
gb|EDM00797.1|  rCG62728, isoform CRA_b                                 304   2e-98    
ref|XP_001276080.1|  40S ribosomal protein S1                           305   2e-98    
dbj|GAA97694.1|  hypothetical protein E5Q_04372                         305   2e-98    
sp|Q4KTD9.1|RS3A_SUBDO  RecName: Full=40S ribosomal protein S3a         305   2e-98    
ref|XP_001817129.1|  40S ribosomal protein S1                           305   2e-98    
ref|XP_754085.1|  40S ribosomal protein S3Ae                            305   3e-98    
ref|XP_003883511.1|  hypothetical protein NCLIV_032660                  305   3e-98    
ref|XP_007116397.1|  PREDICTED: 40S ribosomal protein S3a-like          305   3e-98    
gb|EHH54012.1|  hypothetical protein EGM_14744                          305   3e-98    
gb|AEE62515.1|  unknown                                                 304   4e-98    
ref|XP_005538843.1|  40S ribosomal protein S3A                          305   4e-98    
ref|XP_001218106.1|  40S ribosomal protein S1                           304   5e-98    
gb|EME43162.1|  hypothetical protein DOTSEDRAFT_72517                   303   6e-98    
ref|XP_003786993.1|  PREDICTED: 40S ribosomal protein S3a-like          304   7e-98    
ref|XP_003850287.1|  40S ribosomal protein S1                           303   8e-98    
ref|XP_011645027.1|  PREDICTED: 40S ribosomal protein S3a               303   1e-97    
ref|XP_011259689.1|  PREDICTED: 40S ribosomal protein S3a               303   1e-97    
ref|XP_007291650.1|  40S ribosomal protein S3                           303   1e-97    
sp|Q56FG9.1|RS3A_LYSTE  RecName: Full=40S ribosomal protein S3a         303   1e-97    
gb|EIF47090.1|  40s ribosomal protein s3ae                              303   1e-97    
ref|XP_009457116.1|  PREDICTED: 40S ribosomal protein S3a {ECO:00...    303   2e-97    
ref|XP_003191240.1|  40s ribosomal protein s3ae-a (s1-a)                303   2e-97    
gb|KGB79628.1|  40S ribosomal protein S3ae-a                            302   2e-97    
gb|KEF61644.1|  40S ribosomal protein S1                                302   2e-97    
ref|XP_007586018.1|  putative 40s ribosomal protein s1 protein          302   2e-97    
ref|XP_568980.1|  40s ribosomal protein s3ae-a (s1-a)                   302   2e-97    
ref|XP_002368140.1|  40S ribosomal protein S3a, putative                302   2e-97    



>ref|XP_011090682.1| PREDICTED: 40S ribosomal protein S3a [Sesamum indicum]
Length=260

 Score =   452 bits (1164),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 217/234 (93%), Positives = 226/234 (97%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDIKAPSVFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCI FTKKRV
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIAFTKKRV  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVQKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLG+LMEVHGDY+EDVG KLDRP A+EP AE TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGRLMEVHGDYSEDVGVKLDRP-AEEPAAEPTEVVGA  260



>emb|CDO99096.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   452 bits (1163),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 214/234 (91%), Positives = 227/234 (97%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNY+LR+FCIGFTKKR+
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYSLRLFCIGFTKKRL  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPE IGREIEKATSSIYPL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPELIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRK KILKAPKFDLGKLMEVHGDY+EDVG K+DRP A+EP+AEATE VGA
Sbjct  208  QNVFIRKAKILKAPKFDLGKLMEVHGDYSEDVGVKVDRP-AEEPVAEATEVVGA  260



>ref|NP_001275164.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
 gb|ABB72801.1| 40S ribosomal protein S3a-like protein [Solanum tuberosum]
Length=260

 Score =   444 bits (1142),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 215/234 (92%), Positives = 222/234 (95%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  28   DWYDIKAPSVFGVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNF GMDFTTDKLRSLVKKWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLG+LMEVHGDY+EDVG K+DRPA D    E TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGRLMEVHGDYSEDVGVKVDRPAEDVA-TEPTEVVGA  260



>sp|P33444.4|RS3A_CATRO RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Catharanthus roseus]
Length=261

 Score =   444 bits (1141),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 212/235 (90%), Positives = 225/235 (96%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLV KFIPESIGREIEKATSSIYPL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVQKFIPESIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTE-DVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY E D+GTKLDRP A+E +AE TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYNEDDIGTKLDRP-AEEAVAEPTEVIGA  261



>ref|XP_004247589.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=260

 Score =   442 bits (1137),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 223/235 (95%), Gaps = 3/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  28   DWYDIKAPSVFGVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNF GMDFTTDKLRSLVKKWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDL LKFIPESIGREIEKATSSIYPL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLALKFIPESIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVFIRKVKILKAPKFDLG+LMEVHGDY+EDVG K+DRPA D  IA E TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGRLMEVHGDYSEDVGVKVDRPAED--IATEPTEVVGA  260



>ref|XP_011073454.1| PREDICTED: 40S ribosomal protein S3a-like [Sesamum indicum]
Length=260

 Score =   437 bits (1123),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 207/218 (95%), Positives = 214/218 (98%), Gaps = 0/218 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDIKAPSVFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCI FTKKRV
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIAFTKKRV  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVQKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDR  855
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KLDR
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLDR  245



>ref|XP_002283142.1| PREDICTED: 40S ribosomal protein S3a-1 [Vitis vinifera]
 sp|A5B4K1.1|RS3A1_VITVI RecName: Full=40S ribosomal protein S3a-1 [Vitis vinifera]
 emb|CAN67522.1| hypothetical protein VITISV_020206 [Vitis vinifera]
 emb|CBI26295.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   435 bits (1119),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 207/235 (88%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFEVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQADEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTKKRV
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKKRV  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+TCYAQSSQIRQIRRKMREIM N A SCDLK+LV KFIPESIGREIEKATSSIYPL
Sbjct  148  NQNKKTCYAQSSQIRQIRRKMREIMTNMATSCDLKELVKKFIPESIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+EDVGTKL+RP ADEP+AE  TE +GA
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGTKLERP-ADEPVAEGVTEVIGA  261



>gb|EPS71864.1| hypothetical protein M569_02887, partial [Genlisea aurea]
Length=266

 Score =   435 bits (1119),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 207/234 (88%), Positives = 222/234 (95%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED++FRKIRLR
Sbjct  34   DWYDVKAPSIFNTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSFRKIRLR  93

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLR+FCI FTKKR 
Sbjct  94   AEDVQGKSVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRLFCIAFTKKRA  153

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKMREIM+NQAQS DLKDLV KFIPESIG+EIEKATS IYPL
Sbjct  154  NQQKRTCYAQSSQIRQIRRKMREIMINQAQSSDLKDLVQKFIPESIGKEIEKATSGIYPL  213

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVGTKL+RP A+E  AE  E  GA
Sbjct  214  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGTKLERP-AEESTAEPVEVPGA  266



>ref|XP_010034641.1| PREDICTED: 40S ribosomal protein S3a [Eucalyptus grandis]
Length=261

 Score =   434 bits (1116),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 207/235 (88%), Positives = 223/235 (95%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            +EDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   SEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATTCDLKELVRKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+ED+G KLDRP ADEP+AE  TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDIGVKLDRP-ADEPVAEVPTEVIGA  261



>ref|XP_010553319.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   434 bits (1116),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 207/235 (88%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFTVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RP ADEP+A E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVERP-ADEPMAEEPTEVIGA  261



>ref|XP_010938988.1| PREDICTED: 40S ribosomal protein S3a-like [Elaeis guineensis]
Length=261

 Score =   433 bits (1114),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 207/234 (88%), Positives = 217/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQTSQIRQIRRKMREIMVNQATSCDLKDLVQKFIPEVIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG K+DRPA D  +    E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKIDRPADDVQMEGEPEVVGA  261



>gb|EYU23687.1| hypothetical protein MIMGU_mgv1a012196mg [Erythranthe guttata]
Length=259

 Score =   433 bits (1113),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 207/234 (88%), Positives = 221/234 (94%), Gaps = 2/234 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+AFRKIRLR
Sbjct  28   DWYDVKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRLFCIAFTKKRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIMV QAQSCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMHEIMVAQAQSCDLKELVQKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNV+IRKVKILKAPKFDLGKLMEVHGDYTE+VG K++R  A+E  AE TE VGA
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYTEEVGVKVER--AEETAAEPTEVVGA  259



>ref|XP_012089233.1| PREDICTED: 40S ribosomal protein S3a-1 [Jatropha curcas]
 gb|KDP23643.1| hypothetical protein JCGZ_23476 [Jatropha curcas]
Length=263

 Score =   433 bits (1113),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 222/236 (94%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM+NQA SCDLK+LV KFIPE IGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMINQASSCDLKELVAKFIPEMIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+ +D+G KLDRP ADE IAEA TE VGA
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYSADDIGVKLDRP-ADETIAEAETEVVGA  262



>ref|XP_010942777.1| PREDICTED: 40S ribosomal protein S3a [Elaeis guineensis]
Length=261

 Score =   432 bits (1112),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/234 (88%), Positives = 218/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPL
Sbjct  148  NQVKRTCYAQTSQIRQIRRKMREIMVNQATSCDLKDLVQKFIPEVIGKEIEKATTSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG K+DRPA D P+    E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKIDRPADDVPMEGEPEVVGA  261



>gb|AFS65104.1| 40S ribosomal protein S3a-like protein [Elaeis guineensis]
Length=261

 Score =   432 bits (1112),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/234 (88%), Positives = 218/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPL
Sbjct  148  NQVKRTCYAQTSQIRQIRRKMREIMVNQAASCDLKDLVQKFIPEVIGKEIEKATTSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG K+DRPA D P+    E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKIDRPADDVPMEGEPEVVGA  261



>gb|AFK33413.1| unknown [Lotus japonicus]
Length=261

 Score =   432 bits (1111),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 204/234 (87%), Positives = 219/234 (94%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM+NQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMINQATSCDLKELVRKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVGTK+DRPA +  +  ATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGTKVDRPADETVVEGATEVVGA  261



>gb|KHN30486.1| 40S ribosomal protein S3a, partial [Glycine soja]
Length=242

 Score =   431 bits (1108),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 203/234 (87%), Positives = 219/234 (94%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  9    DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  68

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  69   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  128

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  129  NQVKRTCYAQSSQVRQIRRKMREIMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPL  188

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRPA +    EATE VGA
Sbjct  189  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGAKVDRPADETLAEEATEVVGA  242



>ref|XP_003610736.1| 40S ribosomal protein S3a-like protein [Medicago truncatula]
 gb|AES93694.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   431 bits (1109),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 207/235 (88%), Positives = 221/235 (94%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+N+LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNLLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM+NQA SCDLKDLV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMINQATSCDLKDLVRKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVGTK++RP ADE + E T E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGTKVERP-ADETMVEGTPEIVGA  261



>ref|NP_001241005.1| uncharacterized protein LOC100805519 [Glycine max]
 gb|ACU23898.1| unknown [Glycine max]
Length=261

 Score =   431 bits (1109),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 203/234 (87%), Positives = 219/234 (94%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMREIMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRPA +    EATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGAKVDRPADETLAEEATEVVGA  261



>ref|XP_008438626.1| PREDICTED: 40S ribosomal protein S3a [Cucumis melo]
Length=261

 Score =   431 bits (1108),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 220/234 (94%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQASSCDLKELVRKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RPA +  +  ATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVERPADEAAVEGATEVVGA  261



>ref|XP_010274385.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   431 bits (1108),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 217/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIK PS+FS R IGKTLVTRTQGTKIASEGLKHRVFEV LADLQND+D ++RKIRLR
Sbjct  28   DWYDIKVPSIFSVRTIGKTLVTRTQGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFT++R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTRRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+ED+G K+DRPA D P+   TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDIGVKVDRPAEDAPVEGETEVIGA  261



>ref|XP_004134125.1| PREDICTED: 40S ribosomal protein S3a [Cucumis sativus]
 gb|KGN56950.1| hypothetical protein Csa_3G146360 [Cucumis sativus]
Length=261

 Score =   431 bits (1108),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 220/234 (94%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQEDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQASSCDLKELVRKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RPA +  +  ATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVERPADETAVEGATEVVGA  261



>ref|XP_010553762.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=261

 Score =   431 bits (1107),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 217/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMV +A SCDLK+LV KFIPE+IGREIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RPA +    E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVERPADESMAEEPTEVIGA  261



>ref|XP_007030615.1| Ribosomal protein S3Ae [Theobroma cacao]
 gb|EOY11117.1| Ribosomal protein S3Ae [Theobroma cacao]
Length=261

 Score =   431 bits (1107),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 208/235 (89%), Positives = 219/235 (93%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNERNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNY+LR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYSLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQASSCDLKELVAKFIPEVIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KL+RP ADE  AE  TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLERP-ADETTAEGETEVVGA  261



>ref|NP_001239858.1| uncharacterized protein LOC100808747 [Glycine max]
 gb|ACU23875.1| unknown [Glycine max]
 gb|KHN35171.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   430 bits (1105),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 203/234 (87%), Positives = 219/234 (94%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +NIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATACDLKELVRKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRPA +    EATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGAKVDRPADETLAEEATEVVGA  261



>ref|XP_004153483.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis sativus]
 gb|KGN61672.1| hypothetical protein Csa_2G223140 [Cucumis sativus]
Length=260

 Score =   429 bits (1104),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 204/234 (87%), Positives = 221/234 (94%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG++IEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVRKFIPESIGKDIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRP A+E +  ATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDRP-AEEAVEGATEVVGA  260



>ref|XP_008449325.1| PREDICTED: 40S ribosomal protein S3a-like [Cucumis melo]
Length=260

 Score =   429 bits (1104),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 204/234 (87%), Positives = 221/234 (94%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQEDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KW +LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWHTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG++IEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVRKFIPESIGKDIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRP A+E +  ATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDRP-AEEAVEGATEIVGA  260



>ref|XP_010024230.1| PREDICTED: 40S ribosomal protein S3a-like [Eucalyptus grandis]
 gb|KCW60692.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=261

 Score =   429 bits (1104),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 205/235 (87%), Positives = 222/235 (94%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLV+RTQGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVSRTQGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   CEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVRKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+ED+G KLDRP ADE +AEA TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDIGVKLDRP-ADETVAEAPTEVIGA  261



>ref|XP_007157117.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
 gb|AGZ15363.1| 40S ribosomal protein S3a-like protein [Phaseolus vulgaris]
 gb|ESW29111.1| hypothetical protein PHAVU_002G044200g [Phaseolus vulgaris]
Length=261

 Score =   429 bits (1102),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 201/234 (86%), Positives = 220/234 (94%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++F+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATACDLKELVRKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVGTK++RPA +  +  ATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGTKVERPAEETVVEGATEVVGA  261



>ref|XP_010259119.1| PREDICTED: 40S ribosomal protein S3a-1 [Nelumbo nucifera]
Length=261

 Score =   428 bits (1101),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 219/234 (94%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLR
Sbjct  28   DWYDIKAPSIFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RPA D+     TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKMERPADDQIAEGETEVVGA  261



>ref|XP_010550935.1| PREDICTED: 40S ribosomal protein S3a-2-like [Tarenaya hassleriana]
Length=261

 Score =   428 bits (1101),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 200/234 (85%), Positives = 217/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMV +A SCDLK+LV KFIPE+IGREIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RPA +    E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVERPADETMAEEPTEVIGA  261



>ref|XP_010090259.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB39197.1| 40S ribosomal protein S3a [Morus notabilis]
Length=262

 Score =   428 bits (1101),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 219/236 (93%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSLFNQRQVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FT++R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTRRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM+NQA SCDLKDLV KFIPE IGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMINQATSCDLKDLVNKFIPEMIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPI--AEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRP ADE I   E TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDRP-ADETIVEGEVTEVVGA  262



>ref|XP_004496691.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
 ref|XP_004517272.1| PREDICTED: 40S ribosomal protein S3a-like [Cicer arietinum]
Length=261

 Score =   428 bits (1101),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 222/235 (94%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++AF+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM+NQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMINQATSCDLKELVRKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY++D+GTK+DRP ADE IA E TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSDDIGTKVDRP-ADETIAEETTEVVGA  261



>ref|XP_007034836.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
 gb|EOY05762.1| Ribosomal protein S3Ae isoform 2 [Theobroma cacao]
Length=246

 Score =   427 bits (1098),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRL
Sbjct  12   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRL  71

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  72   RAEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  131

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYP
Sbjct  132  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYP  191

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            LQNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP ADE +AEA TE VGA
Sbjct  192  LQNVFIRKVKILKAPKFDLGKLMEVHGDYGEDVGVKLERP-ADETMAEATTEVVGA  246



>gb|ACU18272.1| unknown [Glycine max]
Length=261

 Score =   427 bits (1098),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 201/234 (86%), Positives = 217/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTK ASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKTASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIG TK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGLTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMREIMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRPA +    EATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGAKVDRPADETLAEEATEVVGA  261



>ref|XP_007034835.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
 gb|EOY05761.1| Ribosomal protein S3Ae isoform 1 [Theobroma cacao]
Length=262

 Score =   427 bits (1098),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            LQNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP ADE +AEA TE VGA
Sbjct  208  LQNVFIRKVKILKAPKFDLGKLMEVHGDYGEDVGVKLERP-ADETMAEATTEVVGA  262



>ref|XP_011026951.1| PREDICTED: 40S ribosomal protein S3a-2 [Populus euphratica]
Length=259

 Score =   427 bits (1097),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 216/228 (95%), Gaps = 1/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRT YAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQVKRTTYAQSSQIRQIRRKMREIMTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KLDRP A+E +AEA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLDRP-AEETMAEA  254



>gb|KHN02741.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   427 bits (1097),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 220/235 (94%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM NQA +CDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMTNQATACDLKELVRKFIPEIIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVF+RKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRP ADE +A E TE VGA
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>ref|XP_010272784.1| PREDICTED: 40S ribosomal protein S3a-like [Nelumbo nucifera]
Length=261

 Score =   427 bits (1097),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 217/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ R +GKTLVTRTQGTKIASEGLKHRVFEV LADLQND+D ++RKIRLR
Sbjct  28   DWYDIKAPSVFNVRTVGKTLVTRTQGTKIASEGLKHRVFEVCLADLQNDDDQSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFT++R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTRRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQTSQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRPA D  +   TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDRPADDTQMEGETEIVGA  261



>ref|XP_010256142.1| PREDICTED: 40S ribosomal protein S3a-1-like [Nelumbo nucifera]
Length=261

 Score =   426 bits (1096),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 203/235 (86%), Positives = 222/235 (94%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+TRN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ D+D ++RKIRLR
Sbjct  28   DWYDIKAPSIFTTRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQADDDQSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+ED+G K++RP A+E +AE  TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDIGIKMERP-AEETMAEGETEVVGA  261



>ref|NP_001241430.1| uncharacterized protein LOC100813273 [Glycine max]
 gb|ACU21516.1| unknown [Glycine max]
 gb|KHN15736.1| 40S ribosomal protein S3a [Glycine soja]
Length=261

 Score =   426 bits (1096),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 220/235 (94%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM NQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMTNQATSCDLKELVRKFIPEIIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVF+RKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRP ADE +A E TE VGA
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>ref|XP_008811659.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein S3a-like 
[Phoenix dactylifera]
Length=261

 Score =   426 bits (1095),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 203/234 (87%), Positives = 216/234 (92%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPL
Sbjct  148  NQVKRTCYAQTSQIRQIRRKMREIMVNQAASCDLKDLVQKFIPEVIGKEIEKATTSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFD GKLMEVHGDY EDVG K+DRPA D  +    E VGA
Sbjct  208  QNVFIRKVKILKAPKFDXGKLMEVHGDYKEDVGVKIDRPADDVQMEGEPEVVGA  261



>ref|XP_002314671.2| ribosomal protein S3a [Populus trichocarpa]
 gb|ABK93373.1| unknown [Populus trichocarpa]
 gb|ABK93864.1| unknown [Populus trichocarpa]
 gb|EEF00842.2| ribosomal protein S3a [Populus trichocarpa]
Length=260

