BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7352

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10959.1|  unnamed protein product                                149   2e-37   Coffea canephora [robusta coffee]
ref|XP_009599390.1|  PREDICTED: putative ABC transporter C family...    145   5e-36   
ref|XP_009599392.1|  PREDICTED: putative ABC transporter C family...    145   6e-36   
ref|XP_009799513.1|  PREDICTED: putative ABC transporter C family...    142   5e-35   Nicotiana sylvestris
ref|XP_009799512.1|  PREDICTED: putative ABC transporter C family...    142   5e-35   Nicotiana sylvestris
ref|XP_010100275.1|  ABC transporter C family member 3                  138   1e-33   
emb|CDP13298.1|  unnamed protein product                                138   1e-33   Coffea canephora [robusta coffee]
gb|KHG27828.1|  ABC transporter C family member 3                       137   2e-33   Gossypium arboreum [tree cotton]
ref|XP_007044985.1|  Multidrug resistance protein ABC transporter...    138   2e-33   
gb|KJB78047.1|  hypothetical protein B456_012G174600                    137   2e-33   Gossypium raimondii
gb|KJB31003.1|  hypothetical protein B456_005G172300                    137   3e-33   Gossypium raimondii
gb|KJB31002.1|  hypothetical protein B456_005G172300                    137   3e-33   Gossypium raimondii
ref|XP_008389787.1|  PREDICTED: ABC transporter C family member 3...    135   6e-33   
ref|XP_004239178.1|  PREDICTED: putative ABC transporter C family...    136   7e-33   Solanum lycopersicum
ref|XP_008389786.1|  PREDICTED: putative ABC transporter C family...    136   8e-33   
ref|XP_002315633.2|  hypothetical protein POPTR_0010s06540g             135   1e-32   
ref|XP_011042301.1|  PREDICTED: putative ABC transporter C family...    135   2e-32   Populus euphratica
ref|XP_002312645.2|  hypothetical protein POPTR_0008s17960g             134   3e-32   
ref|XP_006341758.1|  PREDICTED: ABC transporter C family member 3...    134   3e-32   
ref|XP_010655190.1|  PREDICTED: ABC transporter C family member 3...    134   3e-32   
ref|XP_002266601.1|  PREDICTED: putative ABC transporter C family...    134   5e-32   Vitis vinifera
ref|XP_002515003.1|  multidrug resistance-associated protein 2, 6...    134   5e-32   
ref|XP_007227087.1|  hypothetical protein PRUPE_ppa000215mg             132   1e-31   Prunus persica
ref|XP_012085613.1|  PREDICTED: putative ABC transporter C family...    132   1e-31   Jatropha curcas
ref|XP_008222022.1|  PREDICTED: LOW QUALITY PROTEIN: putative ABC...    132   1e-31   
gb|KDO82031.1|  hypothetical protein CISIN_1g000475mg                   132   2e-31   Citrus sinensis [apfelsine]
ref|XP_011029644.1|  PREDICTED: putative ABC transporter C family...    132   2e-31   Populus euphratica
ref|XP_011029645.1|  PREDICTED: putative ABC transporter C family...    132   2e-31   Populus euphratica
ref|XP_006341760.1|  PREDICTED: ABC transporter C family member 3...    131   2e-31   
ref|XP_011029643.1|  PREDICTED: putative ABC transporter C family...    132   2e-31   Populus euphratica
ref|XP_009385139.1|  PREDICTED: putative ABC transporter C family...    131   4e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004504482.1|  PREDICTED: ABC transporter C family member 3...    130   5e-31   Cicer arietinum [garbanzo]
gb|KDO82030.1|  hypothetical protein CISIN_1g000475mg                   129   1e-30   Citrus sinensis [apfelsine]
ref|XP_006438119.1|  hypothetical protein CICLE_v10030504mg             129   1e-30   
gb|KDO82029.1|  hypothetical protein CISIN_1g000475mg                   129   1e-30   Citrus sinensis [apfelsine]
ref|XP_006438121.1|  hypothetical protein CICLE_v10030504mg             129   2e-30   
gb|KDO82026.1|  hypothetical protein CISIN_1g000475mg                   129   2e-30   Citrus sinensis [apfelsine]
ref|XP_006484035.1|  PREDICTED: ABC transporter C family member 3...    129   2e-30   Citrus sinensis [apfelsine]
ref|XP_004135511.2|  PREDICTED: putative ABC transporter C family...    129   2e-30   Cucumis sativus [cucumbers]
ref|XP_008446087.1|  PREDICTED: putative ABC transporter C family...    129   2e-30   Cucumis melo [Oriental melon]
gb|KCW61997.1|  hypothetical protein EUGRSUZ_H04677                     129   3e-30   Eucalyptus grandis [rose gum]
ref|XP_010027280.1|  PREDICTED: putative ABC transporter C family...    128   4e-30   Eucalyptus grandis [rose gum]
ref|XP_011457543.1|  PREDICTED: ABC transporter C family member 3...    128   4e-30   Fragaria vesca subsp. vesca
ref|XP_010027279.1|  PREDICTED: putative ABC transporter C family...    128   4e-30   
gb|KCW61996.1|  hypothetical protein EUGRSUZ_H04676                     128   4e-30   Eucalyptus grandis [rose gum]
ref|XP_007158721.1|  hypothetical protein PHAVU_002G176600g             127   6e-30   Phaseolus vulgaris [French bean]
ref|XP_007226865.1|  hypothetical protein PRUPE_ppa017042mg             127   6e-30   Prunus persica
ref|XP_009402823.1|  PREDICTED: ABC transporter C family member 3...    127   6e-30   
ref|XP_003567367.2|  PREDICTED: putative ABC transporter C family...    127   7e-30   
ref|XP_007158722.1|  hypothetical protein PHAVU_002G176600g             127   8e-30   Phaseolus vulgaris [French bean]
gb|KDO82028.1|  hypothetical protein CISIN_1g000475mg                   127   1e-29   Citrus sinensis [apfelsine]
ref|XP_008222083.1|  PREDICTED: putative ABC transporter C family...    127   1e-29   Prunus mume [ume]
emb|CBI27547.3|  unnamed protein product                                126   2e-29   Vitis vinifera
ref|XP_009359288.1|  PREDICTED: putative ABC transporter C family...    126   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_003532715.2|  PREDICTED: ABC transporter C family member 3...    126   2e-29   Glycine max [soybeans]
gb|KHN12415.1|  ABC transporter C family member 3                       126   2e-29   Glycine soja [wild soybean]
ref|XP_008777748.1|  PREDICTED: putative ABC transporter C family...    126   2e-29   Phoenix dactylifera
gb|KEH20546.1|  multidrug resistance protein ABC transporter fami...    125   3e-29   Medicago truncatula
ref|XP_011086731.1|  PREDICTED: putative ABC transporter C family...    125   3e-29   Sesamum indicum [beniseed]
gb|EMS45807.1|  ABC transporter C family member 3                       124   1e-28   Triticum urartu
ref|XP_003524162.1|  PREDICTED: ABC transporter C family member 3...    123   2e-28   Glycine max [soybeans]
gb|KHN46034.1|  ABC transporter C family member 3                       122   3e-28   Glycine soja [wild soybean]
gb|KCW61994.1|  hypothetical protein EUGRSUZ_H04675                     122   3e-28   Eucalyptus grandis [rose gum]
gb|KCW61993.1|  hypothetical protein EUGRSUZ_H04675                     122   3e-28   Eucalyptus grandis [rose gum]
ref|XP_010025355.1|  PREDICTED: ABC transporter C family member 3...    122   3e-28   
gb|KCW61995.1|  hypothetical protein EUGRSUZ_H04675                     122   3e-28   Eucalyptus grandis [rose gum]
ref|XP_010025354.1|  PREDICTED: putative ABC transporter C family...    122   3e-28   
gb|KCW61992.1|  hypothetical protein EUGRSUZ_H04675                     122   3e-28   Eucalyptus grandis [rose gum]
ref|XP_010682872.1|  PREDICTED: putative ABC transporter C family...    122   6e-28   
ref|XP_010250841.1|  PREDICTED: putative ABC transporter C family...    120   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010248873.1|  PREDICTED: putative ABC transporter C family...    120   3e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010248874.1|  PREDICTED: putative ABC transporter C family...    120   3e-27   
ref|XP_010910638.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    118   8e-27   
ref|XP_006372251.1|  hypothetical protein POPTR_0018s14660g             117   2e-26   
ref|NP_001172697.1|  Os01g0902100                                       110   1e-25   
ref|XP_006845121.1|  PREDICTED: putative ABC transporter C family...    114   2e-25   Amborella trichopoda
ref|XP_006484036.1|  PREDICTED: ABC transporter C family member 3...    114   2e-25   Citrus sinensis [apfelsine]
ref|XP_006646575.1|  PREDICTED: ABC transporter C family member 3...    114   2e-25   
gb|EEE55832.1|  hypothetical protein OsJ_04442                          114   2e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71977.1|  hypothetical protein OsI_04817                          114   3e-25   Oryza sativa Indica Group [Indian rice]
dbj|BAD82774.1|  putative MRP-like ABC transporter                      114   3e-25   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB90531.1|  putative MRP-like ABC transporter                      114   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002457942.1|  hypothetical protein SORBIDRAFT_03g022890          112   5e-25   
ref|XP_007041004.1|  Multidrug resistance protein ABC transporter...    110   3e-24   
emb|CDM85354.1|  unnamed protein product                                109   1e-23   Triticum aestivum [Canadian hard winter wheat]
gb|KCW73260.1|  hypothetical protein EUGRSUZ_E01721                     108   2e-23   Eucalyptus grandis [rose gum]
gb|EYU25941.1|  hypothetical protein MIMGU_mgv1a000205mg                107   5e-23   Erythranthe guttata [common monkey flower]
gb|KDP28919.1|  hypothetical protein JCGZ_14690                         105   2e-22   Jatropha curcas
ref|XP_012083772.1|  PREDICTED: putative ABC transporter C family...    105   2e-22   Jatropha curcas
ref|XP_002534705.1|  multidrug resistance-associated protein 2, 6...    105   4e-22   
ref|XP_011093464.1|  PREDICTED: putative ABC transporter C family...    104   6e-22   Sesamum indicum [beniseed]
ref|XP_010269958.1|  PREDICTED: putative ABC transporter C family...    103   8e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010269959.1|  PREDICTED: putative ABC transporter C family...    103   8e-22   Nelumbo nucifera [Indian lotus]
gb|ERN01708.1|  hypothetical protein AMTR_s00090p00176020               103   1e-21   Amborella trichopoda
ref|XP_011621781.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    103   1e-21   
ref|XP_010275360.1|  PREDICTED: putative ABC transporter C family...    103   2e-21   
ref|XP_004968865.1|  PREDICTED: ABC transporter C family member 3...    102   2e-21   
gb|KGN56661.1|  hypothetical protein Csa_3G127230                       102   2e-21   Cucumis sativus [cucumbers]
ref|XP_011621776.1|  PREDICTED: ABC transporter C family member 3...    102   3e-21   
ref|XP_011621778.1|  PREDICTED: ABC transporter C family member 3...    102   3e-21   
gb|ERN01707.1|  hypothetical protein AMTR_s00090p00174380               102   3e-21   Amborella trichopoda
ref|XP_011621775.1|  PREDICTED: ABC transporter C family member 3...    102   3e-21   
ref|XP_011621779.1|  PREDICTED: ABC transporter C family member 3...    102   3e-21   
ref|XP_011621774.1|  PREDICTED: ABC transporter C family member 3...    102   3e-21   
ref|XP_006839138.2|  PREDICTED: ABC transporter C family member 3...    102   3e-21   
ref|XP_007008721.1|  Multidrug resistance protein ABC transporter...    102   4e-21   
ref|XP_010691208.1|  PREDICTED: ABC transporter C family member 3...    101   5e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW73258.1|  hypothetical protein EUGRSUZ_E01719                     101   7e-21   Eucalyptus grandis [rose gum]
gb|EYU42306.1|  hypothetical protein MIMGU_mgv1a019873mg                101   7e-21   Erythranthe guttata [common monkey flower]
ref|XP_010056490.1|  PREDICTED: putative ABC transporter C family...    101   7e-21   Eucalyptus grandis [rose gum]
ref|XP_009589885.1|  PREDICTED: putative ABC transporter C family...    101   9e-21   Nicotiana tomentosiformis
ref|XP_006341341.1|  PREDICTED: ABC transporter C family member 9...    100   9e-21   Solanum tuberosum [potatoes]
ref|XP_008438239.1|  PREDICTED: putative ABC transporter C family...    100   1e-20   Cucumis melo [Oriental melon]
ref|XP_011469557.1|  PREDICTED: putative ABC transporter C family...    100   1e-20   Fragaria vesca subsp. vesca
gb|KHG04748.1|  ABC transporter C family member 9                       100   1e-20   Gossypium arboreum [tree cotton]
ref|XP_009586976.1|  PREDICTED: putative ABC transporter C family...    100   1e-20   Nicotiana tomentosiformis
ref|XP_004307284.1|  PREDICTED: putative ABC transporter C family...    100   1e-20   Fragaria vesca subsp. vesca
ref|XP_010058572.1|  PREDICTED: putative ABC transporter C family...    100   2e-20   
ref|XP_009783346.1|  PREDICTED: putative ABC transporter C family...    100   2e-20   Nicotiana sylvestris
emb|CBI16747.3|  unnamed protein product                                100   2e-20   Vitis vinifera
ref|XP_009768406.1|  PREDICTED: putative ABC transporter C family...    100   2e-20   Nicotiana sylvestris
ref|XP_010661444.1|  PREDICTED: putative ABC transporter C family...    100   2e-20   Vitis vinifera
ref|XP_009768405.1|  PREDICTED: putative ABC transporter C family...    100   2e-20   Nicotiana sylvestris
ref|XP_008438245.1|  PREDICTED: putative ABC transporter C family...    100   2e-20   Cucumis melo [Oriental melon]
ref|XP_010327295.1|  PREDICTED: ABC transporter C family member 9...  99.4    3e-20   
ref|XP_010327294.1|  PREDICTED: ABC transporter C family member 9...  99.4    3e-20   
ref|XP_010327296.1|  PREDICTED: ABC transporter C family member 9...  99.4    3e-20   
ref|XP_004248540.1|  PREDICTED: putative ABC transporter C family...  99.8    3e-20   Solanum lycopersicum
ref|XP_010252733.1|  PREDICTED: ABC transporter C family member 3...  99.4    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010252732.1|  PREDICTED: ABC transporter C family member 3...  99.0    4e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010252731.1|  PREDICTED: ABC transporter C family member 3...  99.4    4e-20   Nelumbo nucifera [Indian lotus]
gb|KCW73259.1|  hypothetical protein EUGRSUZ_E01720                   99.0    5e-20   Eucalyptus grandis [rose gum]
ref|XP_010058571.1|  PREDICTED: putative ABC transporter C family...  98.6    6e-20   
emb|CDP09357.1|  unnamed protein product                              98.6    6e-20   Coffea canephora [robusta coffee]
ref|XP_008438240.1|  PREDICTED: putative ABC transporter C family...  98.6    7e-20   Cucumis melo [Oriental melon]
ref|XP_008438242.1|  PREDICTED: putative ABC transporter C family...  98.6    7e-20   
gb|KJB74445.1|  hypothetical protein B456_011G295700                  98.6    7e-20   Gossypium raimondii
ref|XP_011650822.1|  PREDICTED: putative ABC transporter C family...  98.6    7e-20   Cucumis sativus [cucumbers]
ref|XP_009336837.1|  PREDICTED: putative ABC transporter C family...  98.6    7e-20   
ref|XP_008438241.1|  PREDICTED: putative ABC transporter C family...  98.6    7e-20   
ref|XP_009336835.1|  PREDICTED: putative ABC transporter C family...  98.6    7e-20   
ref|XP_008375707.1|  PREDICTED: putative ABC transporter C family...  98.2    8e-20   
emb|CAN75340.1|  hypothetical protein VITISV_007527                   98.2    9e-20   Vitis vinifera
emb|CBI26749.3|  unnamed protein product                              98.2    9e-20   Vitis vinifera
ref|XP_002265605.2|  PREDICTED: ABC transporter C family member 3...  98.2    9e-20   Vitis vinifera
ref|XP_011012376.1|  PREDICTED: putative ABC transporter C family...  97.8    1e-19   Populus euphratica
ref|XP_011012375.1|  PREDICTED: putative ABC transporter C family...  97.8    1e-19   Populus euphratica
gb|EPS64027.1|  multidrug resistance-associated protein               96.7    1e-19   Genlisea aurea
ref|XP_010691202.1|  PREDICTED: ABC transporter C family member 3...  97.8    1e-19   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY71198.1|  BnaCnng71820D                                        95.5    2e-19   Brassica napus [oilseed rape]
ref|XP_006452549.1|  hypothetical protein CICLE_v10007245mg           97.1    2e-19   
ref|XP_006474927.1|  PREDICTED: ABC transporter C family member 3...  97.1    2e-19   
gb|EPS69672.1|  hypothetical protein M569_05085                       97.1    2e-19   Genlisea aurea
ref|XP_011650823.1|  PREDICTED: putative ABC transporter C family...  96.7    3e-19   Cucumis sativus [cucumbers]
ref|XP_009385264.1|  PREDICTED: putative ABC transporter C family...  96.7    3e-19   
ref|XP_006452548.1|  hypothetical protein CICLE_v10007266mg           96.7    3e-19   
gb|KDO62253.1|  hypothetical protein CISIN_1g000452mg                 96.7    3e-19   Citrus sinensis [apfelsine]
ref|XP_006474929.1|  PREDICTED: ABC transporter C family member 3...  96.3    4e-19   Citrus sinensis [apfelsine]
gb|KJB81653.1|  hypothetical protein B456_013G154800                  95.9    5e-19   Gossypium raimondii
emb|CDX82552.1|  BnaA03g32690D                                        95.9    5e-19   
ref|XP_006445505.1|  hypothetical protein CICLE_v10018481mg           95.5    7e-19   Citrus clementina [clementine]
ref|XP_008792064.1|  PREDICTED: ABC transporter C family member 3...  95.5    7e-19   
ref|XP_006464349.1|  PREDICTED: ABC transporter C family member 9...  95.5    7e-19   Citrus sinensis [apfelsine]
ref|XP_008232250.1|  PREDICTED: LOW QUALITY PROTEIN: putative ABC...  95.1    9e-19   
ref|XP_010487052.1|  PREDICTED: ABC transporter C family member 3...  95.1    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002884941.1|  ATMRP3                                           95.1    1e-18   Arabidopsis lyrata subsp. lyrata
gb|KCW68426.1|  hypothetical protein EUGRSUZ_F020791                  94.4    1e-18   Eucalyptus grandis [rose gum]
ref|XP_006296826.1|  hypothetical protein CARUB_v10012811mg           95.1    1e-18   Capsella rubella
ref|XP_002888830.1|  hypothetical protein ARALYDRAFT_894982           94.7    1e-18   
ref|XP_010544544.1|  PREDICTED: putative ABC transporter C family...  94.7    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010552378.1|  PREDICTED: ABC transporter C family member 3     94.7    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010919852.1|  PREDICTED: LOW QUALITY PROTEIN: putative ABC...  94.7    1e-18   Elaeis guineensis
ref|XP_007217911.1|  hypothetical protein PRUPE_ppa017819m3g          94.4    1e-18   
ref|XP_008244538.1|  PREDICTED: ABC transporter C family member 3...  94.7    1e-18   
ref|XP_004309817.1|  PREDICTED: ABC transporter C family member 3...  94.7    1e-18   Fragaria vesca subsp. vesca
ref|XP_009385266.1|  PREDICTED: putative ABC transporter C family...  94.4    1e-18   
ref|XP_010061487.1|  PREDICTED: ABC transporter C family member 3...  94.4    2e-18   Eucalyptus grandis [rose gum]
ref|XP_010061483.1|  PREDICTED: ABC transporter C family member 3...  94.4    2e-18   
ref|XP_008244541.1|  PREDICTED: ABC transporter C family member 3...  94.4    2e-18   Prunus mume [ume]
ref|XP_010061482.1|  PREDICTED: ABC transporter C family member 3...  94.4    2e-18   
ref|XP_008227121.1|  PREDICTED: ABC transporter C family member 3...  94.4    2e-18   
ref|XP_010552377.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  94.4    2e-18   
ref|XP_008244542.1|  PREDICTED: ABC transporter C family member 3...  94.4    2e-18   
ref|XP_010691965.1|  PREDICTED: putative ABC transporter C family...  94.4    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007213725.1|  hypothetical protein PRUPE_ppa000355mg           94.0    2e-18   
gb|ABG45865.1|  multidrug resistance-associated protein 2             93.2    2e-18   Aegilops tauschii
ref|XP_009135285.1|  PREDICTED: ABC transporter C family member 3...  94.0    2e-18   Brassica rapa
ref|XP_007214002.1|  hypothetical protein PRUPE_ppa014637mg           94.0    2e-18   
gb|KHN23859.1|  ABC transporter C family member 3                     94.0    2e-18   Glycine soja [wild soybean]
ref|XP_003545103.1|  PREDICTED: ABC transporter C family member 3...  94.0    2e-18   Glycine max [soybeans]
ref|NP_187915.1|  ABC transporter C family member 3                   94.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850575.1|  ABC transporter C family member 3                   94.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006847668.2|  PREDICTED: putative ABC transporter C family...  93.6    3e-18   
gb|ERN09249.1|  hypothetical protein AMTR_s00149p00037740             93.6    3e-18   Amborella trichopoda
gb|KFK38644.1|  hypothetical protein AALP_AA3G141700                  93.6    3e-18   Arabis alpina [alpine rockcress]
ref|XP_010269957.1|  PREDICTED: LOW QUALITY PROTEIN: putative ABC...  93.6    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010914891.1|  PREDICTED: ABC transporter C family member 3...  93.6    3e-18   Elaeis guineensis
emb|CDX82557.1|  BnaA03g32640D                                        92.0    4e-18   
ref|XP_009788088.1|  PREDICTED: ABC transporter C family member 3...  88.6    4e-18   Nicotiana sylvestris
gb|KCW68423.1|  hypothetical protein EUGRSUZ_F02074                   93.2    4e-18   Eucalyptus grandis [rose gum]
ref|XP_009629048.1|  PREDICTED: ABC transporter C family member 3...  93.2    4e-18   Nicotiana tomentosiformis
ref|XP_010061481.1|  PREDICTED: ABC transporter C family member 3...  93.2    4e-18   
ref|XP_008792061.1|  PREDICTED: ABC transporter C family member 3...  93.2    4e-18   Phoenix dactylifera
gb|KCW68422.1|  hypothetical protein EUGRSUZ_F02074                   93.2    4e-18   Eucalyptus grandis [rose gum]
ref|XP_009357290.1|  PREDICTED: ABC transporter C family member 3...  93.2    4e-18   Pyrus x bretschneideri [bai li]
dbj|BAD11207.1|  multidrug resistance-associated protein              93.2    4e-18   Noccaea caerulescens
ref|XP_007212915.1|  hypothetical protein PRUPE_ppa022260mg           93.2    4e-18   
ref|XP_007020567.1|  Multidrug resistance-associated protein 3        93.2    4e-18   
ref|XP_008784678.1|  PREDICTED: putative ABC transporter C family...  93.2    5e-18   Phoenix dactylifera
ref|XP_011095521.1|  PREDICTED: ABC transporter C family member 3...  92.8    5e-18   Sesamum indicum [beniseed]
gb|AAQ10074.1|  multidrug resistance associated protein MRP2          92.8    5e-18   Triticum aestivum [Canadian hard winter wheat]
emb|CDY43373.1|  BnaA01g30040D                                        92.4    6e-18   Brassica napus [oilseed rape]
gb|EMS63668.1|  ABC transporter C family member 3                     92.4    7e-18   Triticum urartu
ref|XP_004975426.1|  PREDICTED: ABC transporter C family member 9...  92.0    8e-18   
ref|XP_011095523.1|  PREDICTED: ABC transporter C family member 3...  92.4    8e-18   Sesamum indicum [beniseed]
ref|XP_009135282.1|  PREDICTED: ABC transporter C family member 3...  92.4    8e-18   Brassica rapa
ref|XP_006407263.1|  hypothetical protein EUTSA_v10019893mg           92.4    9e-18   Eutrema salsugineum [saltwater cress]
gb|KDO62254.1|  hypothetical protein CISIN_1g039402mg                 92.4    9e-18   Citrus sinensis [apfelsine]
ref|XP_006475120.1|  PREDICTED: ABC transporter C family member 3...  92.0    9e-18   Citrus sinensis [apfelsine]
ref|XP_006452550.1|  hypothetical protein CICLE_v10010386mg           92.0    9e-18   
ref|XP_010914892.1|  PREDICTED: ABC transporter C family member 3...  92.0    1e-17   
gb|EMT04535.1|  ABC transporter C family member 3                     92.0    1e-17   
ref|XP_009124713.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  92.0    1e-17   Brassica rapa
dbj|BAB01400.1|  multidrug resistance-associated protein (MRP); A...  92.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491490.1|  PREDICTED: ABC transporter C family member 3...  92.0    1e-17   Cicer arietinum [garbanzo]
ref|NP_187916.3|  multidrug resistance-associated protein 8           92.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465114.1|  PREDICTED: ABC transporter C family member 3     92.0    1e-17   
gb|AAL14776.1|  ATP-binding cassette transporter MRP6                 92.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007029921.1|  Multidrug resistance-associated protein 3 is...  91.7    1e-17   
ref|XP_004510151.1|  PREDICTED: ABC transporter C family member 9...  92.0    1e-17   Cicer arietinum [garbanzo]
gb|AFK47609.1|  unknown                                               90.5    1e-17   Lotus japonicus
