BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7362

Length=665
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006346222.1|  PREDICTED: polyadenylate-binding protein RBP...    202   7e-59   Solanum tuberosum [potatoes]
ref|XP_004244127.1|  PREDICTED: polyadenylate-binding protein RBP45     202   1e-58   Solanum lycopersicum
ref|XP_009795696.1|  PREDICTED: polyadenylate-binding protein RBP45     202   1e-58   Nicotiana sylvestris
sp|Q9LEB4.1|RBP45_NICPL  RecName: Full=Polyadenylate-binding prot...    202   1e-58   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009600135.1|  PREDICTED: polyadenylate-binding protein RBP45     201   2e-58   Nicotiana tomentosiformis
ref|XP_006449040.1|  hypothetical protein CICLE_v10015407mg             195   3e-57   
gb|KDO75474.1|  hypothetical protein CISIN_1g015091mg                   194   8e-57   Citrus sinensis [apfelsine]
gb|KDO75475.1|  hypothetical protein CISIN_1g015091mg                   194   9e-57   Citrus sinensis [apfelsine]
ref|XP_002518499.1|  nuclear acid binding protein, putative             196   2e-56   Ricinus communis
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg             194   9e-56   Citrus clementina [clementine]
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg             194   9e-56   Citrus clementina [clementine]
gb|EYU33637.1|  hypothetical protein MIMGU_mgv1a007175mg                194   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...    193   3e-55   Citrus sinensis [apfelsine]
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...    192   3e-55   Citrus sinensis [apfelsine]
ref|XP_011037672.1|  PREDICTED: polyadenylate-binding protein RBP...    189   4e-55   Populus euphratica
ref|XP_011037673.1|  PREDICTED: polyadenylate-binding protein RBP...    187   1e-54   Populus euphratica
ref|XP_011097972.1|  PREDICTED: polyadenylate-binding protein RBP...    190   1e-54   
ref|XP_011037671.1|  PREDICTED: polyadenylate-binding protein RBP...    187   3e-54   Populus euphratica
ref|XP_002305583.2|  RNA-binding protein 45                             188   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_011037670.1|  PREDICTED: polyadenylate-binding protein RBP...    187   2e-53   Populus euphratica
ref|XP_012091369.1|  PREDICTED: polyadenylate-binding protein RBP...    184   3e-53   Jatropha curcas
ref|XP_011096084.1|  PREDICTED: polyadenylate-binding protein RBP...    187   4e-53   Sesamum indicum [beniseed]
ref|XP_004234481.1|  PREDICTED: polyadenylate-binding protein RBP...    187   5e-53   Solanum lycopersicum
ref|XP_011096085.1|  PREDICTED: polyadenylate-binding protein RBP...    187   5e-53   Sesamum indicum [beniseed]
ref|XP_006343293.1|  PREDICTED: polyadenylate-binding protein RBP...    187   6e-53   Solanum tuberosum [potatoes]
emb|CDP04386.1|  unnamed protein product                                183   6e-53   Coffea canephora [robusta coffee]
ref|XP_011010322.1|  PREDICTED: polyadenylate-binding protein RBP...    186   1e-52   Populus euphratica
ref|XP_011010320.1|  PREDICTED: polyadenylate-binding protein RBP...    186   1e-52   Populus euphratica
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...    185   1e-52   Glycine max [soybeans]
ref|XP_006594429.1|  PREDICTED: polyadenylate-binding protein RBP...    183   2e-52   Glycine max [soybeans]
ref|XP_012091368.1|  PREDICTED: polyadenylate-binding protein RBP...    183   2e-52   Jatropha curcas
gb|EPS64177.1|  hypothetical protein M569_10604                         186   2e-52   Genlisea aurea
ref|XP_006370698.1|  hypothetical protein POPTR_0001s45000g             185   3e-52   
ref|XP_006446110.1|  hypothetical protein CICLE_v10015576mg             184   3e-52   
gb|KDO61276.1|  hypothetical protein CISIN_1g014513mg                   184   4e-52   Citrus sinensis [apfelsine]
ref|XP_010278713.1|  PREDICTED: polyadenylate-binding protein RBP...    182   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010327242.1|  PREDICTED: polyadenylate-binding protein RBP...    183   4e-52   
gb|KHN35750.1|  Polyadenylate-binding protein RBP45                     184   6e-52   Glycine soja [wild soybean]
gb|KDO61275.1|  hypothetical protein CISIN_1g014513mg                   184   6e-52   Citrus sinensis [apfelsine]
ref|XP_003529629.1|  PREDICTED: polyadenylate-binding protein RBP45     184   6e-52   Glycine max [soybeans]
ref|XP_009631415.1|  PREDICTED: polyadenylate-binding protein RBP...    184   6e-52   Nicotiana tomentosiformis
ref|XP_009631416.1|  PREDICTED: polyadenylate-binding protein RBP...    184   6e-52   Nicotiana tomentosiformis
ref|XP_009631417.1|  PREDICTED: polyadenylate-binding protein RBP...    184   6e-52   
gb|KGN64531.1|  hypothetical protein Csa_1G063550                       183   7e-52   Cucumis sativus [cucumbers]
ref|XP_008349848.1|  PREDICTED: polyadenylate-binding protein RBP...    180   8e-52   
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                    182   1e-51   Glycine soja [wild soybean]
ref|XP_012091367.1|  PREDICTED: polyadenylate-binding protein RBP...    184   1e-51   Jatropha curcas
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...    183   1e-51   Cucumis sativus [cucumbers]
ref|XP_006470600.1|  PREDICTED: polyadenylate-binding protein RBP...    183   1e-51   Citrus sinensis [apfelsine]
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g             182   2e-51   Phaseolus vulgaris [French bean]
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...    182   2e-51   Phaseolus vulgaris [French bean]
dbj|BAH56983.1|  AT1G11650                                              179   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002280601.1|  PREDICTED: polyadenylate-binding protein RBP...    182   2e-51   Vitis vinifera
ref|XP_004232721.1|  PREDICTED: polyadenylate-binding protein RBP45     182   2e-51   Solanum lycopersicum
ref|XP_011652716.1|  PREDICTED: polyadenylate-binding protein RBP...    182   2e-51   Cucumis sativus [cucumbers]
ref|XP_011652720.1|  PREDICTED: polyadenylate-binding protein RBP...    182   2e-51   Cucumis sativus [cucumbers]
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g             182   3e-51   Phaseolus vulgaris [French bean]
ref|XP_008441142.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-51   Cucumis melo [Oriental melon]
ref|XP_008441139.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-51   Cucumis melo [Oriental melon]
ref|XP_004145109.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-51   Cucumis sativus [cucumbers]
ref|XP_008441138.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-51   Cucumis melo [Oriental melon]
ref|XP_008441150.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-51   Cucumis melo [Oriental melon]
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-51   Glycine max [soybeans]
ref|XP_008441163.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-51   Cucumis melo [Oriental melon]
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-51   Glycine max [soybeans]
ref|XP_011652705.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-51   Cucumis sativus [cucumbers]
ref|XP_003610418.1|  RNA-binding protein                                180   3e-51   
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...    183   3e-51   Phoenix dactylifera
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-51   Solanum lycopersicum
ref|XP_010327241.1|  PREDICTED: polyadenylate-binding protein RBP...    182   4e-51   Solanum lycopersicum
gb|KJB69302.1|  hypothetical protein B456_011G015300                    179   4e-51   Gossypium raimondii
emb|CAN83958.1|  hypothetical protein VITISV_039907                     182   4e-51   Vitis vinifera
ref|XP_006348103.1|  PREDICTED: polyadenylate-binding protein RBP...    182   5e-51   Solanum tuberosum [potatoes]
ref|XP_009789022.1|  PREDICTED: polyadenylate-binding protein RBP...    182   5e-51   Nicotiana sylvestris
gb|KEH36838.1|  polyadenylate-binding protein RBP47B                    178   5e-51   Medicago truncatula
gb|KJB69304.1|  hypothetical protein B456_011G015300                    178   5e-51   Gossypium raimondii
ref|XP_009595795.1|  PREDICTED: polyadenylate-binding protein RBP...    181   6e-51   Nicotiana tomentosiformis
gb|EYU27806.1|  hypothetical protein MIMGU_mgv1a007668mg                181   6e-51   Erythranthe guttata [common monkey flower]
ref|NP_849641.1|  polyadenylate-binding protein RBP45B                  179   6e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507696.1|  PREDICTED: polyadenylate-binding protein RBP...    180   6e-51   
ref|XP_009352469.1|  PREDICTED: polyadenylate-binding protein RBP...    181   7e-51   Pyrus x bretschneideri [bai li]
ref|XP_006352617.1|  PREDICTED: polyadenylate-binding protein RBP...    181   7e-51   Solanum tuberosum [potatoes]
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...    181   7e-51   Solanum tuberosum [potatoes]
ref|XP_011654806.1|  PREDICTED: polyadenylate-binding protein RBP...    180   7e-51   Cucumis sativus [cucumbers]
gb|KJB69305.1|  hypothetical protein B456_011G015300                    178   8e-51   Gossypium raimondii
gb|AEW68341.1|  putative nuclear acid binding protein                   181   8e-51   Medicago sativa [alfalfa]
ref|XP_010278711.1|  PREDICTED: polyadenylate-binding protein RBP...    181   1e-50   Nelumbo nucifera [Indian lotus]
gb|KEH36837.1|  polyadenylate-binding protein RBP47B                    177   1e-50   Medicago truncatula
dbj|BAD05744.1|  putative RNA Binding Protein 45                        181   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008365193.1|  PREDICTED: polyadenylate-binding protein RBP...    181   1e-50   Malus domestica [apple tree]
ref|XP_002316998.2|  RNA-binding protein 45                             180   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_012089988.1|  PREDICTED: polyadenylate-binding protein RBP...    181   1e-50   Jatropha curcas
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...    181   2e-50   Cucumis melo [Oriental melon]
ref|XP_010031800.1|  PREDICTED: polyadenylate-binding protein RBP...    181   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010278708.1|  PREDICTED: polyadenylate-binding protein RBP...    181   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_011030800.1|  PREDICTED: polyadenylate-binding protein RBP...    180   2e-50   Populus euphratica
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...    181   2e-50   Cucumis melo [Oriental melon]
ref|XP_008385660.1|  PREDICTED: polyadenylate-binding protein RBP...    180   2e-50   
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...    180   2e-50   Cucumis melo [Oriental melon]
ref|XP_008345010.1|  PREDICTED: polyadenylate-binding protein RBP...    181   2e-50   Malus domestica [apple tree]
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...    180   2e-50   Cucumis sativus [cucumbers]
ref|XP_007015035.1|  RNA-binding family protein isoform 3               180   2e-50   
ref|XP_007015034.1|  RNA-binding family protein isoform 2               180   2e-50   
gb|KJB21879.1|  hypothetical protein B456_004G019500                    180   2e-50   Gossypium raimondii
ref|XP_009375056.1|  PREDICTED: polyadenylate-binding protein RBP...    181   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_011654805.1|  PREDICTED: polyadenylate-binding protein RBP...    180   2e-50   Cucumis sativus [cucumbers]
gb|KJB21880.1|  hypothetical protein B456_004G019500                    180   2e-50   Gossypium raimondii
ref|XP_009376881.1|  PREDICTED: polyadenylate-binding protein RBP...    181   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_009372712.1|  PREDICTED: polyadenylate-binding protein RBP...    180   2e-50   Pyrus x bretschneideri [bai li]
gb|KCW70174.1|  hypothetical protein EUGRSUZ_F03462                     176   2e-50   Eucalyptus grandis [rose gum]
ref|XP_011654802.1|  PREDICTED: polyadenylate-binding protein RBP...    180   2e-50   Cucumis sativus [cucumbers]
ref|XP_002313332.2|  hypothetical protein POPTR_0009s05920g             180   2e-50   
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...    181   3e-50   Elaeis guineensis
ref|XP_008377253.1|  PREDICTED: polyadenylate-binding protein RBP...    180   3e-50   Malus domestica [apple tree]
gb|KHG00069.1|  Polyadenylate-binding RBP47B' -like protein             180   3e-50   Gossypium arboreum [tree cotton]
gb|KGN50253.1|  hypothetical protein Csa_5G162020                       180   3e-50   Cucumis sativus [cucumbers]
ref|XP_011025522.1|  PREDICTED: polyadenylate-binding protein RBP...    179   3e-50   Populus euphratica
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...    179   3e-50   Cicer arietinum [garbanzo]
ref|XP_003610417.1|  RNA-binding protein                                179   3e-50   Medicago truncatula
emb|CBI16387.3|  unnamed protein product                                180   3e-50   Vitis vinifera
ref|XP_006850190.1|  PREDICTED: polyadenylate-binding protein RBP...    180   3e-50   Amborella trichopoda
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...    180   3e-50   Vitis vinifera
ref|XP_011625480.1|  PREDICTED: polyadenylate-binding protein RBP...    180   4e-50   Amborella trichopoda
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...    180   4e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007209154.1|  hypothetical protein PRUPE_ppa005940mg             180   4e-50   Prunus persica
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45     179   5e-50   Phoenix dactylifera
dbj|BAE71189.1|  putative DNA binding protein                           175   5e-50   Trifolium pratense [peavine clover]
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...    180   5e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...    180   5e-50   Nelumbo nucifera [Indian lotus]
ref|XP_009406503.1|  PREDICTED: polyadenylate-binding protein RBP...    179   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406502.1|  PREDICTED: polyadenylate-binding protein RBP...    179   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45     179   6e-50   
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...    179   6e-50   Nicotiana tomentosiformis
gb|KFK43438.1|  hypothetical protein AALP_AA1G125300                    178   7e-50   Arabis alpina [alpine rockcress]
ref|XP_009776429.1|  PREDICTED: polyadenylate-binding protein RBP...    179   7e-50   Nicotiana sylvestris
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...    179   7e-50   Nicotiana sylvestris
ref|XP_010458570.1|  PREDICTED: polyadenylate-binding protein RBP45B    178   8e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002513488.1|  nuclear acid binding protein, putative             178   9e-50   
ref|XP_008238181.1|  PREDICTED: polyadenylate-binding protein RBP...    179   9e-50   
ref|XP_004294372.1|  PREDICTED: polyadenylate-binding protein RBP45C    178   1e-49   Fragaria vesca subsp. vesca
ref|XP_010101438.1|  Polyadenylate-binding protein RBP45B               178   1e-49   
ref|XP_010910520.1|  PREDICTED: polyadenylate-binding protein RBP...    176   1e-49   
ref|XP_002889883.1|  ATRBP45B                                           178   1e-49   Arabidopsis lyrata subsp. lyrata
ref|NP_172630.1|  polyadenylate-binding protein RBP45B                  178   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020874.1|  RNA-binding family protein                         178   1e-49   
gb|KJB69303.1|  hypothetical protein B456_011G015300                    178   1e-49   Gossypium raimondii
gb|AFK41944.1|  unknown                                                 177   2e-49   Medicago truncatula
ref|XP_007026047.1|  RNA-binding family protein                         178   2e-49   Theobroma cacao [chocolate]
ref|XP_008806741.1|  PREDICTED: polyadenylate-binding protein RBP45     178   2e-49   Phoenix dactylifera
ref|XP_003597428.1|  RNA-binding protein                                178   2e-49   Medicago truncatula
gb|KJB69301.1|  hypothetical protein B456_011G015300                    178   2e-49   Gossypium raimondii
ref|XP_008226922.1|  PREDICTED: polyadenylate-binding protein RBP45C    177   2e-49   Prunus mume [ume]
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...    177   2e-49   Phaseolus vulgaris [French bean]
ref|XP_009772575.1|  PREDICTED: polyadenylate-binding protein RBP...    177   2e-49   Nicotiana sylvestris
ref|XP_009772574.1|  PREDICTED: polyadenylate-binding protein RBP...    177   2e-49   Nicotiana sylvestris
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                    177   3e-49   Medicago truncatula
ref|XP_007213954.1|  hypothetical protein PRUPE_ppa006577mg             177   3e-49   Prunus persica
ref|XP_010536076.1|  PREDICTED: polyadenylate-binding protein RBP...    177   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_010536077.1|  PREDICTED: polyadenylate-binding protein RBP...    177   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_010454207.1|  PREDICTED: polyadenylate-binding protein RBP...    177   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010493089.1|  PREDICTED: polyadenylate-binding protein RBP...    177   3e-49   Camelina sativa [gold-of-pleasure]
gb|KDP39118.1|  hypothetical protein JCGZ_00875                         177   4e-49   Jatropha curcas
ref|XP_010495305.1|  PREDICTED: polyadenylate-binding protein RBP...    177   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010476096.1|  PREDICTED: polyadenylate-binding protein RBP...    177   4e-49   Camelina sativa [gold-of-pleasure]
ref|NP_197436.1|  polyadenylate-binding protein RBP47B'                 177   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012070803.1|  PREDICTED: polyadenylate-binding protein RBP45C    176   4e-49   Jatropha curcas
ref|NP_001078604.1|  polyadenylate-binding protein RBP47B'              177   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476097.1|  PREDICTED: polyadenylate-binding protein RBP...    176   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...    177   4e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002871881.1|  hypothetical protein ARALYDRAFT_488820             177   4e-49   
gb|KFK26199.1|  hypothetical protein AALP_AA8G215500                    177   5e-49   Arabis alpina [alpine rockcress]
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...    176   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_006400492.1|  hypothetical protein EUTSA_v10013617mg             177   5e-49   Eutrema salsugineum [saltwater cress]
emb|CDX70874.1|  BnaC03g09580D                                          177   6e-49   
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...    176   6e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006417333.1|  hypothetical protein EUTSA_v10007819mg             176   6e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45     176   6e-49   Elaeis guineensis
ref|XP_009414748.1|  PREDICTED: polyadenylate-binding protein RBP...    176   8e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006452315.1|  hypothetical protein CICLE_v10008440mg             173   8e-49   
ref|XP_006307499.1|  hypothetical protein CARUB_v10009124mg             176   9e-49   
emb|CDX88893.1|  BnaA03g07560D                                          176   9e-49   
dbj|BAK03410.1|  predicted protein                                      176   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG16958.1|  Polyadenylate-binding RBP45B -like protein              177   1e-48   Gossypium arboreum [tree cotton]
gb|AAM64532.1|  putative DNA binding protein                            175   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420736.1|  PREDICTED: polyadenylate-binding protein RBP...    176   1e-48   Camelina sativa [gold-of-pleasure]
emb|CDY13992.1|  BnaC09g38340D                                          176   1e-48   Brassica napus [oilseed rape]
ref|XP_009120896.1|  PREDICTED: polyadenylate-binding protein RBP...    175   1e-48   Brassica rapa
gb|AFW61057.1|  hypothetical protein ZEAMMB73_234884                    173   1e-48   
ref|XP_009120895.1|  PREDICTED: polyadenylate-binding protein RBP...    175   1e-48   Brassica rapa
ref|XP_008349308.1|  PREDICTED: polyadenylate-binding protein RBP...    171   1e-48   
gb|AIN39817.1|  hypothetical protein                                    172   1e-48   Zoysia matrella [Japanese carpet grass]
emb|CDX92537.1|  BnaA10g15760D                                          175   1e-48   
ref|XP_010108648.1|  Polyadenylate-binding protein RBP47B'              176   1e-48   
ref|XP_003543537.1|  PREDICTED: polyadenylate-binding protein RBP...    175   2e-48   Glycine max [soybeans]
ref|XP_009412453.1|  PREDICTED: polyadenylate-binding protein RBP45     176   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001777334.1|  predicted protein                                  175   2e-48   
ref|XP_003580589.1|  PREDICTED: polyadenylate-binding protein RBP...    175   2e-48   Brachypodium distachyon [annual false brome]
ref|XP_010062999.1|  PREDICTED: polyadenylate-binding protein RBP45C    174   2e-48   Eucalyptus grandis [rose gum]
ref|XP_010240455.1|  PREDICTED: polyadenylate-binding protein RBP...    175   2e-48   Brachypodium distachyon [annual false brome]
ref|XP_003543536.1|  PREDICTED: polyadenylate-binding protein RBP...    175   2e-48   Glycine max [soybeans]
ref|XP_011628461.1|  PREDICTED: polyadenylate-binding protein RBP...    175   3e-48   Amborella trichopoda
ref|XP_009118182.1|  PREDICTED: polyadenylate-binding protein RBP...    174   3e-48   Brassica rapa
ref|XP_009118181.1|  PREDICTED: polyadenylate-binding protein RBP...    174   3e-48   Brassica rapa
ref|XP_004486967.1|  PREDICTED: polyadenylate-binding protein RBP...    174   3e-48   
ref|XP_004486966.1|  PREDICTED: polyadenylate-binding protein RBP...    174   3e-48   Cicer arietinum [garbanzo]
ref|XP_011628460.1|  PREDICTED: polyadenylate-binding protein RBP...    174   4e-48   Amborella trichopoda
dbj|BAB08769.1|  unnamed protein product                                174   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673626.1|  PREDICTED: polyadenylate-binding protein RBP...    174   4e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_568815.1|  RNA-binding protein 45A                               173   4e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDY34835.1|  BnaA09g47610D                                          173   4e-48   Brassica napus [oilseed rape]
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...    174   5e-48   Fragaria vesca subsp. vesca
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein             174   5e-48   Gossypium arboreum [tree cotton]
gb|KJB09397.1|  hypothetical protein B456_001G139100                    173   5e-48   Gossypium raimondii
gb|KJB09398.1|  hypothetical protein B456_001G139100                    173   5e-48   Gossypium raimondii
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein              174   6e-48   Gossypium arboreum [tree cotton]
ref|XP_003573391.1|  PREDICTED: polyadenylate-binding protein RBP...    174   6e-48   Brachypodium distachyon [annual false brome]
gb|KJB13664.1|  hypothetical protein B456_002G088100                    173   6e-48   Gossypium raimondii
gb|KJB13665.1|  hypothetical protein B456_002G088100                    174   6e-48   Gossypium raimondii
gb|KJB13666.1|  hypothetical protein B456_002G088100                    174   6e-48   Gossypium raimondii
ref|XP_009131734.1|  PREDICTED: polyadenylate-binding protein RBP...    174   7e-48   Brassica rapa
ref|XP_006452313.1|  hypothetical protein CICLE_v10008440mg             173   7e-48   Citrus clementina [clementine]
ref|XP_009357435.1|  PREDICTED: polyadenylate-binding protein RBP...    171   8e-48   Pyrus x bretschneideri [bai li]
ref|XP_006452314.1|  hypothetical protein CICLE_v10008440mg             173   8e-48   
gb|KJB09396.1|  hypothetical protein B456_001G139100                    173   9e-48   Gossypium raimondii
ref|XP_008349307.1|  PREDICTED: polyadenylate-binding protein RBP...    169   1e-47   