 Score =   426 bits (1095),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 203/234 (87%), Positives = 217/234 (93%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRT YAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQIKRTTYAQSSQIRQIRRKMREIMTAQATSCDLKELVRKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KL+RP ADEPIAEA     A
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLERP-ADEPIAEAPAETAA  260



>ref|XP_008804511.1| PREDICTED: 40S ribosomal protein S3a [Phoenix dactylifera]
Length=261

 Score =   426 bits (1095),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 218/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREI+VNQA SCDLKDLV KFIPE IG+EIEKAT+SIYPL
Sbjct  148  NQVKRTCYAQTSQIRQIRRKMREIVVNQATSCDLKDLVQKFIPEVIGKEIEKATTSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG K++RPA D P+    E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKIERPADDVPMEGEPEVVGA  261



>ref|XP_009779517.1| PREDICTED: 40S ribosomal protein S3a [Nicotiana sylvestris]
 sp|Q285L8.1|RS3A_TOBAC RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Nicotiana tabacum]
 gb|ABA41527.1| cyc07 [Nicotiana tabacum]
Length=261

 Score =   426 bits (1095),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 205/231 (89%), Positives = 217/231 (94%), Gaps = 2/231 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEP  894
            QNV+IRKVKILKAPKFD+GKLMEVHGDY+EDVG KLDRP ADE +AEA EP
Sbjct  208  QNVYIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKLDRP-ADETVAEA-EP  256



>ref|NP_001265990.1| 40S ribosomal protein S3a [Cicer arietinum]
 sp|Q8GTE3.1|RS3A_CICAR RecName: Full=40S ribosomal protein S3a [Cicer arietinum]
 emb|CAD56219.1| ribosomal protein S3a [Cicer arietinum]
Length=261

 Score =   426 bits (1095),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 204/235 (87%), Positives = 220/235 (94%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNAFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVRKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  903
            QNVFIRKVKILK+PKFDLGKLMEVHGDY+EDVGTK++ P ADE + E T E VGA
Sbjct  208  QNVFIRKVKILKSPKFDLGKLMEVHGDYSEDVGTKVESP-ADETVVEGTPEIVGA  261



>gb|ABK56834.1| RPS3 [Cymbidium hybrid cultivar]
Length=261

 Score =   426 bits (1094),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 199/234 (85%), Positives = 215/234 (92%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED ++RKIRLR
Sbjct  28   DWYDIKAPSVFTVRNIGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDQSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAH+DVKTTDNYTLR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHIDVKTTDNYTLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIM NQA SCDLK+LV KFIPE IG+EIEKAT+SIYPL
Sbjct  148  NQVKRTCYAQTSQIRQIRRKMREIMTNQASSCDLKELVQKFIPEVIGKEIEKATTSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY ED G KLDRP  D P+    E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDFGVKLDRPGEDVPVEGEAEVVGA  261



>ref|XP_009628663.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Nicotiana tomentosiformis]
 ref|XP_009763951.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   426 bits (1094),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 205/231 (89%), Positives = 217/231 (94%), Gaps = 2/231 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEP  894
            QNV+IRKVKILKAPKFD+GKLMEVHGDY+EDVG KLDRP ADE +AEA EP
Sbjct  208  QNVYIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKLDRP-ADETVAEA-EP  256



>ref|XP_011030646.1| PREDICTED: 40S ribosomal protein S3a-2-like [Populus euphratica]
Length=259

 Score =   425 bits (1092),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 215/228 (94%), Gaps = 1/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRT YAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQIKRTTYAQSSQIRQIRRKMREIMTAQATSCDLKELVRKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KL+RP  DEPIAEA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLERP-VDEPIAEA  254



>ref|XP_002512232.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF49684.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=263

 Score =   424 bits (1091),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 222/236 (94%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFKVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREI++NQA SCDLK+LVLKFIPESIGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREILINQAASCDLKELVLKFIPESIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+ +D+G KL+RP ADE +AE  TE VGA
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYSADDIGVKLERP-ADELMAEGETEVVGA  262



>ref|XP_006379849.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
 gb|ABK95865.1| unknown [Populus trichocarpa]
 gb|ERP57646.1| hypothetical protein POPTR_0008s15610g [Populus trichocarpa]
Length=259

 Score =   424 bits (1091),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 215/228 (94%), Gaps = 1/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRT YAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQVKRTTYAQSSQIRQIRRKMREIMTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KLDRP A+E +AEA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLDRP-AEETMAEA  254



>ref|XP_004235324.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   424 bits (1091),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 205/232 (88%), Positives = 215/232 (93%), Gaps = 1/232 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPV  897
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+EDVG KLDRP ADE +AEA   V
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLDRP-ADETVAEAEAEV  258



>ref|XP_002517085.1| 40S ribosomal protein S3a, putative [Ricinus communis]
 gb|EEF45248.1| 40S ribosomal protein S3a, putative [Ricinus communis]
Length=260

 Score =   424 bits (1090),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 216/228 (95%), Gaps = 1/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQI QIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYPL
Sbjct  148  NQIKRTCYAQSSQIGQIRRKMREIMTAQAASCDLKELVRKFIPETIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+EDVG KL+RP ADEP+AEA
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLERP-ADEPMAEA  254



>gb|KHG05975.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KHG27725.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   424 bits (1089),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 207/236 (88%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            LQNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  208  LQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  262



>ref|XP_009775368.1| PREDICTED: 40S ribosomal protein S3a-like [Nicotiana sylvestris]
Length=261

 Score =   424 bits (1089),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 204/231 (88%), Positives = 216/231 (94%), Gaps = 2/231 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEP  894
            QNV+IRKVKILKAPKFD+GKLMEVHGDY+EDVG KLDRP  DE +AEA EP
Sbjct  208  QNVYIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKLDRP-VDETVAEA-EP  256



>ref|XP_007137418.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
 gb|ESW09412.1| hypothetical protein PHAVU_009G125400g [Phaseolus vulgaris]
Length=261

 Score =   424 bits (1089),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 217/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFT DKLRSLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTNDKLRSLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKMREIM+NQA SCDLK+LV KFIPE IG+EIEKATSS+YPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMREIMINQATSCDLKELVRKFIPEMIGKEIEKATSSVYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLME+HGDY+ED+GTK++RP  +  +  ATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEIHGDYSEDIGTKVERPVDETMVEGATEVVGA  261



>ref|NP_001276152.1| 40S ribosomal protein S3a-like [Glycine max]
 gb|ACU22108.1| unknown [Glycine max]
Length=261

 Score =   424 bits (1089),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 203/235 (86%), Positives = 219/235 (93%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ D D+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDGDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM NQA +CDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMTNQATACDLKELVRKFIPEIIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVF+RKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRP ADE +A E TE VGA
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYSEDVGAKVDRP-ADEIVAEEPTEIVGA  261



>ref|XP_010524908.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
 ref|XP_010524909.1| PREDICTED: 40S ribosomal protein S3a-2 [Tarenaya hassleriana]
Length=262

 Score =   424 bits (1089),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 201/235 (86%), Positives = 217/235 (92%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMV +A SCDLK+LV KFIPE+IGREIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVKEASSCDLKELVAKFIPEAIGREIEKATQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+ EDVG K++RPA +    E TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSAEDVGVKVERPADETMAEEPTEIVGA  262



>ref|XP_009591686.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=261

 Score =   424 bits (1089),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 204/231 (88%), Positives = 216/231 (94%), Gaps = 2/231 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEP  894
            QNV+IRKVKILKAPKFD+GKLMEVHGDY+EDVG KLDRP  DE +AEA EP
Sbjct  208  QNVYIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKLDRP-TDETVAEA-EP  256



>ref|XP_006408143.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
 gb|ESQ49596.1| hypothetical protein EUTSA_v10021341mg [Eutrema salsugineum]
Length=262

 Score =   423 bits (1088),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 217/235 (92%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFSQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMV +A SCDLKDLV KFIPE+IGREIEKAT +IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVKEASSCDLKDLVAKFIPEAIGREIEKATQNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILK+PKFDLGKLMEVHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  208  QNVFIRKVKILKSPKFDLGKLMEVHGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_010675082.1| PREDICTED: 40S ribosomal protein S3a [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   423 bits (1088),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED  FRKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQNDEDQFFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDN+TLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNFTLRMFCIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRT YAQSSQIRQIRRKMREIMVNQA SCDLKDLV KFIPESIG+EIEKAT  IYPL
Sbjct  148  NQVKRTTYAQSSQIRQIRRKMREIMVNQASSCDLKDLVAKFIPESIGKEIEKATMGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA--TEPVGA  903
            QNV+IRKVKILK+PKFDLGKLMEVHGDY+EDVG KLDRP A+E +AE   TE VGA
Sbjct  208  QNVYIRKVKILKSPKFDLGKLMEVHGDYSEDVGVKLDRP-AEETMAEGETTEVVGA  262



>gb|EYU41450.1| hypothetical protein MIMGU_mgv1a002668mg [Erythranthe guttata]
Length=648

 Score =   437 bits (1124),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 209/234 (89%), Positives = 224/234 (96%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPSVF+TRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQ+DED+AFRKIRLR
Sbjct  416  DWYDVKAPSVFNTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQSDEDHAFRKIRLR  475

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLR+FCI FTKKR 
Sbjct  476  AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRLFCIAFTKKRA  535

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIMV Q+QSCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  536  NQQKRTCYAQSSQIRQIRRKMMEIMVAQSQSCDLKELVQKFIPESIGKEIEKATSSIYPL  595

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYTE+VG KLDR AA+E +AE TE VGA
Sbjct  596  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEEVGVKLDR-AAEEAVAEPTELVGA  648



>sp|P49198.2|RS3A_HELAN RecName: Full=40S ribosomal protein S3a [Helianthus annuus]
 gb|AAA80978.1| ribosomal protein S3a [Helianthus annuus]
Length=260

 Score =   423 bits (1087),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 211/218 (97%), Gaps = 0/218 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+++RKIRLR
Sbjct  28   DWYDIKAPSLFITRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMD TTDKLRSLVKKWQSLIEAHVDVKTTDN+TLRMFCIGFTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDVTTDKLRSLVKKWQSLIEAHVDVKTTDNFTLRMFCIGFTKKRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQI+QIRRKMREIMV QAQ+CDLK+LV KFIPESIGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIKQIRRKMREIMVTQAQTCDLKELVQKFIPESIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDR  855
            QNVFIRKVKILKAPKFD+GKLMEVHGDY+EDVG KLDR
Sbjct  208  QNVFIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKLDR  245



>ref|XP_006848758.1| PREDICTED: 40S ribosomal protein S3a [Amborella trichopoda]
 gb|ERN10339.1| hypothetical protein AMTR_s00026p00042160 [Amborella trichopoda]
Length=261

 Score =   423 bits (1087),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 197/234 (84%), Positives = 215/234 (92%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFE  LADLQNDED A++KIRLR
Sbjct  28   DWYDIKAPSIFNVRTVGKTLVTRTQGTKIASEGLKHRVFECCLADLQNDEDQAYKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMRE+M+NQA SCDLK+LV KFIPE IG+EIEK T SIYPL
Sbjct  148  NQVKRTCYAQTSQIRQIRRKMREVMINQATSCDLKELVQKFIPEVIGKEIEKVTMSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY++DVG K+DRPA D P+   TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSDDVGVKVDRPAEDVPLEGVTEVVGA  261



>ref|XP_006284351.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
 gb|EOA17249.1| hypothetical protein CARUB_v10005523mg [Capsella rubella]
Length=262

 Score =   423 bits (1087),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/235 (86%), Positives = 215/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQSLIEAHVDVKT+D YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTSDGYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLK+LV KFIPE+IG+EIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGKEIEKATQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPAEETVAEEPTEIIGA  262



>gb|KJB72261.1| hypothetical protein B456_011G167500 [Gossypium raimondii]
Length=262

 Score =   422 bits (1086),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 222/236 (94%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  903
            LQNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KL+RP ADE +AE+T E VGA
Sbjct  208  LQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLERP-ADETMAESTPEVVGA  262



>ref|XP_009618011.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Nicotiana tomentosiformis]
Length=260

 Score =   422 bits (1085),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 203/234 (87%), Positives = 215/234 (92%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED +FRKIRLR
Sbjct  28   DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNV+IRKVKILKAPKFD+GKLMEVHGDY+EDVG KLDRP ADE +    E  GA
Sbjct  208  QNVYIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKLDRP-ADETVEAEPEIPGA  260



>gb|KJB34507.1| hypothetical protein B456_006G069600 [Gossypium raimondii]
Length=262

 Score =   422 bits (1085),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 205/236 (87%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+AFRKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAFRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  903
            LQNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RP ADE +AEA  E +GA
Sbjct  208  LQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKIERP-ADETMAEAAPEVIGA  262



>ref|XP_010546607.1| PREDICTED: 40S ribosomal protein S3a-1-like [Tarenaya hassleriana]
Length=262

 Score =   422 bits (1085),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 203/236 (86%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAH+DVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHIDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM  +A SCDLK+LV KFIPE+IGREIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMAKEASSCDLKELVAKFIPEAIGREIEKATQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+ EDVG K+DRP  DE +A E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSAEDVGVKVDRP-TDEIMADEPTEVIGA  262



>ref|XP_009394355.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122} 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   421 bits (1083),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 199/234 (85%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMD TTDK+R LV+KWQ+LIEAHVDVKTTDNYTLR+FC GFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKVRYLVRKWQTLIEAHVDVKTTDNYTLRLFCFGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLKDLVLKFIPE IG+EIEKAT+SI+PL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQASSCDLKDLVLKFIPEVIGKEIEKATASIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG K++RPA D  +    E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKMERPAEDVQMEGEAEVVGA  261



>emb|CDO98656.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   421 bits (1083),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 220/235 (94%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFEVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM+FTTDK+RSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKVRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKKRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ+KRTCYAQSSQIRQIR+KM EIM NQA SCDLK+LV K IPESIGREIEK+T+SI+PL
Sbjct  148  NQRKRTCYAQSSQIRQIRKKMVEIMRNQASSCDLKELVAKIIPESIGREIEKSTTSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+EDVG KLDRP A+E +AE  TE VG+
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLDRP-AEETVAEGETEVVGS  261



>gb|ACJ85751.1| unknown [Medicago truncatula]
 gb|AFK34441.1| unknown [Medicago truncatula]
 gb|KEH43817.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   421 bits (1083),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 199/234 (85%), Positives = 216/234 (92%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIM+NQA SCDLK LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMVEIMINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVGTK++RPA +    E TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYNEDVGTKVERPADEMVTEEPTEIVGA  261



>ref|XP_003638196.1| 40S ribosomal protein S3a [Medicago truncatula]
Length=244

 Score =   421 bits (1081),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 199/234 (85%), Positives = 216/234 (92%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIAS+GLKHRVFEVSLADLQ DE++AFRKIRLR
Sbjct  11   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASDGLKHRVFEVSLADLQGDEEHAFRKIRLR  70

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  71   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  130

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIM+NQA SCDLK LV KFIPE IG+EIEKATSSIYPL
Sbjct  131  NQVKRTCYAQSSQIRQIRRKMVEIMINQASSCDLKGLVHKFIPEMIGKEIEKATSSIYPL  190

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVGTK++RPA +    E TE VGA
Sbjct  191  QNVFIRKVKILKAPKFDLGKLMEVHGDYNEDVGTKVERPADEMVTEEPTEIVGA  244



>ref|XP_010432386.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   421 bits (1082),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTKRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +TLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DR AADEP+A E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>ref|XP_006382773.1| 40S ribosomal protein S3A [Populus trichocarpa]
 gb|ERP60570.1| 40S ribosomal protein S3A [Populus trichocarpa]
Length=261

 Score =   421 bits (1082),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 202/235 (86%), Positives = 218/235 (93%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSQDIGVKIDRP-ADETVAEGETEVVGA  261



>ref|XP_010437575.1| PREDICTED: 40S ribosomal protein S3a-2 [Camelina sativa]
Length=262

 Score =   421 bits (1081),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSSFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +TLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DR AADEP+A E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>gb|KHG19560.1| 40S ribosomal S3a [Gossypium arboreum]
 gb|KJB28387.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=262

 Score =   421 bits (1081),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 221/236 (94%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  903
            LQNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RP ADE +AE T E +GA
Sbjct  208  LQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKIERP-ADETMAEPTPEVIGA  262



>ref|XP_011032434.1| PREDICTED: 40S ribosomal protein S3a [Populus euphratica]
Length=261

 Score =   421 bits (1081),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 202/235 (86%), Positives = 218/235 (93%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSQDIGVKIDRP-ADETMAEGETEVVGA  261



>ref|XP_002312545.2| ribosomal protein S3a [Populus trichocarpa]
 gb|EEE89912.2| ribosomal protein S3a [Populus trichocarpa]
Length=262

 Score =   420 bits (1080),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 203/231 (88%), Positives = 215/231 (93%), Gaps = 4/231 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSVFSVKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FT DKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTNDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRT YAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQVKRTTYAQSSQIRQIRRKMREIMTAQAASCDLKELVRKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLME---VHGDYTEDVGTKLDRPAADEPIAEA  885
            QNVFIRKVKILKAPKFDLGKLME   VHGDY+EDVG KLDRP A+E +AEA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEASIVHGDYSEDVGVKLDRP-AEETMAEA  257



>ref|XP_010447045.1| PREDICTED: 40S ribosomal protein S3a-2-like [Camelina sativa]
Length=262

 Score =   420 bits (1080),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/236 (86%), Positives = 218/236 (92%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSLFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD +T R+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGFTFRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKDLVAKFIPEAIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DR AADEP+A E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDR-AADEPVAEEPTEIIGA  262



>ref|NP_001066631.1| Os12g0406200 [Oryza sativa Japonica Group]
 gb|ABG21991.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29650.1| Os12g0406200 [Oryza sativa Japonica Group]
Length=260

 Score =   420 bits (1079),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 212/225 (94%), Gaps = 0/225 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPI  876
            QNVF+RKVKILKAPKFDLGKLMEVHGDY EDVGTKL+RPA DE +
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYKEDVGTKLERPAEDEVV  252



>sp|Q9MBB3.1|RS3A_DAUCA RecName: Full=40S ribosomal protein S3a; AltName: Full=Protein 
cyc07 [Daucus carota]
 dbj|BAA89498.1| cyc07 [Daucus carota]
Length=261

 Score =   419 bits (1078),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 215/234 (92%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+VF  +N+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPNVFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNF+GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDVQGKNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKKRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFD+GKLMEVHGDY+EDVG KL+RP  +  +   TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKLERPIEETMVEGETEVVGA  261



>ref|NP_195193.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 sp|Q42262.3|RS3A2_ARATH RecName: Full=40S ribosomal protein S3a-2 [Arabidopsis thaliana]
 emb|CAA04689.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAA18846.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 emb|CAB80184.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AAL32578.1| Putative S-phase-specific ribosomal protein [Arabidopsis thaliana]
 gb|AEE86408.1| 40S ribosomal protein S3a-2 [Arabidopsis thaliana]
Length=262

 Score =   419 bits (1078),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 213/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP  F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPGSFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRMFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLK+LV KFIPE+IGREIEKAT  IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETMVEEPTEIIGA  262



>ref|XP_006382772.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
 gb|ERP60569.1| hypothetical protein POPTR_0005s05280g [Populus trichocarpa]
Length=265

 Score =   419 bits (1078),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 202/235 (86%), Positives = 218/235 (93%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  32   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  91

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  92   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRP  151

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPL
Sbjct  152  NQVKRTCYAQSSQIRQIRRKMREIMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPL  211

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  212  QNVFIRKVKILKAPKFDLGKLMEVHGDYSQDIGVKIDRP-ADETVAEGETEVVGA  265



>dbj|BAA00860.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   418 bits (1075),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 197/211 (93%), Positives = 206/211 (98%), Gaps = 0/211 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGL+HRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLV KFIPESIGREIEKATSSIYPL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVQKFIPESIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTED  834
            QNVFIRKVKILKAPKFDLGKLMEVHGDY ED
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYNED  238



>ref|XP_007143300.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
 gb|ESW15294.1| hypothetical protein PHAVU_007G060700g [Phaseolus vulgaris]
Length=261