gb|KCW68421.1|  hypothetical protein EUGRSUZ_F02073                   91.7    1e-17   Eucalyptus grandis [rose gum]
ref|XP_010061479.1|  PREDICTED: ABC transporter C family member 3...  91.7    1e-17   Eucalyptus grandis [rose gum]
ref|XP_007029920.1|  Multidrug resistance-associated protein 3 is...  91.7    1e-17   
ref|XP_010061480.1|  PREDICTED: ABC transporter C family member 3...  91.7    1e-17   
ref|XP_007020566.1|  Multidrug resistance-associated protein 3 is...  91.7    1e-17   
ref|XP_007020565.1|  Multidrug resistance-associated protein 3 is...  91.7    1e-17   
gb|KJB81652.1|  hypothetical protein B456_013G154700                  91.7    1e-17   Gossypium raimondii
ref|XP_007020564.1|  Multidrug resistance-associated protein 3 is...  91.3    2e-17   
ref|XP_003530102.2|  PREDICTED: ABC transporter C family member 9...  91.3    2e-17   Glycine max [soybeans]
gb|KHN10953.1|  ABC transporter C family member 3                     91.3    2e-17   Glycine soja [wild soybean]
gb|KJB45532.1|  hypothetical protein B456_007G310500                  91.3    2e-17   Gossypium raimondii
ref|XP_007134353.1|  hypothetical protein PHAVU_010G040400g           90.9    2e-17   Phaseolus vulgaris [French bean]
ref|XP_009124680.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  90.9    2e-17   Brassica rapa
ref|XP_008385795.1|  PREDICTED: ABC transporter C family member 3...  90.9    2e-17   
ref|XP_008385794.1|  PREDICTED: ABC transporter C family member 3...  90.9    3e-17   
emb|CDY43375.1|  BnaA01g30060D                                        90.5    3e-17   Brassica napus [oilseed rape]
ref|XP_009124708.1|  PREDICTED: ABC transporter C family member 3     90.9    3e-17   Brassica rapa
ref|XP_006645551.1|  PREDICTED: ABC transporter C family member 3...  90.9    3e-17   
emb|CDY24221.1|  BnaC01g38010D                                        90.5    3e-17   Brassica napus [oilseed rape]
ref|XP_004968378.1|  PREDICTED: ABC transporter C family member 3...  90.5    3e-17   
ref|XP_008385793.1|  PREDICTED: ABC transporter C family member 3...  90.9    3e-17   
ref|XP_002321253.1|  ABC transporter family protein                   90.9    3e-17   
gb|KHN21276.1|  ABC transporter C family member 3                     90.9    3e-17   Glycine soja [wild soybean]
gb|EMT08952.1|  ABC transporter C family member 3                     90.5    3e-17   
ref|XP_006602474.1|  PREDICTED: ABC transporter C family member 3...  90.5    3e-17   Glycine max [soybeans]
ref|XP_006602475.1|  PREDICTED: ABC transporter C family member 3...  90.5    3e-17   Glycine max [soybeans]
ref|XP_010091283.1|  ABC transporter C family member 9                90.9    3e-17   
ref|XP_010487054.1|  PREDICTED: ABC transporter C family member 6...  88.6    4e-17   Camelina sativa [gold-of-pleasure]
emb|CDM81974.1|  unnamed protein product                              90.5    4e-17   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006576680.1|  PREDICTED: ABC transporter C family member 9...  90.5    4e-17   
ref|XP_003521031.1|  PREDICTED: ABC transporter C family member 9...  90.1    4e-17   Glycine max [soybeans]
gb|KHM98971.1|  ABC transporter C family member 9                     90.1    4e-17   Glycine soja [wild soybean]
ref|XP_003565403.2|  PREDICTED: ABC transporter C family member 3...  90.1    4e-17   
gb|KFK38636.1|  hypothetical protein AALP_AA3G140200                  90.1    5e-17   Arabis alpina [alpine rockcress]
gb|AGT16648.1|  hypothetical protein SHCRBa_170_C07_F_420             90.1    5e-17   Saccharum hybrid cultivar R570
ref|XP_009104243.1|  PREDICTED: putative ABC transporter C family...  90.1    5e-17   Brassica rapa
ref|XP_009104244.1|  PREDICTED: putative ABC transporter C family...  90.1    5e-17   Brassica rapa
ref|XP_007217907.1|  hypothetical protein PRUPE_ppa000906mg           89.7    5e-17   Prunus persica
emb|CDY64080.1|  BnaAnng19200D                                        89.7    5e-17   Brassica napus [oilseed rape]
ref|XP_009783154.1|  PREDICTED: ABC transporter C family member 3...  89.4    5e-17   Nicotiana sylvestris
emb|CDX98408.1|  BnaC06g17690D                                        89.7    5e-17   
ref|XP_006402616.1|  hypothetical protein EUTSA_v10005742mg           89.7    6e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010324277.1|  PREDICTED: ABC transporter C family member 3     89.7    6e-17   Solanum lycopersicum
gb|EAY72734.1|  hypothetical protein OsI_00599                        89.7    6e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_002457259.1|  hypothetical protein SORBIDRAFT_03g004300        89.7    6e-17   
ref|XP_002884942.1|  predicted protein                                89.7    6e-17   Arabidopsis lyrata subsp. lyrata
ref|NP_001042159.1|  Os01g0173900                                     89.7    6e-17   
ref|XP_010499954.1|  PREDICTED: ABC transporter C family member 6...  89.7    6e-17   Camelina sativa [gold-of-pleasure]
emb|CDY63884.1|  BnaCnng42820D                                        89.7    6e-17   
gb|EAZ10731.1|  hypothetical protein OsJ_00567                        89.7    6e-17   
dbj|BAB62557.1|  putative MRP-like ABC transporter                    89.7    6e-17   
ref|XP_006296834.1|  hypothetical protein CARUB_v10012819mg           89.7    6e-17   
ref|XP_010499969.1|  PREDICTED: ABC transporter C family member 6...  89.7    6e-17   
emb|CBI37201.3|  unnamed protein product                              89.7    6e-17   
ref|XP_010652424.1|  PREDICTED: ABC transporter C family member 5...  89.7    6e-17   
ref|XP_007217913.1|  hypothetical protein PRUPE_ppa020395mg           89.7    7e-17   
ref|XP_010465113.1|  PREDICTED: ABC transporter C family member 6     89.7    7e-17   
ref|XP_011010733.1|  PREDICTED: ABC transporter C family member 3...  89.4    8e-17   
ref|XP_002300362.1|  ABC transporter family protein                   89.4    8e-17   
emb|CAB75931.1|  multi resistance protein homolog                     89.4    9e-17   
ref|NP_191575.2|  multidrug resistance-associated protein 9           89.4    9e-17   
gb|KDO36719.1|  hypothetical protein CISIN_1g011281mg                 87.8    9e-17   
gb|KCW47683.1|  hypothetical protein EUGRSUZ_K01420                   89.4    9e-17   
emb|CDY43395.1|  BnaA01g30260D                                        89.0    1e-16   
ref|XP_002967127.1|  hypothetical protein SELMODRAFT_169086           89.0    1e-16   
ref|XP_010036147.1|  PREDICTED: ABC transporter C family member 5     89.0    1e-16   
ref|XP_009354560.1|  PREDICTED: ABC transporter C family member 3...  89.0    1e-16   
ref|XP_004293055.1|  PREDICTED: ABC transporter C family member 3...  89.0    1e-16   
ref|XP_006452547.1|  hypothetical protein CICLE_v10007260mg           89.0    1e-16   
ref|XP_004150472.1|  PREDICTED: ABC transporter C family member 3...  89.0    1e-16   
ref|XP_002969345.1|  ATP-binding cassette transporter, subfamily ...  88.6    1e-16   
ref|XP_010232551.1|  PREDICTED: ABC transporter C family member 3...  88.6    1e-16   
emb|CDY51899.1|  BnaC03g73620D                                        87.8    1e-16   
ref|XP_006474930.1|  PREDICTED: ABC transporter C family member 3...  88.6    1e-16   
ref|XP_003567267.1|  PREDICTED: ABC transporter C family member 3...  88.6    1e-16   
gb|KHN43879.1|  ABC transporter C family member 3                     88.2    1e-16   
gb|AJR33103.1|  ABC subfamily C transporter                           88.6    1e-16   
ref|XP_008385928.1|  PREDICTED: ABC transporter C family member 3...  88.6    1e-16   
ref|XP_008340977.1|  PREDICTED: ABC transporter C family member 3...  88.6    1e-16   
ref|XP_002970678.1|  hypothetical protein SELMODRAFT_267440           88.6    2e-16   
ref|XP_011095520.1|  PREDICTED: ABC transporter C family member 3...  88.6    2e-16   
gb|AES96106.2|  multidrug resistance protein ABC transporter fami...  88.6    2e-16   
ref|XP_011080125.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  88.6    2e-16   
ref|XP_010232553.1|  PREDICTED: ABC transporter C family member 3...  88.2    2e-16   
ref|XP_010232552.1|  PREDICTED: ABC transporter C family member 3...  88.2    2e-16   
ref|XP_003613148.1|  Multidrug resistance protein ABC transporter...  88.6    2e-16   
ref|XP_002878319.1|  ATMRP9                                           88.2    2e-16   
gb|EMS53035.1|  ABC transporter C family member 3                     88.2    2e-16   
ref|XP_002960885.1|  ATP-binding cassette transporter, subfamily ...  88.2    2e-16   
ref|XP_002960887.1|  ATP-binding cassette transporter, subfamily ...  88.2    2e-16   
ref|XP_010542531.1|  PREDICTED: ABC transporter C family member 7...  88.2    2e-16   
ref|XP_002992133.1|  hypothetical protein SELMODRAFT_134840           87.8    2e-16   
emb|CBI39698.3|  unnamed protein product                              87.8    2e-16   
ref|XP_009381270.1|  PREDICTED: ABC transporter C family member 3...  87.8    2e-16   
ref|XP_008462964.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  87.8    2e-16   
ref|XP_003634755.2|  PREDICTED: ABC transporter C family member 3...  87.8    2e-16   
emb|CBI39701.3|  unnamed protein product                              87.8    2e-16   
gb|KJB45537.1|  hypothetical protein B456_007G3108002                 87.8    2e-16   
ref|XP_006292746.1|  hypothetical protein CARUB_v10018992mg           87.8    3e-16   
ref|XP_002977137.1|  ATP-binding cassette transporter, subfamily ...  87.8    3e-16   
ref|XP_007141099.1|  hypothetical protein PHAVU_008G167400g           87.8    3e-16   
ref|XP_010105586.1|  ABC transporter C family member 3                87.8    3e-16   
ref|XP_003636078.1|  Multidrug resistance protein ABC transporter...  87.8    3e-16   
gb|EYU27424.1|  hypothetical protein MIMGU_mgv1a000180mg              87.4    3e-16   
ref|XP_007140786.1|  hypothetical protein PHAVU_008G142000g           87.4    4e-16   
ref|NP_191656.2|  putative ABC transporter C-15                       87.0    4e-16   
emb|CAB94133.1|  ABC transporter-like protein                         87.0    4e-16   
ref|XP_010469229.1|  PREDICTED: ABC transporter C family member 9...  87.0    5e-16   
ref|XP_010469228.1|  PREDICTED: ABC transporter C family member 9...  87.0    5e-16   
ref|XP_007146601.1|  hypothetical protein PHAVU_006G053900g           87.0    5e-16   
gb|KDP39246.1|  hypothetical protein JCGZ_01003                       85.9    5e-16   
ref|XP_006586316.1|  PREDICTED: ABC transporter C family member 3...  87.0    5e-16   
ref|XP_006575707.1|  PREDICTED: ABC transporter C family member 3...  87.0    5e-16   
ref|XP_007146602.1|  hypothetical protein PHAVU_006G053900g           87.0    5e-16   
gb|KHM99480.1|  ABC transporter C family member 3                     87.0    5e-16   
gb|KHN43880.1|  ABC transporter C family member 3                     87.0    6e-16   
gb|KJB42381.1|  hypothetical protein B456_007G150300                  86.7    6e-16   
gb|KJB42383.1|  hypothetical protein B456_007G150300                  86.7    6e-16   
ref|XP_007146575.1|  hypothetical protein PHAVU_006G052200g           86.7    6e-16   
emb|CDX89842.1|  BnaA10g02400D                                        86.7    7e-16   
ref|XP_006418165.1|  hypothetical protein EUTSA_v10006549mg           86.7    7e-16   
ref|XP_009119329.1|  PREDICTED: ABC transporter C family member 5     86.7    7e-16   
ref|XP_006346157.1|  PREDICTED: ABC transporter C family member 3...  86.7    7e-16   
ref|XP_002960215.1|  ATP-binding cassette transporter, subfamily ...  86.3    7e-16   
ref|XP_002967493.1|  ATP-binding cassette transporter, subfamily ...  86.3    7e-16   
gb|KHG08644.1|  ABC transporter C family member 5                     86.7    8e-16   
emb|CBI39702.3|  unnamed protein product                              85.9    8e-16   
ref|XP_003617730.1|  Multidrug resistance protein ABC transporter...  86.3    8e-16   
ref|XP_007146600.1|  hypothetical protein PHAVU_006G053800g           86.3    8e-16   
ref|XP_010418619.1|  PREDICTED: ABC transporter C family member 9...  86.3    8e-16   
ref|XP_010490291.1|  PREDICTED: ABC transporter C family member 5...  86.3    8e-16   
gb|AET00689.2|  multidrug resistance protein ABC transporter fami...  86.3    9e-16   
ref|XP_006296825.1|  hypothetical protein CARUB_v10012810mg           86.3    9e-16   
ref|XP_009388268.1|  PREDICTED: ABC transporter C family member 3...  86.3    9e-16   
ref|XP_006408953.1|  hypothetical protein EUTSA_v10001878mg           86.3    9e-16   
emb|CDY39771.1|  BnaA09g10230D                                        85.9    9e-16   
ref|XP_009411379.1|  PREDICTED: ABC transporter C family member 5     86.3    1e-15   
ref|XP_010415905.1|  PREDICTED: ABC transporter C family member 5...  86.3    1e-15   
gb|EMT26949.1|  ABC transporter C family member 3                     85.9    1e-15   
ref|XP_009112666.1|  PREDICTED: ABC transporter C family member 5...  86.3    1e-15   
ref|XP_008382708.1|  PREDICTED: ABC transporter C family member 5...  86.3    1e-15   
ref|XP_008372400.1|  PREDICTED: ABC transporter C family member 5...  86.3    1e-15   
gb|KHG26638.1|  ABC transporter C family member 3                     84.7    1e-15   
ref|XP_011010737.1|  PREDICTED: ABC transporter C family member 3...  85.9    1e-15   
ref|XP_009335236.1|  PREDICTED: ABC transporter C family member 5...  85.9    1e-15   
ref|XP_009402116.1|  PREDICTED: putative ABC transporter C family...  85.9    1e-15   
ref|XP_009795282.1|  PREDICTED: ABC transporter C family member 5     85.9    1e-15   
ref|XP_006355894.1|  PREDICTED: ABC transporter C family member 5...  85.9    1e-15   
ref|XP_010522528.1|  PREDICTED: ABC transporter C family member 5     85.9    1e-15   
gb|KEH33995.1|  ABC transporter C family protein                      85.5    1e-15   
ref|XP_012070980.1|  PREDICTED: ABC transporter C family member 3...  85.5    1e-15   
ref|XP_011010736.1|  PREDICTED: ABC transporter C family member 3...  85.9    1e-15   
gb|KJB10062.1|  hypothetical protein B456_001G182400                  85.9    1e-15   
ref|XP_003541373.1|  PREDICTED: ABC transporter C family member 5...  85.9    1e-15   
ref|XP_006443721.1|  hypothetical protein CICLE_v10018479mg           85.9    1e-15   
ref|XP_010465111.1|  PREDICTED: ABC transporter C family member 7...  84.7    1e-15   
gb|KHN48949.1|  ABC transporter C family member 5                     85.9    1e-15   
gb|KEH33996.1|  multidrug resistance protein ABC transporter fami...  85.9    1e-15   
ref|XP_011010734.1|  PREDICTED: ABC transporter C family member 3...  85.9    1e-15   
gb|KJB10064.1|  hypothetical protein B456_001G182400                  85.9    1e-15   
ref|XP_007144409.1|  hypothetical protein PHAVU_007G153800g           85.9    1e-15   
ref|XP_008459973.1|  PREDICTED: ABC transporter C family member 5     85.9    1e-15   
ref|XP_011656762.1|  PREDICTED: ABC transporter C family member 5     85.9    1e-15   
ref|XP_011010735.1|  PREDICTED: ABC transporter C family member 3...  85.9    1e-15   
gb|KHG00271.1|  ABC transporter C family member 5                     85.9    1e-15   
ref|XP_003625394.1|  ABC transporter C family member                  85.9    1e-15   
emb|CAE04853.2|  OSJNBa0086O06.1                                      85.1    1e-15   
ref|XP_002892198.1|  ATMRP5                                           85.9    1e-15   
ref|XP_002446317.1|  hypothetical protein SORBIDRAFT_06g014250        85.5    1e-15   
emb|CAD59598.1|  MRP-like ABC transporter                             85.9    1e-15   
ref|XP_004247127.1|  PREDICTED: ABC transporter C family member 5     85.5    1e-15   
gb|EEC77875.1|  hypothetical protein OsI_17163                        85.5    1e-15   
ref|XP_010483109.1|  PREDICTED: ABC transporter C family member 5...  85.5    1e-15   
ref|XP_008235582.1|  PREDICTED: ABC transporter C family member 5     85.5    1e-15   
ref|XP_010483095.1|  PREDICTED: ABC transporter C family member 5...  85.5    1e-15   
gb|EEE61575.1|  hypothetical protein OsJ_15949                        85.5    1e-15   
gb|KJB10061.1|  hypothetical protein B456_001G182400                  85.5    1e-15   
ref|XP_006306584.1|  hypothetical protein CARUB_v10008087mg           85.5    1e-15   
ref|XP_010475054.1|  PREDICTED: ABC transporter C family member 5...  85.5    1e-15   
ref|XP_006854369.1|  PREDICTED: ABC transporter C family member 5     85.5    1e-15   
ref|XP_009370604.1|  PREDICTED: ABC transporter C family member 5...  85.5    2e-15   
ref|XP_007200340.1|  hypothetical protein PRUPE_ppa000172mg           85.5    2e-15   
gb|KDO60341.1|  hypothetical protein CISIN_1g000702mg                 85.5    2e-15   
ref|NP_171908.1|  inositol hexakisphosphate transporter               85.5    2e-15   
ref|XP_010914894.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  85.5    2e-15   
ref|NP_001184906.1|  inositol hexakisphosphate transporter            85.5    2e-15   
emb|CDP14885.1|  unnamed protein product                              85.5    2e-15   
ref|XP_006299726.1|  hypothetical protein CARUB_v10015919mg           85.5    2e-15   
gb|EYU17951.1|  hypothetical protein MIMGU_mgv1a0001581mg             85.1    2e-15   
gb|AAC16754.1|  Strong similarity to MRP-like ABC transporter gb|...  85.1    2e-15   
ref|XP_002526533.1|  multidrug resistance-associated protein 2, 6...  85.1    2e-15   
ref|NP_001053695.2|  Os04g0588600                                     85.1    2e-15   
gb|KEH42457.1|  multidrug resistance protein ABC transporter fami...  85.1    2e-15   
ref|XP_002447010.1|  hypothetical protein SORBIDRAFT_06g026830        85.1    2e-15   
gb|KDO62251.1|  hypothetical protein CISIN_1g0007552mg                83.2    2e-15   
ref|XP_003519622.1|  PREDICTED: ABC transporter C family member 3...  85.1    2e-15   
ref|XP_006652712.1|  PREDICTED: ABC transporter C family member 9...  85.1    2e-15   
ref|XP_010091823.1|  ABC transporter C family member 5                85.1    2e-15   
gb|KHG25185.1|  ABC transporter C family member 3                     84.7    2e-15   
ref|XP_003554305.1|  PREDICTED: ABC transporter C family member 5...  85.1    2e-15   
ref|XP_009382192.1|  PREDICTED: ABC transporter C family member 5...  84.7    2e-15   
ref|XP_011083071.1|  PREDICTED: ABC transporter C family member 5...  85.1    2e-15   
ref|XP_008364345.1|  PREDICTED: ABC transporter C family member 5...  83.2    2e-15   
gb|AIU41638.1|  ABC transporter family protein                        85.1    2e-15   
ref|XP_003521316.1|  PREDICTED: ABC transporter C family member 5...  84.7    3e-15   
emb|CDY18207.1|  BnaC05g02300D                                        84.7    3e-15   
ref|XP_009586631.1|  PREDICTED: ABC transporter C family member 5     84.7    3e-15   
ref|XP_002304797.2|  hypothetical protein POPTR_0003s19680g           84.7    3e-15   
emb|CBI39697.3|  unnamed protein product                              84.7    3e-15   
ref|XP_010684771.1|  PREDICTED: ABC transporter C family member 5     84.7    3e-15   
gb|KHN09387.1|  ABC transporter C family member 5                     84.7    3e-15   
ref|XP_009146550.1|  PREDICTED: ABC transporter C family member 7     84.7    3e-15   
ref|XP_006369995.1|  hypothetical protein POPTR_0001s37330g           84.7    3e-15   
ref|XP_006652711.1|  PREDICTED: ABC transporter C family member 9...  84.7    3e-15   
ref|XP_010499981.1|  PREDICTED: ABC transporter C family member 7...  84.7    3e-15   
ref|XP_003634753.2|  PREDICTED: ABC transporter C family member 3...  84.3    3e-15   
ref|XP_002301842.1|  ABC transporter family protein                   84.3    3e-15   
tpg|DAA36269.1|  TPA: hypothetical protein ZEAMMB73_974996            84.7    3e-15   
ref|NP_187917.3|  ABC transporter C family member 7                   84.7    3e-15   
gb|KHN43819.1|  ABC transporter C family member 3                     84.3    3e-15   
emb|CDY23565.1|  BnaC05g40290D                                        84.7    3e-15   
emb|CAD45086.1|  multidrug-resistance related protein                 84.3    3e-15   
ref|XP_008668974.1|  PREDICTED: putative ABC transporter C family...  84.7    3e-15   
emb|CDY44021.1|  BnaA05g26160D                                        84.7    3e-15   
gb|KHN02460.1|  ABC transporter C family member 5                     84.3    3e-15   
ref|XP_004975223.1|  PREDICTED: ABC transporter C family member 9...  84.3    4e-15   
ref|XP_008778002.1|  PREDICTED: ABC transporter C family member 5...  84.3    4e-15   
ref|XP_008778003.1|  PREDICTED: ABC transporter C family member 5...  84.3    4e-15   
ref|XP_009382191.1|  PREDICTED: ABC transporter C family member 5...  84.3    4e-15   
ref|XP_010918947.1|  PREDICTED: ABC transporter C family member 5...  84.3    4e-15   
ref|XP_010540922.1|  PREDICTED: ABC transporter C family member 5...  84.3    4e-15   
gb|AES81612.2|  ABC transporter-like family-protein                   84.3    4e-15   
ref|XP_002468062.1|  hypothetical protein SORBIDRAFT_01g038917        84.3    4e-15   
ref|XP_011024496.1|  PREDICTED: ABC transporter C family member 5     84.3    4e-15   
ref|XP_006407262.1|  hypothetical protein EUTSA_v10019894mg           84.3    4e-15   
emb|CBX25010.1|  multidrug resistance-associated protein 1            84.3    4e-15   
ref|XP_003613122.1|  Multidrug resistance protein ABC transporter...  84.3    4e-15   
ref|XP_007162606.1|  hypothetical protein PHAVU_001G165500g           84.3    4e-15   
gb|KHN13588.1|  ABC transporter C family member 3                     84.0    4e-15   
ref|XP_003568225.1|  PREDICTED: ABC transporter C family member 3...  84.0    4e-15   
emb|CDY24217.1|  BnaC01g37970D                                        83.6    5e-15   
ref|XP_002533033.1|  multidrug resistance-associated protein 2, 6...  84.0    5e-15   
ref|NP_001141975.1|  uncharacterized protein LOC100274125             81.6    5e-15   
gb|KEH17986.1|  multidrug resistance protein ABC transporter fami...  83.6    5e-15   
gb|AFW59098.1|  hypothetical protein ZEAMMB73_507300                  84.0    5e-15   
ref|XP_009402086.1|  PREDICTED: ABC transporter C family member 3...  84.0    5e-15   
ref|XP_008663460.1|  PREDICTED: LOW QUALITY PROTEIN: putative ABC...  84.0    5e-15   
gb|EMS62764.1|  ABC transporter C family member 5                     84.0    5e-15   
gb|KJB45533.1|  hypothetical protein B456_007G310600                  84.0    5e-15   
gb|EMS55420.1|  ABC transporter C family member 3                     84.0    5e-15   
ref|XP_012085213.1|  PREDICTED: ABC transporter C family member 5     84.0    5e-15   
ref|XP_006446151.1|  hypothetical protein CICLE_v10018229mg           84.0    5e-15   
ref|XP_002321297.2|  ABC transporter family protein                   84.0    6e-15   
ref|XP_004292247.1|  PREDICTED: ABC transporter C family member 5     83.6    6e-15   
ref|XP_010264828.1|  PREDICTED: ABC transporter C family member 5...  83.6    7e-15   
gb|KEH33999.1|  multidrug resistance protein ABC transporter fami...  83.6    7e-15   
ref|XP_007050143.1|  Multidrug resistance-associated protein 5 is...  83.6    7e-15   
ref|XP_012070979.1|  PREDICTED: ABC transporter C family member 3...  83.6    7e-15   
ref|XP_007050144.1|  Multidrug resistance-associated protein 5 is...  83.6    7e-15   
ref|XP_002884943.1|  predicted protein                                83.6    7e-15   
ref|XP_011090976.1|  PREDICTED: ABC transporter C family member 4...  83.6    8e-15   
ref|XP_010262474.1|  PREDICTED: ABC transporter C family member 5...  83.6    8e-15   
gb|EEE61576.1|  hypothetical protein OsJ_15950                        83.2    8e-15   
ref|XP_010262469.1|  PREDICTED: ABC transporter C family member 5...  83.2    9e-15   
ref|XP_004495053.1|  PREDICTED: ABC transporter C family member 5...  83.2    9e-15   
ref|XP_003530789.1|  PREDICTED: ABC transporter C family member 3...  83.2    9e-15   
ref|XP_006586122.1|  PREDICTED: ABC transporter C family member 3...  83.2    1e-14   
gb|KHM99479.1|  ABC transporter C family member 3                     83.2    1e-14   
gb|AFW89564.1|  hypothetical protein ZEAMMB73_391536                  83.2    1e-14   