ref|XP_004972674.1|  PREDICTED: polyadenylate-binding protein RBP...    174   1e-47   Setaria italica
ref|XP_007150369.1|  hypothetical protein PHAVU_005G147800g             173   1e-47   Phaseolus vulgaris [French bean]
ref|XP_008224811.1|  PREDICTED: polyadenylate-binding protein RBP...    170   1e-47   Prunus mume [ume]
ref|XP_004972673.1|  PREDICTED: polyadenylate-binding protein RBP...    174   1e-47   
ref|XP_010052834.1|  PREDICTED: polyadenylate-binding protein RBP...    170   1e-47   Eucalyptus grandis [rose gum]
ref|XP_001784132.1|  predicted protein                                  173   1e-47   
ref|XP_002522953.1|  nuclear acid binding protein, putative             172   1e-47   Ricinus communis
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...    172   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004976877.1|  PREDICTED: polyadenylate-binding protein RBP...    173   2e-47   Setaria italica
gb|ERN19652.1|  hypothetical protein AMTR_s00062p00161920               174   2e-47   Amborella trichopoda
gb|AFW61056.1|  hypothetical protein ZEAMMB73_234884                    173   2e-47   
ref|XP_008676816.1|  PREDICTED: uncharacterized protein LOC100273...    173   2e-47   Zea mays [maize]
ref|NP_001141359.1|  uncharacterized protein LOC100273450               173   2e-47   Zea mays [maize]
emb|CDY34639.1|  BnaC08g41980D                                          174   3e-47   Brassica napus [oilseed rape]
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...    171   3e-47   Cicer arietinum [garbanzo]
ref|XP_010052833.1|  PREDICTED: polyadenylate-binding protein RBP...    169   4e-47   Eucalyptus grandis [rose gum]
emb|CDY19874.1|  BnaC09g31400D                                          171   5e-47   Brassica napus [oilseed rape]
dbj|BAE71244.1|  putative DNA binding protein                           171   6e-47   Trifolium pratense [peavine clover]
ref|XP_010092144.1|  Polyadenylate-binding protein RBP45                173   6e-47   
ref|XP_006401513.1|  hypothetical protein EUTSA_v10013710mg             171   7e-47   Eutrema salsugineum [saltwater cress]
ref|XP_006401514.1|  hypothetical protein EUTSA_v10013710mg             171   7e-47   Eutrema salsugineum [saltwater cress]
ref|XP_006287675.1|  hypothetical protein CARUB_v10000890mg             172   7e-47   
gb|ERN07615.1|  hypothetical protein AMTR_s00157p00080130               167   7e-47   Amborella trichopoda
gb|ACN40970.1|  unknown                                                 171   8e-47   Picea sitchensis
gb|ACN39849.1|  unknown                                                 171   1e-46   Picea sitchensis
gb|KHG22988.1|  Polyadenylate-binding RBP45C -like protein              170   1e-46   Gossypium arboreum [tree cotton]
ref|XP_008224810.1|  PREDICTED: polyadenylate-binding protein RBP...    170   1e-46   Prunus mume [ume]
ref|XP_009137630.1|  PREDICTED: polyadenylate-binding protein RBP...    170   1e-46   Brassica rapa
ref|XP_008349306.1|  PREDICTED: polyadenylate-binding protein RBP...    169   1e-46   
emb|CDX92786.1|  BnaC07g40440D                                          170   2e-46   
emb|CDY46671.1|  BnaA03g48370D                                          170   2e-46   Brassica napus [oilseed rape]
ref|XP_006413118.1|  hypothetical protein EUTSA_v10025342mg             169   2e-46   Eutrema salsugineum [saltwater cress]
gb|KJB81765.1|  hypothetical protein B456_013G160200                    166   2e-46   Gossypium raimondii
ref|XP_002864364.1|  hypothetical protein ARALYDRAFT_495572             169   2e-46   
ref|XP_007211969.1|  hypothetical protein PRUPE_ppa006617mg             169   2e-46   Prunus persica
ref|XP_007015033.1|  RNA-binding family protein isoform 1               171   2e-46   
ref|XP_006649483.1|  PREDICTED: polyadenylate-binding protein RBP...    169   3e-46   Oryza brachyantha
gb|EEC74608.1|  hypothetical protein OsI_10216                          169   3e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_010546929.1|  PREDICTED: polyadenylate-binding protein RBP45B    169   3e-46   Tarenaya hassleriana [spider flower]
gb|ABF94248.1|  RNA recognition motif family protein, expressed         169   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|KJB22074.1|  hypothetical protein B456_004G028000                    169   3e-46   Gossypium raimondii
gb|EAZ27536.1|  hypothetical protein OsJ_11491                          165   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|AFW59518.1|  hypothetical protein ZEAMMB73_768040                    167   3e-46   
ref|XP_006652855.1|  PREDICTED: polyadenylate-binding protein RBP...    168   3e-46   Oryza brachyantha
ref|NP_001049124.1|  Os03g0174100                                       169   4e-46   
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...    169   4e-46   Eucalyptus grandis [rose gum]
ref|XP_006659900.1|  PREDICTED: polyadenylate-binding protein RBP...    169   4e-46   
emb|CAE04743.3|  OSJNBb0060E08.6                                        168   5e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009120017.1|  PREDICTED: polyadenylate-binding protein RBP45A    168   5e-46   Brassica rapa
gb|EAY95645.1|  hypothetical protein OsI_17510                          169   6e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_010923889.1|  PREDICTED: polyadenylate-binding protein RBP...    169   6e-46   
ref|NP_001275480.1|  DNA binding protein ACBF-like                      167   6e-46   Solanum tuberosum [potatoes]
ref|NP_001053941.1|  Os04g0625800                                       168   6e-46   
emb|CDY17286.1|  BnaA10g09200D                                          168   7e-46   Brassica napus [oilseed rape]
gb|KJB81762.1|  hypothetical protein B456_013G160200                    166   8e-46   
emb|CAL25353.1|  ACBF-like dna binding protein                          162   1e-45   
ref|XP_004985527.1|  PREDICTED: polyadenylate-binding protein RBP...    167   1e-45   
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...    167   1e-45   
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...    167   1e-45   
gb|EMS68789.1|  Uncharacterized RNA-binding protein C23E6.01c           167   1e-45   
ref|XP_010675694.1|  PREDICTED: polyadenylate-binding protein RBP45     167   1e-45   
ref|XP_002979510.1|  hypothetical protein SELMODRAFT_111082             167   2e-45   
ref|NP_001131852.1|  uncharacterized protein LOC100193230               167   2e-45   
gb|AFW59516.1|  hypothetical protein ZEAMMB73_768040                    167   2e-45   
ref|XP_002977811.1|  hypothetical protein SELMODRAFT_232989             167   2e-45   
ref|XP_002447134.1|  hypothetical protein SORBIDRAFT_06g029180          167   3e-45   
gb|EEE61728.1|  hypothetical protein OsJ_16246                          169   3e-45   
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...    166   3e-45   
ref|XP_004982540.1|  PREDICTED: polyadenylate-binding protein RBP...    166   3e-45   
gb|KJB81764.1|  hypothetical protein B456_013G160200                    167   3e-45   
ref|NP_001168324.1|  hypothetical protein                               166   3e-45   
ref|NP_001168401.1|  hypothetical protein                               167   3e-45   
ref|XP_011623994.1|  PREDICTED: polyadenylate-binding protein RBP47     166   3e-45   
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...    166   3e-45   
gb|KJB81761.1|  hypothetical protein B456_013G160200                    166   3e-45   
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47     166   4e-45   
ref|XP_008661406.1|  PREDICTED: uncharacterized protein LOC100193...    167   4e-45   
gb|ACR34003.1|  unknown                                                 166   4e-45   
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47     166   5e-45   
dbj|BAJ93453.1|  predicted protein                                      166   5e-45   
ref|NP_001152183.1|  LOC100285821                                       166   5e-45   
ref|XP_002468416.1|  hypothetical protein SORBIDRAFT_01g045570          166   5e-45   
gb|ABF97193.1|  RNA recognition motif family protein, expressed         166   5e-45   
gb|EEC75600.1|  hypothetical protein OsI_12307                          166   6e-45   
gb|AAG59664.1|AC084319_22  putative RNA binding protein                 165   6e-45   
ref|XP_003529385.1|  PREDICTED: polyadenylate-binding protein RBP...    166   6e-45   
ref|XP_006406534.1|  hypothetical protein EUTSA_v10020763mg             162   9e-45   
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170          165   9e-45   
ref|XP_007132012.1|  hypothetical protein PHAVU_011G059300g             165   1e-44   
emb|CBI26625.3|  unnamed protein product                                159   1e-44   
ref|NP_001050516.1|  Os03g0569900                                       165   1e-44   
ref|XP_004250947.1|  PREDICTED: polyadenylate-binding protein RBP...    165   1e-44   
ref|XP_010313279.1|  PREDICTED: polyadenylate-binding protein RBP...    164   1e-44   
ref|XP_003518846.1|  PREDICTED: polyadenylate-binding protein RBP...    165   2e-44   
ref|XP_008392304.1|  PREDICTED: polyadenylate-binding protein RBP47     165   2e-44   
ref|XP_004145357.2|  PREDICTED: polyadenylate-binding protein RBP47     164   2e-44   
gb|ABR18422.1|  unknown                                                 164   2e-44   
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...    164   2e-44   
gb|KJB79290.1|  hypothetical protein B456_013G042300                    161   3e-44   
emb|CDP05748.1|  unnamed protein product                                162   3e-44   
dbj|BAJ85753.1|  predicted protein                                      163   3e-44   
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                     164   3e-44   
ref|XP_009768585.1|  PREDICTED: polyadenylate-binding protein RBP...    164   4e-44   
gb|KJB63806.1|  hypothetical protein B456_010G017300                    162   4e-44   
ref|XP_009615947.1|  PREDICTED: polyadenylate-binding protein RBP...    164   4e-44   
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454             162   4e-44   
ref|XP_003558701.1|  PREDICTED: polyadenylate-binding protein RBP...    163   4e-44   
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47     164   4e-44   
ref|XP_008459212.1|  PREDICTED: polyadenylate-binding protein RBP47     164   4e-44   
dbj|BAJ87828.1|  predicted protein                                      162   5e-44   
ref|XP_007017334.1|  RNA-binding protein 47C isoform 6                  160   5e-44   
ref|XP_007156541.1|  hypothetical protein PHAVU_003G294800g             162   5e-44   
ref|XP_006361746.1|  PREDICTED: polyadenylate-binding protein RBP...    163   5e-44   
emb|CBI32444.3|  unnamed protein product                                161   5e-44   
gb|KFK27100.1|  hypothetical protein AALP_AA8G334500                    163   5e-44   
gb|KFK27101.1|  hypothetical protein AALP_AA8G334500                    163   5e-44   
ref|XP_007156542.1|  hypothetical protein PHAVU_003G294800g             162   6e-44   
ref|XP_006361747.1|  PREDICTED: polyadenylate-binding protein RBP...    163   6e-44   
ref|XP_004295261.2|  PREDICTED: polyadenylate-binding protein RBP45B    162   7e-44   
gb|KFK29206.1|  hypothetical protein AALP_AA7G103000                    162   7e-44   
ref|XP_003537962.1|  PREDICTED: polyadenylate-binding protein RBP...    162   8e-44   
gb|ABK25253.1|  unknown                                                 164   1e-43   
ref|XP_009135617.1|  PREDICTED: polyadenylate-binding protein RBP...    162   1e-43   
ref|XP_012071696.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   
ref|XP_007017335.1|  RNA-binding protein 47C isoform 7                  160   2e-43   
ref|XP_011013053.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   
ref|XP_011017227.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-43   
gb|KHG27259.1|  Polyadenylate-binding RBP47                             161   2e-43   
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...    161   2e-43   
ref|XP_006280607.1|  hypothetical protein CARUB_v10026566mg             161   2e-43   
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...    161   3e-43   
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...    160   3e-43   
gb|EMS52025.1|  RNA-binding post-transcriptional regulator csx1         163   3e-43   
ref|XP_007017333.1|  RNA-binding protein 47C isoform 5                  160   3e-43   
gb|KHN25246.1|  Polyadenylate-binding protein RBP47B'                   160   3e-43   
ref|XP_007017332.1|  RNA-binding protein 47C isoform 4                  160   4e-43   
ref|XP_010438672.1|  PREDICTED: polyadenylate-binding protein RBP45C    161   4e-43   
ref|XP_010448184.1|  PREDICTED: polyadenylate-binding protein RBP...    161   4e-43   
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...    161   4e-43   
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg             161   4e-43   
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...    161   4e-43   
gb|KJB63805.1|  hypothetical protein B456_010G017300                    161   4e-43   
gb|KJB79291.1|  hypothetical protein B456_013G042300                    160   4e-43   
ref|XP_007017330.1|  RNA-binding protein 47C isoform 2                  160   5e-43   
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                    160   5e-43   
ref|XP_003539457.1|  PREDICTED: polyadenylate-binding protein RBP...    160   5e-43   
ref|XP_006406535.1|  hypothetical protein EUTSA_v10020763mg             161   5e-43   
ref|XP_003528246.1|  PREDICTED: polyadenylate-binding protein RBP...    160   6e-43   
ref|XP_006297696.1|  hypothetical protein CARUB_v10013726mg             160   6e-43   
ref|XP_006283830.1|  hypothetical protein CARUB_v10004931mg             160   6e-43   
gb|AAM67293.1|  nuclear acid binding protein, putative                  160   6e-43   
ref|XP_011080284.1|  PREDICTED: polyadenylate-binding protein RBP...    160   6e-43   
ref|XP_006297697.1|  hypothetical protein CARUB_v10013726mg             160   7e-43   
ref|XP_002510266.1|  nuclear acid binding protein, putative             160   7e-43   
ref|XP_009142977.1|  PREDICTED: polyadenylate-binding protein RBP...    160   7e-43   
gb|KJB79289.1|  hypothetical protein B456_013G042300                    160   7e-43   
emb|CDY22988.1|  BnaC03g40810D                                          160   8e-43   
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...    160   8e-43   
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...    160   9e-43   
ref|XP_010466046.1|  PREDICTED: polyadenylate-binding protein RBP...    160   9e-43   
dbj|BAB02953.1|  DNA/RNA binding protein-like                           161   9e-43   
emb|CDX95462.1|  BnaC01g33540D                                          160   9e-43   
ref|XP_007199852.1|  hypothetical protein PRUPE_ppa005661mg             160   9e-43   
gb|KEH35744.1|  polyadenylate-binding protein RBP47C                    157   9e-43   
ref|XP_006374988.1|  RNA-binding protein 47                             160   1e-42   
emb|CDY29263.1|  BnaC01g19150D                                          160   1e-42   
ref|XP_006434825.1|  hypothetical protein CICLE_v10001214mg             157   1e-42   
ref|XP_008792645.1|  PREDICTED: polyadenylate-binding protein RBP...    160   1e-42   
ref|NP_188544.1|  RNA-binding protein 47B                               160   1e-42   
emb|CDX89287.1|  BnaA01g16060D                                          159   1e-42   
ref|XP_007017331.1|  RNA-binding protein 47C isoform 3                  160   1e-42   
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...    159   1e-42   
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    163   1e-42   
ref|XP_007017329.1|  RNA-binding protein 47C isoform 1                  160   1e-42   
emb|CDY18570.1|  BnaA01g26250D                                          159   2e-42   
gb|AAC49850.1|  DNA binding protein ACBF                                159   2e-42   
ref|XP_002885294.1|  RNA-binding protein 47B                            159   2e-42   
ref|XP_009112124.1|  PREDICTED: polyadenylate-binding protein RBP...    160   2e-42   
ref|XP_009112131.1|  PREDICTED: polyadenylate-binding protein RBP...    159   2e-42   
gb|KHN04518.1|  Polyadenylate-binding protein RBP47C                    158   2e-42   
ref|XP_009590296.1|  PREDICTED: polyadenylate-binding protein RBP47     159   2e-42   
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...    159   2e-42   
ref|XP_002867529.1|  hypothetical protein ARALYDRAFT_913848             159   2e-42   
ref|XP_011461514.1|  PREDICTED: polyadenylate-binding protein RBP...    159   2e-42   
ref|XP_004294842.1|  PREDICTED: polyadenylate-binding protein RBP...    159   2e-42   
sp|Q9LEB3.1|RBP47_NICPL  RecName: Full=Polyadenylate-binding prot...    159   3e-42   
ref|NP_567764.1|  polyadenylate-binding protein RBP45C                  159   3e-42   
ref|XP_003523906.1|  PREDICTED: polyadenylate-binding protein RBP...    158   3e-42   
gb|ACF87959.1|  unknown                                                 159   3e-42   
ref|XP_007136663.1|  hypothetical protein PHAVU_009G063200g             158   3e-42   
ref|XP_008393835.1|  PREDICTED: polyadenylate-binding protein RBP...    159   3e-42   
ref|XP_008361011.1|  PREDICTED: polyadenylate-binding protein RBP...    159   4e-42   
ref|NP_001144988.1|  uncharacterized protein LOC100278143               159   4e-42   
ref|XP_010507446.1|  PREDICTED: polyadenylate-binding protein RBP...    159   4e-42   
ref|XP_010433418.1|  PREDICTED: polyadenylate-binding protein RBP45C    158   4e-42   
ref|XP_008236618.1|  PREDICTED: polyadenylate-binding protein RBP...    159   4e-42   
ref|XP_010507452.1|  PREDICTED: polyadenylate-binding protein RBP...    159   4e-42   
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g             158   4e-42   
gb|KDO84283.1|  hypothetical protein CISIN_1g037458mg                   152   4e-42   
ref|XP_008236617.1|  PREDICTED: polyadenylate-binding protein RBP...    159   4e-42   
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...    158   4e-42   
ref|XP_003634360.1|  PREDICTED: polyadenylate-binding protein RBP...    158   4e-42   
ref|XP_004505196.1|  PREDICTED: polyadenylate-binding protein RBP...    159   4e-42   
gb|AAB92518.1|  putative RNA binding protein                            159   4e-42   
ref|XP_006434824.1|  hypothetical protein CICLE_v10001214mg             157   5e-42   
emb|CAB36546.1|  putative DNA binding protein                           158   5e-42   
ref|XP_007042377.1|  RNA-binding protein 47A                            158   6e-42   
ref|XP_010487839.1|  PREDICTED: polyadenylate-binding protein RBP...    158   6e-42   
ref|XP_010487840.1|  PREDICTED: polyadenylate-binding protein RBP...    158   6e-42   
gb|KJB47423.1|  hypothetical protein B456_008G025400                    157   7e-42   
gb|KJB47422.1|  hypothetical protein B456_008G025400                    157   7e-42   
ref|XP_002302445.2|  RNA-binding protein 47                             157   7e-42   
ref|XP_009794616.1|  PREDICTED: polyadenylate-binding protein RBP...    157   9e-42   
gb|KJB59840.1|  hypothetical protein B456_009G275200                    157   1e-41   
ref|XP_008797245.1|  PREDICTED: polyadenylate-binding protein RBP...    156   1e-41   
ref|XP_012089580.1|  PREDICTED: polyadenylate-binding protein RBP...    157   1e-41   
emb|CDX92304.1|  BnaA05g21030D                                          157   1e-41   
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...    157   1e-41   
ref|XP_002518798.1|  nuclear acid binding protein, putative             157   1e-41   
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...    155   1e-41   
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...    155   2e-41   
ref|XP_008357395.1|  PREDICTED: polyadenylate-binding protein RBP...    157   2e-41   
ref|XP_009145104.1|  PREDICTED: polyadenylate-binding protein RBP...    156   2e-41   
gb|EPS67039.1|  hypothetical protein M569_07737                         156   2e-41   
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...    155   2e-41   
gb|KHG01821.1|  Polyadenylate-binding RBP47C -like protein              156   2e-41   
emb|CDX99265.1|  BnaC05g33800D                                          156   2e-41   
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...    157   2e-41   
gb|KJB58433.1|  hypothetical protein B456_009G209600                    155   2e-41   
ref|XP_006434827.1|  hypothetical protein CICLE_v10001214mg             157   2e-41   
emb|CDY29341.1|  BnaA05g16080D                                          156   2e-41   
ref|XP_006473363.1|  PREDICTED: polyadenylate-binding protein RBP...    156   2e-41   
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47     156   2e-41   
ref|XP_009145825.1|  PREDICTED: polyadenylate-binding protein RBP...    156   2e-41   
ref|XP_003603009.1|  RNA-binding protein                                156   2e-41   
gb|KHN33037.1|  Polyadenylate-binding protein RBP45                     154   2e-41   
ref|NP_001132004.1|  uncharacterized protein LOC100193409               156   2e-41   
ref|XP_006393234.1|  hypothetical protein EUTSA_v10011485mg             156   3e-41   
emb|CDY28101.1|  BnaC06g02820D                                          156   3e-41   
dbj|BAG87507.1|  unnamed protein product                                154   3e-41   
ref|XP_008452518.1|  PREDICTED: polyadenylate-binding protein RBP...    156   3e-41   
emb|CDP18029.1|  unnamed protein product                                156   3e-41   
gb|KFK39249.1|  hypothetical protein AALP_AA3G219800                    156   3e-41   
emb|CDY50959.1|  BnaA06g37550D                                          156   3e-41   
ref|XP_009370171.1|  PREDICTED: polyadenylate-binding protein RBP...    156   3e-41   
ref|XP_002313840.2|  RNA-binding protein 47                             156   3e-41   
ref|XP_009147873.1|  PREDICTED: polyadenylate-binding protein RBP47A    156   3e-41   
gb|KFK39248.1|  hypothetical protein AALP_AA3G219800                    156   3e-41   
ref|XP_010525621.1|  PREDICTED: polyadenylate-binding protein RBP...    156   3e-41   
ref|XP_009370172.1|  PREDICTED: polyadenylate-binding protein RBP...    156   3e-41   
ref|XP_009404023.1|  PREDICTED: polyadenylate-binding protein RBP...    155   3e-41   
gb|KHG24367.1|  Polyadenylate-binding RBP47                             155   4e-41   
ref|XP_002963882.1|  hypothetical protein SELMODRAFT_80061              154   4e-41   
ref|XP_010540323.1|  PREDICTED: polyadenylate-binding protein RBP47B    155   4e-41   
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...    155   4e-41   
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...    155   4e-41   
ref|XP_009391347.1|  PREDICTED: polyadenylate-binding protein RBP...    155   4e-41   
gb|KGN55171.1|  hypothetical protein Csa_4G639100                       154   4e-41   
ref|XP_004501589.1|  PREDICTED: polyadenylate-binding protein RBP...    155   4e-41   
gb|KCW68770.1|  hypothetical protein EUGRSUZ_F02369                     155   4e-41   
gb|KCW68769.1|  hypothetical protein EUGRSUZ_F02369                     155   5e-41   
gb|EYU46265.1|  hypothetical protein MIMGU_mgv1a007107mg                155   5e-41   
dbj|BAJ85879.1|  predicted protein                                      156   5e-41   
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...    154   7e-41   
ref|XP_010482899.1|  PREDICTED: polyadenylate-binding protein RBP...    154   7e-41   
ref|XP_010523211.1|  PREDICTED: polyadenylate-binding protein RBP...    155   7e-41   
gb|KJB58432.1|  hypothetical protein B456_009G209600                    155   7e-41   
ref|NP_001063403.1|  Os09g0462700                                       155   8e-41   
emb|CDY66423.1|  BnaAnng22220D                                          155   8e-41   
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...    155   9e-41   
ref|XP_008444645.1|  PREDICTED: polyadenylate-binding protein RBP...    155   9e-41   