 Score =   419 bits (1077),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 200/234 (85%), Positives = 217/234 (93%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM NQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMSNQATSCDLKELVRKFIPEIIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVF+RKVKILKAPKFDLGKLMEVHGDY+EDVGTK+DRP  +    E TE VGA
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYSEDVGTKVDRPVEETTAEEPTEIVGA  261



>ref|XP_010485869.1| PREDICTED: 40S ribosomal protein S3a-1 [Camelina sativa]
Length=262

 Score =   419 bits (1077),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 215/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSMFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLM++HGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMDIHGDYTAEDVGVKVDRPAEEMAVEEPTEIIGA  262



>ref|XP_010419205.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=262

 Score =   418 bits (1075),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 215/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSMFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNV+IRKVKILKAPKFDLGKLM+VHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMDVHGDYTAEDVGVKVDRPAEEMAVEEPTEIIGA  262



>ref|XP_006663971.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   417 bits (1073),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 197/227 (87%), Positives = 213/227 (94%), Gaps = 1/227 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA  879
            QNVF+RKVKILKAPKFDLGKLMEVHGDYT EDVG KL+RPA DE +A
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYTKEDVGMKLERPAEDEAVA  254



>ref|XP_006663973.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   417 bits (1073),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/227 (87%), Positives = 213/227 (94%), Gaps = 1/227 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA  879
            QNVF+RKVKILKAPKFDLGKLMEVHGDYT EDVG KL+RPA DE +A
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYTKEDVGMKLERPAEDEAVA  254



>ref|XP_006663974.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=261

 Score =   417 bits (1072),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/227 (87%), Positives = 213/227 (94%), Gaps = 1/227 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA SCDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA  879
            QNVF+RKVKILKAPKFDLGKLMEVHGDYT EDVG KL+RPA DE +A
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYTKEDVGMKLERPAEDEAVA  254



>gb|ABK93399.1| unknown [Populus trichocarpa]
Length=261

 Score =   417 bits (1071),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 201/235 (86%), Positives = 217/235 (92%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWY +KAPS F+ ++IG+TLVTRTQGTKIASEGLKHRVFEVSLADLQNDED+AFRKIRLR
Sbjct  28   DWYVVKAPSGFTVKDIGRTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+  
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRCP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLKDLV KFIPE IG+EIEKAT+ IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQASSCDLKDLVQKFIPEVIGKEIEKATTGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY++D+G K+DRP ADE +AE  TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSQDIGVKIDRP-ADETVAEGETEVVGA  261



>ref|XP_009408135.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   417 bits (1071),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            +EDVQG+NVLTNFWGMD TTDKLR +V++WQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   SEDVQGKNVLTNFWGMDLTTDKLRHIVRRWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA +CDLKDLVLKFIP+ IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATTCDLKDLVLKFIPDVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNV+IRKVKILKAPKFDLGKLMEVHGDY EDVG K+DRPA D  +   +E  GA
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKVDRPAEDVQMEGESEVAGA  261



>gb|KJB38202.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=262

 Score =   417 bits (1071),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/236 (86%), Positives = 220/236 (93%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVSRTQGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTD+LRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDRLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPEVIGKEIEKATSSIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            LQNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  208  LQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  262



>ref|XP_002277791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Vitis vinifera]
Length=261

 Score =   416 bits (1070),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKKRQ  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+T YAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IGREIEKATSSIYPL
Sbjct  148  NQNKKTSYAQSSQIRQIRRKMREIMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRP  858
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RP
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKMERP  246



>ref|XP_012069687.1| PREDICTED: 40S ribosomal protein S3a [Jatropha curcas]
 gb|KDP40219.1| hypothetical protein JCGZ_02217 [Jatropha curcas]
Length=262

 Score =   416 bits (1070),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 195/220 (89%), Positives = 209/220 (95%), Gaps = 0/220 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS FS +N+GKTLV+RTQGTKIASEGLKHRVF++SLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSAFSVKNVGKTLVSRTQGTKIASEGLKHRVFDISLADLQGDEDYAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQIKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVRKFIPEIIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA  861
            QNV++RKVKILKAPKFDLGKLMEVHGDY+EDVGTKL+RPA
Sbjct  208  QNVYVRKVKILKAPKFDLGKLMEVHGDYSEDVGTKLERPA  247



>ref|XP_006412198.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
 gb|ESQ53651.1| hypothetical protein EUTSA_v10026006mg [Eutrema salsugineum]
Length=262

 Score =   416 bits (1070),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 214/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP+ F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA RKIRLR
Sbjct  28   DWYDVKAPASFTVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAHRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMV +A SCDLK+LV KFIPE+IGREIEKAT +IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVKEASSCDLKELVAKFIPEAIGREIEKATQNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETMAEEPTEIIGA  262



>ref|NP_187135.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 sp|Q9CAV0.3|RS3A1_ARATH RecName: Full=40S ribosomal protein S3a-1 [Arabidopsis thaliana]
 gb|AAG51414.1|AC009465_14 putative 40S ribosomal protein S3A (S phase specific); 75194-73527 
[Arabidopsis thaliana]
 gb|AAL32874.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM10147.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AAM63004.1| putative 40S ribosomal protein S3A (S phase specific) [Arabidopsis 
thaliana]
 gb|AEE74143.1| 40S ribosomal protein S3a-1 [Arabidopsis thaliana]
Length=262

 Score =   416 bits (1069),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 215/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMR+IMV +A SCDLKDLV KFIPE+IGREIEKAT  IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMRDIMVREASSCDLKDLVAKFIPEAIGREIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLM+VHGDY+ EDVG K+DRPA +  + E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMDVHGDYSAEDVGVKVDRPADEMAVEEPTEIIGA  262



>ref|XP_002882377.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58636.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   416 bits (1069),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 214/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSNFTKRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMR+IM+ +A SCDLKDLV KFIPE+IGREIEKAT  IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMRDIMIKEASSCDLKDLVAKFIPEAIGREIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLM+VHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMDVHGDYTAEDVGVKVDRPADEMAVEEPTEIIGA  262



>ref|XP_009400022.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
[Musa acuminata subsp. malaccensis]
Length=261

 Score =   416 bits (1069),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 197/234 (84%), Positives = 213/234 (91%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAHRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMD TTDK+R +V+KW +LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKVRYIVRKWLTLIEAHVDVKTTDNYTLRMFCIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA +CDLKDLVLKFIP+ IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATTCDLKDLVLKFIPDVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNV+IRKVKILK+PKFDLGKLMEVHGDY EDVG K+DRPA D P+      VGA
Sbjct  208  QNVYIRKVKILKSPKFDLGKLMEVHGDYKEDVGVKVDRPAEDVPMEGEEVVVGA  261



>ref|XP_004958212.1| PREDICTED: 40S ribosomal protein S3a-like [Setaria italica]
Length=262

 Score =   416 bits (1069),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 196/227 (86%), Positives = 213/227 (94%), Gaps = 1/227 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+E+EKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMTNQASTCDLKELVSKFIPEVIGKEVEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIA  879
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVGTK++RPA ADE + 
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGTKVERPAEADEAMG  254



>ref|XP_004241461.1| PREDICTED: 40S ribosomal protein S3a [Solanum lycopersicum]
Length=261

 Score =   416 bits (1069),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRP  858
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+EDVG KLDRP
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLDRP  246



>dbj|BAA05057.1| cyc07 [Catharanthus roseus]
Length=245

 Score =   415 bits (1067),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 204/211 (97%), Gaps = 0/211 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RN+GKTLVTRTQGTKIASEGLKHRVFE+SLADLQ DED++FRKIRLR
Sbjct  28   DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLKHRVFEISLADLQGDEDHSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QG+NVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTD+YTLRMFCIGFTKKR 
Sbjct  88   AEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKMREIMVNQA SCDLKDLV KFIPESIGREIEKAT SIYPL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMREIMVNQAPSCDLKDLVQKFIPESIGREIEKATPSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTED  834
            QNVFIRKVKILKAPKFDLGKLMEVHGDY ED
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYNED  238



>ref|NP_001049289.1| Os03g0200500 [Oryza sativa Japonica Group]
 sp|P49397.2|RS3A_ORYSJ RecName: Full=40S ribosomal protein S3a; AltName: Full=CYC07 
protein [Oryza sativa Japonica Group]
 pdb|3J60|B Chain B, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA05059.1| cyc07 [Oryza sativa]
 gb|ABF94491.1| 40S ribosomal protein S3a, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11203.1| Os03g0200500 [Oryza sativa Japonica Group]
 gb|EAY88924.1| hypothetical protein OsI_10409 [Oryza sativa Indica Group]
 gb|EAZ25948.1| hypothetical protein OsJ_09804 [Oryza sativa Japonica Group]
 dbj|BAG91340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score =   416 bits (1068),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 197/227 (87%), Positives = 211/227 (93%), Gaps = 1/227 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTD Y LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDGYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA SCDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA  879
            QNVF+RKVKILKAPKFDLGKLMEVHGDY  ED+GTKLDRPA DE +A
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYAKEDIGTKLDRPAEDEAMA  254



>ref|XP_003559021.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=265

 Score =   416 bits (1068),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 214/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAP +FSTRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   EWYDIKAPLIFSTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQADEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMVEIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAEATEPVGA  903
            Q+VF+RKVKILKAPKFDLGKLMEVHGDY EDVG K+DRPA  DE I    E V A
Sbjct  208  QSVFVRKVKILKAPKFDLGKLMEVHGDYKEDVGMKVDRPAEGDEAIIPGAEDVAA  262



>ref|NP_001275123.1| cyc07-like protein [Solanum tuberosum]
 gb|ABB87133.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
Length=261

 Score =   415 bits (1067),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRP  858
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+EDVG KLDRP
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLDRP  246



>gb|KHG11221.1| 40S ribosomal S3a [Gossypium arboreum]
Length=262

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/221 (89%), Positives = 211/221 (95%), Gaps = 1/221 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA  861
            LQNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KL+RPA
Sbjct  208  LQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLERPA  248



>gb|ERN01559.1| hypothetical protein AMTR_s00002p00271660 [Amborella trichopoda]
Length=265

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/230 (84%), Positives = 213/230 (93%), Gaps = 0/230 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFE +LADLQ DED ++RKIRLR
Sbjct  33   DWYDIKAPSIFNVRTVGKTLVTRTQGTKIASEGLKHRVFECNLADLQADEDQSYRKIRLR  92

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R 
Sbjct  93   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRP  152

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  153  NQVKRTCYAQTSQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPL  212

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATE  891
            QNVFIRKVKILKAPKFDLGKLMEVHGDY++DVG K++RPA D  +   TE
Sbjct  213  QNVFIRKVKILKAPKFDLGKLMEVHGDYSDDVGVKVERPAEDVAMDGETE  262



>ref|XP_006649574.1| PREDICTED: 40S ribosomal protein S3a-like [Oryza brachyantha]
Length=260

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/225 (86%), Positives = 212/225 (94%), Gaps = 0/225 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG++IEKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKDIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPI  876
            QNVF+RKVKILKAPKFDLGKLMEVHGDY +D+GTK++RPA DE +
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYKDDIGTKVERPAEDEAM  252



>ref|NP_001274913.1| 40S ribosomal protein S3a-like [Solanum tuberosum]
 gb|ABB55367.1| cyc07-like [Solanum tuberosum]
 gb|ABB72794.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   414 bits (1065),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRP  858
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+EDVG KLDRP
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLDRP  246



>emb|CDX75453.1| BnaA01g02490D [Brassica napus]
Length=262

 Score =   414 bits (1065),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 213/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLK+LV KFIPESIGR+IEKA  SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPESIGRDIEKAVQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADEATAEEPTEIIGA  262



>ref|XP_010463973.1| PREDICTED: 40S ribosomal protein S3a-1-like [Camelina sativa]
Length=261

 Score =   414 bits (1065),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 215/235 (91%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSLFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDAYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLKDLV KFIPE+IGREIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMTEIMVKEASSCDLKDLVAKFIPEAIGREIEKATQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLM++HGDYT EDVG K+DRP A+E + E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMDIHGDYTAEDVGVKVDRP-AEEVVEEPTEIIGA  261



>emb|CDX76296.1| BnaA08g11040D [Brassica napus]
Length=261

 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 217/235 (92%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKM EIMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRP ADE   E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRP-ADETAEEPTEIIGA  261



>ref|XP_004985319.1| PREDICTED: 40S ribosomal protein S3a-like isoform X2 [Setaria 
italica]
Length=263

 Score =   414 bits (1064),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 212/235 (90%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG KL+RPA  E      E   A
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTKEDVGVKLERPAEAEEAVVGQEAAAA  262



>ref|XP_003572000.1| PREDICTED: 40S ribosomal protein S3a [Brachypodium distachyon]
Length=265

 Score =   414 bits (1063),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 199/232 (86%), Positives = 214/232 (92%), Gaps = 2/232 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAP +F+TRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   EWYDIKAPLLFNTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNY +RMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMIRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIM+NQA SCDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMVEIMINQAASCDLKELVAKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDY-TEDVGTKLDRPA-ADEPIAEATE  891
            QNV++RKVKILKAPKFDLGKLMEVHGDY  EDVG KLDRPA  DE I  A E
Sbjct  208  QNVYVRKVKILKAPKFDLGKLMEVHGDYGKEDVGVKLDRPAEGDEAIPGAEE  259



>gb|ABB55362.1| cyc07-like [Solanum tuberosum]
 gb|ABB72815.1| cyc07-like protein [Solanum tuberosum]
Length=261

 Score =   414 bits (1063),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  88   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  148  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRP  858
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+EDVG KLDRP
Sbjct  208  QNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLDRP  246



>ref|XP_002869131.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45390.1| 40S ribosomal protein S3A [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   413 bits (1062),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 212/235 (90%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP+ F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPASFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQVDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLK+LV KFIPE+IGREIEKAT  IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETMAEEPTEIIGA  262



>gb|ABB72808.1| cyc07-like protein [Solanum tuberosum]
Length=260

 Score =   413 bits (1062),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTKIAS+GLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  27   DWYDIKAPSVFEIKNVGKTLVTRTQGTKIASDGLKHRVFEVSLADLQKDEDQAFRKIRLR  86

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNF GMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCI FTKKR 
Sbjct  87   AEDVQGRNVLTNFHGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRP  146

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQQKRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPESIGREIEKATSSI+PL
Sbjct  147  NQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPL  206

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRP  858
            QNV+IRKVKILKAPKFDLGKLMEVHGDY+EDVG KLDRP
Sbjct  207  QNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLDRP  245



>ref|XP_009108713.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=261

 Score =   413 bits (1062),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 217/235 (92%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKM EIMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG ++DRP ADE   E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVRVDRP-ADETAEEPTEIIGA  261



>emb|CDX69078.1| BnaC01g03750D [Brassica napus]
Length=262

 Score =   413 bits (1062),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 213/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLK+LV KFIPE+IGR+IEKA  SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGRDIEKAVQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADEATAEEPTEIIGA  262



>ref|XP_010092425.1| 40S ribosomal protein S3a [Morus notabilis]
 gb|EXB51143.1| 40S ribosomal protein S3a [Morus notabilis]
Length=267

 Score =   413 bits (1061),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 222/241 (92%), Gaps = 8/241 (3%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQ+DE++A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQDDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            +EDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDN+TLR+FCIGFT++R 
Sbjct  88   SEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNFTLRLFCIGFTRRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEK T SI+PL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVQKFIPEMIGKEIEKTTKSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLME------VHGDYTEDVGTKLDRPAADEPIAEA-TEPVG  900
            QNVFIRKVKILKAPKFDLGKLME      VHGDY+ED+G K++RP ADE IAEA TE +G
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEASFLYPVHGDYSEDIGAKVERP-ADETIAEATTEVIG  266

Query  901  A  903
            A
Sbjct  267  A  267



>ref|NP_001046578.1| Os02g0287000 [Oryza sativa Japonica Group]
 dbj|BAD21513.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAD21711.1| putative ribosomal protein S3a, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF08492.1| Os02g0287000 [Oryza sativa Japonica Group]
 gb|EAY85405.1| hypothetical protein OsI_06784 [Oryza sativa Indica Group]
Length=261

 Score =   412 bits (1060),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 194/220 (88%), Positives = 207/220 (94%), Gaps = 0/220 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA  861
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KLDRPA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGMKLDRPA  247



>gb|ABK22319.1| unknown [Picea sitchensis]
Length=245

 Score =   411 bits (1057),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 197/234 (84%), Positives = 213/234 (91%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQNDED AFRKI+LR
Sbjct  12   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQNDEDQAFRKIKLR  71

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  72   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRP  131

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIM+ +A SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  132  NQVKRTCYAQSSQIRQIRRKMTEIMIREASSCDLKELVAKFIPEVIGKEIEKATSSIYPL  191

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DR   + P     E VGA
Sbjct  192  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDRTTEEAPAEAEAELVGA  245



>ref|XP_008218237.1| PREDICTED: 40S ribosomal protein S3a-2 [Prunus mume]
Length=260

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/235 (86%), Positives = 216/235 (92%), Gaps = 3/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSLFTERQIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRT  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM+NQA SCDLKDLV KFIPESIGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMINQAASCDLKDLVAKFIPESIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDL KLMEVHG   EDVG K+DR +A+E + E  TE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLPKLMEVHGG-KEDVGVKVDR-SAEETVPEGETEVVGA  260



>ref|XP_009138316.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 ref|XP_009138317.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
 emb|CDY45324.1| BnaA03g52970D [Brassica napus]
 emb|CDX72495.1| BnaC07g45170D [Brassica napus]
Length=261

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 216/236 (92%), Gaps = 4/236 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSIFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLK+LV KFIPESIGR+IEKAT +IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPESIGRDIEKATQNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIA-EATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRP  DE +A E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRP--DETVAEEPTEIIGA  261



>emb|CDY21109.1| BnaA01g33400D [Brassica napus]
Length=261

 Score =   412 bits (1058),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 213/235 (91%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIR KMREIM+ +A SCDLK+LV KFIPESIG++IEKAT  IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRSKMREIMIKEASSCDLKELVAKFIPESIGKDIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  261



>gb|EEE56753.1| hypothetical protein OsJ_06287 [Oryza sativa Japonica Group]
Length=399

 Score =   417 bits (1072),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 197/227 (87%), Positives = 211/227 (93%), Gaps = 1/227 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKVRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIA  879
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KLDRPA  DE +A
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGMKLDRPAETDEAVA  254



>emb|CDY50760.1| BnaAnng10670D [Brassica napus]
 emb|CDY41904.1| BnaC05g47000D [Brassica napus]
Length=262

 Score =   412 bits (1058),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 213/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFNNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIR KMREIM+ +A SCDLK+LV KFIPE+IG++IEKAT  IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRSKMREIMIKEASSCDLKELVAKFIPEAIGKDIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRPA +    E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETAAEEPTEIIGA  262



>ref|XP_006298355.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
 gb|EOA31253.1| hypothetical protein CARUB_v10014425mg [Capsella rubella]
Length=261

 Score =   412 bits (1058),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/235 (83%), Positives = 217/235 (92%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVL  FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKMR+IMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMRDIMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLM+VHGDYT EDVG K+DRP A+E + E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMDVHGDYTAEDVGVKVDRP-AEETVEEPTEIIGA  261



>ref|XP_003526635.1| PREDICTED: 40S ribosomal protein S3a-like [Glycine max]
Length=261

 Score =   411 bits (1057),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 214/235 (91%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ++QIRRKM EIMVNQ  SCDLK++V K IPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQVKQIRRKMTEIMVNQTTSCDLKEVVRKLIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAE-ATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLME+HGDY+EDVG K+DRP  DE + E ATE VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEIHGDYSEDVGVKVDRP-VDETMPEGATEVVGA  261



>emb|CDY30019.1| BnaC01g39890D [Brassica napus]
Length=302

 Score =   413 bits (1061),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 213/235 (91%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  69   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  128

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  129  AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  188

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIR KMREIM+ +A SCDLK+LV KFIPESIG++IEKAT  IYPL
Sbjct  189  NQVKRTCYAQSSQIRQIRSKMREIMIKEASSCDLKELVAKFIPESIGKDIEKATQGIYPL  248