>emb|CDP10959.1| unnamed protein product [Coffea canephora]
Length=1213

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 97/117 (83%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            FLII+AISIWYQ   IS      TARELARMVG QKAP+ HH SES++G  TIRCFNQED
Sbjct  797  FLIILAISIWYQDYYIS------TARELARMVGIQKAPILHHLSESVAGAATIRCFNQED  850

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R LKKNL LID YSRVAFYNSATMEWLS+RINFLFNL F  LL+ILVNLPRSAIDPS
Sbjct  851  RFLKKNLDLIDNYSRVAFYNSATMEWLSIRINFLFNLVFFLLLLILVNLPRSAIDPS  907



>ref|XP_009599390.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009599391.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Nicotiana tomentosiformis]
Length=1466

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 96/117 (82%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARM+G QKAP+ HHFSES++GV TIRCFNQED
Sbjct  1048  FLLILAISMWYQAYYI------TTARELARMIGIQKAPILHHFSESLTGVATIRCFNQED  1101

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L KNL LID YSRVAF+NSATMEWL VRINFLFNL F FLL+IL NLPR AIDPS
Sbjct  1102  RFLNKNLKLIDNYSRVAFHNSATMEWLCVRINFLFNLIFFFLLVILANLPRKAIDPS  1158



>ref|XP_009599392.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Nicotiana tomentosiformis]
Length=1436

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 96/117 (82%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARM+G QKAP+ HHFSES++GV TIRCFNQED
Sbjct  1018  FLLILAISMWYQAYYI------TTARELARMIGIQKAPILHHFSESLTGVATIRCFNQED  1071

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L KNL LID YSRVAF+NSATMEWL VRINFLFNL F FLL+IL NLPR AIDPS
Sbjct  1072  RFLNKNLKLIDNYSRVAFHNSATMEWLCVRINFLFNLIFFFLLVILANLPRKAIDPS  1128



>ref|XP_009799513.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Nicotiana sylvestris]
Length=1437

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 95/117 (81%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+++AIS+WYQ   I      TTARELARM+G QKAP+ HHFSES++GV TIRCFNQED
Sbjct  1019  FLLVLAISMWYQAYYI------TTARELARMIGIQKAPILHHFSESLTGVATIRCFNQED  1072

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L KNL LID YS VAF+NSATMEWL VRINFLFNL F FLL+IL NLPR AIDPS
Sbjct  1073  RFLNKNLKLIDNYSHVAFHNSATMEWLCVRINFLFNLIFFFLLVILANLPRKAIDPS  1129



>ref|XP_009799512.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Nicotiana sylvestris]
Length=1466

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 95/117 (81%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+++AIS+WYQ   I      TTARELARM+G QKAP+ HHFSES++GV TIRCFNQED
Sbjct  1048  FLLVLAISMWYQAYYI------TTARELARMIGIQKAPILHHFSESLTGVATIRCFNQED  1101

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L KNL LID YS VAF+NSATMEWL VRINFLFNL F FLL+IL NLPR AIDPS
Sbjct  1102  RFLNKNLKLIDNYSHVAFHNSATMEWLCVRINFLFNLIFFFLLVILANLPRKAIDPS  1158



>ref|XP_010100275.1| ABC transporter C family member 3 [Morus notabilis]
 gb|EXB82409.1| ABC transporter C family member 3 [Morus notabilis]
Length=1438

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+++ ISIWYQ   I      TTARELARMVG +K+PV HHFSESI+G  TIRCF QED
Sbjct  1018  FLVVLGISIWYQAYYI------TTARELARMVGIRKSPVLHHFSESIAGAATIRCFKQED  1071

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L K LSLID YSRVAF+NSATMEWLSVRINFLFNL F  +LIILV LP+SAIDPS
Sbjct  1072  RFLMKALSLIDDYSRVAFHNSATMEWLSVRINFLFNLVFFLVLIILVTLPKSAIDPS  1128



>emb|CDP13298.1| unnamed protein product [Coffea canephora]
Length=1458

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   IS      TARELARMVG QKAP+ HHFSES++G  TIRCFNQE 
Sbjct  1033  FLVILAISMWYQAYYIS------TARELARMVGIQKAPILHHFSESVAGAATIRCFNQET  1086

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  KKNL L+D YSRV FYNS+TMEWL +RINFLFNL F  LL ILV +PRSAIDPS
Sbjct  1087  RFSKKNLHLVDDYSRVVFYNSSTMEWLCLRINFLFNLVFFILLAILVTIPRSAIDPS  1143



>gb|KHG27828.1| ABC transporter C family member 3 [Gossypium arboreum]
Length=1331

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I+ IS WYQ   I      TTARELARMVG++KAP+ HHFSESI+G  TIRCFNQED
Sbjct  905   FIAILGISFWYQTYYI------TTARELARMVGSRKAPILHHFSESITGAGTIRCFNQED  958

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R ++KNLSLID YSRVAF+NS TMEWL VRINFLFN  F  +LIILV+LPRS IDPS
Sbjct  959   RFIEKNLSLIDDYSRVAFHNSGTMEWLCVRINFLFNFVFFLVLIILVSLPRSTIDPS  1015



>ref|XP_007044985.1| Multidrug resistance protein ABC transporter family isoform 1 
[Theobroma cacao]
 ref|XP_007044986.1| Multidrug resistance protein ABC transporter family isoform 1 
[Theobroma cacao]
 gb|EOY00817.1| Multidrug resistance protein ABC transporter family isoform 1 
[Theobroma cacao]
 gb|EOY00818.1| Multidrug resistance protein ABC transporter family isoform 1 
[Theobroma cacao]
Length=1457

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL I+ IS WYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCF+QED
Sbjct  1033  FLAILGISFWYQSYYI------TTARELARMVGIRKAPILHHFSESIAGAATIRCFSQED  1086

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R ++KNLSLID YSRVAF+NS TMEWL VRINFLFN  F  +LIILV+LPRSAIDPS
Sbjct  1087  RFMEKNLSLIDDYSRVAFHNSGTMEWLCVRINFLFNFVFFLVLIILVSLPRSAIDPS  1143



>gb|KJB78047.1| hypothetical protein B456_012G174600 [Gossypium raimondii]
Length=1454

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I+ IS WYQ   I      TTARELARMVG++KAP+ HHFSESI+G  TIRCFNQED
Sbjct  1027  FIAILGISFWYQTYYI------TTARELARMVGSRKAPILHHFSESITGAGTIRCFNQED  1080

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R ++KNLSLID YSRVAF+NS TMEWL VRINFLFN  F  +LIILV+LPRS IDPS
Sbjct  1081  RFIEKNLSLIDDYSRVAFHNSGTMEWLCVRINFLFNFVFFLVLIILVSLPRSTIDPS  1137



>gb|KJB31003.1| hypothetical protein B456_005G172300 [Gossypium raimondii]
Length=1459

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL I+ IS WYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCF QED
Sbjct  1035  FLAILGISFWYQNYYI------TTARELARMVGIRKAPILHHFSESIAGSTTIRCFGQED  1088

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R ++KNLSLID +SRVAF+NS+TMEWLSVRINFLFN  F  +L+ILV+LPRSAIDPS
Sbjct  1089  RFMEKNLSLIDDFSRVAFHNSSTMEWLSVRINFLFNFVFFLVLVILVSLPRSAIDPS  1145



>gb|KJB31002.1| hypothetical protein B456_005G172300 [Gossypium raimondii]
Length=1422

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL I+ IS WYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCF QED
Sbjct  1035  FLAILGISFWYQNYYI------TTARELARMVGIRKAPILHHFSESIAGSTTIRCFGQED  1088

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R ++KNLSLID +SRVAF+NS+TMEWLSVRINFLFN  F  +L+ILV+LPRSAIDPS
Sbjct  1089  RFMEKNLSLIDDFSRVAFHNSSTMEWLSVRINFLFNFVFFLVLVILVSLPRSAIDPS  1145



>ref|XP_008389787.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Malus domestica]
Length=1024

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            FL+++A+S WYQ   I      TTARELARMVG +KAP+ HHFSES++G  TIRCFNQED
Sbjct  604  FLVVLALSGWYQAYYI------TTARELARMVGIRKAPILHHFSESVTGAGTIRCFNQED  657

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R LKK ++LID YSRVAF+N  TMEWLSVR NFLFNL +  LLIILV+LPRSAIDPS
Sbjct  658  RFLKKIMALIDDYSRVAFHNYGTMEWLSVRTNFLFNLVYFLLLIILVSLPRSAIDPS  714



>ref|XP_004239178.1| PREDICTED: putative ABC transporter C family member 15 [Solanum 
lycopersicum]
Length=1439

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 90/110 (82%), Gaps = 6/110 (5%)
 Frame = -1

Query  560   SIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNL  381
             S+WYQ   I      TTARELARM+G QKAP+ HHFSES++GV TIRCFNQEDR LKKNL
Sbjct  1026  SMWYQAYYI------TTARELARMIGIQKAPILHHFSESLNGVATIRCFNQEDRFLKKNL  1079

Query  380   SLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             SLID YSRV F+NSATMEWL VRINFLFNL F FLL+IL +LPR AIDPS
Sbjct  1080  SLIDDYSRVVFHNSATMEWLCVRINFLFNLIFFFLLVILAHLPREAIDPS  1129



>ref|XP_008389786.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Malus domestica]
Length=1444

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+++A+S WYQ   I      TTARELARMVG +KAP+ HHFSES++G  TIRCFNQED
Sbjct  1024  FLVVLALSGWYQAYYI------TTARELARMVGIRKAPILHHFSESVTGAGTIRCFNQED  1077

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R LKK ++LID YSRVAF+N  TMEWLSVR NFLFNL +  LLIILV+LPRSAIDPS
Sbjct  1078  RFLKKIMALIDDYSRVAFHNYGTMEWLSVRTNFLFNLVYFLLLIILVSLPRSAIDPS  1134



>ref|XP_002315633.2| hypothetical protein POPTR_0010s06540g [Populus trichocarpa]
 gb|EEF01804.2| hypothetical protein POPTR_0010s06540g [Populus trichocarpa]
Length=1458

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1040  FLVILGISIWYQAYYI------TTARELARMVGIRKAPILHHFSESIAGAATIRCFNQEE  1093

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L +NLSLID YSR+ F+NS TMEWL VRINFLFNLGF  +LIILV+LP+SAI+PS
Sbjct  1094  RFLTRNLSLIDDYSRIVFHNSGTMEWLCVRINFLFNLGFFLVLIILVSLPKSAINPS  1150



>ref|XP_011042301.1| PREDICTED: putative ABC transporter C family member 15 [Populus 
euphratica]
 ref|XP_011042302.1| PREDICTED: putative ABC transporter C family member 15 [Populus 
euphratica]
 ref|XP_011042303.1| PREDICTED: putative ABC transporter C family member 15 [Populus 
euphratica]
Length=1458

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVG +KAPV HHFSESI+G  TIRCFNQE+
Sbjct  1040  FLVILGISIWYQAYYI------TTARELARMVGIRKAPVLHHFSESIAGAATIRCFNQEE  1093

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L +N+SLID YSR+ F+NS TMEWL VRINFLFNLGF  +LIILV+LP+SAI+PS
Sbjct  1094  RFLTRNISLIDDYSRIVFHNSGTMEWLCVRINFLFNLGFFLVLIILVSLPKSAINPS  1150



>ref|XP_002312645.2| hypothetical protein POPTR_0008s17960g [Populus trichocarpa]
 gb|EEE90012.2| hypothetical protein POPTR_0008s17960g [Populus trichocarpa]
Length=1448

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1030  FLVILGISIWYQAYYI------TTARELARMVGIRKAPILHHFSESITGAATIRCFNQEE  1083

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L ++LSLID YSR+ F+NS TMEWL +RINFLFNLGF  +LIILVNLP+SAIDPS
Sbjct  1084  RFLMRSLSLIDDYSRIVFHNSGTMEWLCIRINFLFNLGFFLVLIILVNLPKSAIDPS  1140



>ref|XP_006341758.1| PREDICTED: ABC transporter C family member 3-like [Solanum tuberosum]
Length=1354

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 89/110 (81%), Gaps = 6/110 (5%)
 Frame = -1

Query  560   SIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNL  381
             S+WYQ   I      TTARELARM+G QKAP+ HHFSES++GV TIRCFNQEDR L KNL
Sbjct  941   SMWYQAYYI------TTARELARMIGIQKAPILHHFSESLNGVATIRCFNQEDRFLNKNL  994

Query  380   SLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             SLID YSRV F+NSATMEWL VRINFLFNL F FLLIIL +LPR AIDPS
Sbjct  995   SLIDDYSRVVFHNSATMEWLCVRINFLFNLIFFFLLIILAHLPREAIDPS  1044



>ref|XP_010655190.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Vitis vinifera]
Length=899

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ I+AISIWYQ   I+      TARELARMVG +KAP+ HHFSES++G  TIRCF+Q+D
Sbjct  478  FVSILAISIWYQAYYIA------TARELARMVGVRKAPILHHFSESVAGAATIRCFSQDD  531

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R L++NLSLID YSRVAF+N+ATMEWL VRINFLFNL F  +L+ILV+LPRSAI PS
Sbjct  532  RFLRRNLSLIDDYSRVAFHNTATMEWLCVRINFLFNLVFFLVLVILVSLPRSAISPS  588



>ref|XP_002266601.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Vitis vinifera]
Length=1462

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I+AISIWYQ   I+      TARELARMVG +KAP+ HHFSES++G  TIRCF+Q+D
Sbjct  1041  FVSILAISIWYQAYYIA------TARELARMVGVRKAPILHHFSESVAGAATIRCFSQDD  1094

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L++NLSLID YSRVAF+N+ATMEWL VRINFLFNL F  +L+ILV+LPRSAI PS
Sbjct  1095  RFLRRNLSLIDDYSRVAFHNTATMEWLCVRINFLFNLVFFLVLVILVSLPRSAISPS  1151



>ref|XP_002515003.1| multidrug resistance-associated protein 2, 6 (mrp2, 6), abc-transoprter, 
putative [Ricinus communis]
 gb|EEF47557.1| multidrug resistance-associated protein 2, 6 (mrp2, 6), abc-transoprter, 
putative [Ricinus communis]
Length=1464

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ IS+WYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TI CFNQ+D
Sbjct  1042  FLVILGISLWYQAYYI------TTARELARMVGIRKAPILHHFSESIAGAATIHCFNQQD  1095

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L +NLSLID YSR+ F+N+ TMEWL +RINFLFNL F  +LIILVNLPRSAIDPS
Sbjct  1096  RFLMRNLSLIDDYSRIVFHNTGTMEWLCLRINFLFNLVFFLVLIILVNLPRSAIDPS  1152



>ref|XP_007227087.1| hypothetical protein PRUPE_ppa000215mg [Prunus persica]
 gb|EMJ28286.1| hypothetical protein PRUPE_ppa000215mg [Prunus persica]
Length=1451

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL ++A+S+WYQ   I      TTARELARMVG +KAP+ HHFSESI+G  T+RCFNQ D
Sbjct  1026  FLGVLALSMWYQAYYI------TTARELARMVGIRKAPILHHFSESITGAGTLRCFNQGD  1079

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L K + LID YSRVAF+N ATMEWLSVR NFLFNL F  LLIILV+LPRSAIDPS
Sbjct  1080  RFLMKTMDLIDDYSRVAFHNYATMEWLSVRTNFLFNLVFFLLLIILVSLPRSAIDPS  1136



>ref|XP_012085613.1| PREDICTED: putative ABC transporter C family member 15 [Jatropha 
curcas]
 gb|KDP26754.1| hypothetical protein JCGZ_17912 [Jatropha curcas]
Length=1470

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TI CFNQ+D
Sbjct  1051  FLVILGISIWYQAYYI------TTARELARMVGIRKAPILHHFSESITGAATIHCFNQDD  1104

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +++N SLID YSR+ F+N+ TMEWL VRINFLFNL F  +LIILV+LPRSAIDP+
Sbjct  1105  RFIRRNQSLIDDYSRIVFHNTGTMEWLCVRINFLFNLVFFLVLIILVSLPRSAIDPT  1161



>ref|XP_008222022.1| PREDICTED: LOW QUALITY PROTEIN: putative ABC transporter C family 
member 15 [Prunus mume]
Length=1448

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL ++A+S+WYQ   I      TTARELARMVG +KAP+ HHFSESI+G  T+RCFNQ D
Sbjct  1023  FLGVLALSMWYQAYYI------TTARELARMVGIRKAPILHHFSESITGAGTLRCFNQGD  1076

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L K + LID YSRVAF+N ATMEWLSVR NFLFNL F  LLIILV+LPRSAIDPS
Sbjct  1077  RFLMKTMDLIDDYSRVAFHNYATMEWLSVRTNFLFNLVFFLLLIILVSLPRSAIDPS  1133



>gb|KDO82031.1| hypothetical protein CISIN_1g000475mg [Citrus sinensis]
Length=1159

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVGT+KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1033  FLVILGISIWYQAYYI------TTARELARMVGTRKAPILHHFSESIAGATTIRCFNQEN  1086

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPSK  228
             R L ++ SLID YS V F+N  TMEWL +RIN LFN  F  +LIILV LPRSAIDPSK
Sbjct  1087  RFLLRSHSLIDDYSCVTFHNCGTMEWLCLRINLLFNFAFFLVLIILVTLPRSAIDPSK  1144



>ref|XP_011029644.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Populus euphratica]
Length=1457

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I       TARELARMVG +KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1039  FLVILGISIWYQAYYIK------TARELARMVGIRKAPILHHFSESITGAATIRCFNQEE  1092

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L ++LS+ID YSRV F+NS TMEWL +RINFLFNLGF  +LIILVNLP+SAIDPS
Sbjct  1093  RFLMRSLSIIDDYSRVVFHNSGTMEWLCIRINFLFNLGFFLVLIILVNLPKSAIDPS  1149



>ref|XP_011029645.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X3 [Populus euphratica]
Length=1451

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I       TARELARMVG +KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1030  FLVILGISIWYQAYYIK------TARELARMVGIRKAPILHHFSESITGAATIRCFNQEE  1083

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L ++LS+ID YSRV F+NS TMEWL +RINFLFNLGF  +LIILVNLP+SAIDPS
Sbjct  1084  RFLMRSLSIIDDYSRVVFHNSGTMEWLCIRINFLFNLGFFLVLIILVNLPKSAIDPS  1140



>ref|XP_006341760.1| PREDICTED: ABC transporter C family member 3-like [Solanum tuberosum]
Length=1075

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -1

Query  515  TTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNLSLIDCYSRVAFYNSA  336
            TTARELARMVG QKAP+ HHFSES++GV TIRCFNQEDR L KNLSLID YSRV F+NSA
Sbjct  673  TTARELARMVGIQKAPILHHFSESLTGVATIRCFNQEDRFLNKNLSLIDNYSRVVFHNSA  732

Query  335  TMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            TMEWL VRINFLFNL F FLL+IL +LPR AIDPS
Sbjct  733  TMEWLCVRINFLFNLIFFFLLVILAHLPREAIDPS  767



>ref|XP_011029643.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Populus euphratica]
Length=1460

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I       TARELARMVG +KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1039  FLVILGISIWYQAYYIK------TARELARMVGIRKAPILHHFSESITGAATIRCFNQEE  1092

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L ++LS+ID YSRV F+NS TMEWL +RINFLFNLGF  +LIILVNLP+SAIDPS
Sbjct  1093  RFLMRSLSIIDDYSRVVFHNSGTMEWLCIRINFLFNLGFFLVLIILVNLPKSAIDPS  1149



>ref|XP_009385139.1| PREDICTED: putative ABC transporter C family member 15 [Musa 
acuminata subsp. malaccensis]
Length=1365

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+I+ AISIWYQ   IS+      ARELARMVG +KAP+ HHFSES++G  TIRCFNQE+
Sbjct  940   FIIVFAISIWYQNYYISA------ARELARMVGIRKAPILHHFSESLAGAATIRCFNQEE  993

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  K+NL+LID YSR+ F+N ATMEWLSVRINFLFNL F  +L ILV++PR+ IDPS
Sbjct  994   RFSKRNLTLIDDYSRITFHNYATMEWLSVRINFLFNLVFFAMLTILVSMPRNDIDPS  1050



>ref|XP_004504482.1| PREDICTED: ABC transporter C family member 3-like [Cicer arietinum]
Length=1452

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F +++AISIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G VTIRCFNQE 
Sbjct  1026  FFVVLAISIWYQAYYI------TTARELARMVGIRKAPILHHFSESIAGAVTIRCFNQEK  1079

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L K ++LID YSRVAF+N ATMEWLSVRINFLFNL F F+LIILV+LPR AI+PS
Sbjct  1080  IFLTKVMALIDDYSRVAFHNYATMEWLSVRINFLFNLVFYFVLIILVSLPRDAINPS  1136



>gb|KDO82030.1| hypothetical protein CISIN_1g000475mg [Citrus sinensis]
Length=1333

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVGT+KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1033  FLVILGISIWYQAYYI------TTARELARMVGTRKAPILHHFSESIAGATTIRCFNQEN  1086

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L ++ SLID YS V F+N  TMEWL +RIN LFN  F  +LIILV LPRSAIDPS
Sbjct  1087  RFLLRSHSLIDDYSCVTFHNCGTMEWLCLRINLLFNFAFFLVLIILVTLPRSAIDPS  1143



>ref|XP_006438119.1| hypothetical protein CICLE_v10030504mg [Citrus clementina]
 ref|XP_006438120.1| hypothetical protein CICLE_v10030504mg [Citrus clementina]
 gb|ESR51359.1| hypothetical protein CICLE_v10030504mg [Citrus clementina]
 gb|ESR51360.1| hypothetical protein CICLE_v10030504mg [Citrus clementina]
Length=1421

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVGT+KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1033  FLVILGISIWYQAYYI------TTARELARMVGTRKAPILHHFSESIAGATTIRCFNQEN  1086

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L ++ SLID YS V F+N  TMEWL +RIN LFN  F  +LIILV LPRSAIDPS
Sbjct  1087  RFLLRSHSLIDDYSCVTFHNCGTMEWLCLRINLLFNFAFFLVLIILVTLPRSAIDPS  1143



>gb|KDO82029.1| hypothetical protein CISIN_1g000475mg [Citrus sinensis]
Length=1421

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVGT+KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1033  FLVILGISIWYQAYYI------TTARELARMVGTRKAPILHHFSESIAGATTIRCFNQEN  1086

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L ++ SLID YS V F+N  TMEWL +RIN LFN  F  +LIILV LPRSAIDPS
Sbjct  1087  RFLLRSHSLIDDYSCVTFHNCGTMEWLCLRINLLFNFAFFLVLIILVTLPRSAIDPS  1143



>ref|XP_006438121.1| hypothetical protein CICLE_v10030504mg [Citrus clementina]
 ref|XP_006438122.1| hypothetical protein CICLE_v10030504mg [Citrus clementina]
 gb|ESR51361.1| hypothetical protein CICLE_v10030504mg [Citrus clementina]
 gb|ESR51362.1| hypothetical protein CICLE_v10030504mg [Citrus clementina]
Length=1458

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVGT+KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1033  FLVILGISIWYQAYYI------TTARELARMVGTRKAPILHHFSESIAGATTIRCFNQEN  1086

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L ++ SLID YS V F+N  TMEWL +RIN LFN  F  +LIILV LPRSAIDPS
Sbjct  1087  RFLLRSHSLIDDYSCVTFHNCGTMEWLCLRINLLFNFAFFLVLIILVTLPRSAIDPS  1143



>gb|KDO82026.1| hypothetical protein CISIN_1g000475mg [Citrus sinensis]
 gb|KDO82027.1| hypothetical protein CISIN_1g000475mg [Citrus sinensis]
Length=1458

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVGT+KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1033  FLVILGISIWYQAYYI------TTARELARMVGTRKAPILHHFSESIAGATTIRCFNQEN  1086

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L ++ SLID YS V F+N  TMEWL +RIN LFN  F  +LIILV LPRSAIDPS
Sbjct  1087  RFLLRSHSLIDDYSCVTFHNCGTMEWLCLRINLLFNFAFFLVLIILVTLPRSAIDPS  1143



>ref|XP_006484035.1| PREDICTED: ABC transporter C family member 3-like isoform X1 
[Citrus sinensis]
Length=1458

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+ ISIWYQ   I      TTARELARMVGT+KAP+ HHFSESI+G  TIRCFNQE+
Sbjct  1033  FLVILGISIWYQAYYI------TTARELARMVGTRKAPILHHFSESIAGATTIRCFNQEN  1086

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L ++ SLID YS V F+N  TMEWL +RIN LFN  F  +LIILV LPRSAIDPS
Sbjct  1087  RFLLRSHSLIDDYSCVTFHNCGTMEWLCLRINLLFNFAFFLVLIILVTLPRSAIDPS  1143



>ref|XP_004135511.2| PREDICTED: putative ABC transporter C family member 15 [Cucumis 
sativus]
 gb|KGN51699.1| hypothetical protein Csa_5G590160 [Cucumis sativus]
Length=1461

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+++AISIWYQ   IS      TARELARMVG +KAP+ HHFSE++ G   IRCFNQED
Sbjct  1027  FLVVLAISIWYQGYYIS------TARELARMVGIRKAPILHHFSETVVGATIIRCFNQED  1080

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R LKK L+L+D YSRV F+NS +MEWL +RINFLF++ F   LIILV LPR+AIDPS
Sbjct  1081  RFLKKILNLVDDYSRVVFHNSTSMEWLCLRINFLFDVVFFLALIILVTLPRTAIDPS  1137