>ref|XP_006346222.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=414

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQYWMDENY++TCF HTGEL S+KVIRNK +GQSEGYGF+EFRSHAAAE +
Sbjct  83   ELRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQSGQSEGYGFLEFRSHAAAETV  142

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN EQNFR+NWA+LGAGE+RDD+P+YTIFVGDLAADV DY
Sbjct  143  LQTYNGALMPNVEQNFRMNWASLGAGERRDDSPEYTIFVGDLAADVTDY  191



>ref|XP_004244127.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=410

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV+SLWIGDLQYWMDE+Y++TCF HTGEL S+KVIRNK +GQSEGYGF+EFRSHAAAE +
Sbjct  79   EVRSLWIGDLQYWMDESYLSTCFYHTGELVSAKVIRNKQSGQSEGYGFLEFRSHAAAETV  138

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN EQNFR+NWA+LGAGE+RDD+P+YTIFVGDLAADV DY
Sbjct  139  LQTYNGALMPNVEQNFRMNWASLGAGERRDDSPEYTIFVGDLAADVTDY  187



>ref|XP_009795696.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana sylvestris]
Length=409

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV+SLWIGDLQYWMDENY++TCF HTGEL S+KVIRNK TGQSEGYGF+EFRSHAAAE I
Sbjct  82   EVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAAAETI  141

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFR+NWA+LGAGE+RDD+ ++TIFVGDLAADV DY
Sbjct  142  LQTYNGTLMPNVEQNFRMNWASLGAGERRDDSAEHTIFVGDLAADVTDY  190



>sp|Q9LEB4.1|RBP45_NICPL RecName: Full=Polyadenylate-binding protein RBP45; Short=Poly(A)-binding 
protein RBP45; AltName: Full=RNA-binding protein 
45; Short=NplRBP45 [Nicotiana plumbaginifolia]
 emb|CAC01237.1| RNA Binding Protein 45 [Nicotiana plumbaginifolia]
Length=409

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV+SLWIGDLQYWMDENY++TCF HTGEL S+KVIRNK TGQSEGYGF+EFRSHAAAE I
Sbjct  82   EVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAAAETI  141

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFR+NWA+LGAGE+RDD+ ++TIFVGDLAADV DY
Sbjct  142  LQTYNGTLMPNVEQNFRMNWASLGAGERRDDSAEHTIFVGDLAADVTDY  190



>ref|XP_009600135.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana tomentosiformis]
Length=410

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV+SLWIGDLQYWMDENY++TCF HTGEL S+KVIRNK TGQSEGYGF+EFRSHAAAE I
Sbjct  83   EVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAAAETI  142

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFR+NWA+LGAGE+RDD+ ++TIFVGDLAADV DY
Sbjct  143  LQTYNGTLMPNVEQNFRMNWASLGAGERRDDSAEHTIFVGDLAADVTDY  191



>ref|XP_006449040.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62280.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=305

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+ GAGEKRDDTPD+TIFVGDLAADV DY
Sbjct  140  LQTYNGTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDY  188



>gb|KDO75474.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=303

 Score =   194 bits (492),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+NGT MPN EQNFRLNWA+ GAGEKRDDTPD+TIFVGDLAADV DY
Sbjct  140  LQTFNGTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDY  188



>gb|KDO75475.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
 gb|KDO75476.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=305

 Score =   194 bits (492),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+NGT MPN EQNFRLNWA+ GAGEKRDDTPD+TIFVGDLAADV DY
Sbjct  140  LQTFNGTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDY  188



>ref|XP_002518499.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43886.1| nuclear acid binding protein, putative [Ricinus communis]
Length=430

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYIN+CFAHTGE+TS KVIRNK TGQ EGYGF+EF SH  AE I
Sbjct  87   EVRTLWIGDLQYWMDENYINSCFAHTGEVTSVKVIRNKQTGQVEGYGFIEFGSHGTAERI  146

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+   G+KRDDTPD+TIFVGDLAADV DY
Sbjct  147  LQTYNGTPMPNGEQNFRLNWASFSGGDKRDDTPDFTIFVGDLAADVTDY  195



>ref|XP_006449039.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62279.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=406

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+ GAGEKRDDTPD+TIFVGDLAADV DY
Sbjct  140  LQTYNGTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDY  188



>ref|XP_006449038.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62278.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=413

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+ GAGEKRDDTPD+TIFVGDLAADV DY
Sbjct  140  LQTYNGTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDY  188



>gb|EYU33637.1| hypothetical protein MIMGU_mgv1a007175mg [Erythranthe guttata]
Length=416

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQYWMDENY+NTCF HTGEL S+KVIRNK +GQSEGYGF+EFR+HAAAE I
Sbjct  77   EIRSLWIGDLQYWMDENYLNTCFYHTGELVSAKVIRNKQSGQSEGYGFLEFRTHAAAETI  136

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN+EQ+FR+NWA+LGAG+KR DD+P++TIFVGDLA DV DY
Sbjct  137  LQTYNGAMMPNAEQSFRMNWASLGAGDKRTDDSPEHTIFVGDLAGDVTDY  186



>ref|XP_006468021.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Citrus sinensis]
 gb|KDO75473.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=413

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+NGT MPN EQNFRLNWA+ GAGEKRDDTPD+TIFVGDLAADV DY
Sbjct  140  LQTFNGTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDY  188



>ref|XP_006468022.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Citrus sinensis]
 gb|KDO75472.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=406

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE Y+NTCFAHTGE+ + KVIRNK TGQ EGYGF+EF S A AE +
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+NGT MPN EQNFRLNWA+ GAGEKRDDTPD+TIFVGDLAADV DY
Sbjct  140  LQTFNGTPMPNGEQNFRLNWASFGAGEKRDDTPDHTIFVGDLAADVTDY  188



>ref|XP_011037672.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X3 [Populus 
euphratica]
Length=280

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI +CFAHTGE+ S K+IRNK T Q EGYGF+E  SH AAE I
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAAERI  134

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+   G+KRDD+PD+TIFVGDLAADV D+
Sbjct  135  LQTYNGTPMPNGEQNFRLNWASFSGGDKRDDSPDFTIFVGDLAADVTDF  183



>ref|XP_011037673.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X4 [Populus 
euphratica]
Length=273

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI +CFAHTGE+ S K+IRNK T Q EGYGF+E  SH AAE I
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAAERI  134

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+   G+KRDD+PD+TIFVGDLAADV D+
Sbjct  135  LQTYNGTPMPNGEQNFRLNWASFSGGDKRDDSPDFTIFVGDLAADVTDF  183



>ref|XP_011097972.1| PREDICTED: polyadenylate-binding protein RBP45-like [Sesamum 
indicum]
Length=376

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 99/110 (90%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV+SLWIGDLQYWMDENY+ +CF HTGEL S+K+IRNK TGQSEGYGF+EFR+HA AENI
Sbjct  50   EVRSLWIGDLQYWMDENYLTSCFYHTGELVSAKIIRNKQTGQSEGYGFLEFRTHATAENI  109

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN++Q FRLNWA+LGAG+KR DD+P++TIFVGDLA DV DY
Sbjct  110  LQTYNGAMMPNADQTFRLNWASLGAGDKRADDSPEHTIFVGDLAGDVTDY  159



>ref|XP_011037671.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Populus 
euphratica]
Length=321

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI +CFAHTGE+ S K+IRNK T Q EGYGF+E  SH AAE I
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAAERI  134

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+   G+KRDD+PD+TIFVGDLAADV D+
Sbjct  135  LQTYNGTPMPNGEQNFRLNWASFSGGDKRDDSPDFTIFVGDLAADVTDF  183



>ref|XP_002305583.2| RNA-binding protein 45 [Populus trichocarpa]
 gb|EEE86094.2| RNA-binding protein 45 [Populus trichocarpa]
Length=409

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI +CFAHTGE+ S K+IRNK T Q EGYGF+E  SH AAE I
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIEMTSHGAAERI  134

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+   G+KRDD+PD+TIFVGDLAADV D+
Sbjct  135  LQTYNGTPMPNGEQNFRLNWASFSGGDKRDDSPDFTIFVGDLAADVTDF  183



>ref|XP_011037670.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Populus 
euphratica]
Length=409

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI +CFAHTGE+ S K+IRNK T Q EGYGF+E  SH AAE I
Sbjct  75   EVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAAERI  134

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+   G+KRDD+PD+TIFVGDLAADV D+
Sbjct  135  LQTYNGTPMPNGEQNFRLNWASFSGGDKRDDSPDFTIFVGDLAADVTDF  183



>ref|XP_012091369.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X3 [Jatropha 
curcas]
Length=297

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            +V++LWIGDLQYWMDE+Y+++CFA TGE+ + KVIRNK TGQ EGYGF+EF SH +AE +
Sbjct  92   DVRTLWIGDLQYWMDESYLHSCFAQTGEVVNVKVIRNKQTGQVEGYGFIEFNSHGSAERV  151

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+   G+KRDDTPD+TIFVGDLA DV DY
Sbjct  152  LQTYNGTPMPNGEQNFRLNWASFSGGDKRDDTPDFTIFVGDLATDVTDY  200



>ref|XP_011096084.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Sesamum 
indicum]
Length=422

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  339  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENIL  518
            ++SLWIGDLQYWMDE Y+  CFA TGE+ S+KVIRNK TGQSEGYGF+EF SHAAAE  L
Sbjct  86   IRSLWIGDLQYWMDEQYLYNCFAATGEVVSAKVIRNKQTGQSEGYGFIEFASHAAAERNL  145

Query  519  QTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            QTYNG+ MPN EQ FRLNWA++GAGEKRDD P+YTIFVGDLAADV DY
Sbjct  146  QTYNGSLMPNVEQTFRLNWASMGAGEKRDDAPEYTIFVGDLAADVTDY  193



>ref|XP_004234481.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
lycopersicum]
Length=405

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE YI  CFAHTGE+ S KVIRNK +GQSEGYGFVEF SHAAAE  
Sbjct  70   EIRSLWIGDLQFWMDEQYIQNCFAHTGEVASVKVIRNKQSGQSEGYGFVEFISHAAAERN  129

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG+ MPNSEQ FRLNWA+LG+GEKR D+ P+YTIFVGDLAADV DY
Sbjct  130  LQTYNGSMMPNSEQPFRLNWASLGSGEKRSDNGPEYTIFVGDLAADVTDY  179



>ref|XP_011096085.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Sesamum 
indicum]
Length=420

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  339  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENIL  518
            ++SLWIGDLQYWMDE Y+  CFA TGE+ S+KVIRNK TGQSEGYGF+EF SHAAAE  L
Sbjct  86   IRSLWIGDLQYWMDEQYLYNCFAATGEVVSAKVIRNKQTGQSEGYGFIEFASHAAAERNL  145

Query  519  QTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            QTYNG+ MPN EQ FRLNWA++GAGEKRDD P+YTIFVGDLAADV DY
Sbjct  146  QTYNGSLMPNVEQTFRLNWASMGAGEKRDDAPEYTIFVGDLAADVTDY  193



>ref|XP_006343293.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=411

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE YI  CFAHTGE+ S KVIRNK +GQSEGYGFVEF SHAAAE  
Sbjct  76   EIRSLWIGDLQFWMDEPYIQNCFAHTGEVASVKVIRNKQSGQSEGYGFVEFISHAAAERN  135

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG+ MPNSEQ FRLNWA+LG+GEKR D+ P+YTIFVGDLAADV DY
Sbjct  136  LQTYNGSMMPNSEQPFRLNWASLGSGEKRSDNGPEYTIFVGDLAADVTDY  185



>emb|CDP04386.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 1/109 (1%)
 Frame = +3

Query  339  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENIL  518
            ++SLWIGDLQYWMDE Y+ +CF+ TGE+ S+KVIRNK TGQSEGYGF+EF SHA AE  L
Sbjct  79   IRSLWIGDLQYWMDEQYLLSCFSQTGEVLSAKVIRNKQTGQSEGYGFIEFVSHAGAERNL  138

Query  519  QTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            Q YNGT MPN EQ+FRLNWA++GAGEKR DD+PDYTIFVGDLAADV DY
Sbjct  139  QAYNGTLMPNVEQHFRLNWASMGAGEKRSDDSPDYTIFVGDLAADVTDY  187



>ref|XP_011010322.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X3 [Populus euphratica]
Length=427

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+KSLWIGDLQ WMDENYI + F++TGE+  +KVIRNK TG  EGYGF+EF SHAAAE I
Sbjct  65   EIKSLWIGDLQQWMDENYILSIFSNTGEVVQAKVIRNKQTGYPEGYGFIEFVSHAAAERI  124

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPNSEQ FRLNWATLGAGE+R DD PDYTIF+GDLAADVNDY
Sbjct  125  LQTYNGTPMPNSEQTFRLNWATLGAGERRQDDGPDYTIFIGDLAADVNDY  174



>ref|XP_011010320.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X1 [Populus euphratica]
 ref|XP_011010321.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X2 [Populus euphratica]
Length=428

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+KSLWIGDLQ WMDENYI + F++TGE+  +KVIRNK TG  EGYGF+EF SHAAAE I
Sbjct  65   EIKSLWIGDLQQWMDENYILSIFSNTGEVVQAKVIRNKQTGYPEGYGFIEFVSHAAAERI  124

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPNSEQ FRLNWATLGAGE+R DD PDYTIF+GDLAADVNDY
Sbjct  125  LQTYNGTPMPNSEQTFRLNWATLGAGERRQDDGPDYTIFIGDLAADVNDY  174



>ref|XP_003549897.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
 gb|KHN03463.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=402

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCFAHTGEL S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFAHTGELASVKVIRNKQTSQSEGYGFIEFTSRAGAERV  122

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN  QNFRLNWAT  AGE+R DD+PD+TIFVGDLAADV DY
Sbjct  123  LQTYNGTIMPNGGQNFRLNWATFSAGERRHDDSPDHTIFVGDLAADVTDY  172



>ref|XP_006594429.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Glycine 
max]
Length=314

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCFAHTGE+TS KVIRNK T QSEGYGF+EF S A AE I
Sbjct  64   EVRTLWIGDLQYWMDENYLYTCFAHTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAGAERI  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGE--KRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN  Q+FRLNWAT  AGE  + DD+PDYTIFVGDLAADV DY
Sbjct  124  LQTYNGAIMPNGGQSFRLNWATFSAGERSRHDDSPDYTIFVGDLAADVTDY  174



>ref|XP_012091368.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Jatropha 
curcas]
Length=340

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            +V++LWIGDLQYWMDE+Y+++CFA TGE+ + KVIRNK TGQ EGYGF+EF SH +AE +
Sbjct  92   DVRTLWIGDLQYWMDESYLHSCFAQTGEVVNVKVIRNKQTGQVEGYGFIEFNSHGSAERV  151

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+   G+KRDDTPD+TIFVGDLA DV DY
Sbjct  152  LQTYNGTPMPNGEQNFRLNWASFSGGDKRDDTPDFTIFVGDLATDVTDY  200



>gb|EPS64177.1| hypothetical protein M569_10604, partial [Genlisea aurea]
Length=438