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  249  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  302



>ref|XP_009110285.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   411 bits (1057),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 212/235 (90%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSNFKQRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV +A SCDLK+LV KFIPESIGR+IEKA  SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPESIGRDIEKAVQSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT ED G K+DRPA +    E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDGGVKVDRPADEATAEEPTEIIGA  262



>ref|XP_011621751.1| PREDICTED: 40S ribosomal protein S3a-1 [Amborella trichopoda]
Length=317

 Score =   414 bits (1063),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 194/230 (84%), Positives = 213/230 (93%), Gaps = 0/230 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R +GKTLVTRTQGTKIASEGLKHRVFE +LADLQ DED ++RKIRLR
Sbjct  85   DWYDIKAPSIFNVRTVGKTLVTRTQGTKIASEGLKHRVFECNLADLQADEDQSYRKIRLR  144

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R 
Sbjct  145  AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRP  204

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIMVNQA SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  205  NQVKRTCYAQTSQIRQIRRKMREIMVNQATSCDLKELVQKFIPEVIGKEIEKATSSIYPL  264

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATE  891
            QNVFIRKVKILKAPKFDLGKLMEVHGDY++DVG K++RPA D  +   TE
Sbjct  265  QNVFIRKVKILKAPKFDLGKLMEVHGDYSDDVGVKVERPAEDVAMDGETE  314



>ref|XP_010229024.1| PREDICTED: 40S ribosomal protein S3a-like [Brachypodium distachyon]
Length=264

 Score =   410 bits (1055),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 196/226 (87%), Positives = 210/226 (93%), Gaps = 1/226 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAP +FSTRN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   EWYDIKAPLLFSTRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQADEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIM NQA SCDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMVEIMANQATSCDLKELVQKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPI  876
            QNV++RKVKILKAPKFDLGKLMEVHGDY EDVG K+DRPA  DE +
Sbjct  208  QNVYVRKVKILKAPKFDLGKLMEVHGDYKEDVGMKVDRPADGDEAV  253



>ref|XP_009406016.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=260

 Score =   410 bits (1055),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 211/234 (90%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTKIASEGLKHRVFEV LADLQNDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVCLADLQNDEDQAHRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVL NFWGMD TTDK+R +V+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLANFWGMDLTTDKVRYVVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA + DLKDLV KFIPE IG+EIEKAT+SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATTGDLKDLVQKFIPEVIGKEIEKATTSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG K+DRPA D  + E  E  GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGAKVDRPAEDVQM-EGEEVTGA  260



>ref|NP_001152574.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG48293.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89328.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   410 bits (1054),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 210/228 (92%), Gaps = 1/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  882
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAVQE  255



>emb|CDY40680.1| BnaC03g33960D [Brassica napus]
Length=262

 Score =   410 bits (1054),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 213/235 (91%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDN+TLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNFTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIR KMREIM+ +A S DLK+LV KFIPESIG+EI+KAT  IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRSKMREIMIKEASSSDLKELVAKFIPESIGKEIDKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_006420004.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 ref|XP_006489441.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR33244.1| hypothetical protein CICLE_v10005663mg [Citrus clementina]
 gb|KDO74487.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=261

 Score =   410 bits (1053),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 214/235 (91%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KW +LIEA+VDVKTTDNYTLRMFCIGFTK+  
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIM+ QA SCDLK LV KFI E IGREIEKAT SIYPL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RP ADEPI EA TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKMERP-ADEPIPEAPTEVIGA  261



>ref|XP_009124201.1| PREDICTED: 40S ribosomal protein S3a-2 [Brassica rapa]
Length=262

 Score =   410 bits (1053),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 194/235 (83%), Positives = 212/235 (90%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFNNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIR KMREIM+ +A SCDLK+LV KFIPE+IG++IEKAT  IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRSKMREIMIKEASSCDLKELVAKFIPEAIGKDIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+D PA +    E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDSPADETAAEEPTEIIGA  262



>emb|CDX74165.1| BnaA03g28820D [Brassica napus]
Length=262

 Score =   409 bits (1052),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 212/235 (90%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTDN+TLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDNFTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIR+IR KMREIM+ +A S DLK+LV KFIPESIG+EIEKAT  IYPL
Sbjct  148  NQVKRTCYAQSSQIREIRSKMREIMIKEASSSDLKELVAKFIPESIGKEIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRPA +  + E TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETVVEEPTEIIGA  262



>ref|XP_009134791.1| PREDICTED: 40S ribosomal protein S3a-2-like [Brassica rapa]
Length=262

 Score =   409 bits (1051),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 211/235 (90%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTDN+TLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDNFTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIR KMREIM+ +A S DLK+LV KFIPESIG+EIEKAT  IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRSKMREIMIKEASSSDLKELVAKFIPESIGKEIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDYT EDVG K+DRPA +  + E  E +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVKVDRPADETVVEEPAEIIGA  262



>ref|XP_002463138.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
 gb|EER99659.1| hypothetical protein SORBIDRAFT_02g038370 [Sorghum bicolor]
Length=263

 Score =   409 bits (1051),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 210/228 (92%), Gaps = 2/228 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDIQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMTEIMSNQASTCDLKELVSKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPA-ADEPIA  879
            QNVFIRKVKILKAPKFD+GKLMEVHGDY  EDVG K+DRPA  DE + 
Sbjct  208  QNVFIRKVKILKAPKFDIGKLMEVHGDYAKEDVGVKMDRPAEGDEAMG  255



>gb|KFK30101.1| hypothetical protein AALP_AA7G217000 [Arabis alpina]
Length=262

 Score =   409 bits (1050),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 208/235 (89%), Gaps = 1/235 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DEDNA+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNGDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRT  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKM EIM+ +A SCDLK LV KFIPESIGREIEK T +IYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMTEIMIKEASSCDLKQLVAKFIPESIGREIEKVTQNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVH DYT EDVG K+DRP  +    E  E +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHSDYTAEDVGVKVDRPEDETVAEEPAEIIGA  262



>dbj|BAJ93929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   409 bits (1050),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 195/233 (84%), Positives = 213/233 (91%), Gaps = 2/233 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP++F+TRNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED AFRKIRLR
Sbjct  28   DWYDIKAPTLFNTRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDQAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPA-ADEPIAEATEP  894
            QNV++RKVKILKAPKFD+GKLMEVHGDY  EDVG KL+RPA ADE   E   P
Sbjct  208  QNVYVRKVKILKAPKFDIGKLMEVHGDYNKEDVGVKLERPAEADEAGVEVAAP  260



>gb|KDO43437.1| hypothetical protein CISIN_1g040060mg, partial [Citrus sinensis]
Length=241

 Score =   408 bits (1048),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 214/235 (91%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  8    DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  67

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  
Sbjct  68   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLP  127

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIMV QA SCDLK LV KFI E IGREIEKATSSIYPL
Sbjct  128  NQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPL  187

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRP ADEPI EA TE +GA
Sbjct  188  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDRP-ADEPIPEAPTEVIGA  241



>ref|NP_001141038.1| hypothetical protein [Zea mays]
 ref|XP_008660439.1| PREDICTED: 40S ribosomal protein S3a [Zea mays]
 gb|ACF79246.1| unknown [Zea mays]
 gb|ACF85254.1| unknown [Zea mays]
 gb|AFW89336.1| hypothetical protein ZEAMMB73_605321 [Zea mays]
Length=260

 Score =   409 bits (1050),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 195/234 (83%), Positives = 212/234 (91%), Gaps = 3/234 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP   +   EA + V A
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKLERPVEGD---EAGQEVAA  258



>gb|AFW89330.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89331.1| 40S ribosomal protein S3a [Zea mays]
 gb|AFW89332.1| 40S ribosomal protein S3a [Zea mays]
Length=330

 Score =   411 bits (1056),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 210/228 (92%), Gaps = 1/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  98   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  157

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  158  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  217

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  218  NQVKRTCYAQASQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  277

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  882
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  278  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAVQE  325



>gb|KDO37446.1| hypothetical protein CISIN_1g045491mg, partial [Citrus sinensis]
Length=241

 Score =   407 bits (1047),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 215/235 (91%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  8    DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  67

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  
Sbjct  68   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLP  127

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIMV QA SCDLK LV KFI E IGREIEKATSSIYPL
Sbjct  128  NQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPL  187

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRP ADEP+ EA TE +GA
Sbjct  188  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDRP-ADEPMPEAPTEVIGA  241



>gb|AFW89335.1| 40S ribosomal protein S3a [Zea mays]
Length=332

 Score =   411 bits (1056),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 210/228 (92%), Gaps = 1/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  100  DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  159

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  160  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  219

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  220  NQVKRTCYAQASQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  279

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  882
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  280  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAVQE  327



>gb|KEH32959.1| 40S ribosomal protein S3a-1 [Medicago truncatula]
Length=261

 Score =   407 bits (1047),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 211/234 (90%), Gaps = 0/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIA +GLKHRVFEVSL DLQ DE++AFRKIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIALDGLKHRVFEVSLVDLQGDEEHAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+N+LTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNLLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIM+NQA SCDLK LV KFIPE IG+EIE ATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMVEIMINQASSCDLKGLVHKFIPEMIGKEIENATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKF L KLMEVHGDY+EDVGTK++ PA +    E TE VGA
Sbjct  208  QNVFIRKVKILKAPKFHLEKLMEVHGDYSEDVGTKVESPADEMVTEEPTEIVGA  261



>ref|XP_006428321.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
 ref|XP_006480359.1| PREDICTED: 40S ribosomal protein S3a-like [Citrus sinensis]
 gb|ESR41561.1| hypothetical protein CICLE_v10012508mg [Citrus clementina]
Length=261

 Score =   407 bits (1047),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 215/235 (91%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM+FTTDKLRSLV+KW +LIEA+VDVKTTDN+TLR+FCIGFTK+  
Sbjct  88   AEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIMV QA SCDLK LV KFI E IGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DRP ADEP+ EA TE +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDRP-ADEPMPEAPTEVIGA  261



>ref|NP_001149096.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACG34188.1| 40S ribosomal protein S3a [Zea mays]
 gb|ACN31605.1| unknown [Zea mays]
Length=260

 Score =   407 bits (1047),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 210/228 (92%), Gaps = 1/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  882
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAMQE  255



>ref|XP_007205738.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
 gb|EMJ06937.1| hypothetical protein PRUPE_ppa010179mg [Prunus persica]
Length=260

 Score =   407 bits (1047),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 198/233 (85%), Positives = 210/233 (90%), Gaps = 1/233 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ R IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RKIRLR
Sbjct  28   DWYDIKAPSLFTERQIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQKDEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRRT  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIR KMREIM+NQA SCDLKDLV KFIPESIGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRLKMREIMINQAASCDLKDLVAKFIPESIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVG  900
            QNVFIRKVKILKAPKFDL KLMEVHG   EDVG K+DR A +      TE VG
Sbjct  208  QNVFIRKVKILKAPKFDLPKLMEVHGG-KEDVGVKVDRSAEETAPEGETEVVG  259



>ref|XP_002463137.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
 gb|EER99658.1| hypothetical protein SORBIDRAFT_02g038365 [Sorghum bicolor]
Length=263

 Score =   407 bits (1045),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 210/228 (92%), Gaps = 2/228 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS R+IGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRDIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDIQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMTEIMSNQASTCDLKELVSKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPA-ADEPIA  879
            QNVFIRKVKILKAPKFD+GKLMEVHGDY  EDVG K+DRPA  DE + 
Sbjct  208  QNVFIRKVKILKAPKFDIGKLMEVHGDYAKEDVGVKMDRPAEGDEAMG  255



>gb|KFK37895.1| hypothetical protein AALP_AA3G043200 [Arabis alpina]
Length=261

 Score =   406 bits (1044),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 192/235 (82%), Positives = 214/235 (91%), Gaps = 2/235 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDEDNA+RKIRLR
Sbjct  28   DWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLT FWGMDFTTDKLRSLVKKWQ+LIE HVDVKTTD+YTLRMFCI FTK+R 
Sbjct  88   AEDVQGKNVLTQFWGMDFTTDKLRSLVKKWQTLIECHVDVKTTDSYTLRMFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKMR+IM+ +A S DLK+LV KFIPE+IG+EIEK+T +IYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMRDIMIKEASSVDLKELVKKFIPEAIGKEIEKSTQNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGD T EDVG K+DRP  DE + E  E +GA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDLTAEDVGVKVDRP-EDEAVEEPAEIIGA  261



>gb|AGT16352.1| 40S ribosomal protein S3a [Saccharum hybrid cultivar R570]
Length=260

 Score =   406 bits (1043),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 194/234 (83%), Positives = 210/234 (90%), Gaps = 3/234 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM FTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP   +   EA + V A
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKLERPVEGD---EAGQEVAA  258



>gb|ACN40078.1| unknown [Picea sitchensis]
Length=260

 Score =   405 bits (1041),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 196/234 (84%), Positives = 212/234 (91%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F+TR +GKTLVTRTQGTKIASEGLKHRVFE+SLADLQN ED AFRKI+LR
Sbjct  28   DWYDVKAPSTFNTRTVGKTLVTRTQGTKIASEGLKHRVFELSLADLQN-EDQAFRKIKLR  86

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  87   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRP  146

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIM+ +A SCDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  147  NQVKRTCYAQSSQIRQIRRKMTEIMIREASSCDLKELVAKFIPEVIGKEIEKATSSIYPL  206

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K+DR   + P     E VGA
Sbjct  207  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKVDRTTEEAPAEAEAELVGA  260



>gb|ACG33267.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   405 bits (1041),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 209/228 (92%), Gaps = 1/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTT NY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTXNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  882
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAMQE  255



>gb|ACG34058.1| 40S ribosomal protein S3a [Zea mays]
Length=260

 Score =   404 bits (1039),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 209/228 (92%), Gaps = 1/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IAS+GLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASDGLKHRVFEVCLADLQGDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQ RNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQDRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  882
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKLERPVEGDEAMQE  255



>ref|XP_004296667.1| PREDICTED: 40S ribosomal protein S3a [Fragaria vesca subsp. vesca]
Length=259

 Score =   404 bits (1038),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 215/235 (91%), Gaps = 4/235 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ + +GKTLVTRTQGTKIASEGLKHRVFE SLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPSIFNIKQVGKTLVTRTQGTKIASEGLKHRVFETSLADLQGDEEHAYRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGR VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKM EIMV+QA SCDLKDLV KFI ESIG+EIEK T+SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMTEIMVSQASSCDLKDLVRKFIAESIGKEIEKQTTSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGD  EDVGTK+DRP A+E + EA  E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGD--EDVGTKVDRP-AEEAVPEAPVEIVGA  259



>ref|NP_001288829.1| 40S ribosomal protein S3a [Brassica rapa]
 sp|P49396.2|RS3A_BRACM RecName: Full=40S ribosomal protein S3a; AltName: Full=S phase-specific 
protein BIS289 [Brassica rapa]
 gb|AAA33013.1| S-phase-specific protein [Brassica rapa]
 emb|CAA81030.1| unnamed protein product [Brassica rapa]
Length=262

 Score =   404 bits (1037),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 212/236 (90%), Gaps = 3/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADL  DED A+RKIRLR
Sbjct  28   DWYDIKAPSSFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLNKDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIE+HVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIESHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMV-NQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
            NQ KRTCYAQSSQIRQIR KMREIM+  +A SCDLK+LV KFIPESIG++IEKAT  IYP
Sbjct  148  NQVKRTCYAQSSQIRQIRSKMREIMIKEEASSCDLKELVAKFIPESIGKDIEKATQGIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            LQNVFIRKVKILKAPKFDL KLMEVHGDYT EDVG K+DRP ADE + E TE +GA
Sbjct  208  LQNVFIRKVKILKAPKFDLRKLMEVHGDYTAEDVGVKVDRP-ADEVVEEPTEIIGA  262



>gb|KJB38201.1| hypothetical protein B456_006G241700 [Gossypium raimondii]
Length=258

 Score =   404 bits (1037),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 216/236 (92%), Gaps = 7/236 (3%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF+TRN+GKTLV+RTQGTKIASEGLKHRVFEV LADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTTRNVGKTLVSRTQGTKIASEGLKHRVFEVFLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTD+LRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDRLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQ    MREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQ----MREIMTAQATSCDLKELVQKFIPEVIGKEIEKATSSIYP  203

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPVGA  903
            LQNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG KL+RP ADE +AEA  E VGA
Sbjct  204  LQNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKLERP-ADETMAEAPAEVVGA  258



>ref|XP_001761018.1| predicted protein [Physcomitrella patens]
 gb|EDQ74085.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   404 bits (1037),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 192/236 (81%), Positives = 210/236 (89%), Gaps = 2/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F+ +N+GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKNLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY +RMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQIRMFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+TCYAQSSQIRQIRRKMREIMV +AQSCDLK+LV KFIPE IG+EIEKAT  IYPL
Sbjct  148  NQIKKTCYAQSSQIRQIRRKMREIMVREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAAD--EPIAEATEPVGA  903
            QN FIRKVKILKAPKFDL KLMEVHGDY+E+VG K++RP  D  EP+AEA    GA
Sbjct  208  QNTFIRKVKILKAPKFDLMKLMEVHGDYSEEVGAKIERPVGDEAEPVAEAAPVPGA  263



>ref|XP_002987274.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 ref|XP_002987332.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
 ref|XP_002989169.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 ref|XP_002989210.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ09763.1| hypothetical protein SELMODRAFT_184408 [Selaginella moellendorffii]
 gb|EFJ09804.1| hypothetical protein SELMODRAFT_160008 [Selaginella moellendorffii]
 gb|EFJ11589.1| hypothetical protein SELMODRAFT_271906 [Selaginella moellendorffii]
 gb|EFJ11647.1| hypothetical protein SELMODRAFT_271907 [Selaginella moellendorffii]
Length=263

 Score =   403 bits (1036),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 189/222 (85%), Positives = 205/222 (92%), Gaps = 0/222 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KA S F+ R IGKTLVTRTQGTKIAS+GLK RVFEVSLADLQNDED+AFRKI+LR
Sbjct  28   DWYDVKAMSTFNVRQIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEDHAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGMDFTTDKLRSLV+KWQSLIEAHVDVKTTDNYTLR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDNYTLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIR+KMREIMV +AQSCDLKDLV KFIPE IG+EIEK T+ IYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRKKMREIMVREAQSCDLKDLVAKFIPEVIGKEIEKVTAGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAAD  867
            QN +IRKVKILKAPKFDLGKLMEVHGDY+ED G K++RP  D
Sbjct  208  QNTYIRKVKILKAPKFDLGKLMEVHGDYSEDTGVKVERPVGD  249



>ref|XP_004302028.1| PREDICTED: 40S ribosomal protein S3a-2 [Fragaria vesca subsp. 
vesca]
Length=259

 Score =   400 bits (1029),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 212/234 (91%), Gaps = 2/234 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+ APS+F+ R +G TLVTRTQGTKIASEGLKHRVFEVSLADLQ DED+A+RKIRLR
Sbjct  28   DWYDVTAPSLFNVRKVGVTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG++VLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCI FTK+R 
Sbjct  88   AEDVQGKDVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIM+NQA +CDLK+LV KFIPE IGREIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMINQASACDLKELVQKFIPEMIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            Q+VFIRK KILKAPKFDLGKLMEVH +  EDVG K+DRP A+E + E T  VGA
Sbjct  208  QHVFIRKAKILKAPKFDLGKLMEVH-EKKEDVGVKIDRP-AEEIVPEETTIVGA  259



>gb|KJB28385.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=249

 Score =   400 bits (1028),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 205/213 (96%), Gaps = 1/213 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDV  837
            LQNVFIR+VKILKAPKFDLGKLMEVHGDY+EDV
Sbjct  208  LQNVFIRQVKILKAPKFDLGKLMEVHGDYSEDV  240



>ref|XP_001765967.1| predicted protein [Physcomitrella patens]
 gb|EDQ69288.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIE+HVDVKTTDNY LR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIESHVDVKTTDNYMLRIFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+TCYAQSSQIRQIRRKMREIM  +AQSCDLK+LV KFIPE IG+EIEKAT  IYPL
Sbjct  148  NQIKKTCYAQSSQIRQIRRKMREIMTREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QN FIRKVKILKAPKFDL KLMEVHGDY+E+VG K++RP  DEP AEA
Sbjct  208  QNTFIRKVKILKAPKFDLMKLMEVHGDYSEEVGAKIERPVGDEPAAEA  255