>ref|XP_008446087.1| PREDICTED: putative ABC transporter C family member 15 [Cucumis 
melo]
Length=1461

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+++AISIWYQ   IS      TARELARMVG +KAP+ HHFSE++ G   IRCFNQED
Sbjct  1027  FLVVLAISIWYQGYYIS------TARELARMVGIRKAPILHHFSETVVGATIIRCFNQED  1080

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R LKK L+L+D YSRV F+NS +MEWL +RINFLF++ F   LIILV LPR+AIDPS
Sbjct  1081  RFLKKILNLVDDYSRVVFHNSTSMEWLCLRINFLFDVVFFLALIILVTLPRTAIDPS  1137



>gb|KCW61997.1| hypothetical protein EUGRSUZ_H04677 [Eucalyptus grandis]
Length=1350

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARMVG QKAP+ HHFSE I+G   +RCF++ED
Sbjct  925   FLVILAISVWYQAYYI------TTARELARMVGIQKAPILHHFSEVITGAALVRCFDRED  978

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L++ LSLID YSR+ F+NS+TMEWLSVRINFLFN GF  +LIILV+LPRS +DPS
Sbjct  979   DFLRRCLSLIDDYSRIVFHNSSTMEWLSVRINFLFNFGFFIVLIILVSLPRSVVDPS  1035



>ref|XP_010027280.1| PREDICTED: putative ABC transporter C family member 15 [Eucalyptus 
grandis]
Length=1697

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARMVG QKAP+ HHFSE I+G   +RCF++ED
Sbjct  1272  FLVILAISVWYQAYYI------TTARELARMVGIQKAPILHHFSEVITGAALVRCFDRED  1325

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L++ LSLID YSR+ F+NS+TMEWLSVRINFLFN GF  +LIILV+LPRS +DPS
Sbjct  1326  DFLRRCLSLIDDYSRIVFHNSSTMEWLSVRINFLFNFGFFIVLIILVSLPRSVVDPS  1382



>ref|XP_011457543.1| PREDICTED: ABC transporter C family member 3-like, partial [Fragaria 
vesca subsp. vesca]
Length=1176

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 6/110 (5%)
 Frame = -1

Query  560  SIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNL  381
            SIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCFNQE+R L K +
Sbjct  758  SIWYQAYYI------TTARELARMVGIRKAPILHHFSESITGAATIRCFNQENRFLMKIM  811

Query  380  SLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             LID YSRVAF+N ATMEWLSVRINFLFN+ F  +L+ILV+LPRSAIDPS
Sbjct  812  DLIDDYSRVAFHNYATMEWLSVRINFLFNIAFFLVLVILVSLPRSAIDPS  861



>ref|XP_010027279.1| PREDICTED: putative ABC transporter C family member 15 [Eucalyptus 
grandis]
Length=1480

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARMVG QKAP+ HHFSE+++G   +RCFN+ED
Sbjct  1055  FLVILAISMWYQAYYI------TTARELARMVGIQKAPILHHFSEAVTGAALVRCFNRED  1108

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L++ LSLID YS++ F+NS+TMEWLSVRINFLFN GF  +LIILV+LPRS +DPS
Sbjct  1109  DFLRRCLSLIDDYSQIVFHNSSTMEWLSVRINFLFNFGFFIVLIILVSLPRSVMDPS  1165



>gb|KCW61996.1| hypothetical protein EUGRSUZ_H04676, partial [Eucalyptus grandis]
Length=1400

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARMVG QKAP+ HHFSE+++G   +RCFN+ED
Sbjct  984   FLVILAISMWYQAYYI------TTARELARMVGIQKAPILHHFSEAVTGAALVRCFNRED  1037

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L++ LSLID YS++ F+NS+TMEWLSVRINFLFN GF  +LIILV+LPRS +DPS
Sbjct  1038  DFLRRCLSLIDDYSQIVFHNSSTMEWLSVRINFLFNFGFFIVLIILVSLPRSVMDPS  1094



>ref|XP_007158721.1| hypothetical protein PHAVU_002G176600g [Phaseolus vulgaris]
 gb|ESW30715.1| hypothetical protein PHAVU_002G176600g [Phaseolus vulgaris]
Length=1311

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F ++ AISIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCFNQE 
Sbjct  1023  FFVVFAISIWYQSYYI------TTARELARMVGIRKAPILHHFSESIAGAATIRCFNQEQ  1076

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L K   LID YSRVAFYN  TMEWLSVRINFLFNL F F+L+ILV LPRS IDPS
Sbjct  1077  LFLTKVNVLIDDYSRVAFYNFGTMEWLSVRINFLFNLVFYFVLVILVTLPRSTIDPS  1133



>ref|XP_007226865.1| hypothetical protein PRUPE_ppa017042mg [Prunus persica]
 gb|EMJ28064.1| hypothetical protein PRUPE_ppa017042mg [Prunus persica]
Length=1440

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 89/116 (77%), Gaps = 6/116 (5%)
 Frame = -1

Query  578   LIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDR  399
             L + A+S+WYQ   I      TTARELARMVG +KAP+ HHFSESI+G  T+RCFNQEDR
Sbjct  1020  LGVFALSMWYQAYYI------TTARELARMVGIRKAPILHHFSESIAGAGTVRCFNQEDR  1073

Query  398   LLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
              + K + LID YSR+ F+N  TMEWLSVR NFLFNL +  +LIILV+LPRSAIDPS
Sbjct  1074  FMMKTMDLIDDYSRIVFHNYGTMEWLSVRTNFLFNLVYFIVLIILVSLPRSAIDPS  1129



>ref|XP_009402823.1| PREDICTED: ABC transporter C family member 3-like, partial [Musa 
acuminata subsp. malaccensis]
Length=1176

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+++  ISIWYQ   IS+      ARELARMVG QKAP+ HHFSES++G  TIR FNQE+
Sbjct  752  FIVVFTISIWYQNYYISA------ARELARMVGIQKAPILHHFSESLAGAATIRSFNQEE  805

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R  K+NL+LID YSR+ F+N ATMEWLSVRINFLFNL F  +L ILV++PR+ IDPS
Sbjct  806  RFRKRNLTLIDDYSRITFHNYATMEWLSVRINFLFNLVFFAMLTILVSMPRNTIDPS  862



>ref|XP_003567367.2| PREDICTED: putative ABC transporter C family member 15 [Brachypodium 
distachyon]
Length=1452

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FLIIIAIS WYQ   ISS      ARELARMVG +KAPV HHFSE++SG  TIRCFNQ +
Sbjct  1028  FLIIIAISAWYQGYYISS------ARELARMVGIRKAPVLHHFSETVSGAATIRCFNQGE  1081

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             + L K+ +LID Y+RV F+NSAT+EWLS+RINFLFNL F  +L+ILV LPR  IDPS
Sbjct  1082  KFLAKSFALIDDYTRVTFHNSATVEWLSIRINFLFNLVFFVMLVILVLLPRDTIDPS  1138



>ref|XP_007158722.1| hypothetical protein PHAVU_002G176600g [Phaseolus vulgaris]
 gb|ESW30716.1| hypothetical protein PHAVU_002G176600g [Phaseolus vulgaris]
Length=1441

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F ++ AISIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCFNQE 
Sbjct  1023  FFVVFAISIWYQSYYI------TTARELARMVGIRKAPILHHFSESIAGAATIRCFNQEQ  1076

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L K   LID YSRVAFYN  TMEWLSVRINFLFNL F F+L+ILV LPRS IDPS
Sbjct  1077  LFLTKVNVLIDDYSRVAFYNFGTMEWLSVRINFLFNLVFYFVLVILVTLPRSTIDPS  1133



>gb|KDO82028.1| hypothetical protein CISIN_1g000475mg [Citrus sinensis]
Length=1470

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTIS------SKITRTTARELARMVGTQKAPVQHHFSESISGVVTIR  420
             FL+I+ ISIWYQV   +           TTARELARMVGT+KAP+ HHFSESI+G  TIR
Sbjct  1033  FLVILGISIWYQVVNTARCHYLLQAYYITTARELARMVGTRKAPILHHFSESIAGATTIR  1092

Query  419   CFNQEDRLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAI  240
             CFNQE+R L ++ SLID YS V F+N  TMEWL +RIN LFN  F  +LIILV LPRSAI
Sbjct  1093  CFNQENRFLLRSHSLIDDYSCVTFHNCGTMEWLCLRINLLFNFAFFLVLIILVTLPRSAI  1152

Query  239   DPS  231
             DPS
Sbjct  1153  DPS  1155



>ref|XP_008222083.1| PREDICTED: putative ABC transporter C family member 15 [Prunus 
mume]
Length=1440

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 90/116 (78%), Gaps = 6/116 (5%)
 Frame = -1

Query  578   LIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDR  399
             L ++A+S+WYQ   I      TTARELARMVG +KAP+ HHFSESI+G  T+RCFNQEDR
Sbjct  1020  LGVLALSMWYQAYYI------TTARELARMVGIRKAPILHHFSESIAGAGTVRCFNQEDR  1073

Query  398   LLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
              + K + LID YSR+ F+N  TMEWLSVR NFLFNL +  +LIILV+LPRS+IDPS
Sbjct  1074  FMMKTMDLIDDYSRIVFHNYGTMEWLSVRTNFLFNLVYFIVLIILVSLPRSSIDPS  1129



>emb|CBI27547.3| unnamed protein product [Vitis vinifera]
Length=1363

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 93/117 (79%), Gaps = 11/117 (9%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I+AISIWYQ +T           +LARMVG +KAP+ HHFSES++G  TIRCF+Q+D
Sbjct  947   FVSILAISIWYQART-----------KLARMVGVRKAPILHHFSESVAGAATIRCFSQDD  995

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L++NLSLID YSRVAF+N+ATMEWL VRINFLFNL F  +L+ILV+LPRSAI PS
Sbjct  996   RFLRRNLSLIDDYSRVAFHNTATMEWLCVRINFLFNLVFFLVLVILVSLPRSAISPS  1052



>ref|XP_009359288.1| PREDICTED: putative ABC transporter C family member 15 [Pyrus 
x bretschneideri]
Length=1448

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+++A+S WYQ   I      TTA ELARMVG +KAP+ HHFSESI+G  TIRCF+QE 
Sbjct  1024  FLLVLALSGWYQAYYI------TTATELARMVGIRKAPILHHFSESITGAGTIRCFSQEG  1077

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L K ++LID YSRVAF+N  TMEWLSVR NFLFNL +  LL+ILV+LPRSAIDPS
Sbjct  1078  RFLMKVMALIDDYSRVAFHNYGTMEWLSVRTNFLFNLVYFLLLVILVSLPRSAIDPS  1134



>ref|XP_003532715.2| PREDICTED: ABC transporter C family member 3-like [Glycine max]
Length=1455

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F ++ AISIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCFNQE 
Sbjct  1032  FFVVFAISIWYQAYYI------TTARELARMVGIRKAPILHHFSESIAGAATIRCFNQEK  1085

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               + K  +LID YSRVAF+N  TMEWLSVRINFLFNL F F+L+ILV LPRS IDPS
Sbjct  1086  LFMTKIKALIDDYSRVAFHNFGTMEWLSVRINFLFNLVFYFVLVILVTLPRSTIDPS  1142



>gb|KHN12415.1| ABC transporter C family member 3 [Glycine soja]
Length=1352

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F ++ AISIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCFNQE 
Sbjct  929   FFVVFAISIWYQAYYI------TTARELARMVGIRKAPILHHFSESIAGAATIRCFNQEK  982

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               + K  +LID YSRVAF+N  TMEWLSVRINFLFNL F F+L+ILV LPRS IDPS
Sbjct  983   LFMTKLKALIDDYSRVAFHNFGTMEWLSVRINFLFNLVFYFVLVILVTLPRSTIDPS  1039



>ref|XP_008777748.1| PREDICTED: putative ABC transporter C family member 15 [Phoenix 
dactylifera]
Length=1451

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 87/110 (79%), Gaps = 6/110 (5%)
 Frame = -1

Query  560   SIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNL  381
             S+WYQ   IS+      ARELARMVG +KAP+ HHFSESI+G  TIRCFNQEDR   +NL
Sbjct  1034  SMWYQNYYISA------ARELARMVGIRKAPILHHFSESIAGAATIRCFNQEDRFFARNL  1087

Query  380   SLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             SLID YSR+ F+NSATMEWL VRINFLFNL F  +LIILV +PR+AIDPS
Sbjct  1088  SLIDDYSRITFHNSATMEWLCVRINFLFNLVFFLVLIILVTMPRNAIDPS  1137



>gb|KEH20546.1| multidrug resistance protein ABC transporter family protein [Medicago 
truncatula]
Length=1446

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F +++A+S+WYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCF QE 
Sbjct  1023  FFVVLALSVWYQAYYI------TTARELARMVGIRKAPILHHFSESIAGAATIRCFKQEK  1076

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L K + LID YSRVAF+N ATMEWLSVRINFLFNL F F+L+ILV LPRSAI+PS
Sbjct  1077  IFLTKVMVLIDDYSRVAFHNYATMEWLSVRINFLFNLVFYFVLVILVTLPRSAINPS  1133



>ref|XP_011086731.1| PREDICTED: putative ABC transporter C family member 15 [Sesamum 
indicum]
Length=1442

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FLII  ISIWYQ   ISS      ARELARMV  Q+AP+  HFSESISG   IR FNQED
Sbjct  1020  FLIIFGISIWYQSYYISS------ARELARMVPIQQAPILQHFSESISGATVIRSFNQED  1073

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  KKN  LI+ YSRVAF+NS TMEWL VRINFLFNL F  LLIILV+LPRSAIDPS
Sbjct  1074  RFWKKNAELINDYSRVAFHNSGTMEWLCVRINFLFNLVFFILLIILVSLPRSAIDPS  1130



>gb|EMS45807.1| ABC transporter C family member 3 [Triticum urartu]
Length=1457

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+IIIAIS WYQ   ISS      ARELARMVG +KAPV HHFSE++SG  TIRCFNQ +
Sbjct  1029  FIIIIAISTWYQNYYISS------ARELARMVGIRKAPVLHHFSETVSGAATIRCFNQGE  1082

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L K+L+LID Y+R+ F+NSAT+EWL +RINFLFNL F  +LIILV+LPR  IDPS
Sbjct  1083  EFLTKSLALIDDYTRITFHNSATVEWLCIRINFLFNLVFFVMLIILVSLPRDTIDPS  1139



>ref|XP_003524162.1| PREDICTED: ABC transporter C family member 3-like isoform X1 
[Glycine max]
Length=1452

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 87/117 (74%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F  ++ ISIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCFNQE 
Sbjct  1029  FFAVLPISIWYQAYYI------TTARELARMVGIRKAPILHHFSESIAGAATIRCFNQEK  1082

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
                 K  +LID YSRVAF+N  TMEWLSVRINFLFNL F F+L+ILV LPRS IDPS
Sbjct  1083  LFFTKVKALIDDYSRVAFHNFGTMEWLSVRINFLFNLVFYFVLVILVTLPRSTIDPS  1139



>gb|KHN46034.1| ABC transporter C family member 3 [Glycine soja]
Length=1353

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 87/117 (74%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F  ++ ISIWYQ   I      TTARELARMVG +KAP+ HHFSESI+G  TIRCFNQE 
Sbjct  930   FFAVLPISIWYQAYYI------TTARELARMVGIRKAPILHHFSESIAGAATIRCFNQEK  983

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
                 K  +LID YSRVAF+N  TMEWLSVRINFLFNL F F+L+ILV LPRS IDPS
Sbjct  984   LFFTKVKALIDDYSRVAFHNFGTMEWLSVRINFLFNLVFYFVLVILVTLPRSTIDPS  1040



>gb|KCW61994.1| hypothetical protein EUGRSUZ_H04675 [Eucalyptus grandis]
Length=1319

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARMVG +KAP+ HHFSES++G   +RCFN+ED
Sbjct  984   FLLILAISMWYQAYYI------TTARELARMVGIRKAPILHHFSESVTGAAIVRCFNRED  1037

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
                ++ LSLID YSR+ F+NS++MEWLS+RINFLFN GF  +LIILV LP S +DPS
Sbjct  1038  HFFRRCLSLIDNYSRIVFHNSSSMEWLSLRINFLFNFGFFVVLIILVTLPCSVVDPS  1094



>gb|KCW61993.1| hypothetical protein EUGRSUZ_H04675 [Eucalyptus grandis]
Length=1409

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARMVG +KAP+ HHFSES++G   +RCFN+ED
Sbjct  984   FLLILAISMWYQAYYI------TTARELARMVGIRKAPILHHFSESVTGAAIVRCFNRED  1037

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
                ++ LSLID YSR+ F+NS++MEWLS+RINFLFN GF  +LIILV LP S +DPS
Sbjct  1038  HFFRRCLSLIDNYSRIVFHNSSSMEWLSLRINFLFNFGFFVVLIILVTLPCSVVDPS  1094



>ref|XP_010025355.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Eucalyptus grandis]
Length=1137

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            FL+I+AIS+WYQ   I      TTARELARMVG +KAP+ HHFSES++G   +RCFN+ED
Sbjct  712  FLLILAISMWYQAYYI------TTARELARMVGIRKAPILHHFSESVTGAAIVRCFNRED  765

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               ++ LSLID YSR+ F+NS++MEWLS+RINFLFN GF  +LIILV LP S +DPS
Sbjct  766  HFFRRCLSLIDNYSRIVFHNSSSMEWLSLRINFLFNFGFFVVLIILVTLPCSVVDPS  822



>gb|KCW61995.1| hypothetical protein EUGRSUZ_H04675 [Eucalyptus grandis]
Length=1293

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARMVG +KAP+ HHFSES++G   +RCFN+ED
Sbjct  984   FLLILAISMWYQAYYI------TTARELARMVGIRKAPILHHFSESVTGAAIVRCFNRED  1037

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
                ++ LSLID YSR+ F+NS++MEWLS+RINFLFN GF  +LIILV LP S +DPS
Sbjct  1038  HFFRRCLSLIDNYSRIVFHNSSSMEWLSLRINFLFNFGFFVVLIILVTLPCSVVDPS  1094



>ref|XP_010025354.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Eucalyptus grandis]
Length=1417

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARMVG +KAP+ HHFSES++G   +RCFN+ED
Sbjct  992   FLLILAISMWYQAYYI------TTARELARMVGIRKAPILHHFSESVTGAAIVRCFNRED  1045

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
                ++ LSLID YSR+ F+NS++MEWLS+RINFLFN GF  +LIILV LP S +DPS
Sbjct  1046  HFFRRCLSLIDNYSRIVFHNSSSMEWLSLRINFLFNFGFFVVLIILVTLPCSVVDPS  1102



>gb|KCW61992.1| hypothetical protein EUGRSUZ_H04675 [Eucalyptus grandis]
Length=1396

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+I+AIS+WYQ   I      TTARELARMVG +KAP+ HHFSES++G   +RCFN+ED
Sbjct  984   FLLILAISMWYQAYYI------TTARELARMVGIRKAPILHHFSESVTGAAIVRCFNRED  1037

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
                ++ LSLID YSR+ F+NS++MEWLS+RINFLFN GF  +LIILV LP S +DPS
Sbjct  1038  HFFRRCLSLIDNYSRIVFHNSSSMEWLSLRINFLFNFGFFVVLIILVTLPCSVVDPS  1094



>ref|XP_010682872.1| PREDICTED: putative ABC transporter C family member 15 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010682873.1| PREDICTED: putative ABC transporter C family member 15 [Beta 
vulgaris subsp. vulgaris]
Length=1477

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAIS WYQ   I      TTARELARMVG +KAP+ HHFSES+ G  TIRCFNQE 
Sbjct  1054  FVAVIAISCWYQAYYI------TTARELARMVGIRKAPILHHFSESMVGSSTIRCFNQEG  1107

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R   K L+L++ YSRV F+N A MEWLSVRINFLFNL F  +L+ILV LPRSAIDPS
Sbjct  1108  RFYDKILNLVNDYSRVTFHNIAAMEWLSVRINFLFNLVFFIVLVILVMLPRSAIDPS  1164



>ref|XP_010250841.1| PREDICTED: putative ABC transporter C family member 15 [Nelumbo 
nucifera]
Length=1447

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ IIAIS WYQ   IS      TARELARMV ++ AP+ HHFSESI+G  TIR FNQED
Sbjct  1029  FIGIIAISAWYQDYYIS------TARELARMVASRIAPILHHFSESIAGAATIRSFNQED  1082

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L K LSLID YS +AF+N ATMEWL VRINFLFNLGFL +LIILV+LPRSAIDPS
Sbjct  1083  SFLAKTLSLIDDYSSLAFHNCATMEWLCVRINFLFNLGFLLVLIILVSLPRSAIDPS  1139



>ref|XP_010248873.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Nelumbo nucifera]
Length=1451

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+IIAIS WYQ   IS      TARELARMV ++ AP+ HHF+E+I+G  TIR FNQED
Sbjct  1030  FLVIIAISAWYQAYYIS------TARELARMVASRIAPILHHFTETIAGAATIRSFNQED  1083

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L KNLSLID +S ++ +NSATMEWLSVRINFLFNLGF  +LIILVNLP++AI+PS
Sbjct  1084  SFLAKNLSLIDDFSSLSIHNSATMEWLSVRINFLFNLGFFLVLIILVNLPKAAINPS  1140



>ref|XP_010248874.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Nelumbo nucifera]
Length=1430

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 93/117 (79%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL+IIAIS WYQ   IS      TARELARMV ++ AP+ HHF+E+I+G  TIR FNQED
Sbjct  1009  FLVIIAISAWYQAYYIS------TARELARMVASRIAPILHHFTETIAGAATIRSFNQED  1062

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
               L KNLSLID +S ++ +NSATMEWLSVRINFLFNLGF  +LIILVNLP++AI+PS
Sbjct  1063  SFLAKNLSLIDDFSSLSIHNSATMEWLSVRINFLFNLGFFLVLIILVNLPKAAINPS  1119



>ref|XP_010910638.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter C family member 
3-like, partial [Elaeis guineensis]
Length=846

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 86/113 (76%), Gaps = 2/113 (2%)
 Frame = -1

Query  560  SIWYQVKTIS-SKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKN  384
            S+WYQ+  I       + ARELARMVG +KAP+ HHFSESI+G  TIRCFNQEDR   +N
Sbjct  394  SMWYQMIIIFLQNYYISAARELARMVGIRKAPILHHFSESIAGAATIRCFNQEDRFFMRN  453

Query  383  LSLIDCYS-RVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPSK  228
            LSLID YS R+ F+NSATMEWL V INFLFNL F   LIILV +PR+AIDPSK
Sbjct  454  LSLIDEYSHRITFHNSATMEWLCVCINFLFNLVFFLALIILVTMPRNAIDPSK  506



>ref|XP_006372251.1| hypothetical protein POPTR_0018s14660g [Populus trichocarpa]
 gb|ERP50048.1| hypothetical protein POPTR_0018s14660g [Populus trichocarpa]
Length=1250

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 6/90 (7%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            FL    IS+WYQV  +       TARELARM G QKAP+ HHFSES+SGVVTIRCF+QE+
Sbjct  834  FLASFTISVWYQVYYLE------TARELARMAGIQKAPILHHFSESVSGVVTIRCFSQEE  887

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVR  312
            +    N++LI+ +SR+AF+NSATMEWL VR
Sbjct  888  KFYTTNVNLINDFSRIAFFNSATMEWLCVR  917



>ref|NP_001172697.1| Os01g0902100 [Oryza sativa Japonica Group]
 dbj|BAH91427.1| Os01g0902100 [Oryza sativa Japonica Group]
Length=293

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = -1

Query  512  TARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNLSLIDCYSRVAFYNSAT  333
            +ARELARMVG +KAPV HHFSE++SG  TIRCFNQ ++  +K+L+LID YSR+ F+NSAT
Sbjct  23   SARELARMVGIRKAPVLHHFSETVSGAATIRCFNQGEKFFRKSLALIDDYSRITFHNSAT  82

Query  332  MEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            +EWL VRINFLFNL F   L+ILV++PR+ IDPS
Sbjct  83   IEWLCVRINFLFNLVFFVTLVILVSMPRNTIDPS  116



>ref|XP_006845121.1| PREDICTED: putative ABC transporter C family member 15 [Amborella 
trichopoda]
 gb|ERN06796.1| hypothetical protein AMTR_s00005p00188900 [Amborella trichopoda]
Length=1474

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 6/90 (7%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL++I++S WYQV  IS      TARELAR VG+++AP+ HH SE+ISGV TIRCF QE 
Sbjct  1060  FLLVISLSAWYQVYYIS------TARELARNVGSRRAPILHHLSETISGVTTIRCFGQEH  1113

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVR  312
             R L  N  LID YSR+AF+NSA MEWL +R
Sbjct  1114  RFLTTNFRLIDNYSRLAFHNSAAMEWLCLR  1143



>ref|XP_006484036.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Citrus sinensis]
Length=1442

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -1

Query  515   TTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNLSLIDCYSRVAFYNSA  336
             TTARELARMVGT+KAP+ HHFSESI+G  TIRCFNQE+R L ++ SLID YS V F+N  
Sbjct  1033  TTARELARMVGTRKAPILHHFSESIAGATTIRCFNQENRFLLRSHSLIDDYSCVTFHNCG  1092

Query  335   TMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             TMEWL +RIN LFN  F  +LIILV LPRSAIDPS
Sbjct  1093  TMEWLCLRINLLFNFAFFLVLIILVTLPRSAIDPS  1127



>ref|XP_006646575.1| PREDICTED: ABC transporter C family member 3-like [Oryza brachyantha]
Length=1403

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = -1

Query  560   SIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNL  381
             S WYQ   ISS      ARELARMVG +KAPV HHFSE++SG  TIRCFNQ  + L+K+L
Sbjct  994   STWYQSYYISS------ARELARMVGIRKAPVLHHFSETVSGAATIRCFNQGQKFLRKSL  1047