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  339  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENIL  518
            ++SLWIGDLQYWMDE Y+ +CFAHTGE+ S+KVIRN+ TGQSEGYGF+EF SHAAAE  L
Sbjct  89   IRSLWIGDLQYWMDEQYLYSCFAHTGEVASAKVIRNRHTGQSEGYGFIEFVSHAAAERNL  148

Query  519  QTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            QTYNG  MPN EQ FRLNWA++GAGEKRDD  +YTIFVGDLAADV DY
Sbjct  149  QTYNGALMPNVEQTFRLNWASMGAGEKRDDATEYTIFVGDLAADVTDY  196



>ref|XP_006370698.1| hypothetical protein POPTR_0001s45000g [Populus trichocarpa]
 gb|ERP67267.1| hypothetical protein POPTR_0001s45000g [Populus trichocarpa]
Length=430

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+KSLWIGDLQ WMDENYI + F+ TGE+  +KVIRNK TG  EGYGF+EF SHAAAE I
Sbjct  65   EIKSLWIGDLQQWMDENYILSIFSTTGEVVQAKVIRNKQTGYPEGYGFIEFVSHAAAERI  124

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPNSEQ FRLNWATLGAGE+R DD PDYT+F+GDLAADVNDY
Sbjct  125  LQTYNGTPMPNSEQTFRLNWATLGAGERRQDDGPDYTVFIGDLAADVNDY  174



>ref|XP_006446110.1| hypothetical protein CICLE_v10015576mg [Citrus clementina]
 gb|ESR59350.1| hypothetical protein CICLE_v10015576mg [Citrus clementina]
Length=385

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERV  81

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQNFRLNWA+ G GEKR D  P+++IFVGDLA DV DY
Sbjct  82   LQTYNGTPMPGTEQNFRLNWASFGIGEKRPDAGPEHSIFVGDLAPDVTDY  131



>gb|KDO61276.1| hypothetical protein CISIN_1g014513mg [Citrus sinensis]
Length=394

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERV  81

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQNFRLNWA+ G GEKR D  P+++IFVGDLA DV DY
Sbjct  82   LQTYNGTPMPGTEQNFRLNWASFGIGEKRPDAGPEHSIFVGDLAPDVTDY  131



>ref|XP_010278713.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nelumbo 
nucifera]
Length=310

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWM+E+YI++CFAHTGE+ S KVIRNK TGQSEGYGF+EF +  AAE I
Sbjct  95   EVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPAAERI  154

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN+EQNFRLNWA+ G GE+R DD+ D+TIFVGDLA+DV DY
Sbjct  155  LQTYNGTLMPNAEQNFRLNWASFGLGERRPDDSADFTIFVGDLASDVTDY  204



>ref|XP_010327242.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X3 [Solanum lycopersicum]
Length=354

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+WMDE Y+ +CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE  
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  133

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQNFRLNWA+LG+GEKR D+TP+YTIFVGDLAADV DY
Sbjct  134  LQAYNGTLMPNIEQNFRLNWASLGSGEKRSDNTPEYTIFVGDLAADVTDY  183



>gb|KHN35750.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=397

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TC AHTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  59   EVRTLWIGDLQYWMDENYLYTCLAHTGEVASVKVIRNKQTSQSEGYGFIEFTSRAGAERV  118

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN  QNFRLNWATL AGE+R DD+PD+TIFVGDLAADV DY
Sbjct  119  LQTYNGTIMPNGGQNFRLNWATLSAGERRHDDSPDHTIFVGDLAADVTDY  168



>gb|KDO61275.1| hypothetical protein CISIN_1g014513mg [Citrus sinensis]
Length=423

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERV  81

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQNFRLNWA+ G GEKR D  P+++IFVGDLA DV DY
Sbjct  82   LQTYNGTPMPGTEQNFRLNWASFGIGEKRPDAGPEHSIFVGDLAPDVTDY  131



>ref|XP_003529629.1| PREDICTED: polyadenylate-binding protein RBP45 [Glycine max]
Length=397

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TC AHTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  59   EVRTLWIGDLQYWMDENYLYTCLAHTGEVASVKVIRNKQTSQSEGYGFIEFTSRAGAERV  118

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN  QNFRLNWATL AGE+R DD+PD+TIFVGDLAADV DY
Sbjct  119  LQTYNGTIMPNGGQNFRLNWATLSAGERRHDDSPDHTIFVGDLAADVTDY  168



>ref|XP_009631415.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana tomentosiformis]
Length=399

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE Y+  CFA TGE+ ++KVIRNK TGQSEGYGFVEF SHAAAE  
Sbjct  71   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAAAERN  130

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN+EQNFRLNWA+LG+GEKR D+ P+YTIFVGDLAADV DY
Sbjct  131  LQAYNGTLMPNTEQNFRLNWASLGSGEKRSDNAPEYTIFVGDLAADVTDY  180



>ref|XP_009631416.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana tomentosiformis]
Length=398

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE Y+  CFA TGE+ ++KVIRNK TGQSEGYGFVEF SHAAAE  
Sbjct  71   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAAAERN  130

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN+EQNFRLNWA+LG+GEKR D+ P+YTIFVGDLAADV DY
Sbjct  131  LQAYNGTLMPNTEQNFRLNWASLGSGEKRSDNAPEYTIFVGDLAADVTDY  180



>ref|XP_009631417.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nicotiana tomentosiformis]
Length=396

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE Y+  CFA TGE+ ++KVIRNK TGQSEGYGFVEF SHAAAE  
Sbjct  71   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAAAERN  130

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN+EQNFRLNWA+LG+GEKR D+ P+YTIFVGDLAADV DY
Sbjct  131  LQAYNGTLMPNTEQNFRLNWASLGSGEKRSDNAPEYTIFVGDLAADVTDY  180



>gb|KGN64531.1| hypothetical protein Csa_1G063550 [Cucumis sativus]
Length=369

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  165  EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  224

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  225  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  272



>ref|XP_008349848.1| PREDICTED: polyadenylate-binding protein RBP45-like, partial 
[Malus domestica]
Length=271

 Score =   180 bits (456),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDL  WMDE YI +CF  TGE  ++KVIRNKLTG  EGYGF+EFRS A AE I
Sbjct  66   EIRSLWIGDLLQWMDEAYILSCFGPTGEAVNAKVIRNKLTGLPEGYGFIEFRSRAXAEQI  125

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN+EQNFRLNWATLGAGE+R DD PD+T+FVGDLAADV DY
Sbjct  126  LQTYNGTLMPNTEQNFRLNWATLGAGERRQDDGPDFTVFVGDLAADVTDY  175



>gb|KHN37596.1| Polyadenylate-binding protein RBP45B, partial [Glycine soja]
Length=357

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCFAHTGE+TS KVIRNK T QSEGYGF+EF S A AE I
Sbjct  10   EVRTLWIGDLQYWMDENYLYTCFAHTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAGAERI  69

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGE--KRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN  Q+FRLNWAT  AGE  + DD+PDYTIFVGDLAADV DY
Sbjct  70   LQTYNGAIMPNGGQSFRLNWATFSAGERSRHDDSPDYTIFVGDLAADVTDY  120



>ref|XP_012091367.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Jatropha 
curcas]
 gb|KDP20762.1| hypothetical protein JCGZ_21233 [Jatropha curcas]
Length=431

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            +V++LWIGDLQYWMDE+Y+++CFA TGE+ + KVIRNK TGQ EGYGF+EF SH +AE +
Sbjct  92   DVRTLWIGDLQYWMDESYLHSCFAQTGEVVNVKVIRNKQTGQVEGYGFIEFNSHGSAERV  151

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWA+   G+KRDDTPD+TIFVGDLA DV DY
Sbjct  152  LQTYNGTPMPNGEQNFRLNWASFSGGDKRDDTPDFTIFVGDLATDVTDY  200



>ref|XP_004145107.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
sativus]
Length=408

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  124  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  171



>ref|XP_006470600.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Citrus 
sinensis]
Length=424

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  22   EVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERV  81

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQNFRLNWA+ G GEKR D  P+++IFVGDLA DV DY
Sbjct  82   LQTYNGTPMPGTEQNFRLNWASFGIGEKRPDAGPEHSIFVGDLAPDVTDY  131



>ref|XP_007147735.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
 gb|ESW19729.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
Length=399

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCFA TGE+TS KVIRNK T QSEGYGF+EF S AAAE I
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAAAERI  122

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN  Q+FRLNWA+  AGE+R DD+PDYTIFVGDLAADV DY
Sbjct  123  LQTYNGAIMPNGGQSFRLNWASFSAGERRHDDSPDYTIFVGDLAADVTDY  172



>gb|AGV54881.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCFA TGE+TS KVIRNK T QSEGYGF+EF S AAAE I
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAAAERI  122

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN  Q+FRLNWA+  AGE+R DD+PDYTIFVGDLAADV DY
Sbjct  123  LQTYNGAIMPNGGQSFRLNWASFSAGERRHDDSPDYTIFVGDLAADVTDY  172



>dbj|BAH56983.1| AT1G11650 [Arabidopsis thaliana]
Length=271

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE +
Sbjct  60   EIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV  119

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+N   +P+  +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  120  LQTFNNAPIPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  169



>ref|XP_002280601.1| PREDICTED: polyadenylate-binding protein RBP45-like [Vitis vinifera]
Length=417

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WM+ENY+  CF+ TGE+ S KVIRNK TGQ EGYGF+E  + AAAE I
Sbjct  88   EIRSLWIGDLQPWMEENYLWGCFSQTGEVVSVKVIRNKQTGQCEGYGFIELATRAAAERI  147

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPNSEQNFRLNWATLGAGE+R DDTPDYTIFVGDLA+DV DY
Sbjct  148  LQTYNGTLMPNSEQNFRLNWATLGAGERRADDTPDYTIFVGDLASDVTDY  197



>ref|XP_004232721.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=413

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE Y+  CFA TGE+TS+KVIRNK +GQSEGYGF+EF SHAAAE  
Sbjct  77   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVTSAKVIRNKQSGQSEGYGFIEFISHAAAERN  136

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQNFRLNWA+LG+GEKR D+ P+YTIFVGDLAADV+DY
Sbjct  137  LQAYNGTLMPNIEQNFRLNWASLGSGEKRSDNGPEYTIFVGDLAADVSDY  186



>ref|XP_011652716.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X3 [Cucumis 
sativus]
Length=403

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  124  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  171



>ref|XP_011652720.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X4 [Cucumis 
sativus]
Length=402

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  124  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  171



>ref|XP_007153936.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
 gb|ESW25930.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
Length=398

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCFAHTGE+ S KVIRNK T QSEGYGF+EF S A AE I
Sbjct  61   EVRTLWIGDLQYWMDENYLYTCFAHTGEVASVKVIRNKQTSQSEGYGFIEFTSRAGAERI  120

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN  QNFRLNWA+  AG++R DD+PD+TIFVGDLAADV DY
Sbjct  121  LQTYNGTIMPNGGQNFRLNWASFSAGDRRHDDSPDHTIFVGDLAADVTDY  170



>ref|XP_008441142.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Cucumis melo]
Length=403

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  124  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  171



>ref|XP_008441139.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Cucumis melo]
Length=404

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  124  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  171



>ref|XP_004145109.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Cucumis 
sativus]
Length=404

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  124  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  171



>ref|XP_008441138.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Cucumis melo]
Length=405

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  124  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  171



>ref|XP_008441150.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Cucumis melo]
Length=402

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  124  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  171



>ref|XP_003542872.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Glycine 
max]
Length=409

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCFAHTGE+TS KVIRNK T QSEGYGF+EF S A AE I
Sbjct  64   EVRTLWIGDLQYWMDENYLYTCFAHTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAGAERI  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGE--KRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN  Q+FRLNWAT  AGE  + DD+PDYTIFVGDLAADV DY
Sbjct  124  LQTYNGAIMPNGGQSFRLNWATFSAGERSRHDDSPDYTIFVGDLAADVTDY  174



>ref|XP_008441163.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
melo]
Length=407

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  124  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  171



>ref|XP_003546146.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
Length=411

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCFAHTGE++S KVIRNK T QSEGYGF+EF S A AE I
Sbjct  65   EVRTLWIGDLQYWMDENYLYTCFAHTGEVSSVKVIRNKQTSQSEGYGFIEFNSRAGAERI  124

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGE--KRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN  Q+FRLNWAT  AGE  ++DD+PDYTIFVGDLAADV DY
Sbjct  125  LQTYNGAIMPNGGQSFRLNWATFSAGERSRQDDSPDYTIFVGDLAADVTDY  175



>ref|XP_011652705.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Cucumis 
sativus]
Length=405

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFAHTGE++S KVIRNK TGQSEGYGF+EF +  AAE +
Sbjct  64   EVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERV  123

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGTAMPN  QNFRLNWA+  AGEKR DD+PDYTIFVGDLA DV DY
Sbjct  124  LQTYNGTAMPNGAQNFRLNWAS--AGEKRQDDSPDYTIFVGDLAGDVTDY  171



>ref|XP_003610418.1| RNA-binding protein [Medicago truncatula]
Length=319

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EVK+LWIGDLQYWMDENY+  CF+HTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  72   EVKTLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKQTNQSEGYGFLEFISRAGAERV  131

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDYY  665
            LQT+NGT MPN  QNFRLNWAT  +GEKR DD+PDYTIFVGDLAADV+D++
Sbjct  132  LQTFNGTIMPNGGQNFRLNWATFSSGEKRHDDSPDYTIFVGDLAADVSDHH  182



>ref|XP_008812246.1| PREDICTED: polyadenylate-binding protein RBP47B' [Phoenix dactylifera]
Length=447

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE+Y+++CFAHTGE+ S KVIRNK+TG  EGYGFVEF SHAAAE I
Sbjct  45   EVRTLWIGDLQYWVDESYLHSCFAHTGEVVSVKVIRNKITGHPEGYGFVEFVSHAAAERI  104

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG+ MP +EQ FRLNWA+ G GE+RD  PD++IFVGDLA DV DY
Sbjct  105  LQTYNGSQMPGTEQAFRLNWASFGLGERRDAGPDHSIFVGDLAPDVTDY  153



>ref|XP_004248403.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum lycopersicum]
Length=410

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+WMDE Y+ +CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE  
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  133

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQNFRLNWA+LG+GEKR D+TP+YTIFVGDLAADV DY
Sbjct  134  LQAYNGTLMPNIEQNFRLNWASLGSGEKRSDNTPEYTIFVGDLAADVTDY  183



>ref|XP_010327241.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum lycopersicum]
Length=411

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+WMDE Y+ +CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE  
Sbjct  74   EVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  133

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQNFRLNWA+LG+GEKR D+TP+YTIFVGDLAADV DY
Sbjct  134  LQAYNGTLMPNIEQNFRLNWASLGSGEKRSDNTPEYTIFVGDLAADVTDY  183



>gb|KJB69302.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=294

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S AAAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E N+RLNWA+  +G++RD+TP++TIFVGDLAADV DY
Sbjct  148  LQTYNGTPMPNGESNYRLNWASFSSGDRRDETPEFTIFVGDLAADVTDY  196



>emb|CAN83958.1| hypothetical protein VITISV_039907 [Vitis vinifera]
Length=410

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WM+ENY   CF+ TGE+ S KVIRNK TGQ EGYGF+E  + AAAE I
Sbjct  73   EIRSLWIGDLQPWMEENYXWGCFSQTGEVVSVKVIRNKQTGQCEGYGFIELATRAAAERI  132

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPNSEQNFRLNWATLGAGE+R DDTPDYTIFVGDLA+DV DY
Sbjct  133  LQTYNGTLMPNSEQNFRLNWATLGAGERRADDTPDYTIFVGDLASDVTDY  182



>ref|XP_006348103.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=413

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE YI  CFA TGE+TS+KVIRNK +GQSEGYGF+EF SHAAAE  
Sbjct  77   EIRSLWIGDLQFWMDEQYILNCFAQTGEVTSAKVIRNKQSGQSEGYGFIEFISHAAAERN  136

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQNFRLNWA+LG+GEKR D+ P++TIFVGDLAADV+DY
Sbjct  137  LQAYNGTLMPNIEQNFRLNWASLGSGEKRSDNGPEHTIFVGDLAADVSDY  186



>ref|XP_009789022.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
sylvestris]
Length=413

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE YI+ CFAHTGE+ S KVIRNK TGQSEGYGF+EF SHAAAE  
Sbjct  74   EIRSLWIGDLQFWMDEQYIHNCFAHTGEVVSVKVIRNKQTGQSEGYGFIEFISHAAAEKN  133

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQ FRLNWA+ G+GEKR D+ P+Y+IFVGDLAADV DY
Sbjct  134  LQTYNGTLMPNIEQPFRLNWASPGSGEKRSDNGPEYSIFVGDLAADVTDY  183



>gb|KEH36838.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=271

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 93/112 (83%), Gaps = 3/112 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCF +TGELTS KVIRNK T QSEGYGF+EF + A AE +
Sbjct  58   EVRTLWIGDLQYWMDENYLYTCFGNTGELTSVKVIRNKQTSQSEGYGFIEFNTRATAERV  117

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGE---KRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN  QN+RLNWAT  AGE   ++DD PD+TIFVGDLAADV DY
Sbjct  118  LQTYNGTIMPNGGQNYRLNWATFSAGERSSRQDDGPDHTIFVGDLAADVTDY  169



>gb|KJB69304.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=292

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S AAAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E N+RLNWA+  +G++RD+TP++TIFVGDLAADV DY
Sbjct  148  LQTYNGTPMPNGESNYRLNWASFSSGDRRDETPEFTIFVGDLAADVTDY  196



>ref|XP_009595795.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE YI+ CFAHTGE+ S KVIRNK TGQSEGYGF+EF SHAAAE  
Sbjct  72   ELRSLWIGDLQFWMDEQYIHNCFAHTGEVVSVKVIRNKQTGQSEGYGFIEFISHAAAEKN  131

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQ FRLNWA+ G+GEKR DT P+Y+IFVGDLAADV DY
Sbjct  132  LQAYNGTLMPNIEQPFRLNWASPGSGEKRSDTGPEYSIFVGDLAADVTDY  181



>gb|EYU27806.1| hypothetical protein MIMGU_mgv1a007668mg [Erythranthe guttata]
Length=399

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  339  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENIL  518
            VKSLWIGDLQYWMDE Y+ +CF   GE+ S+KVIRNK +GQSEGYGF+ F SHAAAE IL
Sbjct  72   VKSLWIGDLQYWMDEQYLCSCFPAAGEVVSAKVIRNKQSGQSEGYGFIRFASHAAAERIL  131

Query  519  QTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            QTYNG  MPN+EQ FRLNWA++GAGEKR+D  +YT+FVGDLAADV DY
Sbjct  132  QTYNGALMPNAEQTFRLNWASMGAGEKREDANEYTVFVGDLAADVTDY  179



>ref|NP_849641.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
 gb|AEE28765.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
Length=306

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE +
Sbjct  60   EIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV  119

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+N   +P+  +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  120  LQTFNNAPIPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  169



>ref|XP_004507696.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Cicer arietinum]
Length=361

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 94/111 (85%), Gaps = 1/111 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCF+HTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFSHTGEVGSIKVIRNKQTNQSEGYGFIEFTSRAGAERV  122

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDYY  665
            LQT+NGT MPN  QNFRLNWAT  +GE+R DD+PDYTIFVGDLA DV DY+
Sbjct  123  LQTFNGTIMPNGGQNFRLNWATFSSGERRHDDSPDYTIFVGDLATDVTDYH  173



>ref|XP_009352469.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Pyrus x 
bretschneideri]
Length=416

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLW+GDL  WMDE YI +CF  TGE  ++KVIRNKLTG  EGYGF+EFRS AAAE I
Sbjct  74   EIRSLWLGDLLQWMDEAYILSCFGPTGEAVNAKVIRNKLTGLPEGYGFIEFRSRAAAEQI  133

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN+EQNFRLNWATLGAGE+R DD PD+T+FVGDLAADV DY
Sbjct  134  LQTYNGTLMPNTEQNFRLNWATLGAGERRQDDGPDFTVFVGDLAADVTDY  183



>ref|XP_006352617.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum tuberosum]
Length=412

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+WMDE Y+  CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE  
Sbjct  75   EVRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  134

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQNFRLNWA+LG+GEKR D+TP+YTIFVGDLAADV DY
Sbjct  135  LQAYNGTLMPNIEQNFRLNWASLGSGEKRSDNTPEYTIFVGDLAADVTDY  184