>gb|EEC69140.1| hypothetical protein OsI_38068 [Oryza sativa Indica Group]
Length=818

 Score =   418 bits (1075),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/233 (85%), Positives = 215/233 (92%), Gaps = 0/233 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVG  900
            QNVF+RKVKILKAPKFDLGKLMEVHGDY EDVGTKL+RPA DE +   +  +G
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYKEDVGTKLERPAEDEVVERDSSIIG  260



>gb|EEE53089.1| hypothetical protein OsJ_35850 [Oryza sativa Japonica Group]
Length=764

 Score =   416 bits (1070),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/245 (82%), Positives = 222/245 (91%), Gaps = 6/245 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMVNQASSCDLKELVSKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADE--PIAEATEPVGA*N*V  915
            QNVF+RKVKILKAPKFDLGKLMEVHGDY EDVGTKL+RPA DE  P  ++T+ +     V
Sbjct  208  QNVFVRKVKILKAPKFDLGKLMEVHGDYKEDVGTKLERPAEDEVVPWDKSTDVLH----V  263

Query  916  LI*FW  930
            L+ +W
Sbjct  264  LLNYW  268



>gb|AAX55706.1| cyc07 [Vitis vinifera]
Length=237

 Score =   397 bits (1021),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 202/219 (92%), Gaps = 2/219 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRV  +SLADLQNDED A+RKIRLR
Sbjct  6    DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVSGISLADLQNDEDRAYRKIRLR  65

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTK+  
Sbjct  66   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKRST  125

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q  +T YAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IGREIEKATSSIYPL
Sbjct  126  RQ--KTSYAQSSQIRQIRRKMREIMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPL  183

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRP  858
            QNVFIRKVKILKAPKFDLGKLMEVHGDY+EDVG K++RP
Sbjct  184  QNVFIRKVKILKAPKFDLGKLMEVHGDYSEDVGVKMERP  222



>ref|XP_001767326.1| predicted protein [Physcomitrella patens]
 gb|EDQ67817.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   398 bits (1022),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 209/233 (90%), Gaps = 1/233 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP++F+ + +GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNIFTQKALGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+TCYAQSSQIRQIRRKMREIM  +AQSCDLK+LV KFIPE+IG+EIEKAT  IYPL
Sbjct  148  NQIKKTCYAQSSQIRQIRRKMREIMTKEAQSCDLKELVGKFIPEAIGKEIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA-TEPV  897
            QN FIRKVKILKAPKFDL KLMEVHGDY+E+VG K++RP  D+   EA TEPV
Sbjct  208  QNTFIRKVKILKAPKFDLMKLMEVHGDYSEEVGAKIERPVGDDAETEAVTEPV  260



>ref|XP_004985318.1| PREDICTED: 40S ribosomal protein S3a-like isoform X1 [Setaria 
italica]
Length=290

 Score =   399 bits (1024),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/262 (76%), Positives = 212/262 (81%), Gaps = 28/262 (11%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED A+RKIRLR
Sbjct  28   DWYDIKAPSVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDQAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AED+QGRNVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDIQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM NQA +CDLK+LV KFIPE IG+EIEKATSSI+PL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKATSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLME---------------------------VHGDYT-EDV  837
            QNVFIRKVKILKAPKFDLGKLME                           VHGDYT EDV
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVIPSDRAIMFFPAFLWPVILTLNIASQVHGDYTKEDV  267

Query  838  GTKLDRPAADEPIAEATEPVGA  903
            G KL+RPA  E      E   A
Sbjct  268  GVKLERPAEAEEAVVGQEAAAA  289



>gb|AAC98779.1| S-phase-specific ribosomal protein [Oryza sativa Japonica Group]
Length=261

 Score =   396 bits (1018),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 187/220 (85%), Positives = 203/220 (92%), Gaps = 0/220 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSLADL+NDED A+RK+RLR
Sbjct  28   DWYDIKAPTVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLRNDEDQAYRKVRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ ++  + RRKM EIM NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  148  NQVKRTCYAQVARSGRSRRKMVEIMANQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA  861
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KLDRPA
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGMKLDRPA  247



>ref|XP_008224264.1| PREDICTED: 40S ribosomal protein S3a [Prunus mume]
Length=260

 Score =   395 bits (1016),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 209/234 (89%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPSLFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R 
Sbjct  88   AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMV QA S DLKDLV KFI ESIG+EIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVAQATSSDLKDLVRKFIAESIGKEIEKATMSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDL KLMEVHG   EDVG K++RPA +       E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLTKLMEVHGG-NEDVGQKVERPAEEAVTEPPPEIVGA  260



>gb|KJB28386.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=255

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 214/236 (91%), Gaps = 10/236 (4%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  903
            LQNVFIR+VKILKAPKFDLGKLME+        G K++RP ADE +AE T E +GA
Sbjct  208  LQNVFIRQVKILKAPKFDLGKLMEM-------FGVKIERP-ADETMAEPTPELIGA  255



>gb|EMT30223.1| 40S ribosomal protein S3a [Aegilops tauschii]
Length=257

 Score =   392 bits (1006),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/233 (81%), Positives = 205/233 (88%), Gaps = 6/233 (3%)
 Frame = +1

Query  205  WYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRA  384
            WYDIKAP +F++RN+GKTLV+RTQ      EGLKHRVFEVSLADLQNDED A+RKIRLRA
Sbjct  29   WYDIKAPLLFTSRNVGKTLVSRTQ------EGLKHRVFEVSLADLQNDEDQAYRKIRLRA  82

Query  385  EDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVN  564
            EDVQG NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMF IGFTK+R N
Sbjct  83   EDVQGMNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFTIGFTKRRPN  142

Query  565  QQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQ  744
            Q KRTCYAQ+SQIRQIRRKM EIMVNQA SCDLK+LV KFIPE IG+EIEKATSSI+PLQ
Sbjct  143  QVKRTCYAQASQIRQIRRKMVEIMVNQAASCDLKELVNKFIPEVIGKEIEKATSSIFPLQ  202

Query  745  NVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            NV++RKVKILKAPKFDLGKLMEVHGDY EDVG KLDRPA  + +    E V A
Sbjct  203  NVYVRKVKILKAPKFDLGKLMEVHGDYKEDVGVKLDRPADGDEVIPGAEEVAA  255



>ref|XP_001774632.1| predicted protein [Physcomitrella patens]
 gb|EDQ60566.1| predicted protein [Physcomitrella patens]
Length=264

 Score =   388 bits (996),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+TCYAQSSQIRQIRRKMREIM  +AQ+CDLK+LV KFIPE IG+EIEKAT  IYPL
Sbjct  148  NQIKKTCYAQSSQIRQIRRKMREIMTREAQTCDLKELVAKFIPEVIGKEIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAA  864
            QN FIRKVKILKAPKFDL KLMEVHGDY+E+VG K+DRP  
Sbjct  208  QNTFIRKVKILKAPKFDLMKLMEVHGDYSEEVGAKIDRPVG  248



>ref|XP_001777314.1| predicted protein [Physcomitrella patens]
 gb|EDQ57844.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   387 bits (994),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 202/228 (89%), Gaps = 6/228 (3%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTK------IASEGLKHRVFEVSLADLQNDEDNAF  363
            DWYDIKAP+ F+ +N+GKTLVTRT GTK      IAS+GLK RVFEVSLADLQNDED AF
Sbjct  28   DWYDIKAPNTFTQKNLGKTLVTRTAGTKAISSSDIASDGLKGRVFEVSLADLQNDEDQAF  87

Query  364  RKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIG  543
            RKI+LRAEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY +RMFCI 
Sbjct  88   RKIKLRAEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYMIRMFCIA  147

Query  544  FTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKAT  723
            FTKKR NQ K+TCYAQ+SQIRQIRRKMREIMV +AQSCDLK+LV KFIPE IG+EIEKAT
Sbjct  148  FTKKRPNQIKKTCYAQTSQIRQIRRKMREIMVREAQSCDLKELVAKFIPEVIGKEIEKAT  207

Query  724  SSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAAD  867
              IYPLQN FIRKVKILKAPKFDL KLMEVHGDY+E+VG K++RP  D
Sbjct  208  QGIYPLQNTFIRKVKILKAPKFDLMKLMEVHGDYSEEVGAKIERPVGD  255



>gb|KCW60693.1| hypothetical protein EUGRSUZ_H03423 [Eucalyptus grandis]
Length=237

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ +N+GKTLV+RTQGTKIASEGLKHRVFE SLADLQ DED+++RKIRLR
Sbjct  28   DWYDIKAPSVFTVKNVGKTLVSRTQGTKIASEGLKHRVFETSLADLQGDEDHSYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   CEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA SCDLK+LV KFIPESIG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVRKFIPESIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEV  813
            QNVFIRKVKILKAPKFDLGK ME+
Sbjct  208  QNVFIRKVKILKAPKFDLGKFMEI  231



>sp|A7Q5X9.1|RS3A2_VITVI RecName: Full=40S ribosomal protein S3a-2 [Vitis vinifera]
Length=234

 Score =   385 bits (990),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKKRQ  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+T YAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IGREIEKATSSIYPL
Sbjct  148  NQNKKTSYAQSSQIRQIRRKMREIMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEV  813
            QNVFIRKVKILKAPKFDLGKLME 
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEA  231



>ref|XP_001755439.1| predicted protein [Physcomitrella patens]
 gb|EDQ79919.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   387 bits (993),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 200/221 (90%), Gaps = 0/221 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY LR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQLRIFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+TCYAQSSQIRQIRRKMREIM  +AQ+CDLK+LV KFIPE IG+EIEKAT  IYPL
Sbjct  148  NQIKKTCYAQSSQIRQIRRKMREIMTKEAQTCDLKELVAKFIPEVIGKEIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAA  864
            QN FIRKVKILKAPKFDL KLMEVHGDY+E+VG K++RP  
Sbjct  208  QNTFIRKVKILKAPKFDLMKLMEVHGDYSEEVGAKIERPVG  248



>gb|KJB28382.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=248

 Score =   383 bits (983),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 197/205 (96%), Gaps = 1/205 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  147

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYP
Sbjct  148  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYP  207

Query  739  LQNVFIRKVKILKAPKFDLGKLMEV  813
            LQNVFIR+VKILKAPKFDLGKLMEV
Sbjct  208  LQNVFIRQVKILKAPKFDLGKLMEV  232



>ref|XP_008391001.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_008360360.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
 ref|XP_009371956.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 185/234 (79%), Positives = 206/234 (88%), Gaps = 2/234 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP +F+ +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNHQNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKM EIM+ QA S DLK LV KFI ESIG+EIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMSEIMIAQATSSDLKGLVSKFIAESIGKEIEKATMSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDL KLMEV+G   EDVG K++RPA +       E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLTKLMEVYGG--EDVGVKVERPAEEAAPEVQQEIVGA  259



>ref|XP_008390932.1| PREDICTED: 40S ribosomal protein S3a-2-like [Malus domestica]
Length=259

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/234 (79%), Positives = 205/234 (88%), Gaps = 2/234 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP +F+  N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNNTNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKM EIM+ QA S DLK LV KFI ESIG+EIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMSEIMIAQATSSDLKGLVNKFIAESIGKEIEKATMSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDL KLMEV+G   EDVG K++RPA +       E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLTKLMEVYGG--EDVGVKVERPAEEAAPEVQQEIVGA  259



>ref|XP_007226551.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
 gb|EMJ27750.1| hypothetical protein PRUPE_ppa024854mg [Prunus persica]
Length=629

 Score =   394 bits (1013),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 209/234 (89%), Gaps = 1/234 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  397  DWYDIKAPSLFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  456

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLR+FCIGFTK+R 
Sbjct  457  AEDVQGRNVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRP  516

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMV QA S DLKDLV KFI ESIG+EIEKAT SIYPL
Sbjct  517  NQVKRTCYAQSSQIRQIRRKMREIMVAQATSSDLKDLVRKFIAESIGKEIEKATMSIYPL  576

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDL KLMEVHG   EDVG K++RPA +       E VGA
Sbjct  577  QNVFIRKVKILKAPKFDLTKLMEVHGG-NEDVGQKVERPAEEAVTEPPPEIVGA  629



>gb|ACU17112.1| unknown [Glycine max]
Length=227

 Score =   379 bits (974),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKMREIMVNQA +CDLK+LV KFIPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMREIMVNQAAACDLKELVRKFIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLG  798
            QNVFIRKVKILKAPKFDLG
Sbjct  208  QNVFIRKVKILKAPKFDLG  226



>ref|XP_009335287.1| PREDICTED: 40S ribosomal protein S3a-2-like [Pyrus x bretschneideri]
Length=259

 Score =   380 bits (976),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 184/234 (79%), Positives = 204/234 (87%), Gaps = 2/234 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP +F+  N+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ DE++A+RK+RLR
Sbjct  28   DWYDIKAPKLFNNTNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEEHAYRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+ VLTNFWGM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKTVLTNFWGMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKM EIM+ QA S DLK LV KFI ESIG+EIEKAT SIYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMSEIMIAQATSSDLKGLVNKFIAESIGKEIEKATMSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDL KLMEV+G   EDVG K++RP  +       E VGA
Sbjct  208  QNVFIRKVKILKAPKFDLTKLMEVYGG--EDVGVKVERPTEEAAPEVQQEIVGA  259



>gb|AFW89329.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=231

 Score =   377 bits (968),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 195/212 (92%), Gaps = 1/212 (0%)
 Frame = +1

Query  250  GKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGM  429
            GKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLRAEDVQGRNVLTNFWGM
Sbjct  15   GKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGRNVLTNFWGM  74

Query  430  DFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQ  609
            +FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R NQ KRTCYAQ+SQIRQ
Sbjct  75   NFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQ  134

Query  610  IRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKF  789
            IRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PLQNVFIRKVKILKAPKF
Sbjct  135  IRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPLQNVFIRKVKILKAPKF  194

Query  790  DLGKLMEVHGDYTEDVGTKLDRPA-ADEPIAE  882
            DLGKLMEVHGDY EDVG KL+RP   DE + E
Sbjct  195  DLGKLMEVHGDYKEDVGVKLERPVEGDEAVQE  226



>ref|XP_002949135.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49628.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=257

 Score =   377 bits (968),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 197/218 (90%), Gaps = 0/218 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+VF+ RN+GKTLVTRTQGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR
Sbjct  28   DWYDIKAPTVFTVRNVGKTLVTRTQGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQGRN LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD YTLR+FCI FTKKR 
Sbjct  88   VEDVQGRNCLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDGYTLRVFCISFTKKRQ  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q KRTCYAQS+QIRQIR+KM EI+  +A SCDLKDLV KFIPE+IG++IEK+   IYPL
Sbjct  148  GQIKRTCYAQSAQIRQIRKKMTEIITREATSCDLKDLVAKFIPEAIGKDIEKSCQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDR  855
            QN FIRKVK+LKAPKFD+ KLMEVHGDY+E+VGTKLDR
Sbjct  208  QNTFIRKVKVLKAPKFDITKLMEVHGDYSEEVGTKLDR  245



>gb|KHN21710.1| 40S ribosomal protein S3a [Glycine soja]
Length=335

 Score =   376 bits (966),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF  +N+GKTLVTRTQGTK AS+GLKHRVFEVSLADLQ DED+AF+KIRLR
Sbjct  28   DWYDIKAPSVFQVKNVGKTLVTRTQGTKTASDGLKHRVFEVSLADLQGDEDHAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGM FTTDKLRSLV+KWQ+LIEAH DVKTTDNYTLRMFCIGFTK+R 
Sbjct  88   AEDVQGKNVLTNFWGMSFTTDKLRSLVRKWQTLIEAHADVKTTDNYTLRMFCIGFTKRRS  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ++QIRRKM EIMVNQ  SCDLK++V K IPE IG+EIEKATSSIYPL
Sbjct  148  NQVKRTCYAQSSQVKQIRRKMTEIMVNQTTSCDLKEVVRKLIPEMIGKEIEKATSSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDY  825
            QNVFIRKVKILKAPKFDLGKLME+H  +
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMELHSIF  235



>emb|CDY17474.1| BnaC03g65890D [Brassica napus]
Length=245

 Score =   372 bits (955),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 183/235 (78%), Positives = 200/235 (85%), Gaps = 18/235 (8%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F+ RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQ+DED+A+RKIRLR
Sbjct  28   DWYDIKAPSNFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQSDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLT FWGMDFTTDKLRSLVKKWQ+LIEAHVDVKTTD+YTLRMFCIGFTK+R 
Sbjct  88   AEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIGFTKRRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQ+RQIRRKM EIMV +A SCDLK+LV KFIPE+IG+EIEKAT +IYPL
Sbjct  148  NQVKRTCYAQSSQVRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRK                VHGDYT EDVG K+DRP  DE   E TE +GA
Sbjct  208  QNVFIRK----------------VHGDYTAEDVGVKVDRP-DDETAEEPTEIIGA  245



>ref|XP_001693710.1| ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 sp|A8HS48.1|RS3A_CHLRE RecName: Full=40S ribosomal protein S3a [Chlamydomonas reinhardtii]
 gb|EDP08964.1| ribosomal protein S3a [Chlamydomonas reinhardtii]
Length=259

 Score =   371 bits (952),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP++F+ RN+GKTLVTRTQGTKIASE LK RVFEVSLADLQ +ED+AFRK+RLR
Sbjct  28   DWYDIKAPTMFTVRNVGKTLVTRTQGTKIASEALKGRVFEVSLADLQKNEDDAFRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQGRN LTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTD YTLR+FCI FTKKR 
Sbjct  88   VEDVQGRNCLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDGYTLRVFCISFTKKRQ  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q KRTCYAQS+QIRQIR+KM EI+  +A SCDLK+LV KFIPESIG++IEK+   IYPL
Sbjct  148  GQIKRTCYAQSAQIRQIRKKMMEIITREATSCDLKELVAKFIPESIGKDIEKSCQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDR  855
            QN FIRKVK+LKAPKFD+ KLMEVHGDY+E+VG K++R
Sbjct  208  QNTFIRKVKVLKAPKFDITKLMEVHGDYSEEVGAKIER  245



>gb|KDO74488.1| hypothetical protein CISIN_1g024879mg [Citrus sinensis]
Length=245

 Score =   367 bits (943),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E++A+RKIRLR
Sbjct  28   DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLHNEEEHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KW +LIEA+VDVKTTDNYTLRMFCIGFTK+  
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWHTLIEAYVDVKTTDNYTLRMFCIGFTKRLP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKMREIM+ QA SCDLK LV KFI E IGREIEKAT SIYPL
Sbjct  148  NQVKRTCYAQASQIRQIRRKMREIMIAQAASCDLKGLVEKFIAEIIGREIEKATLSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEV  813
            QNVFIRKVKILKAPKFDLGKLMEV
Sbjct  208  QNVFIRKVKILKAPKFDLGKLMEV  231



>ref|XP_009406018.1| PREDICTED: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=241

 Score =   363 bits (933),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 193/234 (82%), Gaps = 20/234 (9%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVF+ RNIGKTLV+RTQGTK                   NDED A RKIRLR
Sbjct  28   DWYDIKAPSVFNVRNIGKTLVSRTQGTK-------------------NDEDQAHRKIRLR  68

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVL NFWGMD TTDK+R +V+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R 
Sbjct  69   AEDVQGKNVLANFWGMDLTTDKVRYVVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRP  128

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQSSQIRQIRRKMREIMVNQA + DLKDLV KFIPE IG+EIEKAT+SIYPL
Sbjct  129  NQVKRTCYAQSSQIRQIRRKMREIMVNQATTGDLKDLVQKFIPEVIGKEIEKATTSIYPL  188

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            QNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG K+DRPA D  + E  E  GA
Sbjct  189  QNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGAKVDRPAEDVQM-EGEEVTGA  241



>ref|XP_005650618.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
 gb|EIE26074.1| ribosomal protein S3Ae [Coccomyxa subellipsoidea C-169]
Length=259