Query  380   SLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
              LID YSR+ F+NSAT+EWL +RINFLFNL F  +L+ILV+LPR+ IDPS
Sbjct  1048  VLIDDYSRITFHNSATVEWLCIRINFLFNLVFFVMLLILVSLPRNTIDPS  1097



>gb|EEE55832.1| hypothetical protein OsJ_04442 [Oryza sativa Japonica Group]
Length=1190

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = -1

Query  560  SIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNL  381
            S WYQ   I S      ARELARMVG +KAPV HHFSE++SG  TIRCFNQ ++  +K+L
Sbjct  781  STWYQSYYICS------ARELARMVGIRKAPVLHHFSETVSGAATIRCFNQGEKFFRKSL  834

Query  380  SLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            +LID YSR+ F+NSAT+EWL VRINFLFNL F   L+ILV++PR+ IDPS
Sbjct  835  ALIDDYSRITFHNSATIEWLCVRINFLFNLVFFVTLVILVSMPRNTIDPS  884



>gb|EEC71977.1| hypothetical protein OsI_04817 [Oryza sativa Indica Group]
Length=1190

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = -1

Query  560  SIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNL  381
            S WYQ   I S      ARELARMVG +KAP+ HHFSE++SG  TIRCFNQ ++  +K+L
Sbjct  781  STWYQSYYICS------ARELARMVGIRKAPILHHFSETVSGAATIRCFNQGEKFFRKSL  834

Query  380  SLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            +LID YSR+ F+NSAT+EWL VRINFLFNL F  +L+ILV++PR+ IDPS
Sbjct  835  ALIDDYSRITFHNSATIEWLCVRINFLFNLVFFVMLVILVSMPRNTIDPS  884



>dbj|BAD82774.1| putative MRP-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD82115.1| putative MRP-like ABC transporter [Oryza sativa Japonica Group]
Length=1487

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = -1

Query  560   SIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNL  381
             S WYQ   I S      ARELARMVG +KAPV HHFSE++SG  TIRCFNQ ++  +K+L
Sbjct  1078  STWYQSYYICS------ARELARMVGIRKAPVLHHFSETVSGAATIRCFNQGEKFFRKSL  1131

Query  380   SLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             +LID YSR+ F+NSAT+EWL VRINFLFNL F   L+ILV++PR+ IDPS
Sbjct  1132  ALIDDYSRITFHNSATIEWLCVRINFLFNLVFFVTLVILVSMPRNTIDPS  1181



>dbj|BAB90531.1| putative MRP-like ABC transporter [Oryza sativa Japonica Group]
 emb|CAD59602.1| MRP-like ABC transporter [Oryza sativa Japonica Group]
Length=1386

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = -1

Query  560   SIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNL  381
             S WYQ   I S      ARELARMVG +KAPV HHFSE++SG  TIRCFNQ ++  +K+L
Sbjct  977   STWYQSYYICS------ARELARMVGIRKAPVLHHFSETVSGAATIRCFNQGEKFFRKSL  1030

Query  380   SLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             +LID YSR+ F+NSAT+EWL VRINFLFNL F   L+ILV++PR+ IDPS
Sbjct  1031  ALIDDYSRITFHNSATIEWLCVRINFLFNLVFFVTLVILVSMPRNTIDPS  1080



>ref|XP_002457942.1| hypothetical protein SORBIDRAFT_03g022890 [Sorghum bicolor]
 gb|EES03062.1| hypothetical protein SORBIDRAFT_03g022890 [Sorghum bicolor]
Length=946

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F++I++IS  YQ   ISS      ARELAR+VG +KAP+ HHFSE+ISG  TIRCFNQ +
Sbjct  527  FIVIVSISTCYQSYYISS------ARELARLVGIKKAPILHHFSETISGAATIRCFNQGE  580

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
              L+K+L+LID YSR+ F+N+A +EWL VRINFLFNL F  +L+ILV+LP   IDPS
Sbjct  581  LFLRKSLTLIDDYSRITFHNAAAIEWLCVRINFLFNLVFFVMLVILVSLPHDTIDPS  637



>ref|XP_007041004.1| Multidrug resistance protein ABC transporter family [Theobroma 
cacao]
 gb|EOX96835.1| Multidrug resistance protein ABC transporter family [Theobroma 
cacao]
Length=957

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            FL+I  IS+ YQ   I      TTARELARMVG QKAPV HHFSE+I+G  TIRCF+QE+
Sbjct  666  FLVIFYISMRYQAYYI------TTARELARMVGVQKAPVLHHFSETIAGAATIRCFDQEE  719

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            +   + L+LID +S +AF+NSAT+EWL VR+NFLFN+GF  +L+ LV+LP  A++PS
Sbjct  720  QFFARILNLIDDFSCIAFHNSATIEWLCVRVNFLFNIGFFLVLVFLVSLPTLAVNPS  776



>emb|CDM85354.1| unnamed protein product [Triticum aestivum]
Length=1408

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -1

Query  515   TTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNLSLIDCYSRVAFYNSA  336
             ++ARELARMVG +KAPV HHFSE++SG  TIRCFNQ ++ L K+L+LID Y+R+ F+NSA
Sbjct  1000  SSARELARMVGIRKAPVLHHFSETVSGAATIRCFNQGEKFLTKSLALIDDYTRITFHNSA  1059

Query  335   TMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             T+EWL +RINFLFNL F  +L+ILV+LPR  IDPS
Sbjct  1060  TVEWLCIRINFLFNLVFFVMLVILVSLPRDTIDPS  1094



>gb|KCW73260.1| hypothetical protein EUGRSUZ_E01721, partial [Eucalyptus grandis]
Length=1444

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 80/117 (68%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I+      TARELAR+ G Q+AP+ HHF+ESI+G  TIR F+QED
Sbjct  1060  FIPVTAICIWYQQYYIA------TARELARLSGIQRAPILHHFAESIAGAATIRAFDQED  1113

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL L+D +SR  FYN +TMEWLS R++ L N  F F L++LV+LP   IDPS
Sbjct  1114  RFTGGNLGLVDNHSRPWFYNVSTMEWLSFRLDLLSNFVFAFSLVLLVSLPEGIIDPS  1170



>gb|EYU25941.1| hypothetical protein MIMGU_mgv1a000205mg [Erythranthe guttata]
Length=1431

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 79/110 (72%), Gaps = 6/110 (5%)
 Frame = -1

Query  560   SIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNL  381
             S WYQ   I      TTARELARMV  Q+AP+  HFSESI+G   IR FNQE R  K N 
Sbjct  1016  SAWYQAYYI------TTARELARMVPIQQAPILQHFSESITGATIIRSFNQEHRFWKTNT  1069

Query  380   SLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
              LI+ YSRVAF+NS TMEWL VRINFLFNL F  LL+ILV+LPRS IDPS
Sbjct  1070  DLINDYSRVAFHNSGTMEWLCVRINFLFNLVFFLLLVILVSLPRSTIDPS  1119



>gb|KDP28919.1| hypothetical protein JCGZ_14690 [Jatropha curcas]
Length=1484

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 79/117 (68%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQED
Sbjct  1064  FIPVSAICIWYQRYYIP------TARELARLAGIQRAPILHHFAESLAGAATIRAFNQED  1117

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R ++ NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1118  RFIEANLDLIDSHSRPWFHNMSAMEWLSFRLNLLSNFVFAFSLVLLVTLPEGIINPS  1174



>ref|XP_012083772.1| PREDICTED: putative ABC transporter C family member 15 [Jatropha 
curcas]
Length=1506

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 79/117 (68%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQED
Sbjct  1086  FIPVSAICIWYQRYYIP------TARELARLAGIQRAPILHHFAESLAGAATIRAFNQED  1139

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R ++ NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1140  RFIEANLDLIDSHSRPWFHNMSAMEWLSFRLNLLSNFVFAFSLVLLVTLPEGIINPS  1196



>ref|XP_002534705.1| multidrug resistance-associated protein 2, 6 (mrp2, 6), abc-transoprter, 
putative [Ricinus communis]
 gb|EEF27679.1| multidrug resistance-associated protein 2, 6 (mrp2, 6), abc-transoprter, 
putative, partial [Ricinus communis]
Length=1239

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR F+QED
Sbjct  1058  FIPVTAICIWYQQYYIP------TARELARLAGIQRAPILHHFAESLAGAATIRAFDQED  1111

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +K NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I P+
Sbjct  1112  RFIKANLDLIDSHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLVVLVTLPEGIISPT  1168



>ref|XP_011093464.1| PREDICTED: putative ABC transporter C family member 15 [Sesamum 
indicum]
Length=1500

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G Q+AP+ HHF+ES+SG  TIR F+Q++
Sbjct  1074  FIPVTAICIWYQQYYIP------TARELARLAGIQRAPILHHFAESLSGAATIRAFDQQE  1127

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LIDC+SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1128  RFTDANLCLIDCHSRPWFHNVSAMEWLSFRLNQLSNFVFAFSLVLLVTLPEGIINPS  1184



>ref|XP_010269958.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Nelumbo nucifera]
Length=1507

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ      +    TARELAR+ G Q+AP+ HHF+ES++G  TIR F+QED
Sbjct  1078  FIPVTAICIWYQ------RYYTPTARELARLDGIQRAPILHHFAESLAGAATIRAFDQED  1131

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R ++ NLSLID +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  1132  RFIEANLSLIDNHSRPWFHNVSAMEWLSFRLNILSNFVFAFSLVLLVSLPEGIINPS  1188



>ref|XP_010269959.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Nelumbo nucifera]
Length=1506

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ      +    TARELAR+ G Q+AP+ HHF+ES++G  TIR F+QED
Sbjct  1077  FIPVTAICIWYQ------RYYTPTARELARLDGIQRAPILHHFAESLAGAATIRAFDQED  1130

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R ++ NLSLID +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  1131  RFIEANLSLIDNHSRPWFHNVSAMEWLSFRLNILSNFVFAFSLVLLVSLPEGIINPS  1187



>gb|ERN01708.1| hypothetical protein AMTR_s00090p00176020 [Amborella trichopoda]
Length=1480

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL +IA+SIWYQ   I       TARELAR+VG  KAP+  +F+ES+SG  TIR F++E 
Sbjct  1070  FLPVIAVSIWYQQYYIP------TARELARLVGVCKAPIIQYFAESLSGSTTIRSFDKES  1123

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL LID YSR  FYN+  MEWL  R++ L +L F F L+ LV LP   IDP 
Sbjct  1124  RFMTTNLKLIDAYSRPKFYNAGAMEWLCFRLDLLSSLTFAFSLVFLVTLPEGIIDPG  1180



>ref|XP_011621781.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter C family member 
3 [Amborella trichopoda]
Length=1382

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             FL +IA+SIWYQ   I       TARELAR+VG  KAP+  +F+ES+SG  TIR F++E 
Sbjct  972   FLPVIAVSIWYQQYYIP------TARELARLVGVCKAPIIQYFAESLSGSTTIRSFDKES  1025

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL LID YSR  FYN+  MEWL  R++ L +L F F L+ LV LP   IDP 
Sbjct  1026  RFMTTNLKLIDAYSRPKFYNAGAMEWLCFRLDLLSSLTFAFSLVFLVTLPEGIIDPG  1082



>ref|XP_010275360.1| PREDICTED: putative ABC transporter C family member 15 [Nelumbo 
nucifera]
Length=1518

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       T RELAR+ G + AP+ HHF+ES++G  TIR F+QED
Sbjct  1061  FIPVTAICIWYQRYYIP------TGRELARLAGIEGAPILHHFAESLAGAATIRAFDQED  1114

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L+ NLSLID +SR  F+N + MEWLS R+N L NL F F L++LV+LP   I+PS
Sbjct  1115  RFLEANLSLIDNHSRPWFHNVSAMEWLSFRLNMLSNLVFAFSLVLLVSLPEGIINPS  1171



>ref|XP_004968865.1| PREDICTED: ABC transporter C family member 3-like isoform X1 
[Setaria italica]
 ref|XP_004968866.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Setaria italica]
 ref|XP_004968867.1| PREDICTED: ABC transporter C family member 3-like isoform X3 
[Setaria italica]
Length=1447

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -1

Query  515   TTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNLSLIDCYSRVAFYNSA  336
             ++ARELAR+VG +KAPV HHFSE++SG  TIRCFNQ +  L+K+L+L+D YS + F+N+A
Sbjct  1042  SSARELARLVGIKKAPVLHHFSETVSGAATIRCFNQGENFLRKSLALVDDYSCITFHNAA  1101

Query  335   TMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
              +EWL +RINFLFNL F  +L+ILV+LPR  IDPS
Sbjct  1102  AIEWLCLRINFLFNLVFFVMLVILVSLPRDTIDPS  1136



>gb|KGN56661.1| hypothetical protein Csa_3G127230 [Cucumis sativus]
Length=1411

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A  IW+Q      +    TARELAR+ G Q+ P+ HHF+ES++G  TIR FNQED
Sbjct  984   FIPITAACIWFQ------QYYTPTARELARLSGIQRTPILHHFAESLAGAATIRAFNQED  1037

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R LK NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1038  RFLKTNLGLIDDHSRPWFHNVSAMEWLSFRLNLLSNFVFGFSLVLLVTLPEGTINPS  1094



>ref|XP_011621776.1| PREDICTED: ABC transporter C family member 3 isoform X4 [Amborella 
trichopoda]
Length=1044

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +I +SIWYQ   I       TARELAR+VG  +APV  HF+ESISG  TIR F++E 
Sbjct  623  FIPVIVVSIWYQQYYIP------TARELARLVGVCEAPVIQHFAESISGSTTIRSFDKES  676

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +  NL LID YSR  FYN+  +EWL  R++ L  L F F L+ LV LP+  IDP 
Sbjct  677  RFMTTNLKLIDAYSRPKFYNAGAIEWLCFRLDMLSALTFAFSLVFLVTLPKGIIDPG  733



>ref|XP_011621778.1| PREDICTED: ABC transporter C family member 3 isoform X5 [Amborella 
trichopoda]
Length=1230

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +I +SIWYQ   I       TARELAR+VG  +APV  HF+ESISG  TIR F++E 
Sbjct  809  FIPVIVVSIWYQQYYIP------TARELARLVGVCEAPVIQHFAESISGSTTIRSFDKES  862

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +  NL LID YSR  FYN+  +EWL  R++ L  L F F L+ LV LP+  IDP 
Sbjct  863  RFMTTNLKLIDAYSRPKFYNAGAIEWLCFRLDMLSALTFAFSLVFLVTLPKGIIDPG  919



>gb|ERN01707.1| hypothetical protein AMTR_s00090p00174380 [Amborella trichopoda]
Length=1504

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +I +SIWYQ   I       TARELAR+VG  +APV  HF+ESISG  TIR F++E 
Sbjct  1083  FIPVIVVSIWYQQYYIP------TARELARLVGVCEAPVIQHFAESISGSTTIRSFDKES  1136

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL LID YSR  FYN+  +EWL  R++ L  L F F L+ LV LP+  IDP 
Sbjct  1137  RFMTTNLKLIDAYSRPKFYNAGAIEWLCFRLDMLSALTFAFSLVFLVTLPKGIIDPG  1193



>ref|XP_011621775.1| PREDICTED: ABC transporter C family member 3 isoform X3 [Amborella 
trichopoda]
Length=1245

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +I +SIWYQ   I       TARELAR+VG  +APV  HF+ESISG  TIR F++E 
Sbjct  829  FIPVIVVSIWYQQYYIP------TARELARLVGVCEAPVIQHFAESISGSTTIRSFDKES  882

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +  NL LID YSR  FYN+  +EWL  R++ L  L F F L+ LV LP+  IDP 
Sbjct  883  RFMTTNLKLIDAYSRPKFYNAGAIEWLCFRLDMLSALTFAFSLVFLVTLPKGIIDPG  939



>ref|XP_011621779.1| PREDICTED: ABC transporter C family member 3 isoform X6 [Amborella 
trichopoda]
Length=1225

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +I +SIWYQ   I       TARELAR+VG  +APV  HF+ESISG  TIR F++E 
Sbjct  829  FIPVIVVSIWYQQYYIP------TARELARLVGVCEAPVIQHFAESISGSTTIRSFDKES  882

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +  NL LID YSR  FYN+  +EWL  R++ L  L F F L+ LV LP+  IDP 
Sbjct  883  RFMTTNLKLIDAYSRPKFYNAGAIEWLCFRLDMLSALTFAFSLVFLVTLPKGIIDPG  939



>ref|XP_011621774.1| PREDICTED: ABC transporter C family member 3 isoform X1 [Amborella 
trichopoda]
Length=1257

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +I +SIWYQ   I       TARELAR+VG  +APV  HF+ESISG  TIR F++E 
Sbjct  829  FIPVIVVSIWYQQYYIP------TARELARLVGVCEAPVIQHFAESISGSTTIRSFDKES  882

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +  NL LID YSR  FYN+  +EWL  R++ L  L F F L+ LV LP+  IDP 
Sbjct  883  RFMTTNLKLIDAYSRPKFYNAGAIEWLCFRLDMLSALTFAFSLVFLVTLPKGIIDPG  939



>ref|XP_006839138.2| PREDICTED: ABC transporter C family member 3 isoform X2 [Amborella 
trichopoda]
Length=1250

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +I +SIWYQ   I       TARELAR+VG  +APV  HF+ESISG  TIR F++E 
Sbjct  829  FIPVIVVSIWYQQYYIP------TARELARLVGVCEAPVIQHFAESISGSTTIRSFDKES  882

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +  NL LID YSR  FYN+  +EWL  R++ L  L F F L+ LV LP+  IDP 
Sbjct  883  RFMTTNLKLIDAYSRPKFYNAGAIEWLCFRLDMLSALTFAFSLVFLVTLPKGIIDPG  939



>ref|XP_007008721.1| Multidrug resistance protein ABC transporter family [Theobroma 
cacao]
 gb|EOY17531.1| Multidrug resistance protein ABC transporter family [Theobroma 
cacao]
Length=1511

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR F+QE+
Sbjct  1085  FIPVTAICIWYQQYYIP------TARELARLAGIQRAPILHHFAESLAGAATIRAFDQEN  1138

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1139  RFIDANLGLIDNHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLVVLVTLPEGIINPS  1195



>ref|XP_010691208.1| PREDICTED: ABC transporter C family member 3-like [Beta vulgaris 
subsp. vulgaris]
Length=1495

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAIS+WYQ   I S      AREL R+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1072  FIPVIAISLWYQQYYIPS------ARELCRLVGLTKAPVIQHFAETISGATTIRSFDQES  1125

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +K ++ L++ YSR  FYN+A MEWL +R++ L ++ F   LI L+++P   IDP 
Sbjct  1126  RFVKTSVKLVNGYSRPKFYNAAAMEWLCIRLDLLSSITFAASLIFLISIPVGLIDPG  1182



>gb|KCW73258.1| hypothetical protein EUGRSUZ_E01719 [Eucalyptus grandis]
Length=1412

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G Q+AP+ HHF ES+ G  TIR FNQED
Sbjct  986   FIPVTAICIWYQQYYIP------TARELARLSGIQRAPILHHFGESLVGAATIRAFNQED  1039

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL L+D +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  1040  RFSDGNLGLVDNHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLVLLVSLPEGIINPS  1096



>gb|EYU42306.1| hypothetical protein MIMGU_mgv1a019873mg, partial [Erythranthe 
guttata]
Length=1403

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G ++AP+ HHF+ES++G  TIR FNQ++
Sbjct  978   FIPVTAICIWYQQYYIP------TARELARLAGIERAPILHHFAESLTGAATIRAFNQQE  1031

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSLID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1032  RFTDANLSLIDNHSRPWFHNVSAMEWLSFRLNQLANFVFAFSLVLLVTLPEGIINPS  1088



>ref|XP_010056490.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010056491.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Eucalyptus grandis]
Length=1517

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G Q+AP+ HHF ES+ G  TIR FNQED
Sbjct  1091  FIPVTAICIWYQQYYIP------TARELARLSGIQRAPILHHFGESLVGAATIRAFNQED  1144

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL L+D +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  1145  RFSDGNLGLVDNHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLVLLVSLPEGIINPS  1201



>ref|XP_009589885.1| PREDICTED: putative ABC transporter C family member 15 [Nicotiana 
tomentosiformis]
Length=1473

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A+ +WYQ   I       TARELAR+ G Q+AP+ HHF+ES+SG  TIR FNQ+D
Sbjct  1054  FIPITAVYVWYQQYYIP------TARELARLSGVQRAPILHHFAESLSGAATIRAFNQKD  1107

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSLID +SR  F+N +  EWLS R+N L    F F L++LV LP   I+PS
Sbjct  1108  RFAHANLSLIDGHSRPWFHNISAQEWLSFRLNQLSTFVFAFFLVLLVTLPEGIINPS  1164



>ref|XP_006341341.1| PREDICTED: ABC transporter C family member 9-like [Solanum tuberosum]
Length=1494

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 8/120 (7%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQ+D
Sbjct  1068  FIPVTAVCIWYQQYYIP------TARELARLYGVQRAPILHHFAESLAGAATIRAFNQKD  1121

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPSKCI  222
             R    NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+P  CI
Sbjct  1122  RFAHANLCLIDGHSRPWFHNVSAMEWLSFRLNQLANFVFAFSLVLLVTLPEGIINP--CI  1179



>ref|XP_008438239.1| PREDICTED: putative ABC transporter C family member 15 [Cucumis 
melo]
Length=1522

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I    IW+Q      +    TARELAR+ G Q+ P+ HHF+ES++G  TIR FNQED
Sbjct  1095  FIPITVACIWFQ------QYYTPTARELARLSGIQRTPILHHFAESLAGAATIRAFNQED  1148

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R LK NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1149  RFLKTNLGLIDDHSRPWFHNVSAMEWLSFRLNLLSNFVFGFSLVLLVTLPEGTINPS  1205



>ref|XP_011469557.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=1476

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR F+QED
Sbjct  1050  FIPVTAVCIWYQQYYIP------TARELARLSGIQRAPILHHFAESLAGAATIRAFDQED  1103

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1104  RFSDANLHLIDNHSRPWFHNVSAMEWLSFRLNILSNFVFAFSLVLLVTLPEGVINPS  1160



>gb|KHG04748.1| ABC transporter C family member 9 [Gossypium arboreum]
 gb|KHG09574.1| ABC transporter C family member 9 [Gossypium arboreum]
Length=1512

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 79/117 (68%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI +WYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR F+QE+
Sbjct  1087  FIPVTAICLWYQQYYIP------TARELARLAGIQRAPILHHFAESLAGAATIRAFDQEN  1140

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL LID +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  1141  RFINANLGLIDNHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLVVLVSLPDGIINPS  1197



>ref|XP_009586976.1| PREDICTED: putative ABC transporter C family member 15 [Nicotiana 
tomentosiformis]
Length=1507

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQ+D
Sbjct  1081  FIPVTAVCIWYQQYYIP------TARELARLSGVQRAPILHHFAESLAGAATIRAFNQKD  1134

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1135  RFALANLCLIDGHSRPWFHNVSAMEWLSFRLNQLSNFVFAFSLVLLVTLPEGIINPS  1191



>ref|XP_004307284.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=1514

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR F+QED
Sbjct  1088  FIPVTAVCIWYQQYYIP------TARELARLSGIQRAPILHHFAESLAGAATIRAFDQED  1141

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1142  RFSDANLHLIDNHSRPWFHNVSAMEWLSFRLNILSNFVFAFSLVLLVTLPEGVINPS  1198



>ref|XP_010058572.1| PREDICTED: putative ABC transporter C family member 15 [Eucalyptus 
grandis]
Length=1469

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -1

Query  512   TARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNLSLIDCYSRVAFYNSAT  333
             TARELAR+ G Q+AP+ HHF+ESI+G  TIR F+QEDR    NL L+D +SR  FYN +T
Sbjct  1061  TARELARLSGIQRAPILHHFAESIAGAATIRAFDQEDRFTGGNLGLVDNHSRPWFYNVST  1120

Query  332   MEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             MEWLS R++ L N  F F L++LV+LP   IDPS
Sbjct  1121  MEWLSFRLDLLSNFVFAFSLVLLVSLPEGIIDPS  1154



>ref|XP_009783346.1| PREDICTED: putative ABC transporter C family member 15 [Nicotiana 
sylvestris]
Length=1507

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ +WYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQ+D
Sbjct  1081  FIPVTAVCVWYQQYYIP------TARELARLSGVQRAPILHHFAESLAGAATIRAFNQKD  1134

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1135  RFALANLCLIDGHSRPWFHNVSAMEWLSFRLNQLSNFVFAFSLVLLVTLPEGIINPS  1191



>emb|CBI16747.3| unnamed protein product [Vitis vinifera]
Length=1109

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ + AI IWYQ   I       TAREL R+   Q++P+ HHFSES+SG  TIR F+QED
Sbjct  684  FIPVTAICIWYQQYYIP------TARELGRLASIQQSPILHHFSESLSGAATIRAFDQED  737

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +  NL L+D +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  738  RFIHANLDLVDNFSRPWFHNVSAMEWLSFRLNVLSNFVFAFSLVLLVSLPEGIINPS  794



>ref|XP_009768406.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Nicotiana sylvestris]
Length=1473

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A+ +WYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQ+D
Sbjct  1054  FIPITAVYVWYQQYYIP------TARELARLSGVQRAPILHHFAESLAGAATIRAFNQKD  1107

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSLID +SR  F+N +  EWLS R+N L    F F L++LV LP   I+PS
Sbjct  1108  RFAHANLSLIDGHSRPWFHNISAQEWLSFRLNQLSTFVFAFFLVLLVTLPEGIINPS  1164



>ref|XP_010661444.1| PREDICTED: putative ABC transporter C family member 15 [Vitis 
vinifera]
Length=1510

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TAREL R+   Q++P+ HHFSES+SG  TIR F+QED
Sbjct  1085  FIPVTAICIWYQQYYIP------TARELGRLASIQQSPILHHFSESLSGAATIRAFDQED  1138

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL L+D +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  1139  RFIHANLDLVDNFSRPWFHNVSAMEWLSFRLNVLSNFVFAFSLVLLVSLPEGIINPS  1195