>ref|XP_006352618.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum tuberosum]
Length=411

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+WMDE Y+  CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE  
Sbjct  75   EVRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  134

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQNFRLNWA+LG+GEKR D+TP+YTIFVGDLAADV DY
Sbjct  135  LQAYNGTLMPNIEQNFRLNWASLGSGEKRSDNTPEYTIFVGDLAADVTDY  184



>ref|XP_011654806.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X4 [Cucumis 
sativus]
Length=375

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  127



>gb|KJB69305.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=286

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S AAAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E N+RLNWA+  +G++RD+TP++TIFVGDLAADV DY
Sbjct  148  LQTYNGTPMPNGESNYRLNWASFSSGDRRDETPEFTIFVGDLAADVTDY  196



>gb|AEW68341.1| putative nuclear acid binding protein [Medicago sativa]
Length=409

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EVK+LWIGDLQYWMDENY+  CF+HTGE+ S KVIRNKL  QSEGYGF+EF S A AE +
Sbjct  70   EVKTLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKLNNQSEGYGFLEFISRAGAERV  129

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDYY  665
            LQTYNGT MPN  QNFRLNWAT  +GEKR DD+PDYTIFVGDLAADV+D++
Sbjct  130  LQTYNGTIMPNGGQNFRLNWATFSSGEKRHDDSPDYTIFVGDLAADVSDHH  180



>ref|XP_010278711.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nelumbo nucifera]
 ref|XP_010278712.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Nelumbo nucifera]
Length=423

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWM+E+YI++CFAHTGE+ S KVIRNK TGQSEGYGF+EF +  AAE I
Sbjct  95   EVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPAAERI  154

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN+EQNFRLNWA+ G GE+R DD+ D+TIFVGDLA+DV DY
Sbjct  155  LQTYNGTLMPNAEQNFRLNWASFGLGERRPDDSADFTIFVGDLASDVTDY  204



>gb|KEH36837.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=284

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 93/112 (83%), Gaps = 3/112 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCF +TGELTS KVIRNK T QSEGYGF+EF + A AE +
Sbjct  58   EVRTLWIGDLQYWMDENYLYTCFGNTGELTSVKVIRNKQTSQSEGYGFIEFNTRATAERV  117

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGE---KRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN  QN+RLNWAT  AGE   ++DD PD+TIFVGDLAADV DY
Sbjct  118  LQTYNGTIMPNGGQNYRLNWATFSAGERSSRQDDGPDHTIFVGDLAADVTDY  169



>dbj|BAD05744.1| putative RNA Binding Protein 45 [Oryza sativa Japonica Group]
 dbj|BAD05783.1| putative RNA Binding Protein 45 [Oryza sativa Japonica Group]
Length=427

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI+ CFA TGEL S K+IR+K TGQ +GYGF+EF SHA AE +
Sbjct  93   EVRTLWIGDLQYWMDENYISACFAPTGELQSVKLIRDKQTGQLQGYGFIEFTSHAGAERV  152

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN EQ +RLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  153  LQTYNGAMMPNVEQTYRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  199



>ref|XP_008365193.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Malus domestica]
Length=408

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDL  WMDE YI +CF  TGE  ++KVIRNKLTG  EGYGF+EFRS AAAE I
Sbjct  66   EIRSLWIGDLLQWMDEAYILSCFGPTGEAVNAKVIRNKLTGLPEGYGFIEFRSRAAAEQI  125

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN+EQNFRLNWATLGAGE+R DD PD+T+FVGDLAADV DY
Sbjct  126  LQTYNGALMPNTEQNFRLNWATLGAGERRQDDGPDFTVFVGDLAADVTDY  175



>ref|XP_002316998.2| RNA-binding protein 45 [Populus trichocarpa]
 gb|EEE97610.2| RNA-binding protein 45 [Populus trichocarpa]
Length=404

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+KSLWIGDLQ WMDENY+ + F+ TGE+  +KVIRNK TG  EGYGF+EF S AAAE I
Sbjct  68   EIKSLWIGDLQQWMDENYLLSIFSATGEIVQAKVIRNKQTGYPEGYGFIEFVSRAAAERI  127

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPNSEQ FRLNWATLGAGE+R DD PD+T+FVGDLAADVNDY
Sbjct  128  LQTYNGTPMPNSEQAFRLNWATLGAGERRQDDGPDFTVFVGDLAADVNDY  177



>ref|XP_012089988.1| PREDICTED: polyadenylate-binding protein RBP47B' [Jatropha curcas]
 gb|KDP22083.1| hypothetical protein JCGZ_25914 [Jatropha curcas]
Length=416

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CFAHTGE+ + K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFAHTGEVVTIKIIRNKITGQPEGYGFVEFVSHAAAERI  79

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  80   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  129



>ref|XP_008437078.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Cucumis 
melo]
Length=425

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  127



>ref|XP_010031800.1| PREDICTED: polyadenylate-binding protein RBP47B' [Eucalyptus 
grandis]
 gb|KCW51191.1| hypothetical protein EUGRSUZ_J00778 [Eucalyptus grandis]
Length=421

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EVK+LWIGDLQYW+DE+Y+  CFAHTGE+ S K+IRNKLTGQ EGYGFVEF SHAAAE I
Sbjct  20   EVKTLWIGDLQYWVDESYLYGCFAHTGEVVSVKIIRNKLTGQPEGYGFVEFMSHAAAERI  79

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  80   LQTYNGTQMPGTEQTFRLNWASFGMGERRADAGPEHSIFVGDLAPDVTDY  129



>ref|XP_010278708.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010278709.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nelumbo nucifera]
Length=430

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWM+E+YI++CFAHTGE+ S KVIRNK TGQSEGYGF+EF +  AAE I
Sbjct  95   EVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPAAERI  154

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN+EQNFRLNWA+ G GE+R DD+ D+TIFVGDLA+DV DY
Sbjct  155  LQTYNGTLMPNAEQNFRLNWASFGLGERRPDDSADFTIFVGDLASDVTDY  204



>ref|XP_011030800.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Populus 
euphratica]
Length=402

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+KSLWIGDLQ WMDENY+ + F+ TGE+  +KVIRNK TG  EGYGF+EF S AAAE I
Sbjct  67   EIKSLWIGDLQQWMDENYLLSIFSATGEIVQAKVIRNKQTGYPEGYGFIEFVSRAAAERI  126

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPNSEQ FRLNWATLGAGE+R DD PD+T+FVGDLAADVNDY
Sbjct  127  LQTYNGTPMPNSEQAFRLNWATLGAGERRQDDGPDFTVFVGDLAADVNDY  176



>ref|XP_008437076.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Cucumis 
melo]
 ref|XP_008437077.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Cucumis 
melo]
Length=427

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  127



>ref|XP_008385660.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Malus domestica]
Length=408

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDL  WMDE YI +CF  TGE  ++KVIRNKLTG  EGYGF+EFRS A AE I
Sbjct  66   EIRSLWIGDLLQWMDEAYILSCFGPTGEAVNAKVIRNKLTGLPEGYGFIEFRSRAXAEQI  125

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN+EQNFRLNWATLGAGE+R DD PD+T+FVGDLAADV DY
Sbjct  126  LQTYNGTLMPNTEQNFRLNWATLGAGERRQDDGPDFTVFVGDLAADVTDY  175



>ref|XP_008437079.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X3 [Cucumis 
melo]
Length=422

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  127



>ref|XP_008345010.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Malus 
domestica]
 ref|XP_008363573.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Malus 
domestica]
Length=442

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+NTCFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  35   EVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERV  94

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            L  YNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  95   LHAYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  144



>ref|XP_004152401.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X3 [Cucumis 
sativus]
Length=422

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  127



>ref|XP_007015035.1| RNA-binding family protein isoform 3 [Theobroma cacao]
 gb|EOY32654.1| RNA-binding family protein isoform 3 [Theobroma cacao]
Length=423

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP ++Q FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTPMPGTDQMFRLNWASFGIGERRTDPGPEHSIFVGDLAPDVTDY  127



>ref|XP_007015034.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY32653.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=423

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP ++Q FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTPMPGTDQMFRLNWASFGIGERRTDPGPEHSIFVGDLAPDVTDY  127



>gb|KJB21879.1| hypothetical protein B456_004G019500 [Gossypium raimondii]
 gb|KJB21881.1| hypothetical protein B456_004G019500 [Gossypium raimondii]
Length=425

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TG  EGYGFVEF SHAAAE I
Sbjct  21   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGLPEGYGFVEFVSHAAAERI  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ GAGE+ +D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTPMPGTEQMFRLNWASFGAGERHNDPGPDHSIFVGDLAPDVTDY  130



>ref|XP_009375056.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
Length=442

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+NTCFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  35   EVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERV  94

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            L  YNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  95   LHAYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  144



>ref|XP_011654805.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Cucumis 
sativus]
Length=425

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  127



>gb|KJB21880.1| hypothetical protein B456_004G019500 [Gossypium raimondii]
Length=424

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TG  EGYGFVEF SHAAAE I
Sbjct  21   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGLPEGYGFVEFVSHAAAERI  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ GAGE+ +D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTPMPGTEQMFRLNWASFGAGERHNDPGPDHSIFVGDLAPDVTDY  130



>ref|XP_009376881.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
 ref|XP_009347313.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
 ref|XP_009347319.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
Length=442

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+NTCFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  35   EVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERV  94

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDD-TPDYTIFVGDLAADVNDY  662
            L  YNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  95   LHAYNGTQMPGTEQTFRLNWASFGIGERRPDAAPEHSIFVGDLAPDVTDY  144



>ref|XP_009372712.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Pyrus x 
bretschneideri]
Length=408

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDL  WMDE YI +CF  TGE  ++KVIRNKLTG  EGYGF+EFRS AAAE  
Sbjct  66   EIRSLWIGDLLQWMDEAYILSCFGPTGEAVNAKVIRNKLTGLPEGYGFIEFRSRAAAEQF  125

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN+EQNFRLNWATLGAGE+R DD PD+T+FVGDLAADV DY
Sbjct  126  LQTYNGTLMPNTEQNFRLNWATLGAGERRQDDGPDFTVFVGDLAADVTDY  175



>gb|KCW70174.1| hypothetical protein EUGRSUZ_F03462 [Eucalyptus grandis]
Length=268

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+KSLWIGDLQ  MDE Y+  CFAH+GE+ S+KVIRNK T   EGYGF+EF + AAAE I
Sbjct  62   EIKSLWIGDLQPHMDETYLLNCFAHSGEVLSAKVIRNKQTALPEGYGFIEFMTRAAAERI  121

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPNS+QNFRLNWATLG GE+R D+ PDYTIFVGDLAADV D+
Sbjct  122  LQTYNGTLMPNSDQNFRLNWATLGPGERRQDEGPDYTIFVGDLAADVTDH  171



>ref|XP_011654802.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Cucumis 
sativus]
 ref|XP_011654803.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Cucumis 
sativus]
 ref|XP_011654804.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Cucumis 
sativus]
Length=427

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  127



>ref|XP_002313332.2| hypothetical protein POPTR_0009s05920g [Populus trichocarpa]
 gb|EEE87287.2| hypothetical protein POPTR_0009s05920g [Populus trichocarpa]
Length=416

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW DE+Y+ +CFAHTGE+ S K+IRNKLTGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWADESYLTSCFAHTGEVVSIKIIRNKLTGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  127



>ref|XP_010938882.1| PREDICTED: polyadenylate-binding protein RBP47B' [Elaeis guineensis]
Length=448

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE+Y+++CFAHTGE+ S KVIRNK+TG  EGYGFVEF SHAAAE I
Sbjct  46   EVRTLWIGDLQYWVDESYLHSCFAHTGEVVSVKVIRNKITGHPEGYGFVEFVSHAAAERI  105

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQ YNG+ MP +EQ FRLNWA+ G GE+RD  PD++IFVGDLA DV DY
Sbjct  106  LQMYNGSQMPGTEQAFRLNWASFGLGERRDAGPDHSIFVGDLAPDVTDY  154



>ref|XP_008377253.1| PREDICTED: polyadenylate-binding protein RBP47B' [Malus domestica]
Length=431

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+NTCFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  24   EVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERV  83

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDD-TPDYTIFVGDLAADVNDY  662
            L  YNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  84   LHAYNGTQMPGTEQTFRLNWASFGIGERRPDAAPEHSIFVGDLAPDVTDY  133



>gb|KHG00069.1| Polyadenylate-binding RBP47B' -like protein [Gossypium arboreum]
Length=441

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TG  EGYGFVEF SHAAAE I
Sbjct  21   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGLPEGYGFVEFVSHAAAERI  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ GAGE+ +D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTPMPGTEQMFRLNWASFGAGERHNDPGPDHSIFVGDLAPDVTDY  130



>gb|KGN50253.1| hypothetical protein Csa_5G162020 [Cucumis sativus]
Length=420

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE+Y+N+CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  127



>ref|XP_011025522.1| PREDICTED: polyadenylate-binding protein RBP47B' [Populus euphratica]
Length=416

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW DE+Y+ +CFAHTGE+ S K+IRNKLTGQ EGYGFVEF SHAAAE I
Sbjct  18   EVRTLWIGDLQYWADESYLTSCFAHTGEVVSIKIIRNKLTGQPEGYGFVEFVSHAAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  78   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  127



>ref|XP_004507695.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Cicer arietinum]
Length=400

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 94/111 (85%), Gaps = 1/111 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCF+HTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFSHTGEVGSIKVIRNKQTNQSEGYGFIEFTSRAGAERV  122

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDYY  665
            LQT+NGT MPN  QNFRLNWAT  +GE+R DD+PDYTIFVGDLA DV DY+
Sbjct  123  LQTFNGTIMPNGGQNFRLNWATFSSGERRHDDSPDYTIFVGDLATDVTDYH  173



>ref|XP_003610417.1| RNA-binding protein [Medicago truncatula]
 gb|AES92614.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=411

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EVK+LWIGDLQYWMDENY+  CF+HTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  72   EVKTLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKQTNQSEGYGFLEFISRAGAERV  131

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDYY  665
            LQT+NGT MPN  QNFRLNWAT  +GEKR DD+PDYTIFVGDLAADV+D++
Sbjct  132  LQTFNGTIMPNGGQNFRLNWATFSSGEKRHDDSPDYTIFVGDLAADVSDHH  182



>emb|CBI16387.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  39   EVRTLWIGDLQYWVDENYLHSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  98

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQ YNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  99   LQAYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  148



>ref|XP_006850190.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Amborella 
trichopoda]
 gb|ERN11771.1| hypothetical protein AMTR_s00022p00247520 [Amborella trichopoda]
Length=451

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYW+DENY++TCF+HTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  43   EIRTLWIGDLQYWVDENYLHTCFSHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  102

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FR+NWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  103  LQTYNGTPMPGTEQCFRMNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  152



>ref|XP_002285479.1| PREDICTED: polyadenylate-binding protein RBP47B' [Vitis vinifera]
Length=447

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  39   EVRTLWIGDLQYWVDENYLHSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  98

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQ YNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  99   LQAYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  148



>ref|XP_011625480.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Amborella 
trichopoda]
Length=450

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYW+DENY++TCF+HTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  43   EIRTLWIGDLQYWVDENYLHTCFSHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  102

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FR+NWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  103  LQTYNGTPMPGTEQCFRMNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  152



>ref|XP_009418782.1| PREDICTED: polyadenylate-binding protein RBP45-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LW+GDLQYWMDENY+ +CF HTGE+ S K+IRNKL GQSEGYGF+EF S AAA+ +
Sbjct  108  EIRTLWVGDLQYWMDENYLYSCFVHTGEVLSVKIIRNKLNGQSEGYGFIEFVSRAAADRV  167

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+NG  MPN+EQ FRLNWA+ GAGEKR D  DYTIFVGDLAADV DY
Sbjct  168  LQTFNGQVMPNTEQAFRLNWASCGAGEKRGDGADYTIFVGDLAADVTDY  216



>ref|XP_007209154.1| hypothetical protein PRUPE_ppa005940mg [Prunus persica]
 gb|EMJ10353.1| hypothetical protein PRUPE_ppa005940mg [Prunus persica]
Length=436

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ TCFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  31   EVRTLWIGDLQYWVDENYLTTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERV  90

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            L  YNGT MP +EQNFRLNWA+ G GE+R D  P+++IFVGDLA DV D+
Sbjct  91   LHAYNGTLMPGTEQNFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDF  140



>ref|XP_008796097.1| PREDICTED: polyadenylate-binding protein RBP45 [Phoenix dactylifera]
Length=420

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LW+GDLQYWMDENY+  CFA TGE+ S K+IRNK TGQSEGYGF+EF + AAAE +
Sbjct  82   EIRTLWVGDLQYWMDENYLFGCFASTGEVLSVKMIRNKQTGQSEGYGFIEFATRAAAERV  141

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQ +NG  MPN EQ FRLNWAT G+GE+RDD+PDYTIFVGDLA+DV DY
Sbjct  142  LQAFNGQMMPNIEQTFRLNWATCGSGERRDDSPDYTIFVGDLASDVTDY  190



>dbj|BAE71189.1| putative DNA binding protein [Trifolium pratense]
Length=253

 Score =   175 bits (443),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+  CF+HTGE+ + KVIRNK T QSEGYGF+EF S A AE I
Sbjct  66   EVRTLWIGDLQYWMDENYLYQCFSHTGEVGNVKVIRNKQTNQSEGYGFLEFTSRAGAERI  125

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDYY  665
            LQ YNG  MPN  QNFRLNWAT  +GEKR DD+PD+TIFVGDLAADV DY+
Sbjct  126  LQQYNGNIMPNGGQNFRLNWATFSSGEKRHDDSPDFTIFVGDLAADVTDYH  176



>ref|XP_010265752.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Nelumbo 
nucifera]
Length=449

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYW+DE+Y+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  41   EIRTLWIGDLQYWVDESYLHSCFAHTGEVLSIKIIRNKITGQPEGYGFVEFVSHAAAERI  100

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  101  LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  150



>ref|XP_010265753.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYW+DE+Y+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  41   EIRTLWIGDLQYWVDESYLHSCFAHTGEVLSIKIIRNKITGQPEGYGFVEFVSHAAAERI  100

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  101  LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDY  150



>ref|XP_009406503.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=430

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIG LQ+WMDENY+ +CFAHTGE+ S K+IRNK +GQSEGYGF+EF SHA A+ I
Sbjct  94   EIRTLWIGGLQFWMDENYLYSCFAHTGEVVSVKIIRNKQSGQSEGYGFLEFVSHAGADRI  153

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN+EQ FRLNWAT GAGE+R D  DYTIFVGDLAADV DY
Sbjct  154  LQTYNGQVMPNTEQAFRLNWATCGAGERRGDGVDYTIFVGDLAADVTDY  202



>ref|XP_009406502.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=437

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIG LQ+WMDENY+ +CFAHTGE+ S K+IRNK +GQSEGYGF+EF SHA A+ I
Sbjct  101  EIRTLWIGGLQFWMDENYLYSCFAHTGEVVSVKIIRNKQSGQSEGYGFLEFVSHAGADRI  160

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN+EQ FRLNWAT GAGE+R D  DYTIFVGDLAADV DY
Sbjct  161  LQTYNGQVMPNTEQAFRLNWATCGAGERRGDGVDYTIFVGDLAADVTDY  209



>ref|XP_009420609.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LW+GDLQYWMDENY+ +CF HTGE+ S KVIRNK TGQSEGYGF+EF S  AA+ I
Sbjct  93   EIRTLWVGDLQYWMDENYLYSCFVHTGEVVSVKVIRNKQTGQSEGYGFIEFVSRVAADRI  152

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPNSEQ FR+NWAT GAGEK  D  DYTIFVGDLAADV DY
Sbjct  153  LQTYNGQIMPNSEQAFRMNWATCGAGEKHGDGADYTIFVGDLAADVTDY  201



>ref|XP_009614215.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=415

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQ+WMDE Y+  CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE  
Sbjct  78   EIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  137

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQNFRLNWA+LG+GEKR D+ P+YTIFVGDLAADV DY
Sbjct  138  LQAYNGTLMPNIEQNFRLNWASLGSGEKRSDNGPEYTIFVGDLAADVTDY  187



>gb|KFK43438.1| hypothetical protein AALP_AA1G125300 [Arabis alpina]
Length=403

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQ+WMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE  
Sbjct  60   EIRTLWIGDLQFWMDENFLFGCFAHTGEVVSAKVIRNKQTGQVEGYGFIEFVSHAAAERA  119