 Score =   364 bits (934),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 197/231 (85%), Gaps = 1/231 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS F++RN+GKTLVTRTQGTKIAS+GLK RVFEVSLADLQ +E +AFRKIRLR
Sbjct  28   DWYDVKAPSSFTSRNVGKTLVTRTQGTKIASDGLKGRVFEVSLADLQTNEADAFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQGRN LTNFWGMD+TTDKLRSLV+KWQ+LIEA VDVKTTD Y LRMF I FTKKR 
Sbjct  88   VEDVQGRNCLTNFWGMDYTTDKLRSLVRKWQTLIEAQVDVKTTDGYLLRMFAIAFTKKRT  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q K+T YAQSSQIRQIR+KM EIM  +A SCDLK+LV KFIPE+IG+EIEKAT  IYPL
Sbjct  148  GQVKKTAYAQSSQIRQIRKKMVEIMTREASSCDLKELVGKFIPEAIGKEIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKL-DRPAADEPIAEATE  891
            QN  IRKVKIL+APKFDL KL+EVHGDY+E+ G K+ ++PA + P A   E
Sbjct  208  QNTAIRKVKILRAPKFDLTKLLEVHGDYSEEAGAKIAEKPAEEIPGAATAE  258



>gb|ABE66401.1| S phase protein [Striga asiatica]
Length=190

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 184/191 (96%), Gaps = 1/191 (1%)
 Frame = +1

Query  280  TKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSL  459
            TKIASEGLKHRVFEVSLADLQ DED++FRKIRLRAEDVQG+NVLTNFWGMDFTTDKLRSL
Sbjct  1    TKIASEGLKHRVFEVSLADLQGDEDHSFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLRSL  60

Query  460  VKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMV  639
            V+KWQSLIEAHVDVKTTDNYTLR+FCI FTKKRVNQQKRTCYAQSSQIRQIRRKMREIMV
Sbjct  61   VRKWQSLIEAHVDVKTTDNYTLRLFCIAFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMV  120

Query  640  NQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHG  819
            NQAQSCDLKDLV KF+PESIG+EIEKAT SIYPLQNV+IRKVKILKAPKFDL +LMEVHG
Sbjct  121  NQAQSCDLKDLVQKFVPESIGKEIEKATQSIYPLQNVYIRKVKILKAPKFDLSRLMEVHG  180

Query  820  DYTEDVGTKLD  852
            D+ E++G KL+
Sbjct  181  DH-EEIGVKLE  190



>ref|XP_001774288.1| predicted protein [Physcomitrella patens]
 gb|EDQ60924.1| predicted protein [Physcomitrella patens]
Length=254

 Score =   362 bits (929),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 196/234 (84%), Gaps = 12/234 (5%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F  +++GKTLVTRT GTKIAS+GL+ RVFE          D AFRKI+LR
Sbjct  28   DWYDIKAPNTFPQKSLGKTLVTRTAGTKIASDGLRGRVFE----------DQAFRKIKLR  77

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIEAHVDVKTTDNY LR+FCI  TKKR 
Sbjct  78   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIEAHVDVKTTDNYQLRIFCIASTKKRP  137

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+TCYAQSSQIRQIRRKMREIM  +AQ+CDLKDLV KFIPE IG+EIEKAT  IYPL
Sbjct  138  NQIKKTCYAQSSQIRQIRRKMREIMTREAQTCDLKDLVSKFIPEVIGKEIEKATQGIYPL  197

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAAD--EPIAEATEPV  897
            QN FIRKVKILKAPKFDL KLMEVHGDY+E+VG+K++RP  D  E  A A EPV
Sbjct  198  QNTFIRKVKILKAPKFDLMKLMEVHGDYSEEVGSKIERPVGDVAETDAGAAEPV  251



>gb|KHG19561.1| 40S ribosomal S3a [Gossypium arboreum]
Length=245

 Score =   362 bits (928),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 183/236 (78%), Positives = 201/236 (85%), Gaps = 20/236 (8%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWY+IKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKI  
Sbjct  28   DWYNIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKI--  85

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
                           GM+FTTDKLRSLV+KWQ+LIEAHVDVKTTDNYTLRMFCIGFTK+R
Sbjct  86   ---------------GMNFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRR  130

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQI RKMREIM  QA SCDLK+LV KFIPE IG+EIEKATSSIYP
Sbjct  131  PNQVKRTCYAQSSQIRQICRKMREIMTAQATSCDLKELVQKFIPEMIGKEIEKATSSIYP  190

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  903
            LQNVFIR+VKILKAPKFDLGKLM VHGDY+EDV  K++RP ADE +AE T E +GA
Sbjct  191  LQNVFIREVKILKAPKFDLGKLMAVHGDYSEDVRVKIERP-ADETMAEPTPELIGA  245



>ref|XP_001765908.1| predicted protein [Physcomitrella patens]
 gb|EDQ69229.1| predicted protein [Physcomitrella patens]
Length=244

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP+ F+ +++GKTLVTRT GTKIAS+GLK RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPNTFTQKSLGKTLVTRTAGTKIASDGLKGRVFEVSLADLQNDEDQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMD TTDKLRSLV+KWQSLIE+HVDVKTTDNY LR+FCI FTKKR 
Sbjct  88   AEDVQGKNVLTNFWGMDLTTDKLRSLVRKWQSLIESHVDVKTTDNYMLRIFCIAFTKKRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+TCYAQSSQIRQIRRKMREIM  +AQSCDLK+LV KFIPE IG+EIEKAT  IYPL
Sbjct  148  NQIKKTCYAQSSQIRQIRRKMREIMTREAQSCDLKELVAKFIPEVIGKEIEKATQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLME  810
            QN FIRKVKILKAPKFDL KLME
Sbjct  208  QNTFIRKVKILKAPKFDLMKLME  230



>gb|EYU30365.1| hypothetical protein MIMGU_mgv1a021183mg, partial [Erythranthe 
guttata]
Length=206

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/214 (82%), Positives = 189/214 (88%), Gaps = 8/214 (4%)
 Frame = +1

Query  262  VTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTT  441
            V  T  TKIASEGLKHRVFEVSLADLQ+DED AFRKIRLRAEDVQG+NVLTNFWGMDFTT
Sbjct  1    VKSTLNTKIASEGLKHRVFEVSLADLQSDEDLAFRKIRLRAEDVQGKNVLTNFWGMDFTT  60

Query  442  DKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRK  621
            DKLRSLV+KWQ+LIEAHVDVK TD+YTL++FCI FTKKR NQQKRTCYAQSSQIRQIRRK
Sbjct  61   DKLRSLVRKWQTLIEAHVDVKKTDSYTLKLFCIAFTKKRANQQKRTCYAQSSQIRQIRRK  120

Query  622  MREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGK  801
            M EIMV Q+QSCDLK+LV KFIPESIG+EIEKATSSI PL NVFIRKVKILKAPKFDLGK
Sbjct  121  MMEIMVAQSQSCDLKELVQKFIPESIGKEIEKATSSICPLHNVFIRKVKILKAPKFDLGK  180

Query  802  LMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            LMEVH       G KLDR +A+E +AE TE VGA
Sbjct  181  LMEVH-------GVKLDR-SAEEAVAEPTELVGA  206



>gb|EYU26004.1| hypothetical protein MIMGU_mgv1a019927mg, partial [Erythranthe 
guttata]
Length=209

 Score =   353 bits (907),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 189/214 (88%), Gaps = 8/214 (4%)
 Frame = +1

Query  262  VTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRAEDVQGRNVLTNFWGMDFTT  441
            V  T  TKIASEGLKHRVFEVSLADLQ+DED+AFRKIRLRAEDVQG+NVLTNFWGMDFTT
Sbjct  4    VKSTLNTKIASEGLKHRVFEVSLADLQSDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTT  63

Query  442  DKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVNQQKRTCYAQSSQIRQIRRK  621
            DKLRSLV+KWQ+LIEAHVDVK TD+YTL++FCI FTKKR NQQKRTCYAQSSQI QIRRK
Sbjct  64   DKLRSLVRKWQTLIEAHVDVKKTDSYTLKLFCIAFTKKRANQQKRTCYAQSSQILQIRRK  123

Query  622  MREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGK  801
            M EIMV Q+QSCDLK+LV KFIPESIG+EIEKATSSI PL NVFIRKVKILKAPKFDLGK
Sbjct  124  MMEIMVAQSQSCDLKELVQKFIPESIGKEIEKATSSICPLHNVFIRKVKILKAPKFDLGK  183

Query  802  LMEVHGDYTEDVGTKLDRPAADEPIAEATEPVGA  903
            LMEVH       G KLDR +A+E +AE TE VGA
Sbjct  184  LMEVH-------GVKLDR-SAEEAVAEPTELVGA  209



>emb|CBX25071.1| 40S ribosomal protein S3a [Polytomella sp. Pringsheim 198.80]
Length=262

 Score =   355 bits (910),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP  FS RN+GKTLVTRTQGTKIASEGLK RVFEVSLADLQ +E++AF+KIRLR
Sbjct  28   DWYDLKAPGFFSVRNVGKTLVTRTQGTKIASEGLKGRVFEVSLADLQKNEEDAFKKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQGRN LTNF+GMDFTTDKLR L++KWQSLIEAHVDVKTTD Y+LRMFCI FTKKR 
Sbjct  88   VEDVQGRNCLTNFYGMDFTTDKLRFLIRKWQSLIEAHVDVKTTDGYSLRMFCIAFTKKRQ  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q KRTCYAQ+ QIR IR+KM EIM  +A SC++K+LV K IPE+IG++IEKA   I+P+
Sbjct  148  GQIKRTCYAQTGQIRSIRKKMVEIMAREASSCEVKELVAKLIPEAIGKDIEKACQGIFPI  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADE  870
             NVF+RKVK+LK PKFD  KLMEVHGDYT +VGTK++R   +E
Sbjct  208  TNVFVRKVKVLKTPKFDHAKLMEVHGDYTAEVGTKVERVLIEE  250



>emb|CEG00819.1| Ribosomal protein S3Ae [Ostreococcus tauri]
Length=258

 Score =   354 bits (909),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 195/220 (89%), Gaps = 1/220 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RNIGKTLVTRTQGTKIAS+GLK R+FE+SLADL NDED +FRK++L+
Sbjct  28   DWYDIKAPSMFSVRNIGKTLVTRTQGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLK  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQG+NVLTNF GMDFTTDK+RSLV+KW SLIE  VDVKTTD Y+LR+FCIGFTK+R+
Sbjct  88   CEDVQGKNVLTNFAGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYSLRVFCIGFTKRRI  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q KRTCYAQS+QIR+IR KM EI+  +  +CDLK+LVLKFIPE IG+EIEK+ S IYPL
Sbjct  148  DQAKRTCYAQSAQIRRIRAKMVEIITRECTTCDLKELVLKFIPEVIGKEIEKSCSGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRP  858
            QNV+IRKVK+LKAPKFDL KLMEVHGDY+ E VG  ++RP
Sbjct  208  QNVYIRKVKVLKAPKFDLTKLMEVHGDYSNEAVGQPVERP  247



>ref|XP_001422366.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 sp|A4SAD2.1|RS3A_OSTLU RecName: Full=40S ribosomal protein S3a [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00683.1| Ribosomal protein S3a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=260

 Score =   353 bits (906),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 194/220 (88%), Gaps = 1/220 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RNIGKTLV+RTQGTKIAS+GLK R+FE+SLADL NDED +FRK++L+
Sbjct  28   DWYDIKAPSMFSVRNIGKTLVSRTQGTKIASDGLKGRIFEISLADLNNDEDQSFRKMKLK  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQG+NVLTNF GMDFTTDK+RSLV+KW SLIE  VDVKTTD YTLR+FCIGFTK+R+
Sbjct  88   CEDVQGKNVLTNFAGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYTLRVFCIGFTKRRM  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q KRTCYAQS+QIR+IR KM EI+  +  +CDLK+LVLKFIPE IG+EIEK+ + IYPL
Sbjct  148  DQAKRTCYAQSAQIRKIRAKMVEIITRECTTCDLKELVLKFIPEVIGKEIEKSCAGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRP  858
            QNV+IRKVKILKAPKFDL KLMEVHGDY+ E VG  + RP
Sbjct  208  QNVYIRKVKILKAPKFDLTKLMEVHGDYSGEAVGEAVARP  247



>gb|AAP80855.1| cyc07 [Triticum aestivum]
Length=242

 Score =   351 bits (901),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 184/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  205  WYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLRA  384
            WYDIKAP +F++RN+GKTLV+RTQGTKIASEGLKHRVFEVSLADLQNDED A+RKIRLRA
Sbjct  29   WYDIKAPLLFTSRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRA  88

Query  385  EDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRVN  564
            EDVQG NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVDVKTTDNY LRMF IGFTK+R N
Sbjct  89   EDVQGMNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYMLRMFAIGFTKRRPN  148

Query  565  QQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPLQ  744
            Q KRTCYAQ+SQIRQIRRKM EIMVNQA SCDL +LV KFIPE IG+EIE ATS I PLQ
Sbjct  149  QVKRTCYAQASQIRQIRRKMVEIMVNQAASCDLXELVNKFIPEVIGKEIEXATSGIXPLQ  208

Query  745  NVFIRKVKILKAPKFD-LGKLMEVHGDY  825
            NV++RKVKI + P+    G   EVHGDY
Sbjct  209  NVYVRKVKIPEGPQVSTWGSFXEVHGDY  236



>ref|XP_002465526.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
 gb|EER92524.1| hypothetical protein SORBIDRAFT_01g040570 [Sorghum bicolor]
Length=254

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 191/241 (79%), Gaps = 24/241 (10%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQG-------TKIASEGLKHRVFEVSLADLQNDEDNA  360
            DWYDIKAPSVFS RNIGKT V  T           IASEGLKHRVFEV LADLQ DED A
Sbjct  28   DWYDIKAPSVFSVRNIGKTSVQDTGCYSISNFIQNIASEGLKHRVFEVCLADLQGDEDQA  87

Query  361  FRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCI  540
            +RKIRLRAEDVQGRNVLTNFWGM FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCI
Sbjct  88   YRKIRLRAEDVQGRNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCI  147

Query  541  GFTKKRVNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKA  720
            GFTK+R N              QIRRKM +IMVNQA SCDLK+LV KFIPE IG+EIEKA
Sbjct  148  GFTKRRPN--------------QIRRKMVDIMVNQASSCDLKELVSKFIPEVIGKEIEKA  193

Query  721  TSSIYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEATEPVG  900
            TSSI+PLQNVFIRKVKILKAPKFDLGKLMEVHGDY EDVG KL+RP   +   EA + V 
Sbjct  194  TSSIFPLQNVFIRKVKILKAPKFDLGKLMEVHGDYKEDVGVKLERPVEGD---EAGQEVA  250

Query  901  A  903
            A
Sbjct  251  A  251



>gb|AFW89333.1| hypothetical protein ZEAMMB73_166147 [Zea mays]
Length=313

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 184/206 (89%), Gaps = 3/206 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPSVFS RNIGKTLV+RTQGT+IASEGLKHRVFEV LADLQ DED A+RKIRLR
Sbjct  98   DWYDIKAPSVFSVRNIGKTLVSRTQGTRIASEGLKHRVFEVCLADLQGDEDQAYRKIRLR  157

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQGRNVLTNFWGM+FTTDKLRSLVKKWQ+LIEAHVDVKTTDNY LR+FCIGFTK+R 
Sbjct  158  AEDVQGRNVLTNFWGMNFTTDKLRSLVKKWQTLIEAHVDVKTTDNYMLRLFCIGFTKRRP  217

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ KRTCYAQ+SQIRQIRRKM EIM+NQA +CDLK+LV KFIPE IG+EIEK+TSSI+PL
Sbjct  218  NQVKRTCYAQASQIRQIRRKMVEIMINQASTCDLKELVSKFIPEVIGKEIEKSTSSIFPL  277

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHG  819
            QNVFIRK +  + P+    +  E HG
Sbjct  278  QNVFIRKGEDTQGPQV---RSWETHG  300



>ref|XP_002505259.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66517.1| predicted protein [Micromonas sp. RCC299]
Length=263

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 193/236 (82%), Gaps = 2/236 (1%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAPS+F+ + +GKTLVTR+ GTKIAS+GLK R+FE SLADLQ DED AFRK+ L+
Sbjct  28   EWYDIKAPSMFTVKQVGKTLVTRSAGTKIASDGLKGRIFECSLADLQQDEDQAFRKMLLK  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQG NVLT F GMDFTTDKLRSLV+KW SLIE  VDVKTTD YTLR+FCIGFTK+R+
Sbjct  88   CEDVQGTNVLTQFAGMDFTTDKLRSLVRKWFSLIETFVDVKTTDQYTLRVFCIGFTKRRM  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q KRTCYAQS QIRQIR+KM EI+  +  SCDLK+ VLKFIPE IG+EIEK  + IYPL
Sbjct  148  DQTKRTCYAQSGQIRQIRKKMNEIINREISSCDLKESVLKFIPEVIGKEIEKVCAGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDRPA-ADEPIAEATEPVGA  903
            QNV+IRKVKILK PKFD+ KLMEVHGDY  ED G K+DRP    E + +  E VGA
Sbjct  208  QNVYIRKVKILKRPKFDVTKLMEVHGDYAGEDAGAKVDRPKDLIEKVEKRDEVVGA  263



>ref|XP_007508881.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19967.1| predicted protein [Bathycoccus prasinos]
Length=267

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F+ RN+GKT  TRTQGTKIAS+GLK R+FE SLADL  DED AFRK+ L+
Sbjct  36   DWYDIKAPSMFTVRNVGKTPQTRTQGTKIASDGLKGRIFECSLADLNQDEDQAFRKMFLK  95

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQG+NVLTNF+GMDFTTDK+RSLV+KW SLIE  VDVKTTD YT+R+FCIGFTK+RV
Sbjct  96   CEDVQGKNVLTNFYGMDFTTDKIRSLVRKWFSLIECFVDVKTTDGYTMRVFCIGFTKRRV  155

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q KRTCYAQS+QIR+IR KM EI+  + +SCDLK+LVLKFIPE IG+EIEK+ S IYPL
Sbjct  156  DQTKRTCYAQSAQIRKIRAKMVEIIKRECESCDLKELVLKFIPEVIGKEIEKSCSGIYPL  215

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDR  855
            QNV++RKVK+LK PKFD+ KLMEVHGDY+ E+VG ++ R
Sbjct  216  QNVYLRKVKMLKTPKFDVTKLMEVHGDYSGEEVGQQIPR  254



>emb|CBI34197.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   336 bits (861),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 175/204 (86%), Gaps = 19/204 (9%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLV+RTQGTKIASEGLKHRVFE+SLADLQNDED+A+RKIRLR
Sbjct  28   DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQ+LIEAHVD                   R 
Sbjct  88   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVD-------------------RQ  128

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+T YAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE IGREIEKATSSIYPL
Sbjct  129  NQNKKTSYAQSSQIRQIRRKMREIMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPL  188

Query  742  QNVFIRKVKILKAPKFDLGKLMEV  813
            QNVFIRKVKILKAPKFDLGKLME 
Sbjct  189  QNVFIRKVKILKAPKFDLGKLMEA  212



>ref|XP_011395666.1| 40S ribosomal protein S3a [Auxenochlorella protothecoides]
 gb|KFM22801.1| 40S ribosomal protein S3a [Auxenochlorella protothecoides]
Length=260

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 182/220 (83%), Gaps = 0/220 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDI+APS F  R +GKTLVTRT GTKIAS+GLK RV  V+LADLQ ++ +A+R I+LR
Sbjct  28   DWYDIRAPSTFQQRAVGKTLVTRTAGTKIASDGLKGRVITVNLADLQKNDADAYRNIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQGR+ LTNF GMD TTDKLRSLV+KWQ+LIEAHVDVKTTD YTLR+F I FTKKR 
Sbjct  88   VEDVQGRHCLTNFHGMDLTTDKLRSLVRKWQTLIEAHVDVKTTDGYTLRLFAIAFTKKRA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q K+T YAQSSQIR IRR+M +IM  +A S DLKDLV KFIPE+IG+EIEKA   IYPL
Sbjct  148  GQVKKTAYAQSSQIRAIRRRMVDIMTREATSVDLKDLVAKFIPEAIGKEIEKACQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPA  861
            QN F+RKVK+L++PKFD+GKLMEVHGD   +V T +DRPA
Sbjct  208  QNTFVRKVKVLRSPKFDVGKLMEVHGDLPTEVSTAVDRPA  247