>ref|XP_009768405.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Nicotiana sylvestris]
Length=1500

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A+ +WYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQ+D
Sbjct  1081  FIPITAVYVWYQQYYIP------TARELARLSGVQRAPILHHFAESLAGAATIRAFNQKD  1134

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSLID +SR  F+N +  EWLS R+N L    F F L++LV LP   I+PS
Sbjct  1135  RFAHANLSLIDGHSRPWFHNISAQEWLSFRLNQLSTFVFAFFLVLLVTLPEGIINPS  1191



>ref|XP_008438245.1| PREDICTED: putative ABC transporter C family member 15 [Cucumis 
melo]
Length=1512

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 6/121 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A  IWYQ           TARE+ R+ G  ++P+ HHF+ES++G  TIR FNQED
Sbjct  1087  FIPITAACIWYQ------HYYTPTAREIGRLSGIHQSPIMHHFAESLAGAATIRAFNQED  1140

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPSKCI  222
             R    NL LID +S+  F+N++ MEWLS R+N L +  F F L++LV LP   IDPS   
Sbjct  1141  RFFNTNLRLIDGFSKTWFHNNSVMEWLSFRLNMLSHFVFAFSLVLLVTLPEGIIDPSNAG  1200

Query  221   L  219
             L
Sbjct  1201  L  1201



>ref|XP_010327295.1| PREDICTED: ABC transporter C family member 9-like isoform X3 
[Solanum lycopersicum]
Length=972

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ + A+ IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQ+D
Sbjct  552  FIPVTAVCIWYQQYYIP------TARELARLYGVQRAPILHHFAESLAGATTIRAFNQKD  605

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    NL LID +SR  F+N + MEWL  R+N L N  F F L++LV LP   I+PS
Sbjct  606  RFAHANLCLIDGHSRPWFHNVSAMEWLYFRLNQLANFVFAFSLVLLVTLPEGIINPS  662



>ref|XP_010327294.1| PREDICTED: ABC transporter C family member 9-like isoform X2 
[Solanum lycopersicum]
Length=994

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ + A+ IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQ+D
Sbjct  574  FIPVTAVCIWYQQYYIP------TARELARLYGVQRAPILHHFAESLAGATTIRAFNQKD  627

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    NL LID +SR  F+N + MEWL  R+N L N  F F L++LV LP   I+PS
Sbjct  628  RFAHANLCLIDGHSRPWFHNVSAMEWLYFRLNQLANFVFAFSLVLLVTLPEGIINPS  684



>ref|XP_010327296.1| PREDICTED: ABC transporter C family member 9-like isoform X4 
[Solanum lycopersicum]
Length=960

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ + A+ IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQ+D
Sbjct  540  FIPVTAVCIWYQQYYIP------TARELARLYGVQRAPILHHFAESLAGATTIRAFNQKD  593

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    NL LID +SR  F+N + MEWL  R+N L N  F F L++LV LP   I+PS
Sbjct  594  RFAHANLCLIDGHSRPWFHNVSAMEWLYFRLNQLANFVFAFSLVLLVTLPEGIINPS  650



>ref|XP_004248540.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Solanum lycopersicum]
Length=1491

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR FNQ+D
Sbjct  1071  FIPVTAVCIWYQQYYIP------TARELARLYGVQRAPILHHFAESLAGATTIRAFNQKD  1124

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LID +SR  F+N + MEWL  R+N L N  F F L++LV LP   I+PS
Sbjct  1125  RFAHANLCLIDGHSRPWFHNVSAMEWLYFRLNQLANFVFAFSLVLLVTLPEGIINPS  1181



>ref|XP_010252733.1| PREDICTED: ABC transporter C family member 3-like isoform X3 
[Nelumbo nucifera]
Length=1112

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IA  IWYQ   IS      TARELAR+VG  KAPV  +FSESISG  TIR F+QE 
Sbjct  691  FIPVIATCIWYQHYYIS------TARELARLVGVCKAPVIQYFSESISGSTTIRGFDQEL  744

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +  NL LID YSR  F+ +A MEWL  R++ L ++ F F LI L+++P   IDP 
Sbjct  745  RFMDTNLKLIDAYSRPKFHVAAAMEWLCFRLDMLSSITFAFSLIFLISVPEGVIDPG  801



>ref|XP_010252732.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Nelumbo nucifera]
Length=1245

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IA  IWYQ   IS      TARELAR+VG  KAPV  +FSESISG  TIR F+QE 
Sbjct  824  FIPVIATCIWYQHYYIS------TARELARLVGVCKAPVIQYFSESISGSTTIRGFDQEL  877

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +  NL LID YSR  F+ +A MEWL  R++ L ++ F F LI L+++P   IDP 
Sbjct  878  RFMDTNLKLIDAYSRPKFHVAAAMEWLCFRLDMLSSITFAFSLIFLISVPEGVIDPG  934



>ref|XP_010252731.1| PREDICTED: ABC transporter C family member 3-like isoform X1 
[Nelumbo nucifera]
Length=1499

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   IS      TARELAR+VG  KAPV  +FSESISG  TIR F+QE 
Sbjct  1078  FIPVIATCIWYQHYYIS------TARELARLVGVCKAPVIQYFSESISGSTTIRGFDQEL  1131

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL LID YSR  F+ +A MEWL  R++ L ++ F F LI L+++P   IDP 
Sbjct  1132  RFMDTNLKLIDAYSRPKFHVAAAMEWLCFRLDMLSSITFAFSLIFLISVPEGVIDPG  1188



>gb|KCW73259.1| hypothetical protein EUGRSUZ_E01720, partial [Eucalyptus grandis]
Length=1469

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I      TTARELAR+ GTQ+AP+ HHF+ESI+G  TIR F++ED
Sbjct  1085  FIPVTAICIWYQQYYI------TTARELARISGTQQAPILHHFAESIAGAATIRAFDRED  1138

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL L+D +SR  F+  + MEWLS R+N L N  F F L++LV+LP   I PS
Sbjct  1139  RFTDGNLGLVDNHSRPWFHLVSAMEWLSFRLNLLSNSVFAFALLLLVSLPEGIIIPS  1195



>ref|XP_010058571.1| PREDICTED: putative ABC transporter C family member 15 [Eucalyptus 
grandis]
Length=1517

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I      TTARELAR+ GTQ+AP+ HHF+ESI+G  TIR F++ED
Sbjct  1091  FIPVTAICIWYQQYYI------TTARELARISGTQQAPILHHFAESIAGAATIRAFDRED  1144

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL L+D +SR  F+  + MEWLS R+N L N  F F L++LV+LP   I PS
Sbjct  1145  RFTDGNLGLVDNHSRPWFHLVSAMEWLSFRLNLLSNSVFAFALLLLVSLPEGIIIPS  1201



>emb|CDP09357.1| unnamed protein product [Coffea canephora]
Length=1508

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G  TIR F+Q+ 
Sbjct  1082  FIPVTAICIWYQRYYIP------TARELARLAGIQRAPILHHFAESLAGAATIRAFDQKC  1135

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   IDPS
Sbjct  1136  RFIDSNLCLIDNHSRPWFHNVSAMEWLSFRLNQLSNFVFAFSLVLLVTLPDGIIDPS  1192



>ref|XP_008438240.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Cucumis melo]
Length=1531

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A  IW+Q      +    TARELAR+ G ++ P+ HHF+ES+SG  TIR F+QED
Sbjct  1104  FIPITAACIWFQ------QYYTPTARELARLSGIRQTPILHHFAESLSGAATIRAFDQED  1157

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  K NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1158  RFFKTNLGLIDDFSRPWFHNVSAMEWLSFRLNVLSNFVFGFSLVLLVTLPEGIINPS  1214



>ref|XP_008438242.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X3 [Cucumis melo]
Length=1397

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A  IW+Q      +    TARELAR+ G ++ P+ HHF+ES+SG  TIR F+QED
Sbjct  1104  FIPITAACIWFQ------QYYTPTARELARLSGIRQTPILHHFAESLSGAATIRAFDQED  1157

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  K NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1158  RFFKTNLGLIDDFSRPWFHNVSAMEWLSFRLNVLSNFVFGFSLVLLVTLPEGIINPS  1214



>gb|KJB74445.1| hypothetical protein B456_011G295700 [Gossypium raimondii]
Length=1512

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI +WYQ   I       TARELAR+ G Q+AP+ HHF+ES++G   IR F+QE+
Sbjct  1087  FIPVTAICLWYQQYYIP------TARELARLAGIQRAPILHHFAESLAGAAAIRAFDQEN  1140

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL LID +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  1141  RFIHANLGLIDNHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLVVLVSLPDGIINPS  1197



>ref|XP_011650822.1| PREDICTED: putative ABC transporter C family member 15 [Cucumis 
sativus]
 gb|KGN56660.1| hypothetical protein Csa_3G127220 [Cucumis sativus]
Length=1531

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A  IW+Q      +    TARELAR+ G ++ P+ HHF+ES+SG  TIR F+QED
Sbjct  1104  FIPITAACIWFQ------QYYTPTARELARLSGIRQTPILHHFAESLSGAATIRAFDQED  1157

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  K NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1158  RFFKTNLGLIDDFSRPWFHNVSAMEWLSFRLNVLSNFVFGFSLVLLVTLPEGIINPS  1214



>ref|XP_009336837.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Pyrus x bretschneideri]
Length=1518

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G ++AP+ HHF+ES++G  TIR F+Q++
Sbjct  1085  FIPVTAICIWYQRYYIP------TARELARLSGIERAPILHHFAESLAGAATIRAFDQQE  1138

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSLID +SR  F+N + MEWLS R+N L N  F F LI+LV LP   I+PS
Sbjct  1139  RFSDSNLSLIDNHSRPWFHNMSAMEWLSFRLNLLSNFVFAFSLILLVTLPEGVINPS  1195



>ref|XP_008438241.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Cucumis melo]
Length=1435

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A  IW+Q      +    TARELAR+ G ++ P+ HHF+ES+SG  TIR F+QED
Sbjct  1104  FIPITAACIWFQ------QYYTPTARELARLSGIRQTPILHHFAESLSGAATIRAFDQED  1157

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  K NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1158  RFFKTNLGLIDDFSRPWFHNVSAMEWLSFRLNVLSNFVFGFSLVLLVTLPEGIINPS  1214



>ref|XP_009336835.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336836.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Pyrus x bretschneideri]
Length=1518

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G ++AP+ HHF+ES++G  TIR F+Q++
Sbjct  1085  FIPVTAICIWYQRYYIP------TARELARLSGIERAPILHHFAESLAGAATIRAFDQQE  1138

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSLID +SR  F+N + MEWLS R+N L N  F F LI+LV LP   I+PS
Sbjct  1139  RFSDSNLSLIDNHSRPWFHNMSAMEWLSFRLNLLSNFVFAFSLILLVTLPEGVINPS  1195



>ref|XP_008375707.1| PREDICTED: putative ABC transporter C family member 15 [Malus 
domestica]
Length=1509

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G ++AP+ HHF+ES++G  TIR F+Q++
Sbjct  1085  FIPVTAICIWYQRYYIP------TARELARLSGIERAPILHHFAESLAGAATIRAFDQQE  1138

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSLID +SR  F+N + MEWLS R+N L N  F F LI+LV LP   I+PS
Sbjct  1139  RFSDSNLSLIDNHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLILLVTLPEGVINPS  1195



>emb|CAN75340.1| hypothetical protein VITISV_007527 [Vitis vinifera]
Length=1458

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   ISS      ARELAR+VG  KAPV  HFSE+ISG  TIR F+QE 
Sbjct  1040  FVPMIATCIWYQRYYISS------ARELARLVGVCKAPVIQHFSETISGSTTIRSFDQES  1093

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ LID Y+R  F ++A MEWL  R++ L ++ F F L+ L+++P  AIDP 
Sbjct  1094  RFRDTNMKLIDGYTRPKFNSAAAMEWLCFRLDVLSSITFAFSLVFLISIPEGAIDPG  1150



>emb|CBI26749.3| unnamed protein product [Vitis vinifera]
Length=1269

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IA  IWYQ   ISS      ARELAR+VG  KAPV  HFSE+ISG  TIR F+QE 
Sbjct  851  FVPMIATCIWYQRYYISS------ARELARLVGVCKAPVIQHFSETISGSTTIRSFDQES  904

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ LID Y+R  F ++A MEWL  R++ L ++ F F L+ L+++P  AIDP 
Sbjct  905  RFRDTNMKLIDGYTRPKFNSAAAMEWLCFRLDVLSSITFAFSLVFLISIPEGAIDPG  961



>ref|XP_002265605.2| PREDICTED: ABC transporter C family member 3-like [Vitis vinifera]
Length=1485

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   ISS      ARELAR+VG  KAPV  HFSE+ISG  TIR F+QE 
Sbjct  1067  FVPMIATCIWYQRYYISS------ARELARLVGVCKAPVIQHFSETISGSTTIRSFDQES  1120

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ LID Y+R  F ++A MEWL  R++ L ++ F F L+ L+++P  AIDP 
Sbjct  1121  RFRDTNMKLIDGYTRPKFNSAAAMEWLCFRLDVLSSITFAFSLVFLISIPEGAIDPG  1177



>ref|XP_011012376.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X2 [Populus euphratica]
Length=1492

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ IWYQ      +    TARELAR+ G Q+AP+ HHFSES++G  TIR F+Q++
Sbjct  1066  FIPVTAVCIWYQ------QYYTPTARELARLAGIQQAPILHHFSESLAGAATIRAFDQQE  1119

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LID +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I PS
Sbjct  1120  RFYCSNLDLIDNHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLVLLVSLPEGVISPS  1176



>ref|XP_011012375.1| PREDICTED: putative ABC transporter C family member 15 isoform 
X1 [Populus euphratica]
Length=1508

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ IWYQ      +    TARELAR+ G Q+AP+ HHFSES++G  TIR F+Q++
Sbjct  1082  FIPVTAVCIWYQ------QYYTPTARELARLAGIQQAPILHHFSESLAGAATIRAFDQQE  1135

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LID +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I PS
Sbjct  1136  RFYCSNLDLIDNHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLVLLVSLPEGVISPS  1192



>gb|EPS64027.1| multidrug resistance-associated protein, partial [Genlisea aurea]
Length=692

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 6/121 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +I IS+W Q   ISS      ARELAR+ G +KAP+  HFSE++SG +TIR F+Q++
Sbjct  274  FIPVIGISLWLQRYYISS------ARELARLSGIRKAPLIQHFSETLSGSITIRSFDQQE  327

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPSKCI  222
            R  +  + LID YSR  F+ +  MEWLS+R++ L  + F F L+ LV++P   IDPS   
Sbjct  328  RFRRLGMKLIDDYSRPKFHTAGAMEWLSIRLDVLSLIAFAFSLVFLVSVPEGTIDPSAAG  387

Query  221  L  219
            L
Sbjct  388  L  388



>ref|XP_010691202.1| PREDICTED: ABC transporter C family member 3-like [Beta vulgaris 
subsp. vulgaris]
Length=1494

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAIS+WYQ   I S      AREL R+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1071  FIPVIAISLWYQQYYIPS------ARELCRLVGLTKAPVIQHFAETISGATTIRSFDQES  1124

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +K ++ L++ +SR  FYN+A  EWL +R++ L ++ F   LI L+++P   IDP 
Sbjct  1125  RFVKTSVKLVNGFSRPKFYNAAATEWLCIRLDLLSSITFAASLIFLISIPVGLIDPG  1181



>emb|CDY71198.1| BnaCnng71820D, partial [Brassica napus]
Length=506

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HF+E+ISG  TIR FNQE 
Sbjct  86   FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFAETISGSTTIRSFNQES  139

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L D YSR  FY++  MEWL  R++ L +L F F L+ L+++P   IDPS
Sbjct  140  RFRGDNMRLSDGYSRPKFYSAGAMEWLCFRLDMLSSLTFAFSLVFLISIPTGVIDPS  196



>ref|XP_006452549.1| hypothetical protein CICLE_v10007245mg [Citrus clementina]
 gb|ESR65789.1| hypothetical protein CICLE_v10007245mg [Citrus clementina]
Length=1466

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (68%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   ISS      AREL+R+VG  KAP+  HF+E++SG  TIR F+QE 
Sbjct  1044  FIPVIATCIWYQQYYISS------ARELSRLVGVCKAPLIQHFAETVSGSTTIRSFDQES  1097

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  N+ L+D YSR  F+ +A MEWL +R++ L N+ F F L+ L+++P+  IDP+
Sbjct  1098  RFIDTNMELMDGYSRPTFHVAAAMEWLGLRLDMLSNITFAFSLVFLISIPKGFIDPA  1154



>ref|XP_006474927.1| PREDICTED: ABC transporter C family member 3-like isoform X1 
[Citrus sinensis]
 ref|XP_006474928.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Citrus sinensis]
Length=1495

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (68%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   ISS      AREL+R+VG  KAP+  HF+E++SG  TIR F+QE 
Sbjct  1073  FIPVIATCIWYQQYYISS------ARELSRLVGVCKAPLIQHFAETVSGSTTIRSFDQES  1126

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  N+ L+D YSR  F+ +A MEWL +R++ L N+ F F L+ L+++P+  IDP+
Sbjct  1127  RFIDTNMELMDGYSRPTFHVAAAMEWLGLRLDMLSNITFAFSLVFLISIPKGFIDPA  1183



>gb|EPS69672.1| hypothetical protein M569_05085, partial [Genlisea aurea]
Length=1366

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI I YQ      +    TARELAR+ G Q++P+ HHF+ES+SG  TIR FN + 
Sbjct  979   FIPVTAICILYQ------RYYNPTARELARLAGNQRSPILHHFAESLSGAATIRAFNDQK  1032

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NLSLID +SR  F+N A MEWLS R+N L N  F   L++LV+LP   I PS
Sbjct  1033  RFIDGNLSLIDNHSRSWFHNVAAMEWLSFRLNQLSNFVFASSLVLLVSLPEGIISPS  1089



>ref|XP_011650823.1| PREDICTED: putative ABC transporter C family member 15 [Cucumis 
sativus]
 gb|KGN56657.1| hypothetical protein Csa_3G127200 [Cucumis sativus]
Length=1504

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 75/121 (62%), Gaps = 6/121 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A  IWYQ           TARE+ R+ G  ++P+ HHF+ES++G  TIR FNQE+
Sbjct  1078  FIPVTAACIWYQ------HYYTPTAREIGRLSGIHQSPIMHHFAESLAGAATIRAFNQEE  1131

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPSKCI  222
             R    NL L+D +S+  F+N++ MEWLS R+N L +  F F L++LV LP   IDPS   
Sbjct  1132  RFFNTNLRLVDGFSKTWFHNNSVMEWLSFRLNVLSHFVFAFSLVLLVTLPEGIIDPSNAG  1191

Query  221   L  219
             L
Sbjct  1192  L  1192



>ref|XP_009385264.1| PREDICTED: putative ABC transporter C family member 15 [Musa 
acuminata subsp. malaccensis]
Length=1540

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+   QKAP+ HHF ES+SG VTIR F Q+D
Sbjct  1115  FIPVTAICIWYQQYYIP------TARELARLSEIQKAPILHHFGESLSGAVTIRAFGQKD  1168

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSLID +SR  F+N + +EWLS R+N L N  F F LI+LVNLP   ++PS
Sbjct  1169  RFSNTNLSLIDNHSRPWFHNISAVEWLSFRLNLLSNFVFAFSLIVLVNLPEGFLNPS  1225



>ref|XP_006452548.1| hypothetical protein CICLE_v10007266mg [Citrus clementina]
 gb|ESR65788.1| hypothetical protein CICLE_v10007266mg [Citrus clementina]
Length=1255

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IA+SIWYQ   I S      AREL+R+VG  KAPV  HFSE+ISG  TIR F+QE 
Sbjct  835  FIPVIAVSIWYQQYYIPS------ARELSRLVGVCKAPVIQHFSETISGSTTIRSFDQES  888

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L+D YSR  F+ +  MEWL  R++ L +L F F L++L+++P+  I+P+
Sbjct  889  RFRDTNMKLVDGYSRPKFHIAGAMEWLCFRLDMLSSLTFAFSLVLLISIPKGVIEPA  945



>gb|KDO62253.1| hypothetical protein CISIN_1g000452mg [Citrus sinensis]
Length=1495

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   ISS      AREL+R+VG  KAP+  HF+E++SG  TIR F+QE 
Sbjct  1073  FIPVIATCIWYQQYYISS------ARELSRLVGVCKAPLIQHFAETVSGSTTIRSFDQES  1126

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  N+ L+D YSR  F+ +A MEWL  R++ L N+ F F L+ L+++P+  IDP+
Sbjct  1127  RFIDTNMELMDGYSRPTFHVAAAMEWLGFRLDMLSNITFAFSLVFLISIPKGFIDPA  1183



>ref|XP_006474929.1| PREDICTED: ABC transporter C family member 3-like [Citrus sinensis]
Length=1492

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 78/117 (67%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA+SIWYQ   I S      AREL+R+VG  KAPV  HFSE+ISG  TIR F+QE 
Sbjct  1072  FIPVIAVSIWYQQYYIPS------ARELSRLVGVCKAPVIQHFSETISGSTTIRSFDQES  1125

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L+D YSR  F+ +  MEWL  R++ L +L F F L++L+++P+  I+P+
Sbjct  1126  RFRDTNMKLVDGYSRPKFHIAGAMEWLCFRLDMLSSLTFAFSLVLLISIPKGVIEPA  1182



>gb|KJB81653.1| hypothetical protein B456_013G154800 [Gossypium raimondii]
Length=1481

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +I   IWYQ   ISS      ARELAR+VG  KAPV  +FSE+I G  TIR F+QE 
Sbjct  1065  FIPVITTCIWYQQYYISS------ARELARLVGVCKAPVIQNFSETILGATTIRSFDQES  1118

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  +KN+ L+D YSR  FY +  MEWL  R++ L ++ F F L  L+++P+  IDP+
Sbjct  1119  RFQQKNMELMDAYSRPNFYVAGAMEWLCFRLDMLSSITFAFFLFFLISIPKGIIDPA  1175



>emb|CDX82552.1| BnaA03g32690D [Brassica napus]
Length=1231

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HF+E+ISG  TIR FNQE 
Sbjct  811  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFAETISGSTTIRSFNQES  864

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L D YSR  FY++  MEWL  R++ L +L F F L+ L+++P   IDPS
Sbjct  865  RFRGDNMRLSDGYSRPKFYSAGAMEWLCFRLDMLSSLTFAFSLVFLISIPTGVIDPS  921



>ref|XP_006445505.1| hypothetical protein CICLE_v10018481mg [Citrus clementina]
 gb|ESR58745.1| hypothetical protein CICLE_v10018481mg [Citrus clementina]
 gb|KDO85375.1| hypothetical protein CISIN_1g000432mg [Citrus sinensis]
Length=1513

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +  I IWYQ   I       TARELAR+   Q+AP+ HHF+ES++G  TI  F+QED
Sbjct  1087  FIPVTGICIWYQQYYIP------TARELARLAEIQRAPILHHFAESLAGAATIHAFDQED  1140

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSLID +SR  F+N + MEWL  R+N L N  F F L++LV LP   I+PS
Sbjct  1141  RFTNANLSLIDNHSRPWFHNVSAMEWLCFRLNLLSNFVFAFSLVVLVTLPEGIINPS  1197



>ref|XP_008792064.1| PREDICTED: ABC transporter C family member 3-like [Phoenix dactylifera]
Length=1268

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IA  IWYQ   I       TARELAR+VG  KAP+  HF+ES+SG +TIR F  E 
Sbjct  843  FIPVIAACIWYQQYYID------TARELARLVGVCKAPIIQHFAESMSGSMTIRSFGHES  896

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +  N  L D YSR  FYN   MEWL  R++ L +L F F L+ L+++P+  IDP 
Sbjct  897  RFVGTNFHLNDDYSRPEFYNVGAMEWLCFRLDMLSSLTFAFSLVFLISVPKGVIDPG  953



>ref|XP_006464349.1| PREDICTED: ABC transporter C family member 9-like isoform X1 
[Citrus sinensis]
 ref|XP_006464350.1| PREDICTED: ABC transporter C family member 9-like isoform X2 
[Citrus sinensis]
 ref|XP_006464351.1| PREDICTED: ABC transporter C family member 9-like isoform X3 
[Citrus sinensis]
Length=1513

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +  I IWYQ   I       TARELAR+   Q+AP+ HHF+ES++G  TI  F+QED
Sbjct  1087  FIPVTGICIWYQQYYIP------TARELARLAEIQRAPILHHFAESLAGAATIHAFDQED  1140

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSLID +SR  F+N + MEWL  R+N L N  F F L++LV LP   I+PS
Sbjct  1141  RFTNANLSLIDNHSRPWFHNVSAMEWLCFRLNLLSNFVFAFSLVVLVTLPEGIINPS  1197



>ref|XP_008232250.1| PREDICTED: LOW QUALITY PROTEIN: putative ABC transporter C family 
member 15 [Prunus mume]
Length=1479

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ IWYQ   I       TARELAR+ G ++AP+ HHF+ES++G  TIR F+Q++
Sbjct  1053  FIPVTAVCIWYQQYYIP------TARELARLSGIERAPILHHFAESLAGAATIRAFDQKE  1106

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LID +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1107  RFSHTNLILIDNHSRPWFHNMSAMEWLSFRLNLLSNFVFAFSLVLLVTLPEGVINPS  1163



>ref|XP_010487052.1| PREDICTED: ABC transporter C family member 3-like [Camelina sativa]
Length=1527

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HFSE+ISG  TIR F+QE 
Sbjct  1107  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFSETISGATTIRSFSQES  1160

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY +  MEWL  R++ L +L F+F L+ LV++P   IDPS
Sbjct  1161  RFRADNMRLSDGYSRPKFYTAGAMEWLCFRLDMLSSLTFVFSLVFLVSIPTGVIDPS  1217



>ref|XP_002884941.1| ATMRP3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61200.1| ATMRP3 [Arabidopsis lyrata subsp. lyrata]
Length=1516