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYN T +PN  +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  120  LQTYNNTPIPNVPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  169



>ref|XP_009776429.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=415

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQ+WMDE Y+  CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE  
Sbjct  78   EIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  137

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQNFRLNWA+LG+GEKR D+ P+YTIFVGDLAADV DY
Sbjct  138  LQAYNGTLMPNIEQNFRLNWASLGSGEKRADNGPEYTIFVGDLAADVTDY  187



>ref|XP_009776437.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=414

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQ+WMDE Y+  CFA TGE+ S+KVIRNK T QSEGYGF+EF SHAAAE  
Sbjct  78   EIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAAAERN  137

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN EQNFRLNWA+LG+GEKR D+ P+YTIFVGDLAADV DY
Sbjct  138  LQAYNGTLMPNIEQNFRLNWASLGSGEKRADNGPEYTIFVGDLAADVTDY  187



>ref|XP_010458570.1| PREDICTED: polyadenylate-binding protein RBP45B [Camelina sativa]
Length=406

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDEN++  CFAHTGEL S+KVIRNK TGQ EGYGF+EF SHAAAE  
Sbjct  61   EIRTLWIGDLQYWMDENFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAAERT  120

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+N T +P+  +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  121  LQTFNNTPIPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  170



>ref|XP_002513488.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF48891.1| nuclear acid binding protein, putative [Ricinus communis]
Length=412

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SH AAE I
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFAHTGEVLSIKIIRNKITGQPEGYGFVEFVSHVAAERI  79

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDL+ DV DY
Sbjct  80   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLSPDVTDY  129



>ref|XP_008238181.1| PREDICTED: polyadenylate-binding protein RBP47B' [Prunus mume]
Length=437

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ TCFAHTG L S K+IRNK+TGQ EGYGFVEF SHAAAE +
Sbjct  31   EVRTLWIGDLQYWVDENYLTTCFAHTGSLISIKIIRNKITGQPEGYGFVEFVSHAAAERV  90

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            L  YNGT MP +EQNFRLNWA+ G GE+R D  P+++IFVGDLA DV D+
Sbjct  91   LHAYNGTLMPGTEQNFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVTDF  140



>ref|XP_004294372.1| PREDICTED: polyadenylate-binding protein RBP45C [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDL  WMDENYI  CF  TGE  ++KVIRNK TG  EGYGF+EFR+ +AAE +
Sbjct  74   EIRSLWIGDLLQWMDENYILNCFGPTGEAVNAKVIRNKQTGLPEGYGFIEFRTRSAAEQV  133

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN+EQNFRLNWATLGAGE+R DD PDYT+FVGDLAADV DY
Sbjct  134  LQNYNGTVMPNTEQNFRLNWATLGAGERRQDDGPDYTVFVGDLAADVTDY  183



>ref|XP_010101438.1| Polyadenylate-binding protein RBP45B [Morus notabilis]
 gb|EXB88421.1| Polyadenylate-binding protein RBP45B [Morus notabilis]
Length=398

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWM+ENY+ +CF HTGE+ S KVIRNK TGQSEGYGF+EF S  AAE  
Sbjct  63   EVRTLWIGDLQYWMEENYLYSCFVHTGEVVSVKVIRNKQTGQSEGYGFIEFVSRPAAERA  122

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQT+NG+ MPN  QNFRLNWA+  AGEKR DDTPDYTIFVGDLAADV DY
Sbjct  123  LQTFNGSPMPNGAQNFRLNWAS--AGEKRSDDTPDYTIFVGDLAADVTDY  170



>ref|XP_010910520.1| PREDICTED: polyadenylate-binding protein RBP45-like, partial 
[Elaeis guineensis]
Length=332

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 94/109 (86%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LW+GDLQYWMDE+Y++ CFAHTGE+ S K+IR+K TGQ +GYGF+EF +HA+AE +
Sbjct  108  EVRTLWMGDLQYWMDESYVHGCFAHTGEVVSVKLIRDKQTGQLQGYGFIEFATHASAERV  167

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQ +NG  MPN +Q FRLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  168  LQAFNGQMMPNVDQVFRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  214



>ref|XP_002889883.1| ATRBP45B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66142.1| ATRBP45B [Arabidopsis lyrata subsp. lyrata]
Length=408

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE +
Sbjct  62   EIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV  121

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+N   +P+  +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  122  LQTFNNAPIPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  171



>ref|NP_172630.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
 sp|Q9SAB3.1|RB45B_ARATH RecName: Full=Polyadenylate-binding protein RBP45B; Short=Poly(A)-binding 
protein RBP45B; AltName: Full=RNA-binding protein 
45B; Short=AtRBP45B [Arabidopsis thaliana]
 gb|AAD30259.1|AC007296_20 Similar to gb|U90212 DNA binding protein ACBF from Nicotiana 
tabacum and contains 3 PF|00076 RNA recognition motif domains. 
ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, 
gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, 
gb|F15495 and gb|Z30868 come from this gene [Arabidopsis 
thaliana]
 gb|AAM13200.1| similar to gb|U90212 DNA binding protein ACBF from Nicotiana 
tabacum and contains 3 PF|00076 RNA recognition motif domains 
[Arabidopsis thaliana]
 gb|AAP37853.1| At1g11650 [Arabidopsis thaliana]
 gb|AEE28764.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
Length=405

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE +
Sbjct  60   EIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV  119

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+N   +P+  +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  120  LQTFNNAPIPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  169



>ref|XP_007020874.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY12399.1| RNA-binding family protein [Theobroma cacao]
Length=417

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WMDENY+   FAHTGE+ S+KVIRNK T   EGYGF+EF S AAAE +
Sbjct  82   EIRSLWIGDLQQWMDENYLINIFAHTGEVASAKVIRNKQTALPEGYGFIEFVSRAAAERV  141

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ+YNG  MPNSEQNFRLNWA LG GEKR D+ PDYTIFVGDLAADV+DY
Sbjct  142  LQSYNGVPMPNSEQNFRLNWAALGYGEKRQDEGPDYTIFVGDLAADVSDY  191



>gb|KJB69303.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=419

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S AAAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E N+RLNWA+  +G++RD+TP++TIFVGDLAADV DY
Sbjct  148  LQTYNGTPMPNGESNYRLNWASFSSGDRRDETPEFTIFVGDLAADVTDY  196



>gb|AFK41944.1| unknown [Medicago truncatula]
Length=411

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+  CF+HTGE+ S KVIRNK T QSEGYGF+EF S A AE +
Sbjct  72   EVETLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKQTNQSEGYGFLEFISRAGAERV  131

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDYY  665
            LQT+NGT MPN  QNFRLNWAT  +GEKR DD+PDYTIFVGDLAADV+D++
Sbjct  132  LQTFNGTIMPNGGQNFRLNWATFSSGEKRHDDSPDYTIFVGDLAADVSDHH  182



>ref|XP_007026047.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY28669.1| RNA-binding family protein [Theobroma cacao]
Length=421

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQY+MDENY+  CFA TGE+ S KVIRNK TGQ EGYGF+EF S  AAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLGCFAQTGEVVSVKVIRNKQTGQVEGYGFIEFVSRGAAERV  147

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E N+RLNWA+  +GE+RD+TPD+TIFVGDLAADV DY
Sbjct  148  LQTYNGTPMPNGENNYRLNWASFSSGERRDETPDFTIFVGDLAADVTDY  196



>ref|XP_008806741.1| PREDICTED: polyadenylate-binding protein RBP45 [Phoenix dactylifera]
Length=420

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 95/109 (87%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LW+GDLQYWMDE+Y++ CFAHTGE+ S K+IR+KLTGQ +GYGF+EF + A+AE +
Sbjct  96   EVRTLWMGDLQYWMDESYVHGCFAHTGEVVSVKLIRDKLTGQLQGYGFIEFANRASAERV  155

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN EQ FRLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  156  LQTYNGQMMPNVEQVFRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  202



>ref|XP_003597428.1| RNA-binding protein [Medicago truncatula]
 gb|AES67679.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=428

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+  CF+HTGE+ S K+IRNK+TGQ EGYGF+EF SH+AAE +
Sbjct  13   EVRTLWIGDLQYWVDENYLTHCFSHTGEVISIKIIRNKITGQPEGYGFIEFVSHSAAERV  72

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNGT MP +EQ FRLNWA+ G GE+R D  PD++IFVGDLA DV DY
Sbjct  73   LQTYNGTQMPGTEQTFRLNWASFGIGERRPDAGPDHSIFVGDLAPDVTDY  122



>gb|KJB69301.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=427

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S AAAE +
Sbjct  88   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAERV  147

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E N+RLNWA+  +G++RD+TP++TIFVGDLAADV DY
Sbjct  148  LQTYNGTPMPNGESNYRLNWASFSSGDRRDETPEFTIFVGDLAADVTDY  196



>ref|XP_008226922.1| PREDICTED: polyadenylate-binding protein RBP45C [Prunus mume]
Length=406

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDL  WMDENYI +CF  TGE  ++KVIRNK T   EGYGF+EFRS +AAE I
Sbjct  67   EIRSLWIGDLLPWMDENYILSCFGPTGEAVTAKVIRNKQTALPEGYGFIEFRSRSAAEQI  126

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN+EQNFRLNWATLGAGE+R DD PD+T+FVGDLAADV DY
Sbjct  127  LQQYNGTLMPNTEQNFRLNWATLGAGERRQDDGPDFTVFVGDLAADVTDY  176



>gb|AGV54456.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCFA TGE+TS KVIRNK T QSEGYGF+EF S AAAE I
Sbjct  63   EVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAAAERI  122

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN  Q+FRLNWA+  AGE+R D++P+YTIFVG+LAADV DY
Sbjct  123  LQTYNGAIMPNGGQSFRLNWASFSAGERRPDESPEYTIFVGELAADVTDY  172



>ref|XP_009772575.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=410

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE Y+  CFA TGE+ ++KVIRNK TGQSEGYGF+EF SHAAAE  
Sbjct  74   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFIEFNSHAAAERN  133

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            L  YNGT MPN EQNFRLNWA+LG+GE+R D+ P+YTIFVGDLAADV DY
Sbjct  134  LLAYNGTLMPNIEQNFRLNWASLGSGERRSDNAPEYTIFVGDLAADVTDY  183



>ref|XP_009772574.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=411

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ+WMDE Y+  CFA TGE+ ++KVIRNK TGQSEGYGF+EF SHAAAE  
Sbjct  74   EIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFIEFNSHAAAERN  133

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            L  YNGT MPN EQNFRLNWA+LG+GE+R D+ P+YTIFVGDLAADV DY
Sbjct  134  LLAYNGTLMPNIEQNFRLNWASLGSGERRSDNAPEYTIFVGDLAADVTDY  183



>gb|KEH36836.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=401

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 93/112 (83%), Gaps = 3/112 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCF +TGELTS KVIRNK T QSEGYGF+EF + A AE +
Sbjct  58   EVRTLWIGDLQYWMDENYLYTCFGNTGELTSVKVIRNKQTSQSEGYGFIEFNTRATAERV  117

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGE---KRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN  QN+RLNWAT  AGE   ++DD PD+TIFVGDLAADV DY
Sbjct  118  LQTYNGTIMPNGGQNYRLNWATFSAGERSSRQDDGPDHTIFVGDLAADVTDY  169



>ref|XP_007213954.1| hypothetical protein PRUPE_ppa006577mg [Prunus persica]
 gb|EMJ15153.1| hypothetical protein PRUPE_ppa006577mg [Prunus persica]
Length=405

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDL  WMDENYI +CF  TGE  ++KVIRNK T   EGYGF+EFRS +AAE I
Sbjct  66   EIRSLWIGDLLPWMDENYILSCFGPTGEAVTAKVIRNKQTALPEGYGFIEFRSRSAAEQI  125

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MPN+EQNFRLNWATLGAGE+R DD PD+T+FVGDLAADV DY
Sbjct  126  LQQYNGTLMPNTEQNFRLNWATLGAGERRQDDGPDFTVFVGDLAADVTDY  175



>ref|XP_010536076.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Tarenaya 
hassleriana]
Length=432

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+++NY+ +CF+HTGEL S K+IRNK+TGQ EGYGF+EF SHAAAE I
Sbjct  19   EVRTLWIGDLQYWVEDNYLTSCFSHTGELVSVKIIRNKITGQPEGYGFIEFVSHAAAERI  78

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MP ++Q FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  79   LQMYNGTQMPGTDQTFRLNWASFGSGQKVDTGPDHSIFVGDLAPDVTDY  127



>ref|XP_010536077.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Tarenaya 
hassleriana]
Length=431

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+++NY+ +CF+HTGEL S K+IRNK+TGQ EGYGF+EF SHAAAE I
Sbjct  19   EVRTLWIGDLQYWVEDNYLTSCFSHTGELVSVKIIRNKITGQPEGYGFIEFVSHAAAERI  78

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQ YNGT MP ++Q FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  79   LQMYNGTQMPGTDQTFRLNWASFGSGQKVDTGPDHSIFVGDLAPDVTDY  127



>ref|XP_010454207.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Camelina 
sativa]
Length=424

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAERT  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTQMPGTELTFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  129



>ref|XP_010493089.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Camelina 
sativa]
Length=406

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE+++  CFAHTGEL S+KVIRNK TGQ EGYGF+EF SHAAAE  
Sbjct  61   EIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAAERT  120

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+N T +P+  +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  121  LQTFNNTPIPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  170



>gb|KDP39118.1| hypothetical protein JCGZ_00875 [Jatropha curcas]
Length=407

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+KSLWIGDLQ WMDENY+ + F+ TGE+ S+KVIRNK TG  EGYGF+EF S AAAE I
Sbjct  68   EIKSLWIGDLQQWMDENYLLSIFSSTGEVVSAKVIRNKQTGLPEGYGFIEFVSRAAAERI  127

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN++Q FRLNWATL AGE+R DD PD+TIFVGDLAADVNDY
Sbjct  128  LQTYNGALMPNTDQTFRLNWATLAAGERRQDDGPDFTIFVGDLAADVNDY  177



>ref|XP_010495305.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Camelina 
sativa]
Length=418

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAERT  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTQMPGTELTFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  129



>ref|XP_010476096.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Camelina sativa]
Length=407

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE+++  CFAHTGEL S+KVIRNK TGQ EGYGF+EF SHAAAE  
Sbjct  61   EIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAAERT  120

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+N T +P+  +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  121  LQTFNNTPIPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  170



>ref|NP_197436.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
 sp|Q8VXZ9.1|R47BP_ARATH RecName: Full=Polyadenylate-binding protein RBP47B'; Short=Poly(A)-binding 
protein RBP47B'; AltName: Full=RNA-binding protein 
47B'; Short=AtRBP47B prime; Short=AtRBP47B' [Arabidopsis 
thaliana]
 gb|AAL67015.1| putative DNA binding protein ACBF [Arabidopsis thaliana]
 gb|AAM45052.1| putative DNA binding protein ACBF [Arabidopsis thaliana]
 gb|AED92689.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
Length=425

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  22   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERT  81

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  82   LQTYNGTQMPGTELTFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  130



>ref|XP_012070803.1| PREDICTED: polyadenylate-binding protein RBP45C [Jatropha curcas]
Length=394

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+KSLWIGDLQ WMDENY+ + F+ TGE+ S+KVIRNK TG  EGYGF+EF S AAAE I
Sbjct  55   EIKSLWIGDLQQWMDENYLLSIFSSTGEVVSAKVIRNKQTGLPEGYGFIEFVSRAAAERI  114

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN++Q FRLNWATL AGE+R DD PD+TIFVGDLAADVNDY
Sbjct  115  LQTYNGALMPNTDQTFRLNWATLAAGERRQDDGPDFTIFVGDLAADVNDY  164



>ref|NP_001078604.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
 gb|AED92690.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
Length=421

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  22   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERT  81

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  82   LQTYNGTQMPGTELTFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  130



>ref|XP_010476097.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Camelina sativa]
Length=397

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE+++  CFAHTGEL S+KVIRNK TGQ EGYGF+EF SHAAAE  
Sbjct  61   EIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAAERT  120

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+N T +P+  +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  121  LQTFNNTPIPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  170



>ref|XP_010276065.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Nelumbo 
nucifera]
Length=417

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWM+ENY+++CFAHTGE+ S KVI NK TGQSEGYGF+EF + A AE I
Sbjct  88   EIRTLWIGDLQYWMEENYLHSCFAHTGEVASIKVIHNKQTGQSEGYGFIEFLTRAIAERI  147

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWAT  +G++R DD+PD+ IFVGDLA DV DY
Sbjct  148  LQTYNGTLMPNVEQNFRLNWATFSSGDRRPDDSPDFPIFVGDLAVDVTDY  197



>ref|XP_002871881.1| hypothetical protein ARALYDRAFT_488820 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48140.1| hypothetical protein ARALYDRAFT_488820 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERT  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTQMPGTELTFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  129



>gb|KFK26199.1| hypothetical protein AALP_AA8G215500 [Arabis alpina]
Length=429

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SH AAE  
Sbjct  21   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHPAAERA  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTPMPGTEVTFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  129



>ref|XP_010545222.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Tarenaya 
hassleriana]
Length=411

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WMDENY+ + FAHTGE+ S+KVIR+K TG SEGYGF+EF +H+AAE I
Sbjct  75   EIRSLWIGDLQSWMDENYLMSIFAHTGEIQSAKVIRSKQTGYSEGYGFIEFVNHSAAERI  134

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRD-DTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN+EQNFRLNWA LG+GE+R  + PDYTIFVGDLA +V DY
Sbjct  135  LQTYNGTQMPNTEQNFRLNWAALGSGERRQAEGPDYTIFVGDLAPEVTDY  184



>ref|XP_006400492.1| hypothetical protein EUTSA_v10013617mg [Eutrema salsugineum]
 gb|ESQ41945.1| hypothetical protein EUTSA_v10013617mg [Eutrema salsugineum]
Length=429

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  21   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAERT  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTQMPGTEIPFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  129



>emb|CDX70874.1| BnaC03g09580D [Brassica napus]
Length=430

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  21   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAERT  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTLMPGTEVAFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  129



>ref|XP_010276064.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Nelumbo 
nucifera]
Length=425

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWM+ENY+++CFAHTGE+ S KVI NK TGQSEGYGF+EF + A AE I
Sbjct  88   EIRTLWIGDLQYWMEENYLHSCFAHTGEVASIKVIHNKQTGQSEGYGFIEFLTRAIAERI  147

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN EQNFRLNWAT  +G++R DD+PD+ IFVGDLA DV DY
Sbjct  148  LQTYNGTLMPNVEQNFRLNWATFSSGDRRPDDSPDFPIFVGDLAVDVTDY  197



>ref|XP_006417333.1| hypothetical protein EUTSA_v10007819mg [Eutrema salsugineum]
 gb|ESQ35686.1| hypothetical protein EUTSA_v10007819mg [Eutrema salsugineum]
Length=397

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQ+WMDEN++ +CFAHTGE+ S+KVIRNK T Q EGYGF+EF SHAAAE  
Sbjct  61   EIRTLWIGDLQFWMDENFLYSCFAHTGEVVSAKVIRNKQTAQVEGYGFIEFVSHAAAERA  120

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYN T +P   +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  121  LQTYNNTPVPGLPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  170



>ref|XP_010930147.1| PREDICTED: polyadenylate-binding protein RBP45 [Elaeis guineensis]
Length=418

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDENY+  CF  TGE+ S K+IRNK TGQSEGYGF+EF + A AE +
Sbjct  81   EIRTLWIGDLQYWMDENYLFGCFVSTGEVLSVKIIRNKQTGQSEGYGFIEFATRATAERV  140

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN EQ FRLNWAT G+GE+RDD+ DYTIFVGDLA+DV DY
Sbjct  141  LQTYNGQMMPNIEQTFRLNWATCGSGERRDDSTDYTIFVGDLASDVTDY  189



>ref|XP_009414748.1| PREDICTED: polyadenylate-binding protein RBP47B' [Musa acuminata 
subsp. malaccensis]
Length=440

 Score =   176 bits (447),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV+SLWIGDLQYW+DE+Y++ CFAHTGE+ S K+IRNK+TG  EGYGF+EF SH AAE I
Sbjct  39   EVRSLWIGDLQYWVDESYLHNCFAHTGEVVSVKIIRNKITGLPEGYGFIEFVSHPAAERI  98