>ref|XP_003060358.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55127.1| predicted protein [Micromonas pusilla CCMP1545]
Length=257

 Score =   332 bits (851),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 186/219 (85%), Gaps = 1/219 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WY+IKAPS+FS + +GKTLVTR+ GTKIAS+GLK R+FEVSLADL  DED AFRK+ L+
Sbjct  28   EWYNIKAPSMFSVKQVGKTLVTRSAGTKIASDGLKGRIFEVSLADLNQDEDQAFRKMLLK  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQG NVLT F GMDFTTDK+RSLV+KW SLIE + DVKTTD Y LR+FCIGFTK+R+
Sbjct  88   CEDVQGTNVLTQFHGMDFTTDKIRSLVRKWFSLIECYADVKTTDGYRLRVFCIGFTKRRM  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q KRTCYAQS QIRQIR+KM EI+  +  +CDLK+ VLKFIPE IG+EIEK  + IYPL
Sbjct  148  DQTKRTCYAQSGQIRQIRKKMVEIISRETTTCDLKECVLKFIPEVIGKEIEKVCAGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYT-EDVGTKLDR  855
            QNV+IRKVKIL APKFD+ KLMEVHGDYT E+VG K++R
Sbjct  208  QNVYIRKVKILGAPKFDVTKLMEVHGDYTSEEVGAKVER  246



>gb|ERZ98268.1| hypothetical protein GLOINDRAFT_339726, partial [Rhizophagus 
irregularis DAOM 181602]
Length=253

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 184/216 (85%), Gaps = 1/216 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F  RNIGKTLV RTQG K A++ LK RVFEVSLADL  DE+ AFRKI+LR
Sbjct  24   DWYDVKAPSIFEVRNIGKTLVNRTQGLKNANDALKGRVFEVSLADLNKDEEQAFRKIKLR  83

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N+LTNF GMDFT+DKLRSLVKKWQSLIEAHVDVKTTD Y LR+F I FTK+R 
Sbjct  84   VDEVQGKNLLTNFHGMDFTSDKLRSLVKKWQSLIEAHVDVKTTDGYLLRLFAIAFTKRRP  143

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ ++T YAQSSQIRQIR+KM +IM  QA +CDLK+LVLKF+PESIGREIEKA   IYPL
Sbjct  144  NQVRKTTYAQSSQIRQIRKKMFDIMTQQAATCDLKELVLKFVPESIGREIEKACQGIYPL  203

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKL  849
            Q V+IRKVKILK+PKFD+ KLME+HGD   D G+K+
Sbjct  204  QFVYIRKVKILKSPKFDVQKLMELHGDNI-DTGSKM  238



>gb|KIY51600.1| ribosomal protein S3Ae [Fistulina hepatica ATCC 64428]
Length=256

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTLV R+ G K A++ LK RV EVSLADL  DE+ AFRKI+LR
Sbjct  28   DWYDIKAPSIFEVRNVGKTLVNRSTGLKNANDSLKGRVVEVSLADLNKDEEQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   VDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q ++T YAQSSQIR+IRRKM EIM  +A SCDLK+LV KF+PE+IGREIEKA   IYPL
Sbjct  148  SQVRKTTYAQSSQIREIRRKMFEIMTREATSCDLKELVQKFVPEAIGREIEKAARGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KLME+HG+ T++ GTK+ +   +  I +A
Sbjct  208  QNVYVRKAKILKAPKFDMSKLMELHGESTDETGTKVAKDFQEPEILDA  255



>gb|KJB28384.1| hypothetical protein B456_005G045000 [Gossypium raimondii]
Length=230

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 188/236 (80%), Gaps = 35/236 (15%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQN-DEDNAFRKIRL  378
            DWYDIKAPSVF++RN+GKTLVTRTQGTKIASEGLKHRVFEVSLADLQ  DED+A+RKIRL
Sbjct  28   DWYDIKAPSVFTSRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQGGDEDHAYRKIRL  87

Query  379  RAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKR  558
            RAEDVQG+NVLTNFWGM+FTTDKLR                         MFCI FTK+R
Sbjct  88   RAEDVQGKNVLTNFWGMNFTTDKLR-------------------------MFCIRFTKRR  122

Query  559  VNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYP  738
             NQ KRTCYAQSSQIRQIRRKMREIM  QA SCDLK+LV KFIPE+IG+EIEKATSSIYP
Sbjct  123  PNQVKRTCYAQSSQIRQIRRKMREIMTAQATSCDLKELVQKFIPETIGKEIEKATSSIYP  182

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEAT-EPVGA  903
            LQNVFIR+VKILKAPKFDLGKLME+        G K++RP ADE +AE T E +GA
Sbjct  183  LQNVFIRQVKILKAPKFDLGKLMEMF-------GVKIERP-ADETMAEPTPELIGA  230



>gb|EMD41078.1| hypothetical protein CERSUDRAFT_80722 [Ceriporiopsis subvermispora 
B]
Length=256

 Score =   327 bits (838),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTLV R+QG K A++ LK R+ E+SLADL NDE+ AFRKI+LR
Sbjct  28   DWYDIKAPSIFERRNVGKTLVNRSQGLKNANDSLKGRIVEISLADLNNDEEQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             +++QG+N LTNF GM FT+DKLRSLV+KWQ+LIEAHVDVKTTD Y +R+F IGFTK+R 
Sbjct  88   VDEIQGKNCLTNFHGMAFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLIRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q ++T YAQSSQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKAT SIYPL
Sbjct  148  QQVRKTTYAQSSQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKATRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV+I K KILKAPKFDL KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYIHKAKILKAPKFDLSKLLELHGESTDETGTRVAKEFKEPEILES  255



>ref|XP_003038024.1| 40S ribosomal protein S1 [Schizophyllum commune H4-8]
 gb|EFJ03122.1| hypothetical protein SCHCODRAFT_72059 [Schizophyllum commune 
H4-8]
Length=256

 Score =   327 bits (838),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAPS+F  RN+GKT+V R+QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR
Sbjct  28   EWYDIKAPSIFEVRNVGKTIVNRSQGLKNANDSLKGRIVEVSLADLNKDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   VDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q ++T YAQSSQ+R+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKA+ SIYPL
Sbjct  148  TQVRKTTYAQSSQVREIRKKMFEIMTREATSCDLKELVQKFVPEAIGREIEKASRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KLME+HG+ T++ GTK+ +   +  I E+
Sbjct  208  QNVYVRKAKILKAPKFDVSKLMELHGESTDETGTKIAKDFKEPEILES  255



>gb|KDD76342.1| ribosomal protein S3Ae [Helicosporidium sp. ATCC 50920]
Length=259

 Score =   327 bits (838),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 181/218 (83%), Gaps = 0/218 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+FS RN+GKTLVTRT GTKIAS+GLK R+  VSLADLQ++E +A+R I+LR
Sbjct  28   DWYDIKAPSMFSVRNVGKTLVTRTAGTKIASDGLKGRIINVSLADLQSNEADAYRNIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             EDVQGRN LT+F GMD TTDKLRSLV+KWQ+LIEAHVDV+T D YTLRMFCI FTKK  
Sbjct  88   IEDVQGRNCLTHFHGMDLTTDKLRSLVRKWQTLIEAHVDVRTADGYTLRMFCISFTKKGA  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q K+TCYAQS+QIR IRRKM ++M  +A SCDLKDLV KFIPE+IG++IEKA   I+PL
Sbjct  148  GQIKKTCYAQSAQIRAIRRKMVDVMTREATSCDLKDLVGKFIPEAIGKDIEKACLGIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDR  855
            QN FIRKVK+L+ PKFD  KL+EVH +Y  D G  ++R
Sbjct  208  QNTFIRKVKVLRTPKFDASKLLEVHENYDVDAGEVVER  245



>ref|XP_007862325.1| 40S ribosomal protein S1 [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ59292.1| 40S ribosomal protein S1 [Gloeophyllum trabeum ATCC 11539]
Length=256

 Score =   326 bits (835),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N GKTLV R+ G K A++ LK R+ EVSLADL  DE+ AFRKI+LR
Sbjct  28   DWYDIKAPSIFEVKNAGKTLVNRSSGLKNANDSLKGRIIEVSLADLNKDEEQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   IDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRQ  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q K+T YAQSSQIR+IR+KM EIM  +A SCDLK+LV KFIPE+IGREIEKAT SIYPL
Sbjct  148  SQVKKTTYAQSSQIREIRKKMFEIMTREATSCDLKELVQKFIPEAIGREIEKATRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKILKAPKFDVSKLLELHGESTDETGTRVVKDFKEPEILES  255



>ref|XP_007382215.1| S-phase-specific ribosomal protein cyc07 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN10703.1| S-phase-specific ribosomal protein cyc07 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=256

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV R+QG K A++ LK R+ E+SL DL  DE+ AFRKI+LR
Sbjct  28   DWYDIKAPSIFEVKNVGKTLVNRSQGLKNANDSLKGRIIELSLGDLNKDEEQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   IDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYILRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q K+T YAQS+QIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKAT SIYPL
Sbjct  148  TQVKKTTYAQSAQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKATRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV+IRK KI+KAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYIRKAKIIKAPKFDVSKLLELHGETTDETGTRIIKDFKEPEILES  255



>ref|XP_001837102.1| 40S ribosomal protein S1 [Coprinopsis cinerea okayama7#130]
 sp|A8NX92.1|RS3A_COPC7 RecName: Full=40S ribosomal protein S1 [Coprinopsis cinerea okayama7#130]
 gb|EAU84719.1| 40s ribosomal protein s3ae-a [Coprinopsis cinerea okayama7#130]
Length=256

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 191/228 (84%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F TRN+GKTLV R+QG K A++ L+ R+ EVSLADL  DE+ +FRKI+LR
Sbjct  28   DWYDIKAPSIFETRNVGKTLVNRSQGLKNANDSLRGRIIEVSLADLNKDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             +++QGRN LTNF GMDFT+DKLRSLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   VDEIQGRNCLTNFHGMDFTSDKLRSLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q K+T YAQ++Q+R++R+KM EI+  +A SCDLK+LV KF+PE+IGREIEKA+ SIYPL
Sbjct  148  TQVKKTTYAQTAQVRELRKKMFEIITREATSCDLKELVQKFVPEAIGREIEKASRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV+IRK KILKAPKFD+ KL+E+HGD T++ GT++ +   +  + E+
Sbjct  208  QNVYIRKAKILKAPKFDVSKLLELHGDSTDESGTRVTKDFKEPEVLES  255



>gb|ABW23199.1| ribosomal protein rps3a [Eurythoe complanata]
Length=263

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 188/230 (82%), Gaps = 7/230 (3%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F+ R IGKTLVTRTQGTKIASEGLK RVFEVSLADLQNDE  AFRK +L 
Sbjct  29   DWYDVKAPSMFNIRQIGKTLVTRTQGTKIASEGLKGRVFEVSLADLQNDE-VAFRKFKLV  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AE+VQGRNVLTNF GM+ TTDKLRS+VKKWQ+LIEA+VDV+TTD + LR+FCIGFTKKR 
Sbjct  88   AEEVQGRNVLTNFHGMNLTTDKLRSMVKKWQTLIEANVDVRTTDAFLLRLFCIGFTKKRQ  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+TCYAQ +Q+R I +KM EIM  +  S DLK++V K IP+SIG++IEKA   IYPL
Sbjct  148  NQIKKTCYAQHTQVRAIXKKMVEIMSREVSSNDLKEVVNKLIPDSIGKDIEKACQGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGD------YTEDVGTKLDRPAADEP  873
             +V+IRKVKILK PKFDLGKLME+HG+       T + G K+DRP   EP
Sbjct  208  HDVYIRKVKILKKPKFDLGKLMELHGEGGTTKTVTTEGGEKVDRPEGYEP  257



>ref|XP_007843081.1| 40s ribosomal protein s3ae [Moniliophthora roreri MCA 2997]
 gb|ESK97646.1| 40s ribosomal protein s3ae [Moniliophthora roreri MCA 2997]
Length=256

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS F  RN+GKTLV R+QG + A++ LK RV EVSL DL  DED +FRKI+LR
Sbjct  28   DWYDIKAPSTFEVRNVGKTLVNRSQGLRNANDSLKGRVIEVSLGDLNKDEDQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             +++QG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   VDEIQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q ++T YAQSSQIR+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPL
Sbjct  148  TQVRKTTYAQSSQIREIRKKMFEIMTREASNCDLKELVQKFVPEAIGREIEKASRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KLME+HG+ T++ GT++ +   +  + E+
Sbjct  208  QNVYVRKAKILKAPKFDVSKLMELHGETTDETGTRVAKDFKEPEVLES  255



>gb|KIK65348.1| hypothetical protein GYMLUDRAFT_38796 [Gymnopus luxurians FD-317 
M1]
Length=256

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTLV R+QG K A++ LK R+ EVSL DL  +E+ +FRKI+LR
Sbjct  28   DWYDIKAPSIFDVRNVGKTLVNRSQGLKNANDSLKGRIIEVSLGDLNKEEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   VDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q ++T YAQSSQ+R+IR+KM EIM  ++ +CDLK+LV KF+PE+IGREIEKA+ SIYPL
Sbjct  148  TQVRKTTYAQSSQVREIRKKMFEIMTRESTNCDLKELVQKFVPEAIGREIEKASRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV+IRK KILKAPKFD+ KLME+HG+ T++ GTK+ +   +  I E+
Sbjct  208  QNVYIRKAKILKAPKFDVSKLMELHGESTDETGTKIAKDFKEPEILES  255



>sp|Q764D2.1|RS3A_LENED RecName: Full=40S ribosomal protein S1; AltName: Full=Protein 
cyc07 [Lentinula edodes]
 dbj|BAD11816.1| putative S-phase specific ribosomal protein cyc07 [Lentinula 
edodes]
Length=256

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTLV R+QG K A++ LK R+ EVSL DL  +E+ +FRKI+LR
Sbjct  28   DWYDIKAPSIFDVRNVGKTLVNRSQGLKNANDSLKGRIIEVSLGDLNKEEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   VDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q ++T YAQSSQ+R+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPL
Sbjct  148  TQVRKTTYAQSSQVREIRKKMFEIMTREATNCDLKELVQKFVPEAIGREIEKASRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KLME+HG+ T++ GTK+ +   +  + E+
Sbjct  208  QNVYVRKAKILKAPKFDVSKLMELHGESTDETGTKIAKDFKEPEVLES  255



>ref|XP_007315533.1| hypothetical protein SERLADRAFT_382295 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01811.1| hypothetical protein SERLA73DRAFT_120459 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO27442.1| hypothetical protein SERLADRAFT_382295 [Serpula lacrymans var. 
lacrymans S7.9]
Length=256

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAPS+F  RN+GKTLV R+QG K A++ LK R+ EVSLADL  DE+ ++RKI+LR
Sbjct  28   EWYDIKAPSIFEVRNVGKTLVNRSQGLKNANDSLKGRIVEVSLADLNKDEEQSYRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQSLIEAHVDVKTTD Y +R+F IGFTK+R 
Sbjct  88   IDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQSLIEAHVDVKTTDGYLIRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ ++T YAQ+SQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKA  SIYPL
Sbjct  148  NQVRKTTYAQTSQIREIRKKMFEIMTREATSCDLKELVQKFVPEAIGREIEKAARSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKILKAPKFDVSKLLELHGESTDETGTRIVKDFKEPEILES  255



>gb|KIK48635.1| hypothetical protein CY34DRAFT_797777 [Suillus luteus UH-Slu-Lm8-n1]
Length=256

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYD+KAPS F  RN+GKTLV R+QG K AS+ LK R+ EVSLADL  DE+ +FRKI+LR
Sbjct  28   EWYDVKAPSTFEVRNVGKTLVNRSQGLKNASDSLKGRIIEVSLADLNKDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQSLIEAHVDVKTTD Y +R+F IGFTK+R 
Sbjct  88   IDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQSLIEAHVDVKTTDGYLIRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ ++T YAQ+SQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEK T +IYPL
Sbjct  148  NQVRKTTYAQTSQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKILKAPKFDVSKLLELHGESTDETGTRVAKDFKEPEILES  255



>gb|EXX58553.1| ribosomal 40S subunit protein S1A [Rhizophagus irregularis DAOM 
197198w]
Length=258

 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 184/220 (84%), Gaps = 5/220 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAPS+F  RNIGKTLV RTQG K A++ LK RVFEVSLADL  DE+ AFRKI+LR
Sbjct  25   DWYDVKAPSIFEVRNIGKTLVNRTQGLKNANDALKGRVFEVSLADLNKDEEQAFRKIKLR  84

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQ----SLIEAHVDVKTTDNYTLRMFCIGFT  549
             ++VQG+N+LTNF GMDFT+DKLRSLVKKWQ    SLIEAHVDVKTTD Y LR+F I FT
Sbjct  85   VDEVQGKNLLTNFHGMDFTSDKLRSLVKKWQGRLGSLIEAHVDVKTTDGYLLRLFAIAFT  144

Query  550  KKRVNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSS  729
            K+R NQ ++T YAQSSQIRQIR+KM +IM  QA +CDLK+LVLKF+PESIGREIEKA   
Sbjct  145  KRRPNQVRKTTYAQSSQIRQIRKKMFDIMTQQAATCDLKELVLKFVPESIGREIEKACQG  204

Query  730  IYPLQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKL  849
            IYPLQ V+IRKVKILK+PKFD+ KLME+HGD   D G+K+
Sbjct  205  IYPLQFVYIRKVKILKSPKFDVQKLMELHGDNI-DTGSKM  243



>gb|ABI52667.1| 40S ribosomal protein S3a [Argas monolakensis]
Length=255

 Score =   324 bits (830),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 185/236 (78%), Gaps = 13/236 (6%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYD+KAP ++S RNIGKT V RTQGTKIASEGLK RVFEVS ADLQN ED AFRK RL 
Sbjct  15   DWYDVKAPMMYSVRNIGKTFVNRTQGTKIASEGLKGRVFEVSQADLQNGED-AFRKFRLI  73

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AE+VQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEA VDV+TTD Y LRMFCIGFTKK  
Sbjct  74   AEEVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEATVDVRTTDGYLLRMFCIGFTKKCS  133

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ K+TCYAQ +Q+RQIR+KM E+MV +  + DLKD+V K IPESIG++IEKA   IYPL
Sbjct  134  NQVKKTCYAQHTQVRQIRKKMTEMMVREVSTSDLKDVVNKLIPESIGKDIEKACQRIYPL  193

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTE------------DVGTKLDRPAADEP  873
             +V IRKVK+LK PKF+LGKL+E+HG+ T             + G K+DRP   EP
Sbjct  194  HDVLIRKVKVLKKPKFELGKLLELHGEGTSKGGAAPATTPTGEEGIKVDRPEGYEP  249



>gb|KIM46265.1| hypothetical protein M413DRAFT_441346 [Hebeloma cylindrosporum 
h7]
Length=256

 Score =   323 bits (829),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTL  R QG K  ++ LK R+ E+SLADL  DE+ +FRKI+LR
Sbjct  28   DWYDIKAPSIFEVRNVGKTLANRAQGLKNPNDSLKGRIIEISLADLNKDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             +++QGRN LTNF GMDFT+DKLRSLV+KWQSLIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   IDEIQGRNCLTNFHGMDFTSDKLRSLVRKWQSLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q ++T YAQSSQIR+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPL
Sbjct  148  SQVRKTTYAQSSQIREIRKKMFEIMTREATTCDLKELVQKFVPEAIGREIEKASRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKILKAPKFDVSKLLELHGESTDETGTRVAKEFKEPEILES  255



>ref|XP_002428136.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
 gb|EEB15398.1| 40S ribosomal protein S3A, putative [Pediculus humanus corporis]
Length=263