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HFSE+ISG  TIR F+QE 
Sbjct  1096  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFSETISGATTIRSFSQES  1149

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY +  MEWL  R++ L +L F+F L+ LV++P   IDPS
Sbjct  1150  RFRSDNMRLSDGYSRPKFYTAGAMEWLCFRLDMLSSLTFVFSLVFLVSIPTGVIDPS  1206



>gb|KCW68426.1| hypothetical protein EUGRSUZ_F020791, partial [Eucalyptus grandis]
Length=711

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IAI +WYQ   ISS      AREL+R+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  290  FIPVIAICVWYQQYYISS------ARELSRLVGVCKAPVIQHFAETISGATTIRSFDQES  343

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L D YSR  F+ +  MEWL  R++ L ++ F F LI LV++P   IDP+
Sbjct  344  RFQDTNMKLADGYSRPKFHIAGAMEWLCFRLDMLSSIIFGFSLIFLVSVPEGFIDPA  400



>ref|XP_006296826.1| hypothetical protein CARUB_v10012811mg [Capsella rubella]
 gb|EOA29724.1| hypothetical protein CARUB_v10012811mg [Capsella rubella]
Length=1513

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HFSE+ISG  TIR F+QE 
Sbjct  1093  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFSETISGATTIRSFSQES  1146

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY +  MEWL  R++ L +L F+F L+ LV++P   IDPS
Sbjct  1147  RFRSDNMRLSDGYSRPKFYTAGAMEWLCFRLDMLSSLTFVFSLVFLVSIPTGVIDPS  1203



>ref|XP_002888830.1| hypothetical protein ARALYDRAFT_894982 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65089.1| hypothetical protein ARALYDRAFT_894982 [Arabidopsis lyrata subsp. 
lyrata]
Length=1017

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HFSE+ISG  TIR F+QE 
Sbjct  618  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFSETISGATTIRGFSQES  671

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L D YSR  FY +  MEWL  R+  L +L F+F L++LV+LP   IDPS
Sbjct  672  RFRSDNMRLSDGYSRPKFYKAGAMEWLCFRLEMLSSLTFVFPLVVLVSLPTGVIDPS  728



>ref|XP_010544544.1| PREDICTED: putative ABC transporter C family member 15 [Tarenaya 
hassleriana]
Length=1502

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (68%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ +WYQ      +    TARELAR+ G Q+AP+ HHF+ESI+G  TIR F+Q +
Sbjct  1076  FIPVAAVCVWYQ------RYYTPTARELARISGVQRAPILHHFAESIAGATTIRAFDQRE  1129

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL+LID +SR  F+  ++MEWLS R+N L +  F+F L++LV LP   I+PS
Sbjct  1130  RFINSNLALIDNHSRPWFHVISSMEWLSFRLNLLSHFVFVFSLVLLVTLPEGVINPS  1186



>ref|XP_010552378.1| PREDICTED: ABC transporter C family member 3 [Tarenaya hassleriana]
Length=1509

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      ARELAR++G  KAP+  HF+E+ISG  TIR F+QE 
Sbjct  1089  FIPVVAASIWYQRYYIAA------ARELARLIGVCKAPLIQHFAETISGSTTIRSFDQES  1142

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY++  MEWL  R++ L +L F F LI L+++P   IDPS
Sbjct  1143  RFRSDNMRLSDGYSRPKFYSAGAMEWLCFRLDMLSSLTFAFSLIFLISIPTGVIDPS  1199



>ref|XP_010919852.1| PREDICTED: LOW QUALITY PROTEIN: putative ABC transporter C family 
member 15 [Elaeis guineensis]
Length=1525

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G Q+AP+ HHF+ES++G   IR F QE 
Sbjct  1096  FIPVTAICIWYQQYYIP------TARELARLSGIQRAPILHHFAESLAGAAAIRAFRQEI  1149

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NLSL+D +SR  F+N + MEWLS R+N L N  F F LI+LV+LP   I+PS
Sbjct  1150  RFSNANLSLVDNHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLILLVSLPEGFINPS  1206



>ref|XP_007217911.1| hypothetical protein PRUPE_ppa017819m3g, partial [Prunus persica]
 gb|EMJ19110.1| hypothetical protein PRUPE_ppa017819m3g, partial [Prunus persica]
Length=948

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IAI IW Q   I S      ARELAR+VG  KAPV  HF+E+ISG  TIR FNQE 
Sbjct  711  FIPVIAICIWLQQYYIPS------ARELARLVGVCKAPVIQHFAETISGSTTIRSFNQES  764

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L+D Y R  F+ +A MEWL  R++ L ++ F F L+ L+++P   IDP 
Sbjct  765  RFRDTNMKLMDGYGRPKFHTAAAMEWLCFRLDMLSSITFGFCLVFLISIPAGVIDPG  821



>ref|XP_008244538.1| PREDICTED: ABC transporter C family member 3-like isoform X1 
[Prunus mume]
Length=1504

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI IW Q   ISS      ARELAR+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1085  FIPVIAICIWLQQYYISS------ARELARLVGVYKAPVIQHFAETISGSTTIRSFDQES  1138

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L+D Y R  F+ +A MEWL  R++ L ++ F F L+ L+++P   IDP 
Sbjct  1139  RFRDTNMKLMDGYGRPNFHTAAAMEWLCFRLDMLSSITFGFCLVFLISIPAGVIDPG  1195



>ref|XP_004309817.1| PREDICTED: ABC transporter C family member 3-like [Fragaria vesca 
subsp. vesca]
Length=1506

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +I   +WYQ   ISS      ARELAR+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1085  FIPVITACVWYQQYYISS------ARELARLVGVCKAPVIQHFAETISGSTTIRSFDQES  1138

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L+D Y R  FY +  MEWL  R++ L ++ F F L+ L+++P   IDP 
Sbjct  1139  RFRDTNMKLMDGYGRPKFYTAGAMEWLCFRLDVLSSITFAFCLVFLISVPEGVIDPG  1195



>ref|XP_009385266.1| PREDICTED: putative ABC transporter C family member 15 [Musa 
acuminata subsp. malaccensis]
Length=1151

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 75/114 (66%), Gaps = 6/114 (5%)
 Frame = -1

Query  572  IIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLL  393
            + AI IWYQ   I       TARELAR+   QKAP+ HHF ES+SG VTIR F Q+DR  
Sbjct  729  VTAICIWYQQYYIP------TARELARLSEIQKAPILHHFVESLSGAVTIRAFGQKDRFS  782

Query  392  KKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
              NLSLID +SR  F+N + +EWLS R+N L N  F F LI+LVN+P   ++PS
Sbjct  783  NTNLSLIDNHSRPWFHNISALEWLSFRLNLLSNFVFAFSLIVLVNMPEGFLNPS  836



>ref|XP_010061487.1| PREDICTED: ABC transporter C family member 3-like [Eucalyptus 
grandis]
 gb|KCW68429.1| hypothetical protein EUGRSUZ_F02083 [Eucalyptus grandis]
Length=1514

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI +WYQ   ISS      AREL+R+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1093  FIPVIAICVWYQQYYISS------ARELSRLVGVCKAPVIQHFAETISGATTIRSFDQES  1146

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  F+ +  MEWL  R++ L ++ F F LI LV++P   IDP+
Sbjct  1147  RFQDTNMKLADGYSRPKFHIAGAMEWLCFRLDMLSSITFGFSLIFLVSVPEGFIDPA  1203



>ref|XP_010061483.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Eucalyptus grandis]
Length=1383

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI +WYQ   ISS      AREL+R+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1072  FIPVIAICVWYQQYYISS------ARELSRLVGVCKAPVIQHFAETISGATTIRSFDQES  1125

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  F+ +  MEWL  R++ L ++ F F LI LV++P   IDP+
Sbjct  1126  RFQDTNMKLADGYSRPKFHIAGAMEWLCFRLDMLSSIIFGFSLIFLVSVPEGFIDPA  1182



>ref|XP_008244541.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Prunus mume]
Length=1252

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IAI IW Q   ISS      ARELAR+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  832  FIPVIAICIWLQKYYISS------ARELARLVGVCKAPVIQHFAETISGSTTIRSFDQES  885

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L+D Y R  F+ +A MEWL  R++ L ++ F F L+ L+++P   IDP 
Sbjct  886  RFRDTNMKLMDGYGRPKFHTAAAMEWLCFRLDMLSSITFGFCLVFLISIPAGVIDPG  942



>ref|XP_010061482.1| PREDICTED: ABC transporter C family member 3-like isoform X1 
[Eucalyptus grandis]
Length=1493

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI +WYQ   ISS      AREL+R+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1072  FIPVIAICVWYQQYYISS------ARELSRLVGVCKAPVIQHFAETISGATTIRSFDQES  1125

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  F+ +  MEWL  R++ L ++ F F LI LV++P   IDP+
Sbjct  1126  RFQDTNMKLADGYSRPKFHIAGAMEWLCFRLDMLSSIIFGFSLIFLVSVPEGFIDPA  1182



>ref|XP_008227121.1| PREDICTED: ABC transporter C family member 3-like [Prunus mume]
Length=1250

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IAI IW Q   ISS      ARELAR+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  885  FIPVIAICIWLQQYYISS------ARELARLVGVCKAPVIQHFAETISGSTTIRSFDQES  938

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L+D Y R  F+ +A MEWL  R++ L ++ F F L+ L+++P   IDP 
Sbjct  939  RFRDTNMKLMDGYGRPKFHTAAAMEWLCFRLDMLSSITFGFCLVFLISIPAGVIDPG  995



>ref|XP_010552377.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter C family member 
7-like [Tarenaya hassleriana]
Length=1188

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 77/118 (65%), Gaps = 6/118 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA   WYQ   IS+      ARE+ R+ G  ++P+  HFSE++SG+ TIR F+Q+ 
Sbjct  1041  FIPVIAACFWYQQHYISA------AREITRIAGVSRSPLIQHFSETLSGITTIRSFDQKS  1094

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPSK  228
             R  K N+ L DCYSRV F+++   EWLS R++ L  + F   L++LV++P+  I+PS+
Sbjct  1095  RFCKDNMRLSDCYSRVVFHSAGATEWLSFRLDVLCTVAFALSLVLLVSVPQGVINPSE  1152



>ref|XP_008244542.1| PREDICTED: ABC transporter C family member 3-like [Prunus mume]
Length=1325

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI IW Q   ISS      ARELAR+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  905   FIPVIAICIWLQQYYISS------ARELARLVGVCKAPVIQHFAETISGSTTIRSFDQES  958

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L+D Y R  F+ +A MEWL  R++ L ++ F F L+ L+++P   IDP 
Sbjct  959   RFRDTNMKLMDGYGRPNFHTAAAMEWLCFRLDMLSSITFGFCLVFLISIPAGVIDPG  1015



>ref|XP_010691965.1| PREDICTED: putative ABC transporter C family member 15 [Beta 
vulgaris subsp. vulgaris]
Length=1506

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWY+   I       TARELAR+   QKAP+ HHF ES++G  TIR F+Q+D
Sbjct  1080  FIPVTAICIWYKQYYIP------TARELARLSEIQKAPILHHFGESLAGAATIRAFDQKD  1133

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL L+D +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  1134  RFTTANLILVDGFSRPWFHNVSAMEWLSFRLNQLSNFVFAFSLVLLVSLPDGIINPS  1190



>ref|XP_007213725.1| hypothetical protein PRUPE_ppa000355mg [Prunus persica]
 gb|EMJ14924.1| hypothetical protein PRUPE_ppa000355mg [Prunus persica]
Length=1252

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IAI IW Q   ISS      ARELAR+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  832  FIPVIAICIWLQQYYISS------ARELARLVGVCKAPVIQHFAETISGSTTIRSFDQES  885

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L+D Y R  F+ +A MEWL  R++ L ++ F F L+ L+++P   IDP 
Sbjct  886  RFRDTNMKLMDGYGRPNFHTAAAMEWLCFRLDMLSSITFGFCLVFLISIPAGVIDPG  942



>gb|ABG45865.1| multidrug resistance-associated protein 2 [Aegilops tauschii]
Length=641

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 71/117 (61%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IAI +WYQ   I       TAREL RMVG  KAP+  HF ESI+G   IR F +E+
Sbjct  323  FIPVIAICLWYQRYYID------TARELQRMVGICKAPIIQHFVESITGSTIIRSFGKEN  376

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            + L  N  L+D YSR  FYN+  MEWL  R++ L +L F   LI L+NLP   IDP 
Sbjct  377  QFLSTNNQLMDAYSRPKFYNAGAMEWLCFRMDMLSSLTFATSLIFLINLPTGIIDPG  433



>ref|XP_009135285.1| PREDICTED: ABC transporter C family member 3 isoform X1 [Brassica 
rapa]
Length=1479

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+ G  KAP+  HFSE+ISG  TIR FNQE 
Sbjct  1059  FIPVVAASIWYQRYYIAA------ARELSRLDGVCKAPLIQHFSETISGSTTIRSFNQES  1112

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY++  MEWL  R++ L +L F F L+ L+++P   IDPS
Sbjct  1113  RFRGDNMRLSDGYSRPKFYSAGAMEWLCFRLDMLSSLTFAFSLVFLISIPTGVIDPS  1169



>ref|XP_007214002.1| hypothetical protein PRUPE_ppa014637mg, partial [Prunus persica]
 gb|EMJ15201.1| hypothetical protein PRUPE_ppa014637mg, partial [Prunus persica]
Length=1477

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI IW Q   ISS      ARELAR+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1057  FIPVIAICIWLQQYYISS------ARELARLVGVCKAPVIQHFAETISGSTTIRGFDQES  1110

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L+D Y R  F+ +A MEWL  R++ L ++ F F L+ L+++P   IDP 
Sbjct  1111  RFRDTNMKLMDGYGRPKFHTAAAMEWLCFRLDMLSSITFGFCLVFLISIPAGVIDPG  1167



>gb|KHN23859.1| ABC transporter C family member 3 [Glycine soja]
Length=1492

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA+SIWYQ   I S      ARELAR+VG  KAP+  HFSE+ISG  TIR F+Q+ 
Sbjct  1067  FIPVIAVSIWYQQYYIPS------ARELARLVGVCKAPIIQHFSETISGTSTIRSFDQQS  1120

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  + N+ L D YSR  F  +  MEWL  R++ L ++ F F L+ L+++P+  IDP 
Sbjct  1121  RFQETNMKLTDGYSRPKFNIAGAMEWLCFRLDMLSSITFAFSLVFLISIPQGFIDPG  1177



>ref|XP_003545103.1| PREDICTED: ABC transporter C family member 3-like [Glycine max]
Length=1494

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA+SIWYQ   I S      ARELAR+VG  KAP+  HFSE+ISG  TIR F+Q+ 
Sbjct  1069  FIPVIAVSIWYQQYYIPS------ARELARLVGVCKAPIIQHFSETISGTSTIRSFDQQS  1122

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  + N+ L D YSR  F  +  MEWL  R++ L ++ F F L+ L+++P+  IDP 
Sbjct  1123  RFQETNMKLTDGYSRPKFNIAGAMEWLCFRLDMLSSITFAFSLVFLISIPQGFIDPG  1179



>ref|NP_187915.1| ABC transporter C family member 3 [Arabidopsis thaliana]
 sp|Q9LK64.1|AB3C_ARATH RecName: Full=ABC transporter C family member 3; Short=ABC transporter 
ABCC.3; Short=AtABCC3; AltName: Full=ATP-energized 
glutathione S-conjugate pump 3; AltName: Full=Glutathione S-conjugate-transporting 
ATPase 3; AltName: Full=Multidrug resistance-associated 
protein 3 [Arabidopsis thaliana]
 dbj|BAB01399.1| multidrug resistance-associated protein (MRP); ABC-transoprter 
[Arabidopsis thaliana]
 gb|AEE75292.1| ABC transporter C family member 3 [Arabidopsis thaliana]
Length=1514

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HFSE+ISG  TIR F+QE 
Sbjct  1094  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFSETISGATTIRSFSQEF  1147

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY +  MEWL  R++ L +L F+F L+ LV++P   IDPS
Sbjct  1148  RFRSDNMRLSDGYSRPKFYTAGAMEWLCFRLDMLSSLTFVFSLVFLVSIPTGVIDPS  1204



>ref|NP_850575.1| ABC transporter C family member 3 [Arabidopsis thaliana]
 gb|AEE75291.1| ABC transporter C family member 3 [Arabidopsis thaliana]
Length=1489

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HFSE+ISG  TIR F+QE 
Sbjct  1094  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFSETISGATTIRSFSQEF  1147

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY +  MEWL  R++ L +L F+F L+ LV++P   IDPS
Sbjct  1148  RFRSDNMRLSDGYSRPKFYTAGAMEWLCFRLDMLSSLTFVFSLVFLVSIPTGVIDPS  1204



>ref|XP_006847668.2| PREDICTED: putative ABC transporter C family member 15 [Amborella 
trichopoda]
Length=1490

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A  IWYQ      +    TARELAR+ G Q+AP+ HHF+ES++G  TIR F  + 
Sbjct  1069  FIPITATCIWYQ------QYYTPTARELARLAGIQQAPILHHFAESLTGAATIRAFGHDS  1122

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LI+ +SR  FYN + MEWLS R+N L N+ F F L++LV+LP   I+PS
Sbjct  1123  RFANTNLILINDFSRPWFYNVSAMEWLSFRLNILSNIVFAFSLVLLVSLPEGVINPS  1179



>gb|ERN09249.1| hypothetical protein AMTR_s00149p00037740 [Amborella trichopoda]
Length=1510

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ I A  IWYQ      +    TARELAR+ G Q+AP+ HHF+ES++G  TIR F  + 
Sbjct  1089  FIPITATCIWYQ------QYYTPTARELARLAGIQQAPILHHFAESLTGAATIRAFGHDS  1142

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LI+ +SR  FYN + MEWLS R+N L N+ F F L++LV+LP   I+PS
Sbjct  1143  RFANTNLILINDFSRPWFYNVSAMEWLSFRLNILSNIVFAFSLVLLVSLPEGVINPS  1199



>gb|KFK38644.1| hypothetical protein AALP_AA3G141700 [Arabis alpina]
Length=1507

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+VG  K P+  HF+E+ISG  TIR FNQE 
Sbjct  1087  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKGPLIQHFAETISGSTTIRSFNQES  1140

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY++  MEWL  R++ L +L F F L+ L+++P   IDPS
Sbjct  1141  RFRCDNMRLSDGYSRPKFYSAGAMEWLCFRLDMLSSLTFAFSLVFLISIPTGVIDPS  1197



>ref|XP_010269957.1| PREDICTED: LOW QUALITY PROTEIN: putative ABC transporter C family 
member 15 [Nelumbo nucifera]
Length=1511

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 73/116 (63%), Gaps = 6/116 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ      +   +TAREL R+ G Q AP+ HHF ES+SG   IR FNQE+
Sbjct  1078  FIPVTAICIWYQ------QYYTSTARELTRLTGIQTAPILHHFVESLSGAAAIRAFNQEN  1131

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDP  234
             R  + NL LID YSR  F+N +  EW+S R+N L N  F F ++ LV+LP   I+P
Sbjct  1132  RFTETNLILIDNYSRPWFHNMSATEWISFRLNILSNFVFAFSVVFLVSLPHGIINP  1187



>ref|XP_010914891.1| PREDICTED: ABC transporter C family member 3-like [Elaeis guineensis]
Length=1533

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   I       TARELAR+VG  KAP+  HF+ES+SG +TIR F  E 
Sbjct  1108  FIPVIAACIWYQQYYID------TARELARLVGVCKAPIIQHFAESMSGSMTIRSFGHES  1161

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  N  L D YSR  F+N+  M+WL  R++ L +L F F L+ L+++P+  IDP 
Sbjct  1162  RFVGANFHLNDDYSRPKFHNAGAMDWLCFRLDMLSSLTFAFSLVFLISMPKGVIDPG  1218



>emb|CDX82557.1| BnaA03g32640D [Brassica napus]
Length=502

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HF+E+ISG  TIR FNQE 
Sbjct  82   FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFAETISGSTTIRSFNQES  135

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L D +SR  FY +  MEWL  R++ L +L F F L+ L+++P   IDPS
Sbjct  136  RFRGDNMRLSDDFSRPKFYLAGAMEWLCFRLDMLSSLTFAFSLVFLISIPTGVIDPS  192



>ref|XP_009788088.1| PREDICTED: ABC transporter C family member 3-like, partial [Nicotiana 
sylvestris]
Length=193

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IA+ IW +   I S      ARELAR+ GT KAPV  HF+E+ISG  TIR F+QE 
Sbjct  12   FIPVIAVCIWLEQYYIPS------ARELARLNGTCKAPVIQHFAETISGSSTIRSFDQES  65

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    ++ LID YSR  F+ +A MEWL +R++ L  + F F LI L++LP   IDPS
Sbjct  66   RFQDTSMKLIDNYSRPKFHIAAAMEWLCMRLDMLSLITFAFSLIFLISLPVGTIDPS  122



>gb|KCW68423.1| hypothetical protein EUGRSUZ_F02074 [Eucalyptus grandis]
Length=1559

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI +WYQ   ISS      AREL+R+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1168  FIPVIAICVWYQQYYISS------ARELSRLVGVCKAPVIQHFAETISGATTIRSFDQES  1221

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  F+ +  MEWL  R++ L ++ F F LI LV++P   IDP+
Sbjct  1222  RFQDTNMKLADRYSRPKFHIAGAMEWLCFRLDMLSSIIFGFSLIFLVSVPEGFIDPA  1278



>ref|XP_009629048.1| PREDICTED: ABC transporter C family member 3-like [Nicotiana 
tomentosiformis]
Length=1506

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ IIA+SIW +   I S      ARELAR+ GT KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1081  FIPIIAVSIWLEQYYIPS------ARELARLNGTCKAPVIQHFAETISGSSTIRSFDQES  1134

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    ++ LID YSR  F+ +A MEWL +R++ L  + F F LI L++LP   IDPS
Sbjct  1135  RFQDASMKLIDNYSRPKFHTAAAMEWLCMRLDMLSLITFAFSLIFLISLPVGTIDPS  1191



>ref|XP_010061481.1| PREDICTED: ABC transporter C family member 3-like isoform X3 
[Eucalyptus grandis]
Length=1493

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI +WYQ   ISS      AREL+R+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1072  FIPVIAICVWYQQYYISS------ARELSRLVGVCKAPVIQHFAETISGATTIRSFDQES  1125

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  F+ +  MEWL  R++ L ++ F F LI LV++P   IDP+
Sbjct  1126  RFQDTNMKLADRYSRPKFHIAGAMEWLCFRLDMLSSIIFGFSLIFLVSVPEGFIDPA  1182



>ref|XP_008792061.1| PREDICTED: ABC transporter C family member 3-like isoform X1 
[Phoenix dactylifera]
Length=1529

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   I       TARELAR+VG  KAP+  HF+ES+SG +TIR F  E 
Sbjct  1104  FIPVIAACIWYQQYYID------TARELARLVGVCKAPIIQHFAESMSGSMTIRSFGHES  1157

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  N  L D YSR  FYN   MEWL  R++ L +L F F L+ L+++P+  I+P 
Sbjct  1158  RFVGTNFHLNDDYSRPEFYNVGAMEWLCFRLDMLSSLTFAFSLVFLISVPKGVIEPG  1214



>gb|KCW68422.1| hypothetical protein EUGRSUZ_F02074 [Eucalyptus grandis]
Length=1589

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI +WYQ   ISS      AREL+R+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1168  FIPVIAICVWYQQYYISS------ARELSRLVGVCKAPVIQHFAETISGATTIRSFDQES  1221

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  F+ +  MEWL  R++ L ++ F F LI LV++P   IDP+
Sbjct  1222  RFQDTNMKLADRYSRPKFHIAGAMEWLCFRLDMLSSIIFGFSLIFLVSVPEGFIDPA  1278



>ref|XP_009357290.1| PREDICTED: ABC transporter C family member 3-like [Pyrus x bretschneideri]
Length=1515

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++AI IWYQ   I      T+ARELAR+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1095  FIPVVAICIWYQQYYI------TSARELARLVGVCKAPVIQHFAETISGSTTIRSFDQES  1148

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D + R  F+ +A MEWL  R++ L ++ F F LI L+++P   IDP 
Sbjct  1149  RFRDTNMKLNDSFGRPKFHTAAAMEWLCFRLDMLSSITFGFSLIFLISIPAGVIDPG  1205



>dbj|BAD11207.1| multidrug resistance-associated protein [Thlaspi caerulescens]
Length=1514

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HF+E+ISG  TIR F+QE 
Sbjct  1094  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFAETISGSTTIRSFSQES  1147

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY++  MEWL  R++ L +L F F L+ L+++P   IDPS
Sbjct  1148  RFRSDNMRLSDGYSRPKFYSAGAMEWLCFRLDVLSSLTFAFSLVFLISIPTGVIDPS  1204



>ref|XP_007212915.1| hypothetical protein PRUPE_ppa022260mg, partial [Prunus persica]
 gb|EMJ14114.1| hypothetical protein PRUPE_ppa022260mg, partial [Prunus persica]
Length=1477

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI IW Q   I S      ARELAR+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1057  FIPVIAICIWLQQYYIPS------ARELARLVGVCKAPVIQHFAETISGSTTIRSFDQES  1110

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L+D Y R  F+ +A MEWL  R++ L ++ F F L+ L+++P   IDP 
Sbjct  1111  RFRDTNMKLMDGYGRPKFHTAAAMEWLCFRLDMLSSITFGFCLVFLISIPEGVIDPG  1167



>ref|XP_007020567.1| Multidrug resistance-associated protein 3 [Theobroma cacao]
 gb|EOY12092.1| Multidrug resistance-associated protein 3 [Theobroma cacao]
Length=1256

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IA  IWYQ   ISS      ARELAR+VG  KAPV  HF+E+I G  TIR F+QE 
Sbjct  833  FIPVIATCIWYQQYYISS------ARELARLVGVCKAPVIQHFAETILGATTIRSFDQES  886