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNG  MP +EQ FRLNWA+ G GE+R D  PD++IFVGDLA+DV DY
Sbjct  99   LQTYNGAQMPGTEQTFRLNWASFGIGERRPDAGPDHSIFVGDLASDVTDY  148



>ref|XP_006452315.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 ref|XP_006452316.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|ESR65555.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|ESR65556.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|KDO62644.1| hypothetical protein CISIN_1g015468mg [Citrus sinensis]
Length=320

 Score =   173 bits (439),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = +3

Query  339  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENIL  518
            ++SLWIGDLQ WM+E+YI + F HTGE  S KVIRNK T  SEGYGF+EF SHAAAE +L
Sbjct  73   IRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVL  132

Query  519  QTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            QT+NGT MP++EQNFRLNWAT GAGE+R DD PD+TIFVGDLAADV DY
Sbjct  133  QTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDY  181



>ref|XP_006307499.1| hypothetical protein CARUB_v10009124mg, partial [Capsella rubella]
 gb|EOA40397.1| hypothetical protein CARUB_v10009124mg, partial [Capsella rubella]
Length=448

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDE+++  CFAHTGEL S+KVIRNK TGQ EGYGF+EF SHAAAE  
Sbjct  101  EIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAAERT  160

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+N T +P+  +Q FRLNWA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  161  LQTFNNTPIPSFPDQLFRLNWASLSSGDKRDDSPDYTIFVGDLAADVTDY  210



>emb|CDX88893.1| BnaA03g07560D [Brassica napus]
Length=430

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAERT  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTLMPGTEVAFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  129



>dbj|BAK03410.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88936.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI +CFA+TGE  S K+IR+K TGQ +GYGFVEF SHAAAE +
Sbjct  89   EVRTLWIGDLQYWMDENYIYSCFANTGEFQSVKLIRDKQTGQLQGYGFVEFASHAAAERV  148

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+NG  MPN E  +RLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  149  LQTFNGQMMPNVELAYRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  195



>gb|KHG16958.1| Polyadenylate-binding RBP45B -like protein [Gossypium arboreum]
Length=465

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQY+MDENY+ +CFA TGE+ S KVIRNK TGQ EGYGF+EF S  AAE +
Sbjct  79   EVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRVAAERV  138

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E N+RLNWA+  +G++RD+TP++TIFVGDLAADV DY
Sbjct  139  LQTYNGTPMPNGESNYRLNWASFSSGDRRDETPEFTIFVGDLAADVTDY  187



>gb|AAM64532.1| putative DNA binding protein [Arabidopsis thaliana]
Length=404

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDEN++  CFAHTGE+ S+KVIRNK TGQ EGYGF+EF SHAAAE +
Sbjct  59   EIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV  118

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQT+N   +P+  +Q FRL WA+L +G+KRDD+PDYTIFVGDLAADV DY
Sbjct  119  LQTFNNAPIPSFPDQLFRLXWASLSSGDKRDDSPDYTIFVGDLAADVTDY  168



>ref|XP_010420736.1| PREDICTED: polyadenylate-binding protein RBP47B' [Camelina sativa]
Length=423

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SH AAE  
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHGAAERT  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTQMPGTELTFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  129



>emb|CDY13992.1| BnaC09g38340D [Brassica napus]
Length=419

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERT  79

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E NFRLNWA+ G+G+K D   D++IFVGDLA DV DY
Sbjct  80   LQTYNGTPMPGTEINFRLNWASFGSGQKVDPGTDHSIFVGDLAPDVTDY  128



>ref|XP_009120896.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Brassica 
rapa]
Length=409

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERT  79

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E NFRLNWA+ G+G+K D   D++IFVGDLA DV DY
Sbjct  80   LQTYNGTPMPGTEINFRLNWASFGSGQKVDPGTDHSIFVGDLAPDVTDY  128



>gb|AFW61057.1| hypothetical protein ZEAMMB73_234884 [Zea mays]
Length=322

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMD+NYI  CFA TGE+ + K+IR+K TGQ +GYGF+EF S AAAE +
Sbjct  119  EVRTLWIGDLQYWMDDNYIYGCFASTGEVQNVKLIRDKHTGQLQGYGFIEFISRAAAERV  178

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E  FRLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  179  LQTYNGTMMPNVELPFRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  225



>ref|XP_009120895.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Brassica 
rapa]
Length=419

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERT  79

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E NFRLNWA+ G+G+K D   D++IFVGDLA DV DY
Sbjct  80   LQTYNGTPMPGTEINFRLNWASFGSGQKVDPGTDHSIFVGDLAPDVTDY  128



>ref|XP_008349308.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X3 [Malus domestica]
Length=238

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 90/110 (82%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWM+ENY+   F HTGE+ S KVIRNK T QSEGYGF+EF S AAAE +
Sbjct  34   EVRTLWIGDLQYWMEENYLYNIFLHTGEVVSVKVIRNKQTCQSEGYGFIEFNSRAAAERV  93

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ +NGT MPN  QNFRLNWA+   GEKR DDTPDYTIFVGDLAADV DY
Sbjct  94   LQAFNGTPMPNGAQNFRLNWAS--TGEKRSDDTPDYTIFVGDLAADVTDY  141



>gb|AIN39817.1| hypothetical protein [Zoysia matrella]
Length=298

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDENYI +CFA TGE+ S K+IR+K +GQ +GYGFVEF S AAAE +
Sbjct  87   EMRTLWIGDLQYWMDENYIYSCFAATGEVQSVKLIRDKQSGQIQGYGFVEFSSRAAAERV  146

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN E  +RLNWA+  AGEKRDD+PDYTIFVGDLAADV DY
Sbjct  147  LQTYNGQMMPNVELTYRLNWAS--AGEKRDDSPDYTIFVGDLAADVTDY  193



>emb|CDX92537.1| BnaA10g15760D [Brassica napus]
Length=419

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+++CF+ TGEL S KVIRNK+TGQ EGYGF+EF SHAAAE  
Sbjct  20   EVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERT  79

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E NFRLNWA+ G+G+K D   D++IFVGDLA DV DY
Sbjct  80   LQTYNGTPMPGTEINFRLNWASFGSGQKVDPGTDHSIFVGDLAPDVTDY  128



>ref|XP_010108648.1| Polyadenylate-binding protein RBP47B' [Morus notabilis]
 gb|EXC19904.1| Polyadenylate-binding protein RBP47B' [Morus notabilis]
Length=469

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+W+DENY+N+CF+HTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  34   EVRTLWIGDLQFWVDENYLNSCFSHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAERI  93

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTP--DYTIFVGDLAADVNDY  662
            LQ+YNGT MP +EQ FRLNWA+ G GE+R D    +++IFVGDLA DV DY
Sbjct  94   LQSYNGTKMPGTEQTFRLNWASFGIGERRPDAAGVEHSIFVGDLAPDVTDY  144



>ref|XP_003543537.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoformX2 
[Glycine max]
Length=410

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE Y++ CF HTGE+ S K+IRNKLTGQ EGYGFVEF SHAAAE +
Sbjct  12   EVRTLWIGDLQYWVDEGYLSHCFGHTGEVISIKIIRNKLTGQPEGYGFVEFVSHAAAERV  71

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDD-TPDYTIFVGDLAADVNDY  662
            LQTYNGT MP ++Q FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  72   LQTYNGTQMPATDQTFRLNWASFGIGERRPDAAPEHSIFVGDLAPDVTDY  121



>ref|XP_009412453.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412454.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDL YWM+E+Y+ +CF HTGE+ S KVIRNK TGQSEGYGF+EF S AAA+ I
Sbjct  103  EIRTLWIGDLPYWMEESYLYSCFVHTGEMVSVKVIRNKQTGQSEGYGFIEFVSRAAADRI  162

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN+EQ FRLNWA+ GAGE+R D  DYTIFVGDL ADV DY
Sbjct  163  LQTYNGQVMPNTEQAFRLNWASCGAGERRGDGADYTIFVGDLGADVTDY  211



>ref|XP_001777334.1| predicted protein [Physcomitrella patens]
 ref|XP_001782740.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ52446.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ57864.1| predicted protein, partial [Physcomitrella patens]
Length=416

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EVK+LW+GDLQYWMDENY++T F HTGE+ S K+IRNK TG SEGYGFVEF SHAAAE I
Sbjct  6    EVKTLWVGDLQYWMDENYLHTAFVHTGEVQSVKIIRNKQTGYSEGYGFVEFVSHAAAEKI  65

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQ YNGT MPN+EQ FRLNWA+ G GE+R +  P+++IFVGDLA DV DY
Sbjct  66   LQAYNGTQMPNTEQPFRLNWASFGIGERRPEAGPEHSIFVGDLAPDVTDY  115



>ref|XP_003580589.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Brachypodium distachyon]
Length=426

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDE YI+ CFA TGEL S K+IR+K TGQ +GYGFVEF SHAAAE +
Sbjct  86   EVRTLWIGDLQYWMDETYIHGCFASTGELQSVKLIRDKQTGQLQGYGFVEFTSHAAAERV  145

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQ YNG AMPN +  +RLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  146  LQGYNGHAMPNVDLAYRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  192



>ref|XP_010062999.1| PREDICTED: polyadenylate-binding protein RBP45C [Eucalyptus grandis]
 gb|KCW70173.1| hypothetical protein EUGRSUZ_F03462 [Eucalyptus grandis]
Length=397

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+KSLWIGDLQ  MDE Y+  CFAH+GE+ S+KVIRNK T   EGYGF+EF + AAAE I
Sbjct  62   EIKSLWIGDLQPHMDETYLLNCFAHSGEVLSAKVIRNKQTALPEGYGFIEFMTRAAAERI  121

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPNS+QNFRLNWATLG GE+R D+ PDYTIFVGDLAADV D+
Sbjct  122  LQTYNGTLMPNSDQNFRLNWATLGPGERRQDEGPDYTIFVGDLAADVTDH  171



>ref|XP_010240455.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Brachypodium distachyon]
Length=423

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDE YI+ CFA TGEL S K+IR+K TGQ +GYGFVEF SHAAAE +
Sbjct  86   EVRTLWIGDLQYWMDETYIHGCFASTGELQSVKLIRDKQTGQLQGYGFVEFTSHAAAERV  145

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQ YNG AMPN +  +RLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  146  LQGYNGHAMPNVDLAYRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  192



>ref|XP_003543536.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoformX1 
[Glycine max]
Length=419

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE Y++ CF HTGE+ S K+IRNKLTGQ EGYGFVEF SHAAAE +
Sbjct  12   EVRTLWIGDLQYWVDEGYLSHCFGHTGEVISIKIIRNKLTGQPEGYGFVEFVSHAAAERV  71

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDD-TPDYTIFVGDLAADVNDY  662
            LQTYNGT MP ++Q FRLNWA+ G GE+R D  P+++IFVGDLA DV DY
Sbjct  72   LQTYNGTQMPATDQTFRLNWASFGIGERRPDAAPEHSIFVGDLAPDVTDY  121



>ref|XP_011628461.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Amborella 
trichopoda]
Length=422

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDE YI++CFAHTGE+ S K+IRNK TGQ EGYGF+EF S A AE I
Sbjct  90   EVRTLWIGDLQYWMDEAYIHSCFAHTGEVLSVKIIRNKQTGQPEGYGFIEFASRATAERI  149

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            +QT NGT MPN+EQ+FRLNWAT G G+KR +  D+ +FVGDLA+DV DY
Sbjct  150  IQTVNGTTMPNTEQSFRLNWATFGGGDKRSEGTDFPVFVGDLASDVTDY  198



>ref|XP_009118182.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Brassica 
rapa]
Length=388

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQ+WMDEN++ +CFAHTGE+ S KVIRNK T Q EGYGF+EF SHAAAE  
Sbjct  58   EIRTLWIGDLQFWMDENFLYSCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAAERA  117

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYN T +P   +  FRLNWA+LG G+KRDD+PDYTIFVGDLAADV DY
Sbjct  118  LQTYNNTPIPGLPDHLFRLNWASLGTGDKRDDSPDYTIFVGDLAADVTDY  167



>ref|XP_009118181.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Brassica 
rapa]
Length=394

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQ+WMDEN++ +CFAHTGE+ S KVIRNK T Q EGYGF+EF SHAAAE  
Sbjct  58   EIRTLWIGDLQFWMDENFLYSCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAAERA  117

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYN T +P   +  FRLNWA+LG G+KRDD+PDYTIFVGDLAADV DY
Sbjct  118  LQTYNNTPIPGLPDHLFRLNWASLGTGDKRDDSPDYTIFVGDLAADVTDY  167



>ref|XP_004486967.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
X2 [Cicer arietinum]
Length=427

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE Y+  CF+HTGE+ S K+IRNK+TGQ EGYGFVEF SH AAE +
Sbjct  13   EVRTLWIGDLQYWVDETYLTHCFSHTGEVISIKIIRNKITGQPEGYGFVEFVSHTAAERV  72

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQ+YNGT MP +EQ FRLNWA+ G GE+R D  PD++IFVGDLA DV DY
Sbjct  73   LQSYNGTQMPGTEQTFRLNWASFGIGERRPDAGPDHSIFVGDLAPDVTDY  122



>ref|XP_004486966.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
X1 [Cicer arietinum]
Length=429

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE Y+  CF+HTGE+ S K+IRNK+TGQ EGYGFVEF SH AAE +
Sbjct  13   EVRTLWIGDLQYWVDETYLTHCFSHTGEVISIKIIRNKITGQPEGYGFVEFVSHTAAERV  72

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQ+YNGT MP +EQ FRLNWA+ G GE+R D  PD++IFVGDLA DV DY
Sbjct  73   LQSYNGTQMPGTEQTFRLNWASFGIGERRPDAGPDHSIFVGDLAPDVTDY  122



>ref|XP_011628460.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Amborella 
trichopoda]
Length=430

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDE YI++CFAHTGE+ S K+IRNK TGQ EGYGF+EF S A AE I
Sbjct  90   EVRTLWIGDLQYWMDEAYIHSCFAHTGEVLSVKIIRNKQTGQPEGYGFIEFASRATAERI  149

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            +QT NGT MPN+EQ+FRLNWAT G G+KR +  D+ +FVGDLA+DV DY
Sbjct  150  IQTVNGTTMPNTEQSFRLNWATFGGGDKRSEGTDFPVFVGDLASDVTDY  198



>dbj|BAB08769.1| unnamed protein product [Arabidopsis thaliana]
Length=390

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            +VKSLWIGDLQ WMDENYI + FA +GE TS+KVIRNKLTGQSEGYGF+EF SH+ AE +
Sbjct  58   DVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVAERV  117

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT--PDYTIFVGDLAADVNDY  662
            LQTYNG  MP++EQ FRLNWA  GAGEKR  T  PD+TIFVGDLA +V DY
Sbjct  118  LQTYNGAPMPSTEQTFRLNWAQAGAGEKRFQTEGPDHTIFVGDLAPEVTDY  168



>ref|XP_010673626.1| PREDICTED: polyadenylate-binding protein RBP47B' [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ W+DE+YI++CFA TGE+ S KVIRNK+TG  EGYGFVEF SHAAAE +
Sbjct  14   EVRTLWIGDLQIWVDESYIHSCFAQTGEVISVKVIRNKITGHPEGYGFVEFVSHAAAERV  73

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQ+YNGT MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA DV+DY
Sbjct  74   LQSYNGTPMPGTEQPFRLNWASFGIGERRPDAGPEHSIFVGDLAPDVSDY  123



>ref|NP_568815.1| RNA-binding protein 45A [Arabidopsis thaliana]
 sp|Q9FPJ8.1|RB45A_ARATH RecName: Full=Polyadenylate-binding protein RBP45A; Short=Poly(A)-binding 
protein RBP45A; AltName: Full=RNA-binding protein 
45A; Short=AtRBP45A [Arabidopsis thaliana]
 gb|AAG40335.1|AF324983_1 AT5g54900 [Arabidopsis thaliana]
 gb|ABL66801.1| At5g54900 [Arabidopsis thaliana]
 gb|AED96554.1| RNA-binding protein 45A [Arabidopsis thaliana]
Length=387

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            +VKSLWIGDLQ WMDENYI + FA +GE TS+KVIRNKLTGQSEGYGF+EF SH+ AE +
Sbjct  58   DVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVAERV  117

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT--PDYTIFVGDLAADVNDY  662
            LQTYNG  MP++EQ FRLNWA  GAGEKR  T  PD+TIFVGDLA +V DY
Sbjct  118  LQTYNGAPMPSTEQTFRLNWAQAGAGEKRFQTEGPDHTIFVGDLAPEVTDY  168



>emb|CDY34835.1| BnaA09g47610D [Brassica napus]
Length=393

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQ+WMDEN++  CFAHTGE+ S KVIRNK T Q EGYGF+EF SHAAAE  
Sbjct  57   EIRTLWIGDLQFWMDENFLYGCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAAERA  116

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYN T +P   +  FRLNWA+LG+G+KRDD+PDYTIFVGDLAADV DY
Sbjct  117  LQTYNNTPIPGLPDHLFRLNWASLGSGDKRDDSPDYTIFVGDLAADVTDY  166



>ref|XP_004288602.1| PREDICTED: polyadenylate-binding protein RBP47B' [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ +CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHAAAE I
Sbjct  10   EVRTLWIGDLQYWVDENYLTSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAAAERI  69

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            L  YN T MP ++Q FRLNWA+ G GE+R D  PD++IFVGDLA DV D+
Sbjct  70   LHAYNATQMPGTDQTFRLNWASFGIGERRPDAGPDHSIFVGDLAPDVTDF  119



>gb|KHG09232.1| Polyadenylate-binding RBP47B' -like protein [Gossypium arboreum]
Length=423

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SH AAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHQAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTP-DYTIFVGDLAADVNDY  662
            LQTYNGT MP ++Q FRLNWA+ G GE+R D   +++IFVGDLA+DV DY
Sbjct  78   LQTYNGTPMPGTDQMFRLNWASFGIGERRTDPGLEHSIFVGDLASDVTDY  127



>gb|KJB09397.1| hypothetical protein B456_001G139100 [Gossypium raimondii]
Length=395

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SH AAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHQAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTP-DYTIFVGDLAADVNDY  662
            LQTYNGT MP ++Q FRLNWA+ G GE+R D   +++IFVGDLA DV DY
Sbjct  78   LQTYNGTTMPGTDQMFRLNWASFGIGERRTDPGLEHSIFVGDLAPDVTDY  127



>gb|KJB09398.1| hypothetical protein B456_001G139100 [Gossypium raimondii]
Length=372

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SH AAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHQAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTP-DYTIFVGDLAADVNDY  662
            LQTYNGT MP ++Q FRLNWA+ G GE+R D   +++IFVGDLA DV DY
Sbjct  78   LQTYNGTTMPGTDQMFRLNWASFGIGERRTDPGLEHSIFVGDLAPDVTDY  127



>gb|KHG01774.1| Polyadenylate-binding RBP45C -like protein [Gossypium arboreum]
Length=413

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WMDENY+ + FA TGE+ S+KVIRNK T   EGYGF+EF S AAAE +
Sbjct  79   EIRSLWIGDLQPWMDENYLMSIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSRAAAERV  138

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNG  MPNSEQNFRLNWA LG GEKR ++ PDYTIFVGDLAADV+DY
Sbjct  139  LQLYNGVPMPNSEQNFRLNWAALGYGEKRQEEGPDYTIFVGDLAADVSDY  188



>ref|XP_003573391.1| PREDICTED: polyadenylate-binding protein RBP45-like [Brachypodium 
distachyon]
Length=435

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+  CFAHTGE+ S K+IR+K TGQ +GYGFVEF + A AE +
Sbjct  96   EVRTLWIGDLQYWMDENYVYGCFAHTGEVQSVKLIRDKQTGQLQGYGFVEFTTRAGAERV  155

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN E  +RLNWA+  AGEKRDD PDYTIFVGDLAADV DY
Sbjct  156  LQTYNGATMPNVEMPYRLNWAS--AGEKRDDGPDYTIFVGDLAADVTDY  202



>gb|KJB13664.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=413

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WMDENY+ + FA TGE+ S+KVIRNK T   EGYGF+EF S AAAE +
Sbjct  79   EIRSLWIGDLQPWMDENYLMSIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSRAAAERV  138

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNG  MPNSEQNFRLNWA LG GEKR ++ PDYTIFVGDLAADV+DY
Sbjct  139  LQLYNGVPMPNSEQNFRLNWAALGYGEKRQEEGPDYTIFVGDLAADVSDY  188