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 184/229 (80%), Gaps = 5/229 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDED--NAFRKIR  375
            DWYD+KAPS+F+TR IGKTLV RTQGTKIASEGLK+RVFEVSLADLQND D   +FRK R
Sbjct  29   DWYDVKAPSMFATRQIGKTLVNRTQGTKIASEGLKNRVFEVSLADLQNDTDAERSFRKFR  88

Query  376  LRAEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKK  555
            L AEDVQGRNVLTNF GMD TTDKLRS+VKKWQ+LIEAHVDVKTTD Y LR+FCIGFT K
Sbjct  89   LIAEDVQGRNVLTNFHGMDLTTDKLRSMVKKWQTLIEAHVDVKTTDGYLLRVFCIGFTNK  148

Query  556  RVNQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIY  735
                QK+TCYAQ +Q+R IR+KM EI+  +    DLKD+V K +P+SI +EIEK    IY
Sbjct  149  DQMSQKKTCYAQHTQVRAIRKKMTEIITKEVTDSDLKDVVQKLLPDSIAKEIEKYCQKIY  208

Query  736  PLQNVFIRKVKILKAPKFDLGKLMEVHGD---YTEDVGTKLDRPAADEP  873
            PL +V+IRKVK+LK P+FDL KL+E+HGD    +++ G K+DRP   EP
Sbjct  209  PLHDVYIRKVKVLKKPRFDLSKLLELHGDSKAASDEPGAKVDRPKGYEP  257



>ref|XP_007392195.1| hypothetical protein PHACADRAFT_250267 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM59637.1| hypothetical protein PHACADRAFT_250267 [Phanerochaete carnosa 
HHB-10118-sp]
Length=256

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  +N+GKTLV R+QG K A++ LK R+ EVSLADL  DE+ AFRKI+LR
Sbjct  28   DWYDIKAPSIFEVKNVGKTLVNRSQGLKNANDSLKGRIIEVSLADLNKDEEQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GM FT+DKLRSLV+KWQ+LIEAHVDVKTTD Y +R+F IGFTK+R 
Sbjct  88   VDEVQGKNCLTNFHGMSFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLIRLFTIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ ++T YAQSSQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKA  SIYPL
Sbjct  148  NQVRKTTYAQSSQIREIRKKMFEIMTREATSCDLKELVQKFVPEAIGREIEKAARSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++ K KILKAP+FDL KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYVHKAKILKAPRFDLSKLLELHGESTDETGTRVVKDFKEPEILES  255



>gb|KIK30608.1| hypothetical protein PISMIDRAFT_670675 [Pisolithus microcarpus 
441]
Length=256

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 185/216 (86%), Gaps = 0/216 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAPS+F  RN+GKTLV R+QG K A++ LK R+ EVSLADLQ DE+ +FRKI+LR
Sbjct  28   EWYDIKAPSIFEVRNVGKTLVNRSQGLKNANDSLKGRIIEVSLADLQKDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R 
Sbjct  88   VDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ ++T YAQ+SQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEK T +IYPL
Sbjct  148  NQVRKTTYAQTSQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKL  849
            QNV++RK KILKAPKFD+ KL+E+HG+ T++ GT++
Sbjct  208  QNVYVRKAKILKAPKFDVSKLLELHGETTDETGTRV  243



>sp|B0CY45.2|RS3A_LACBS RecName: Full=40S ribosomal protein S1 [Laccaria bicolor S238N-H82]
Length=256

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTL  R+QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR
Sbjct  28   DWYDIKAPSIFEVRNVGKTLANRSQGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             +++QG+N LTNF GMDFT+DKLRSLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   IDEIQGKNCLTNFHGMDFTSDKLRSLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q ++T YAQSSQ+R+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA  SIYPL
Sbjct  148  SQVRKTTYAQSSQVREIRKKMFEIMTREATNCDLKELVQKFVPEAIGREIEKAARSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILK+PKFD+ KL+E+HGD T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKILKSPKFDMSKLLELHGDSTDETGTRIAKDFKEPEILES  255



>gb|EPS95373.1| hypothetical protein FOMPIDRAFT_157719 [Fomitopsis pinicola FP-58527 
SS1]
Length=266

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTLV R+QG K A++ LK R+ EVSLADL NDE+ AFRKI+LR
Sbjct  38   DWYDIKAPSIFEKRNVGKTLVNRSQGLKNANDSLKGRIVEVSLADLNNDEEQAFRKIKLR  97

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG++ LTNF GM F++DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  98   IDEVQGKHCLTNFHGMSFSSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRP  157

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q ++T YAQSSQIR+IRRKM EIM  +A SCDLK+LV KFIPE+IGREIEKA  SIYP+
Sbjct  158  SQVRKTTYAQSSQIREIRRKMFEIMTREATSCDLKELVQKFIPEAIGREIEKAARSIYPV  217

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++ K KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  218  QNVYVHKAKILKAPKFDMSKLLELHGESTDETGTRVAKDFKEPEILES  265



>gb|KIM68608.1| hypothetical protein SCLCIDRAFT_1208801 [Scleroderma citrinum 
Foug A]
Length=256

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAPS+F  RN+GKTLV R+QG K A++ LK R+ EVSLADLQ DE+ +FRKIRLR
Sbjct  28   EWYDIKAPSIFEVRNVGKTLVNRSQGLKNANDSLKGRIVEVSLADLQKDEEQSFRKIRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R 
Sbjct  88   IDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q ++T YAQ+SQ+R+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEK T +IYPL
Sbjct  148  SQVRKTTYAQTSQVREIRKKMFEIMTREATSCDLKELVQKFVPEAIGREIEKHTRNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKILKAPKFDMSKLLELHGESTDETGTRVVKDFKEPEILES  255



>ref|XP_002475466.1| 40S ribosomal protein S3A [Postia placenta Mad-698-R]
 sp|B8PIG4.1|RS3A_POSPM RecName: Full=40S ribosomal protein S1 [Postia placenta Mad-698-R]
 gb|EED79317.1| 40S ribosomal protein S3A [Postia placenta Mad-698-R]
Length=256

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 186/228 (82%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTLV R+ G K A++ LK R+ E+SLADL NDE+ AFRKI+LR
Sbjct  28   DWYDIKAPSIFEKRNVGKTLVNRSSGLKNANDSLKGRIVEISLADLNNDEEQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GM F++DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   IDEVQGKNCLTNFHGMSFSSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q ++T YAQSSQIRQIR+KM EIM  +A SCDLK+LV KFIPE+IGREIEKA   IYPL
Sbjct  148  TQVRKTTYAQSSQIRQIRQKMFEIMTREASSCDLKELVQKFIPEAIGREIEKAARGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNVF+ K KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVFVHKAKILKAPKFDMSKLLELHGESTDETGTRVVKDFKEPEILES  255



>ref|XP_007767741.1| ribosomal protein S3Ae [Coniophora puteana RWD-64-598 SS2]
 gb|EIW82383.1| ribosomal protein S3Ae [Coniophora puteana RWD-64-598 SS2]
Length=256

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYD+KAPS F  RN+GKTLV R+QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR
Sbjct  28   EWYDVKAPSTFEVRNVGKTLVNRSQGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQSLIEAHVDVKTTD Y +R+F I FTK+R 
Sbjct  88   VDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQSLIEAHVDVKTTDGYLIRLFAIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ ++T YAQSSQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEK T +IYPL
Sbjct  148  NQVRKTTYAQSSQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKNTRNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV+IRK KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYIRKAKILKAPKFDVSKLLELHGESTDETGTRVVKDFKEPEILES  255



>ref|XP_008671813.1| PREDICTED: 40S ribosomal protein S3a-like [Zea mays]
Length=238

 Score =   322 bits (824),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            D YDIKAP VFS RNIGKTLV+RTQGTKIASEGLKHRVFEVSL DL +DED  + KIRL 
Sbjct  28   DRYDIKAPPVFSVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLVDLHSDEDKTYMKIRLC  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG NV+TNFWGM FTTDKL SLVKKWQ LIEAHV++KTTDNY LR+FCIGFTK+R 
Sbjct  88   AEDVQGGNVITNFWGMSFTTDKLHSLVKKWQRLIEAHVNIKTTDNYMLRLFCIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            N+ KRT YAQ+SQIR I  KM EIM NQ  +CDLK+LV  FIPE IG+EIE ATS+I+PL
Sbjct  148  NRVKRTSYAQASQIRHILWKMTEIMSNQTSTCDLKELVSNFIPEVIGKEIENATSTIFPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEV  813
            QNVFIRKV  L +PKFD+GKLMEV
Sbjct  208  QNVFIRKVNTL-SPKFDIGKLMEV  230



>emb|CCM04869.1| predicted protein [Fibroporia radiculosa]
Length=256

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 187/228 (82%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTLV R+QG K A++ LK R+ EVSLADL NDE+ AFRK++LR
Sbjct  28   DWYDIKAPSIFEKRNVGKTLVNRSQGLKNANDSLKGRIIEVSLADLNNDEEQAFRKMKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GM F++DKLRSLV+KWQ+LIEAHVDVKTTD Y +R+F IGFTK+R 
Sbjct  88   IDEVQGKNCLTNFHGMSFSSDKLRSLVRKWQTLIEAHVDVKTTDGYLIRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q ++T YAQ+SQIR+IRRKM EIM  +A SCDLK+LV KFIPE+IGREIEKA   IYPL
Sbjct  148  TQVRKTTYAQTSQIREIRRKMFEIMTREASSCDLKELVQKFIPEAIGREIEKAARGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNVF+ K KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVFVHKAKILKAPKFDMSKLLELHGESTDETGTRVVKDFKEPEILES  255



>ref|XP_001877091.1| 40S ribosomal protein S1 [Laccaria bicolor S238N-H82]
 gb|EDR12827.1| predicted protein [Laccaria bicolor S238N-H82]
Length=273

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTL  R+QG K A++ LK R+ EVSLADL  DE+ +FRKI+LR
Sbjct  45   DWYDIKAPSIFEVRNVGKTLANRSQGLKNANDSLKGRIIEVSLADLNKDEEQSFRKIKLR  104

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             +++QG+N LTNF GMDFT+DKLRSLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  105  IDEIQGKNCLTNFHGMDFTSDKLRSLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRP  164

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q ++T YAQSSQ+R+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA  SIYPL
Sbjct  165  SQVRKTTYAQSSQVREIRKKMFEIMTREATNCDLKELVQKFVPEAIGREIEKAARSIYPL  224

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILK+PKFD+ KL+E+HGD T++ GT++ +   +  I E+
Sbjct  225  QNVYVRKAKILKSPKFDMSKLLELHGDSTDETGTRIAKDFKEPEILES  272



>gb|KIK06774.1| hypothetical protein K443DRAFT_674057 [Laccaria amethystina LaAM-08-1]
Length=256

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTL  R+QG K A++ L+ R+ EVSLADL  DE+ +FRKI+LR
Sbjct  28   DWYDIKAPSIFEVRNVGKTLANRSQGLKNANDSLRGRIIEVSLADLNKDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             +++QG+N LTNF GMDFT+DKLRSLV+KWQ+L+EAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   IDEIQGKNCLTNFHGMDFTSDKLRSLVRKWQTLVEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q ++T YAQSSQ+R+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA  SIYPL
Sbjct  148  SQVRKTTYAQSSQVREIRKKMFEIMTREATNCDLKELVQKFVPEAIGREIEKAARSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILK+PKFD+ KL+E+HGD T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKILKSPKFDMSKLLELHGDSTDETGTRIAKDFKEPEILES  255



>gb|KJA29982.1| hypothetical protein HYPSUDRAFT_81601 [Hypholoma sublateritium 
FD-334 SS-4]
Length=256

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTL  R+QG K A++ LK R+ E+SLADL  DE+ +FRKI+LR
Sbjct  28   DWYDIKAPSIFEVRNVGKTLANRSQGLKNANDSLKGRIIELSLADLNKDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             +++QG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   IDEIQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q ++T YAQ+SQIR+IR+KM EIM  +A +CDLK+LV KF+PE+IGREIEKA+ SIYPL
Sbjct  148  SQVRKTTYAQTSQIREIRKKMFEIMTREATTCDLKELVQKFVPEAIGREIEKASRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKILKAPKFDVSKLLELHGESTDETGTRVAKEFKEPEILES  255



>gb|KIY73683.1| putative S-phase-specific ribosomal protein cyc07 [Cylindrobasidium 
torrendii FP15055 ss-10]
Length=256

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYD+KAPS+F  RN+GKTLV R+QG K A++ LK R+ EVSL DL  DE+ +FRK+RLR
Sbjct  28   EWYDVKAPSIFEVRNVGKTLVNRSQGLKNANDSLKGRIIEVSLGDLNKDEEQSFRKMRLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   VDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q ++T YAQS+Q+R+IR+KM EIM  +A + DLKDLV KFIPE+IGREIEKA+ SIYPL
Sbjct  148  SQVRKTTYAQSAQVREIRKKMFEIMTREATTVDLKDLVQKFIPEAIGREIEKASRSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KLME+HG+ T++ GT++ +   +  + E+
Sbjct  208  QNVYVRKAKILKAPKFDINKLMELHGESTDETGTRIAKDFKEPEVLES  255



>gb|KIJ70171.1| hypothetical protein HYDPIDRAFT_104846 [Hydnomerulius pinastri 
MD-312]
Length=256

 Score =   321 bits (823),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAPS F  +N+GKTLV R+QG K AS+ LK R+ EVSLADL  DE+ +FRKI+LR
Sbjct  28   EWYDIKAPSTFEVKNVGKTLVNRSQGLKNASDSLKGRIVEVSLADLNKDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R 
Sbjct  88   IDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ ++T YAQSSQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEK + +IYPL
Sbjct  148  NQVRKTTYAQSSQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKHSRNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKILKAPKFDVSKLLELHGESTDETGTRVAKDFKEPEILES  255



>gb|KDQ14611.1| hypothetical protein BOTBODRAFT_65919 [Botryobasidium botryosum 
FD-172 SS1]
Length=256

 Score =   321 bits (823),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 184/216 (85%), Gaps = 0/216 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAPS+F TRN+GKTLV ++QG K A++ LK RV E+SLADL  DED +FRKI+LR
Sbjct  28   EWYDIKAPSIFDTRNVGKTLVNKSQGLKNANDSLKGRVIELSLADLNKDEDQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             +++QG+N LTNF GMDFT+DKLRSLV+KWQSLIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   VDEIQGKNCLTNFHGMDFTSDKLRSLVRKWQSLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q K+T YAQ++QIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKA   IYPL
Sbjct  148  AQVKKTTYAQTAQIREIRKKMFEIMTREATSCDLKELVQKFVPEAIGREIEKACRGIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKL  849
            QNV++RK KILKAPKFD+ KL+E+HG+ T++ GT++
Sbjct  208  QNVYVRKAKILKAPKFDVQKLLELHGESTDETGTRV  243



>gb|KIJ20179.1| hypothetical protein PAXINDRAFT_166304 [Paxillus involutus ATCC 
200175]
 gb|KIK98754.1| hypothetical protein PAXRUDRAFT_823536 [Paxillus rubicundulus 
Ve08.2h10]
Length=256

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            +WYDIKAPS F  +N+GKTLV R+QG K A++ LK RV EVSLADL  DE+ +FRKI+LR
Sbjct  28   EWYDIKAPSTFEVKNVGKTLVNRSQGLKNANDSLKGRVVEVSLADLNGDEEQSFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R 
Sbjct  88   IDEVQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            NQ ++T YAQ+SQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEK T +IYPL
Sbjct  148  NQVRKTTYAQTSQIREIRKKMFEIMTREASSCDLKELVQKFVPEAIGREIEKHTRNIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KILKAPKFD+ KL+E+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKILKAPKFDVSKLLELHGESTDETGTRVAKDFKEPEILES  255



>ref|XP_007268611.1| 40S ribosomal protein S1 [Fomitiporia mediterranea MF3/22]
 gb|EJD01334.1| 40S ribosomal protein S1 [Fomitiporia mediterranea MF3/22]
Length=256

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWY+IKAPS+F  R++GKTL  R+QG K A++ L+ R+ EVSLADL  DE+ AFRKI+LR
Sbjct  28   DWYNIKAPSLFEVRDVGKTLANRSQGLKNANDSLRGRIVEVSLADLAKDEEQAFRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             +++QG+N LTNF GMDFT+DKLRSLV+KWQ+LIEAHVDVKTTD Y LR+F I FTK+R 
Sbjct  88   IDEIQGKNCLTNFHGMDFTSDKLRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIAFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
             Q K+T YAQ++QIR+IR+KM EIM  +A SCDLK+LVLKFIPE+IGREIEKAT  IYPL
Sbjct  148  TQVKKTTYAQTAQIREIRKKMFEIMTREASSCDLKELVLKFIPEAIGREIEKATRKIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKLDRPAADEPIAEA  885
            QNV++RK KI+KAPKFD+ KLME+HG+ T++ GT++ +   +  I E+
Sbjct  208  QNVYVRKAKIIKAPKFDVSKLMELHGESTDETGTRVAKEFKEPEIQES  255



>gb|KII94785.1| hypothetical protein PLICRDRAFT_33595 [Plicaturopsis crispa FD-325 
SS-3]
Length=256

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAPS+F  RN+GKTL  R+QG K A++ LK R+ EVSL DL  DE+ ++RKI+LR
Sbjct  28   DWYDIKAPSIFEVRNVGKTLANRSQGLKNANDSLKGRIIEVSLGDLNKDEEQSYRKIKLR  87

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
             ++VQGRN LTNF GMDFT+DK+RSLV+KWQ+LIEAHVDVKTTD Y LR+F IGFTK+R 
Sbjct  88   IDEVQGRNCLTNFHGMDFTSDKIRSLVRKWQTLIEAHVDVKTTDGYLLRLFAIGFTKRRP  147

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATSSIYPL  741
            +Q ++T YAQSSQIR+IR+KM EIM  +A SCDLK+LV KF+PE+IGREIEKA  SIYPL
Sbjct  148  SQVRKTTYAQSSQIREIRKKMFEIMTREATSCDLKELVQKFVPEAIGREIEKAARSIYPL  207

Query  742  QNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKL  849
            QNV++RK KILK+PKFD+ KL+E+HG+ T++ GT++
Sbjct  208  QNVYVRKAKILKSPKFDVSKLLELHGESTDETGTRV  243



>sp|Q9XEG7.3|RS3A_TORRU RecName: Full=40S ribosomal protein S3a [Syntrichia ruralis]
 gb|AAD23952.1|AF093109_1 ribosomal protein S3 [Syntrichia ruralis]
Length=248

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 180/217 (83%), Gaps = 4/217 (2%)
 Frame = +1

Query  202  DWYDIKAPSVFSTRNIGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDNAFRKIRLR  381
            DWYDIKAP   S R        RT GTKIAS+GL  RVFEVSLADLQNDED AFRKI+LR
Sbjct  28   DWYDIKAPPR-SRRARSGRRCHRTAGTKIASDGLNFRVFEVSLADLQNDEDQAFRKIKLR  86

Query  382  AEDVQGRNVLTNFWGMDFTTDKLRSLVKKWQSLIEAHVDVKTTDNYTLRMFCIGFTKKRV  561
            AEDVQG+NVLTNFWGMDFTTDKLRSLV+KWQSLI+AHVDVKTTDNY +R+FCI FTKKR 
Sbjct  87   AEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIQAHVDVKTTDNYQIRIFCIAFTKKRP  146

Query  562  NQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVLKFIPESIGREIEKATS-SIYP  738
            N   R  YAQSSQI  IRRKMREIMV +AQ+CDLK+LV KFIPE IG+EI++  S  IYP
Sbjct  147  NHT-RNFYAQSSQI-AIRRKMREIMVKEAQTCDLKELVAKFIPEVIGKEIDEWRSQGIYP  204

Query  739  LQNVFIRKVKILKAPKFDLGKLMEVHGDYTEDVGTKL  849
            LQ+ FIRKVKILKAPKFDL KLMEVHGDY E+VG K+
Sbjct  205  LQSTFIRKVKILKAPKFDLMKLMEVHGDYNEEVGAKI  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3031982759680