>gb|KJB13665.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=415

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WMDENY+ + FA TGE+ S+KVIRNK T   EGYGF+EF S AAAE +
Sbjct  79   EIRSLWIGDLQPWMDENYLMSIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSRAAAERV  138

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNG  MPNSEQNFRLNWA LG GEKR ++ PDYTIFVGDLAADV+DY
Sbjct  139  LQLYNGVPMPNSEQNFRLNWAALGYGEKRQEEGPDYTIFVGDLAADVSDY  188



>gb|KJB13666.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=418

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WMDENY+ + FA TGE+ S+KVIRNK T   EGYGF+EF S AAAE +
Sbjct  79   EIRSLWIGDLQPWMDENYLMSIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSRAAAERV  138

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ YNG  MPNSEQNFRLNWA LG GEKR ++ PDYTIFVGDLAADV+DY
Sbjct  139  LQLYNGVPMPNSEQNFRLNWAALGYGEKRQEEGPDYTIFVGDLAADVSDY  188



>ref|XP_009131734.1| PREDICTED: polyadenylate-binding protein RBP47B' [Brassica rapa]
Length=430

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DENY+ +CF+ TGEL S KVIRNK+TGQ EGYG +EF SHAAAE  
Sbjct  21   EVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGVIEFVSHAAAERT  80

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  81   LQTYNGTLMPGTEVAFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  129



>ref|XP_006452313.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 ref|XP_006475160.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Citrus 
sinensis]
 gb|ESR65553.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|KDO62643.1| hypothetical protein CISIN_1g015468mg [Citrus sinensis]
Length=406

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = +3

Query  339  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENIL  518
            ++SLWIGDLQ WM+E+YI + F HTGE  S KVIRNK T  SEGYGF+EF SHAAAE +L
Sbjct  73   IRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVL  132

Query  519  QTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            QT+NGT MP++EQNFRLNWAT GAGE+R DD PD+TIFVGDLAADV DY
Sbjct  133  QTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDY  181



>ref|XP_009357435.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Pyrus x 
bretschneideri]
Length=315

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 90/110 (82%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWM+ENY+   F HTGE+ S KVIRNK T QSEGYGF+EF S AAAE +
Sbjct  69   EVRTLWIGDLQYWMEENYLYNIFLHTGEVVSVKVIRNKQTCQSEGYGFIEFNSRAAAERV  128

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ +NGT MPN  QNFRLNWA+   GEKR DDTPDYTIFVGDLAADV DY
Sbjct  129  LQAFNGTPMPNGAQNFRLNWAS--TGEKRSDDTPDYTIFVGDLAADVTDY  176



>ref|XP_006452314.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|ESR65554.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
Length=417

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = +3

Query  339  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENIL  518
            ++SLWIGDLQ WM+E+YI + F HTGE  S KVIRNK T  SEGYGF+EF SHAAAE +L
Sbjct  73   IRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVL  132

Query  519  QTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            QT+NGT MP++EQNFRLNWAT GAGE+R DD PD+TIFVGDLAADV DY
Sbjct  133  QTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDY  181



>gb|KJB09396.1| hypothetical protein B456_001G139100 [Gossypium raimondii]
Length=423

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQ+W+DE+Y+N+CFAHTGEL S K+IRNK+TGQ EGYGFVEF SH AAE I
Sbjct  18   EVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHQAAERI  77

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTP-DYTIFVGDLAADVNDY  662
            LQTYNGT MP ++Q FRLNWA+ G GE+R D   +++IFVGDLA DV DY
Sbjct  78   LQTYNGTTMPGTDQMFRLNWASFGIGERRTDPGLEHSIFVGDLAPDVTDY  127



>ref|XP_008349307.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Malus domestica]
Length=280

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 90/110 (82%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWM+ENY+   F HTGE+ S KVIRNK T QSEGYGF+EF S AAAE +
Sbjct  34   EVRTLWIGDLQYWMEENYLYNIFLHTGEVVSVKVIRNKQTCQSEGYGFIEFNSRAAAERV  93

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ +NGT MPN  QNFRLNWA+   GEKR DDTPDYTIFVGDLAADV DY
Sbjct  94   LQAFNGTPMPNGAQNFRLNWAS--TGEKRSDDTPDYTIFVGDLAADVTDY  141



>ref|XP_004972674.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Setaria italica]
Length=446

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFA TGE+ S K+IR+K TGQ +GYGFVEF + A AE +
Sbjct  107  EVRTLWIGDLQYWMDENYIYGCFAATGEVQSVKLIRDKHTGQLQGYGFVEFMTRATAEKV  166

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E  FRLNWA+  AGEKRDD+PDYTIFVGDLAADV DY
Sbjct  167  LQTYNGTMMPNVELPFRLNWAS--AGEKRDDSPDYTIFVGDLAADVTDY  213



>ref|XP_007150369.1| hypothetical protein PHAVU_005G147800g [Phaseolus vulgaris]
 gb|ESW22363.1| hypothetical protein PHAVU_005G147800g [Phaseolus vulgaris]
Length=424

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYW+DE Y++ CFAHTGE+ S K+IRNK+TGQ EGYGFVEF SHA+AE +
Sbjct  16   EVRTLWIGDLQYWVDEAYLSHCFAHTGEVLSIKIIRNKMTGQPEGYGFVEFVSHASAERV  75

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQTYNG  MP +EQ FRLNWA+ G GE+R D  P+++IFVGDLA +V DY
Sbjct  76   LQTYNGMQMPGTEQTFRLNWASFGIGERRPDAGPEHSIFVGDLAPEVTDY  125



>ref|XP_008224811.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Prunus 
mume]
Length=311

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 90/110 (82%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWM+E Y+     HTGEL S KVIRNK T QSEGYGF+EF S AAAE +
Sbjct  65   EVRTLWIGDLQYWMEETYLYNILVHTGELVSVKVIRNKQTTQSEGYGFIEFSSRAAAERV  124

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQ+YNGT MPN  QNFRLNWA+  AGEKR DDTPDYTIFVGDLA+DV DY
Sbjct  125  LQSYNGTPMPNGAQNFRLNWAS--AGEKRSDDTPDYTIFVGDLASDVTDY  172



>ref|XP_004972673.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Setaria italica]
Length=456

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 91/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFA TGE+ S K+IR+K TGQ +GYGFVEF + A AE +
Sbjct  107  EVRTLWIGDLQYWMDENYIYGCFAATGEVQSVKLIRDKHTGQLQGYGFVEFMTRATAEKV  166

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E  FRLNWA+  AGEKRDD+PDYTIFVGDLAADV DY
Sbjct  167  LQTYNGTMMPNVELPFRLNWAS--AGEKRDDSPDYTIFVGDLAADVTDY  213



>ref|XP_010052834.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X3 [Eucalyptus 
grandis]
 gb|KCW76950.1| hypothetical protein EUGRSUZ_D01310 [Eucalyptus grandis]
Length=300

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDE Y+ TCFA TGE+ + KVIRNK T Q EGYGF+EF + AAAE +
Sbjct  90   EVRTLWIGDLQYWMDEAYLGTCFAATGEVANVKVIRNKQTMQPEGYGFIEFYTRAAAERV  149

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN  Q+FRLNWA+  AGEKR DDTPDYTIFVGDLA+DV DY
Sbjct  150  LQTYNGAIMPNGGQSFRLNWAS--AGEKRADDTPDYTIFVGDLASDVTDY  197



>ref|XP_001784132.1| predicted protein [Physcomitrella patens]
 gb|EDQ51056.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EVK+LW+GDLQYWMDENY++T F HTGE+ S K+IRNK TG SEGYGFVEF SH AAE I
Sbjct  41   EVKTLWVGDLQYWMDENYLHTAFVHTGEVQSVKIIRNKQTGYSEGYGFVEFVSHVAAEKI  100

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVNDY  662
            LQ YNGT MPN+EQ FRLNWA+ G GE+R +  P+++IFVGDLA DV DY
Sbjct  101  LQAYNGTQMPNTEQPFRLNWASFGIGERRPEAGPEHSIFVGDLAPDVTDY  150



>ref|XP_002522953.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF39383.1| nuclear acid binding protein, putative [Ricinus communis]
Length=404

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = +3

Query  339  VKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENIL  518
            +KSLWIGDLQ WMDE Y+   F+ TGE+ S+KVIRNK TG  EGYGF+EF + AAAE IL
Sbjct  65   IKSLWIGDLQQWMDEGYLFNIFSGTGEVVSAKVIRNKQTGMPEGYGFIEFINRAAAERIL  124

Query  519  QTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            QTYNGT MPN+EQNFRLNWATL AGE+R DD PDYT+FVGDLA DVND+
Sbjct  125  QTYNGTQMPNTEQNFRLNWATLAAGERRQDDGPDYTVFVGDLAPDVNDF  173



>ref|XP_010665562.1| PREDICTED: polyadenylate-binding protein RBP45-like [Beta vulgaris 
subsp. vulgaris]
Length=414

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQYWMDENYI TCFA +GEL + K+IRNK T QSE YGF+EF +HAAAE I
Sbjct  80   EIRTLWIGDLQYWMDENYIRTCFAQSGELVNVKIIRNKQTMQSECYGFIEFSTHAAAERI  139

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYN T MPN EQN+RLNWA  G+GEKR +D  DYTIFVGDLA DV DY
Sbjct  140  LQTYNNTLMPNVEQNYRLNWAFYGSGEKRGEDASDYTIFVGDLAPDVTDY  189



>ref|XP_004976877.1| PREDICTED: polyadenylate-binding protein RBP45-like [Setaria 
italica]
Length=428

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENYI  CFA+TGE+ S K+IR+K +GQ +GYGFVEF S AAAE +
Sbjct  88   EVRTLWIGDLQYWMDENYIYGCFANTGEVQSVKLIRDKNSGQLQGYGFVEFTSRAAAERV  147

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN E  FRLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  148  LQTYNGQMMPNVELTFRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  194



>gb|ERN19652.1| hypothetical protein AMTR_s00062p00161920 [Amborella trichopoda]
Length=492

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDE YI++CFAHTGE+ S K+IRNK TGQ EGYGF+EF S A AE I
Sbjct  90   EVRTLWIGDLQYWMDEAYIHSCFAHTGEVLSVKIIRNKQTGQPEGYGFIEFASRATAERI  149

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            +QT NGT MPN+EQ+FRLNWAT G G+KR +  D+ +FVGDLA+DV DY
Sbjct  150  IQTVNGTTMPNTEQSFRLNWATFGGGDKRSEGTDFPVFVGDLASDVTDY  198



>gb|AFW61056.1| hypothetical protein ZEAMMB73_234884 [Zea mays]
Length=453

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMD+NYI  CFA TGE+ + K+IR+K TGQ +GYGF+EF S AAAE +
Sbjct  109  EVRTLWIGDLQYWMDDNYIYGCFASTGEVQNVKLIRDKHTGQLQGYGFIEFISRAAAERV  168

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E  FRLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  169  LQTYNGTMMPNVELPFRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  215



>ref|XP_008676816.1| PREDICTED: uncharacterized protein LOC100273450 isoform X1 [Zea 
mays]
 gb|ACF85557.1| unknown [Zea mays]
 gb|AFW61058.1| hypothetical protein ZEAMMB73_234884 [Zea mays]
Length=456

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMD+NYI  CFA TGE+ + K+IR+K TGQ +GYGF+EF S AAAE +
Sbjct  119  EVRTLWIGDLQYWMDDNYIYGCFASTGEVQNVKLIRDKHTGQLQGYGFIEFISRAAAERV  178

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E  FRLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  179  LQTYNGTMMPNVELPFRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  225



>ref|NP_001141359.1| uncharacterized protein LOC100273450 [Zea mays]
 gb|ACF86164.1| unknown [Zea mays]
 gb|AFW61059.1| hypothetical protein ZEAMMB73_234884 [Zea mays]
Length=453

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMD+NYI  CFA TGE+ + K+IR+K TGQ +GYGF+EF S AAAE +
Sbjct  119  EVRTLWIGDLQYWMDDNYIYGCFASTGEVQNVKLIRDKHTGQLQGYGFIEFISRAAAERV  178

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPN E  FRLNWA+  AGEKRDDTPDYTIFVGDLAADV DY
Sbjct  179  LQTYNGTMMPNVELPFRLNWAS--AGEKRDDTPDYTIFVGDLAADVTDY  225



>emb|CDY34639.1| BnaC08g41980D [Brassica napus]
Length=507

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E+++LWIGDLQ+WMDE+++ +CFAHTGE+ S KVIRNK T Q EGYGF+EF SHAAAE  
Sbjct  167  EIRTLWIGDLQFWMDESFLYSCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAAERA  226

Query  516  LQTYNGTAMPN-SEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYN T +P   +  FRLNWA+LG+G+KRDD+PDYTIFVGDLAADV DY
Sbjct  227  LQTYNNTPIPGLPDHLFRLNWASLGSGDKRDDSPDYTIFVGDLAADVTDY  276



>ref|XP_004486120.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cicer arietinum]
Length=399

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 3/112 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCF  TGE+TS KVIRNK T QSEGYGF+EF S A AE +
Sbjct  54   EVRTLWIGDLQYWMDENYLYTCFGQTGEVTSLKVIRNKQTSQSEGYGFIEFNSRATAERV  113

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGE---KRDDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN  Q++RLNWAT  AGE   ++DD PD+TIFVGDLA DV DY
Sbjct  114  LQTYNGAIMPNGGQSYRLNWATFSAGERSSRQDDGPDHTIFVGDLAVDVTDY  165



>ref|XP_010052833.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Eucalyptus 
grandis]
Length=336

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 3/110 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDE Y+ TCFA TGE+ + KVIRNK T Q EGYGF+EF + AAAE +
Sbjct  90   EVRTLWIGDLQYWMDEAYLGTCFAATGEVANVKVIRNKQTMQPEGYGFIEFYTRAAAERV  149

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN  Q+FRLNWA+  AGEKR DDTPDYTIFVGDLA+DV DY
Sbjct  150  LQTYNGAIMPNGGQSFRLNWAS--AGEKRADDTPDYTIFVGDLASDVTDY  197



>emb|CDY19874.1| BnaC09g31400D [Brassica napus]
Length=419

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIG LQ WMDENYI T FA TGE+ S+KVIRNKLTG  EGYGFVEF +HAAAE +
Sbjct  69   EIRSLWIGALQPWMDENYIMTVFAQTGEVQSAKVIRNKLTGMCEGYGFVEFANHAAAERV  128

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRD-DTPDYTIFVGDLAADVNDY  662
            LQTYNGT MPNS+Q FRLNWA  GAGE+R  + P+YTIFVGDLA +V D+
Sbjct  129  LQTYNGTQMPNSDQTFRLNWAQAGAGERRQAEGPEYTIFVGDLAPEVTDF  178



>dbj|BAE71244.1| putative DNA binding protein [Trifolium pratense]
Length=402

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 92/112 (82%), Gaps = 3/112 (3%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDLQYWMDENY+ TCF +TGE+TS KVIRNK T QSEGYGF+EF + A+AE +
Sbjct  55   EVRTLWIGDLQYWMDENYLYTCFGNTGEVTSVKVIRNKQTSQSEGYGFIEFNTRASAERV  114

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGE---KRDDTPDYTIFVGDLAADVNDY  662
            LQTY G  MPN  Q++RLNWAT  AGE   ++DD PD+TIFVGDLAADV DY
Sbjct  115  LQTYQGAIMPNGGQSYRLNWATFSAGERSSRQDDGPDHTIFVGDLAADVTDY  166



>ref|XP_010092144.1| Polyadenylate-binding protein RBP45 [Morus notabilis]
 gb|EXB50295.1| Polyadenylate-binding protein RBP45 [Morus notabilis]
Length=543

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WM+ENY+ +CFAHTGE  ++KVIRNK TG  EGYGF+EF S AAAE  
Sbjct  71   EIRSLWIGDLQQWMEENYLISCFAHTGEALTAKVIRNKQTGLPEGYGFIEFASRAAAERA  130

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN++QNFRLNWATLGAGE+R +D P++TIFVGDL+ADV D+
Sbjct  131  LQTYNGALMPNTDQNFRLNWATLGAGERRQEDGPEHTIFVGDLSADVTDF  180



>ref|XP_006401513.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
 gb|ESQ42966.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
Length=401

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WMDENYI + FA TGE  S+KVIRNK TGQ EGYGF+EF +HAAAE +
Sbjct  71   EIRSLWIGDLQPWMDENYIMSIFAQTGEAQSAKVIRNKQTGQCEGYGFIEFANHAAAERV  130

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRD-DTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN EQ FRLNWA  GAGE+R  + PD+TIFVGDLA +V DY
Sbjct  131  LQTYNGAQMPNCEQTFRLNWAQAGAGERRQAEGPDHTIFVGDLAPEVTDY  180



>ref|XP_006401514.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
 gb|ESQ42967.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
Length=403

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E++SLWIGDLQ WMDENYI + FA TGE  S+KVIRNK TGQ EGYGF+EF +HAAAE +
Sbjct  71   EIRSLWIGDLQPWMDENYIMSIFAQTGEAQSAKVIRNKQTGQCEGYGFIEFANHAAAERV  130

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRD-DTPDYTIFVGDLAADVNDY  662
            LQTYNG  MPN EQ FRLNWA  GAGE+R  + PD+TIFVGDLA +V DY
Sbjct  131  LQTYNGAQMPNCEQTFRLNWAQAGAGERRQAEGPDHTIFVGDLAPEVTDY  180



>ref|XP_006287675.1| hypothetical protein CARUB_v10000890mg, partial [Capsella rubella]
 gb|EOA20573.1| hypothetical protein CARUB_v10000890mg, partial [Capsella rubella]
Length=467

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EV++LWIGDL YW DENY+ +CF+ TGEL S KVIRNK+TGQ EGYGF+EF SH AAE  
Sbjct  66   EVRTLWIGDLLYWADENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHGAAERT  125

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDTPDYTIFVGDLAADVNDY  662
            LQTYNGT MP +E  FRLNWA+ G+G+K D  PD++IFVGDLA DV DY
Sbjct  126  LQTYNGTQMPGAELTFRLNWASFGSGQKVDAGPDHSIFVGDLAPDVTDY  174



>gb|ERN07615.1| hypothetical protein AMTR_s00157p00080130 [Amborella trichopoda]
Length=291

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            E KSLW+GDLQYWMDENY+N+CF HTGE+ S KVIRNK TGQSEGYGFVEF S AAAE I
Sbjct  77   ENKSLWVGDLQYWMDENYLNSCFGHTGEVVSLKVIRNKQTGQSEGYGFVEFVSRAAAEKI  136

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKRDDT-PDYTIFVGDLAADVND  659
            LQ YNG  MP+++Q FRLNWAT   G++R D   D++IFVGDLA+DV D
Sbjct  137  LQNYNGGMMPSTDQAFRLNWATFSMGDRRSDMGSDHSIFVGDLASDVTD  185



>gb|ACN40970.1| unknown [Picea sitchensis]
Length=430

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EVK+LW+GDLQ+WMDE Y++TCF+HTGEL S+K+IRNK TGQSEGYGF+EF +  AAE I
Sbjct  90   EVKTLWVGDLQFWMDEGYLHTCFSHTGELVSAKIIRNKYTGQSEGYGFMEFITRTAAEKI  149

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVND  659
            +QTYNGT MPN+EQ FR+NWAT   GE+R D  PD++IFVGDL +DV+D
Sbjct  150  MQTYNGTLMPNTEQVFRMNWATFSMGERRLDGGPDFSIFVGDLDSDVSD  198



>gb|ACN39849.1| unknown [Picea sitchensis]
Length=429

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +3

Query  336  EVKSLWIGDLQYWMDENYINTCFAHTGELTSSKVIRNKLTGQSEGYGFVEFRSHAAAENI  515
            EVK+LW+GDLQ+WMDE Y++TCF+HTGEL S+K+IRNK TGQSEGYGF+EF +  AAE I
Sbjct  90   EVKTLWVGDLQFWMDEGYLHTCFSHTGELVSAKIIRNKYTGQSEGYGFMEFITRTAAEKI  149

Query  516  LQTYNGTAMPNSEQNFRLNWATLGAGEKR-DDTPDYTIFVGDLAADVND  659
            +QTYNGT MPN+EQ FR+NWAT   GE+R D  PD++IFVGDL +DV+D
Sbjct  150  MQTYNGTLMPNTEQVFRMNWATFSMGERRLDGGPDFSIFVGDLDSDVSD  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077441081409