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R  + ++ L D YSR  F+ +A MEWL  R++ L ++ F F L  L+++P   IDP+
Sbjct  887  RFQETSMKLTDGYSRPKFHAAAAMEWLCFRMDMLSSITFAFSLFFLISIPEGVIDPA  943



>ref|XP_008784678.1| PREDICTED: putative ABC transporter C family member 15 [Phoenix 
dactylifera]
Length=1549

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + AI IWYQ   I       TARELAR+ G Q+AP+ HHF+ES+SG   IR F  E 
Sbjct  1120  FIPVTAICIWYQQYYIP------TARELARLSGIQRAPILHHFAESLSGAAAIRAFGHEI  1173

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    NL LID +SR  F+N + MEWLS R+N L N  F F LI+LV+LP   I+PS
Sbjct  1174  RFSNANLRLIDNHSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLILLVSLPEGFINPS  1230



>ref|XP_011095521.1| PREDICTED: ABC transporter C family member 3-like [Sesamum indicum]
Length=1516

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI IW Q   I+S      ARELAR+ G  KAPV  HFSE++SG  TIR F+QE 
Sbjct  1089  FIPVIAICIWLQRYYIAS------ARELARLCGVCKAPVIQHFSETLSGSSTIRSFDQER  1142

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    ++ LID YSR  FY +  MEWL +R++ L  + F F LI L+ +P   IDPS
Sbjct  1143  RFRDISMRLIDGYSRPKFYTAGAMEWLCIRLDVLSLMTFAFSLIFLIAIPEGTIDPS  1199



>gb|AAQ10074.1| multidrug resistance associated protein MRP2 [Triticum aestivum]
Length=1471

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 71/117 (61%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI +WYQ   I       TAREL RMVG  KAP+  HF ESI+G   IR F +E+
Sbjct  1053  FIPVIAICLWYQRYYID------TARELQRMVGICKAPIIQHFVESITGSTIIRSFGKEN  1106

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             + L  N  L+D YSR  FYN+  MEWL  R++ L +L F   LI L+NLP   IDP 
Sbjct  1107  QFLSTNNQLMDAYSRPKFYNAGAMEWLCFRMDMLSSLTFAISLIFLINLPTGIIDPG  1163



>emb|CDY43373.1| BnaA01g30040D [Brassica napus]
Length=1133

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ ++A S WY+   IS+      ARELAR+ G  ++P+ HHFSE++SGV TIR F+QE 
Sbjct  710  FIPVVAASAWYRQYYISA------ARELARLAGISRSPLVHHFSETLSGVTTIRSFDQEP  763

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R L   + L DC SR+ F+++  MEWL  R+  L  + F   L+I+V+ P   ++PS
Sbjct  764  RFLGDIMKLSDCLSRLRFHSTGAMEWLCFRLELLSTIAFALSLVIVVSAPEGTVNPS  820



>gb|EMS63668.1| ABC transporter C family member 3 [Triticum urartu]
Length=1222

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 71/117 (61%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IAI +WYQ   I       TAREL RMVG  KAP+  HF ESI+G   IR F +E+
Sbjct  804  FIPVIAICLWYQRYYID------TARELQRMVGICKAPIIQHFVESITGSTIIRSFGKEN  857

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            + L  N  L+D YSR  FYN+  MEWL  R++ L +L F   LI L+NLP   IDP 
Sbjct  858  QFLSTNNQLMDAYSRPKFYNAGAMEWLCFRMDMLSSLTFAISLIFLINLPIGIIDPG  914



>ref|XP_004975426.1| PREDICTED: ABC transporter C family member 9-like [Setaria italica]
Length=775

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +I +S+ YQ   I +      ARELAR+   Q+AP+ HHF+ES+SG  +IR + Q+D
Sbjct  351  FIPVIVVSVLYQRYQIPA------ARELARLYKIQRAPILHHFAESLSGASSIRAYGQKD  404

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R +K NL L D +SR  F+N A+MEWLS+R+  L  L F   LI+LV+LP   ++PS
Sbjct  405  RFIKANLGLFDNHSRPWFHNFASMEWLSLRLAMLSTLVFAVCLILLVSLPEGLLNPS  461



>ref|XP_011095523.1| PREDICTED: ABC transporter C family member 3-like [Sesamum indicum]
Length=1518

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+++ AI IW Q   I+S      AREL R+ G  KAPV  HFSE++SG  TIR F QE 
Sbjct  1089  FILVSAICIWLQRYYIAS------ARELTRLCGVCKAPVIQHFSETLSGSSTIRSFGQEG  1142

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R   + + LID YSR  FY +A +EWL +R++ L  + F F LI LV +P   IDPS
Sbjct  1143  RFHDRGMRLIDGYSRPKFYTAAALEWLCIRLDVLSLVTFAFSLIFLVAIPEGTIDPS  1199



>ref|XP_009135282.1| PREDICTED: ABC transporter C family member 3-like [Brassica rapa]
Length=1493

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HF+E+ISG  TIR FNQE 
Sbjct  1073  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFAETISGSTTIRSFNQES  1126

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D +SR  FY +  MEWL  R++ L +L F F L+ L+++P   IDPS
Sbjct  1127  RFRGDNMRLSDDFSRPKFYLAGAMEWLCFRLDMLSSLTFAFSLVFLISIPTGVIDPS  1183



>ref|XP_006407263.1| hypothetical protein EUTSA_v10019893mg [Eutrema salsugineum]
 gb|ESQ48716.1| hypothetical protein EUTSA_v10019893mg [Eutrema salsugineum]
Length=1513

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+VG  KAP+  HF+E+ISG  TIR F+QE 
Sbjct  1093  FIPVVAASIWYQRYYIAA------ARELSRLVGVCKAPLIQHFAETISGSTTIRSFSQES  1146

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY++  MEWL  R++ L +L F F L+ L+++P   IDPS
Sbjct  1147  RFRCDNMRLSDGYSRPKFYSAGAMEWLCFRLDMLSSLTFAFSLVFLISIPTGVIDPS  1203



>gb|KDO62254.1| hypothetical protein CISIN_1g039402mg [Citrus sinensis]
Length=1496

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+  +   IWYQ   ISS      AREL+R+VG  KAPV  HF+E++SG  TIR F+QE 
Sbjct  1071  FVPAVGSCIWYQQYYISS------ARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQES  1124

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R   +N+ L+D YSR  F+ +A MEWL +R++ L ++ F F L+ L+++P+  IDP+
Sbjct  1125  RFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPA  1181



>ref|XP_006475120.1| PREDICTED: ABC transporter C family member 3-like [Citrus sinensis]
Length=1519

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+  +   IWYQ   ISS      AREL+R+VG  KAPV  HF+E++SG  TIR F+QE 
Sbjct  1094  FVPAVGSCIWYQQYYISS------ARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQES  1147

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R   +N+ L+D YSR  F+ +A MEWL +R++ L ++ F F L+ L+++P+  IDP+
Sbjct  1148  RFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPA  1204



>ref|XP_006452550.1| hypothetical protein CICLE_v10010386mg [Citrus clementina]
 gb|ESR65790.1| hypothetical protein CICLE_v10010386mg [Citrus clementina]
Length=1490

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+  +   IWYQ   ISS      AREL+R+VG  KAPV  HF+E++SG  TIR F+QE 
Sbjct  1065  FVPAVGSCIWYQQYYISS------ARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQES  1118

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R   +N+ L+D YSR  F+ +A MEWL +R++ L ++ F F L+ L+++P+  IDP+
Sbjct  1119  RFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPA  1175



>ref|XP_010914892.1| PREDICTED: ABC transporter C family member 3-like isoform X1 
[Elaeis guineensis]
Length=1538

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA SIWYQ   I +      ARELAR+VG  KAP+  HF+ES+SG +TIR F  E 
Sbjct  1113  FIPVIAASIWYQQYYIDA------ARELARLVGVCKAPIIQHFAESMSGSMTIRSFGHES  1166

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  N  L D YS+  F+N+A  EWL  R++ L +L F F L+ L+++P+  IDP 
Sbjct  1167  RFVGTNFHLYDDYSQPKFHNAAAREWLCFRLDMLSSLTFAFSLVFLISMPKGVIDPG  1223



>gb|EMT04535.1| ABC transporter C family member 3 [Aegilops tauschii]
Length=1732

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 71/116 (61%), Gaps = 6/116 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAI +WYQ   I       TAREL RMVG  KAP+  HF ESI+G   IR F +E+
Sbjct  1302  FIPVIAICLWYQRYYID------TARELQRMVGICKAPIIQHFVESITGSTIIRSFGKEN  1355

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDP  234
             + L  N  L+D YSR  FYN+  MEWL  R++ L +L F   LI L+NLP   IDP
Sbjct  1356  QFLSTNNQLMDAYSRPKFYNAGAMEWLCFRMDMLSSLTFAISLIFLINLPTGIIDP  1411



>ref|XP_009124713.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter C family member 
6 [Brassica rapa]
Length=1464

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A S WY+   IS+      ARELAR+ G  ++P+ HHFSE++SGV TIR F+QE 
Sbjct  1041  FIPVVAASAWYRQYYISA------ARELARLAGISRSPLVHHFSETLSGVTTIRSFDQEP  1094

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L   + L DC SR+ F+++  MEWL  R+  L  + F   L+I+V+ P   ++PS
Sbjct  1095  RFLGDIMKLNDCLSRLRFHSTGAMEWLCFRLELLSTIAFALSLVIVVSAPEGTVNPS  1151



>dbj|BAB01400.1| multidrug resistance-associated protein (MRP); ABC-transoprter 
[Arabidopsis thaliana]
Length=1441

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A   WY+   IS+      ARELAR+ G  ++PV HHFSE++SG+ TIR F+QE 
Sbjct  1044  FIPVVAACAWYRQYYISA------ARELARLAGISRSPVVHHFSETLSGITTIRSFDQEP  1097

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R     + L DCYSR+ F+++  MEWL  R+  L    F   L+ILV+ P   I+PS
Sbjct  1098  RFRGDIMRLSDCYSRLKFHSTGAMEWLCFRLELLSTFAFASSLVILVSAPEGVINPS  1154



>ref|XP_004491490.1| PREDICTED: ABC transporter C family member 3-like [Cicer arietinum]
Length=1512

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 76/117 (65%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IAISIWYQ      +    +AREL+R+VG  KAP+  HF+E+ISG  TIR F Q+ 
Sbjct  1086  FIPVIAISIWYQ------RFYLPSARELSRLVGVCKAPIIQHFAETISGTTTIRSFGQQS  1139

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  + N+ L D YSR  F  +A MEWL +R++ L ++ F F LI L+++P+  I+P 
Sbjct  1140  RFHETNMKLTDGYSRPKFNIAAAMEWLCIRLDMLSSITFAFSLIFLISIPQGIINPG  1196



>ref|NP_187916.3| multidrug resistance-associated protein 8 [Arabidopsis thaliana]
 sp|Q8VZZ4.3|AB6C_ARATH RecName: Full=ABC transporter C family member 6; Short=ABC transporter 
ABCC.6; Short=AtABCC6; AltName: Full=ATP-energized 
glutathione S-conjugate pump 8; AltName: Full=Glutathione S-conjugate-transporting 
ATPase 8; AltName: Full=Multidrug resistance-associated 
protein 8 [Arabidopsis thaliana]
 gb|AEE75295.1| multidrug resistance-associated protein 8 [Arabidopsis thaliana]
Length=1466

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A   WY+   IS+      ARELAR+ G  ++PV HHFSE++SG+ TIR F+QE 
Sbjct  1044  FIPVVAACAWYRQYYISA------ARELARLAGISRSPVVHHFSETLSGITTIRSFDQEP  1097

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R     + L DCYSR+ F+++  MEWL  R+  L    F   L+ILV+ P   I+PS
Sbjct  1098  RFRGDIMRLSDCYSRLKFHSTGAMEWLCFRLELLSTFAFASSLVILVSAPEGVINPS  1154



>ref|XP_010465114.1| PREDICTED: ABC transporter C family member 3 [Camelina sativa]
Length=1515

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIW Q   I++      AREL+R+VG  KAP+  HFSE+ISG  TIR F+QE 
Sbjct  1095  FIPVVAASIWLQRYYIAA------ARELSRLVGVCKAPLIQHFSETISGATTIRSFSQES  1148

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY +  MEWL  R++ L +L F+F L+ LV++P   IDPS
Sbjct  1149  RFRSDNMRLSDGYSRPKFYTAGAMEWLCFRLDMLSSLTFVFSLVFLVSIPTGVIDPS  1205



>gb|AAL14776.1| ATP-binding cassette transporter MRP6 [Arabidopsis thaliana]
Length=1466

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A   WY+   IS+      ARELAR+ G  ++PV HHFSE++SG+ TIR F+QE 
Sbjct  1044  FIPVVAACAWYRQYYISA------ARELARLAGISRSPVVHHFSETLSGITTIRSFDQEP  1097

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R     + L DCYSR+ F+++  MEWL  R+  L    F   L+ILV+ P   I+PS
Sbjct  1098  RFRGDIMRLSDCYSRLKFHSTGAMEWLCFRLELLSTFAFASSLVILVSAPEGVINPS  1154



>ref|XP_007029921.1| Multidrug resistance-associated protein 3 isoform 2 [Theobroma 
cacao]
 gb|EOY10423.1| Multidrug resistance-associated protein 3 isoform 2 [Theobroma 
cacao]
Length=1391

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 6/114 (5%)
 Frame = -1

Query  572   IIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLL  393
             +IA  IWYQ   ISS      AREL+R+VG  KAPV  HF+E+ISG  TIR F+QE R  
Sbjct  1083  VIATCIWYQQCYISS------ARELSRLVGVCKAPVIQHFAETISGATTIRSFDQESRFQ  1136

Query  392   KKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             + N+ L D YSR  F+ +  MEWL  R++ L ++ F F L  L+++P   IDP+
Sbjct  1137  ETNMILTDAYSRPKFHIAGAMEWLCFRLDMLTSITFAFSLFFLISIPEGVIDPA  1190



>ref|XP_004510151.1| PREDICTED: ABC transporter C family member 9-like isoform X1 
[Cicer arietinum]
 ref|XP_004510152.1| PREDICTED: ABC transporter C family member 9-like isoform X2 
[Cicer arietinum]
Length=1517

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +  + IWYQ      +    TARELAR+   Q  P+ HHFSES++G  +IR F+QE 
Sbjct  1087  FIPVTGVCIWYQ------RYYNPTARELARLAQIQITPILHHFSESLAGAASIRAFDQEG  1140

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R ++ NL L+D +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  1141  RFMRTNLVLLDGFSRPWFHNVSAMEWLSYRLNLLSNFVFAFSLVLLVSLPEGFINPS  1197



>gb|AFK47609.1| unknown [Lotus japonicus]
Length=510

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ +IAISIWYQ   + S      AREL+R+VG  KAP+  HF+E+ISG  TIR F+Q+ 
Sbjct  85   FIPVIAISIWYQQYYLPS------ARELSRLVGVCKAPIIQHFAETISGTSTIRSFDQQR  138

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R  + N+ L D YSR  F  +  MEWL  R++ L ++ F F LI L+++P+  IDP 
Sbjct  139  RFQETNMKLTDGYSRPKFNIAGAMEWLCFRLDMLSSITFAFSLIFLISIPQGIIDPG  195



>gb|KCW68421.1| hypothetical protein EUGRSUZ_F02073 [Eucalyptus grandis]
Length=1482

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   I S      ARELAR+VG  KAPV  HFSE+ISG  TI  F+QE 
Sbjct  1061  FIPVIATCIWYQQYYIPS------ARELARLVGVNKAPVIQHFSETISGSTTIHGFDQES  1114

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  F+ +  MEWL  R++ L  + F   LI L+++P   IDP+
Sbjct  1115  RFRNTNMELSDAYSRPKFHVAGAMEWLCFRLDMLSIITFGISLIFLISIPEGFIDPA  1171



>ref|XP_010061479.1| PREDICTED: ABC transporter C family member 3-like isoform X1 
[Eucalyptus grandis]
Length=1503

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   I S      ARELAR+VG  KAPV  HFSE+ISG  TI  F+QE 
Sbjct  1082  FIPVIATCIWYQQYYIPS------ARELARLVGVNKAPVIQHFSETISGSTTIHGFDQES  1135

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  F+ +  MEWL  R++ L  + F   LI L+++P   IDP+
Sbjct  1136  RFRNTNMELSDAYSRPKFHVAGAMEWLCFRLDMLSIITFGISLIFLISIPEGFIDPA  1192



>ref|XP_007029920.1| Multidrug resistance-associated protein 3 isoform 1 [Theobroma 
cacao]
 gb|EOY10422.1| Multidrug resistance-associated protein 3 isoform 1 [Theobroma 
cacao]
Length=1502

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 6/114 (5%)
 Frame = -1

Query  572   IIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLL  393
             +IA  IWYQ   ISS      AREL+R+VG  KAPV  HF+E+ISG  TIR F+QE R  
Sbjct  1083  VIATCIWYQQCYISS------ARELSRLVGVCKAPVIQHFAETISGATTIRSFDQESRFQ  1136

Query  392   KKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             + N+ L D YSR  F+ +  MEWL  R++ L ++ F F L  L+++P   IDP+
Sbjct  1137  ETNMILTDAYSRPKFHIAGAMEWLCFRLDMLTSITFAFSLFFLISIPEGVIDPA  1190



>ref|XP_010061480.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Eucalyptus grandis]
Length=1503

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   I S      ARELAR+VG  KAPV  HFSE+ISG  TI  F+QE 
Sbjct  1082  FIPVIATCIWYQQYYIPS------ARELARLVGVNKAPVIQHFSETISGSTTIHGFDQES  1135

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  F+ +  MEWL  R++ L  + F   LI L+++P   IDP+
Sbjct  1136  RFRNTNMELSDAYSRPKFHVAGAMEWLCFRLDMLSIITFGISLIFLISIPEGFIDPA  1192



>ref|XP_007020566.1| Multidrug resistance-associated protein 3 isoform 3 [Theobroma 
cacao]
 gb|EOY12091.1| Multidrug resistance-associated protein 3 isoform 3 [Theobroma 
cacao]
Length=1228

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ ++A  IWYQ   ISS      ARELAR+VG  KAPV  HF+E+I G  TIR F+QE 
Sbjct  833  FIPVVATCIWYQQYYISS------ARELARLVGVCKAPVIQHFAETILGATTIRSFDQES  886

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R  + N+ L+D +SR  F+ +  MEWL  R++ L ++ F F L  L+++P   IDP+
Sbjct  887  RFQEANMILMDAFSRPKFHVAGAMEWLCFRLDMLSSITFAFSLFFLISIPEGIIDPA  943



>ref|XP_007020565.1| Multidrug resistance-associated protein 3 isoform 2 [Theobroma 
cacao]
 gb|EOY12090.1| Multidrug resistance-associated protein 3 isoform 2 [Theobroma 
cacao]
Length=1256

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ ++A  IWYQ   ISS      ARELAR+VG  KAPV  HF+E+I G  TIR F+QE 
Sbjct  833  FIPVVATCIWYQQYYISS------ARELARLVGVCKAPVIQHFAETILGATTIRSFDQES  886

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R  + N+ L+D +SR  F+ +  MEWL  R++ L ++ F F L  L+++P   IDP+
Sbjct  887  RFQEANMILMDAFSRPKFHVAGAMEWLCFRLDMLSSITFAFSLFFLISIPEGIIDPA  943



>gb|KJB81652.1| hypothetical protein B456_013G154700 [Gossypium raimondii]
Length=1496

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 72/109 (66%), Gaps = 6/109 (6%)
 Frame = -1

Query  557   IWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQEDRLLKKNLS  378
             IWYQ   ISS      ARELAR+VG  KAPV  HF+E++ GV TIRCF+QE R  + NL+
Sbjct  1081  IWYQQYYISS------ARELARLVGVSKAPVIQHFAETLLGVTTIRCFDQESRFQETNLT  1134

Query  377   LIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             L D YSR  F+ S   EWL  R++ L ++ F F L IL+++P+  I+P+
Sbjct  1135  LNDSYSRPKFHVSCAKEWLCFRLDMLSSITFAFGLFILISVPKGVINPA  1183



>ref|XP_007020564.1| Multidrug resistance-associated protein 3 isoform 1 [Theobroma 
cacao]
 gb|EOY12089.1| Multidrug resistance-associated protein 3 isoform 1 [Theobroma 
cacao]
Length=1438

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A  IWYQ   ISS      ARELAR+VG  KAPV  HF+E+I G  TIR F+QE 
Sbjct  1015  FIPVVATCIWYQQYYISS------ARELARLVGVCKAPVIQHFAETILGATTIRSFDQES  1068

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  + N+ L+D +SR  F+ +  MEWL  R++ L ++ F F L  L+++P   IDP+
Sbjct  1069  RFQEANMILMDAFSRPKFHVAGAMEWLCFRLDMLSSITFAFSLFFLISIPEGIIDPA  1125



>ref|XP_003530102.2| PREDICTED: ABC transporter C family member 9-like [Glycine max]
 gb|KHN34003.1| ABC transporter C family member 9 [Glycine soja]
Length=1517

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ IWYQ      +    TARELAR+   Q  P+ HHFSES++G  +IR F+QE 
Sbjct  1085  FIPVTAVCIWYQ------RYYTPTARELARLAQIQITPILHHFSESLAGAASIRAFDQEG  1138

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL L+D +SR  F+N + MEWLS R+N L N  F F L++LV+LP   I+PS
Sbjct  1139  RFIYTNLLLVDGFSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLVMLVSLPEGIINPS  1195



>gb|KHN10953.1| ABC transporter C family member 3 [Glycine soja]
Length=1394

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA+SIWYQ   I S      AREL+R+VG  KAP+  HF+E+ISG  TIRCF+ + 
Sbjct  999   FIPVIAVSIWYQQYYIPS------ARELSRLVGVCKAPIIQHFAETISGTSTIRCFDHQS  1052

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R  + N+ L D YSR  F     MEWL  R++ L ++ F F LI L+++P   IDP 
Sbjct  1053  RFQETNMKLTDGYSRPKFNIVGAMEWLCFRLDMLSSITFAFSLIFLISIPPGIIDPG  1109



>gb|KJB45532.1| hypothetical protein B456_007G310500 [Gossypium raimondii]
Length=1486

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA  IWYQ   ISS      AREL+R+VG  +APV  +F+E+I G  TIR F+QE 
Sbjct  1067  FIPVIATCIWYQQYYISS------ARELSRLVGVCQAPVIQNFAETILGATTIRSFDQEK  1120

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N++L D YSR  FY +  MEWL  R++ L ++ F F L IL++LP   IDP+
Sbjct  1121  RFQDTNMALTDSYSRPKFYAAGAMEWLCFRLDLLSSVTFAFSLFILISLPEGVIDPA  1177



>ref|XP_007134353.1| hypothetical protein PHAVU_010G040400g [Phaseolus vulgaris]
 gb|ESW06347.1| hypothetical protein PHAVU_010G040400g [Phaseolus vulgaris]
Length=1514

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ + A+ IWYQ      +    TARELAR+   Q  P+ HHFSES++G  +IR F+QE 
Sbjct  1082  FIPVTAVCIWYQ------RYYTPTARELARLAQIQITPILHHFSESLAGAASIRAFDQEG  1135

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R +  NL L+D +SR  F+N + MEWLS R+N L N  F F L++LV LP   I+PS
Sbjct  1136  RFIYTNLILVDGFSRPWFHNVSAMEWLSFRLNLLSNFVFAFSLVMLVTLPEEIINPS  1192



>ref|XP_009124680.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter C family member 
6-like [Brassica rapa]
Length=1492

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A S WY+   IS+      ARELAR+ G  ++P+ HHFSE++SGV TIR F+QE 
Sbjct  1069  FIPVVAASSWYRQYYISA------ARELARLAGISRSPLVHHFSETLSGVTTIRSFDQEP  1122

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R L   + L DC SR+AF+++   EWL  R+  L  + F   L+I+V+ P   ++PS
Sbjct  1123  RFLSDIMKLSDCLSRLAFHSTGATEWLCFRLELLATIAFALSLVIVVSAPDGTVNPS  1179



>ref|XP_008385795.1| PREDICTED: ABC transporter C family member 3-like [Malus domestica]
Length=1480

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++AI IWYQ   I +      ARELAR+VG  KAPV  HF+E+ISG  TIR F+QE 
Sbjct  1060  FIPVVAICIWYQQYYIPA------ARELARLVGVCKAPVIQHFAETISGSTTIRSFDQES  1113

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D + R  F+ +A MEWL  R++ L ++ F F LI L+++P   IDP 
Sbjct  1114  RFRDTNMKLNDSFGRPNFHTAAAMEWLCFRLDMLSSITFGFSLIFLISIPAGVIDPG  1170



>ref|XP_008385794.1| PREDICTED: ABC transporter C family member 3-like isoform X2 
[Malus domestica]
Length=1400

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++AI IWYQ   I S      ARELAR+VG  K+PV  HF+E+ISG  TIR F+QE 
Sbjct  1095  FIPVVAICIWYQQYYIPS------ARELARLVGVCKSPVIQHFAETISGSTTIRSFDQES  1148

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D + R  F+ +A MEWL  R++ L ++ F F LI L+++P   IDP 
Sbjct  1149  RFRDTNMKLNDSFGRPKFHTAAAMEWLCFRLDMLSSITFGFSLIFLISIPAGVIDPG  1205



>emb|CDY43375.1| BnaA01g30060D [Brassica napus]
Length=1160

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ ++A SIWYQ   I++      AREL+R+ G  KAP+  HFSE+ISG  TIR FNQE 
Sbjct  740  FIPVVAASIWYQRYYIAA------ARELSRLDGVCKAPLIQHFSETISGSTTIRSFNQES  793

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L D YSR  FY +  +EWL  R++ L +L F F LI L+++P   IDPS
Sbjct  794  RFRGDNMRLSDAYSRPKFYLAGAVEWLCFRLDMLSSLVFAFSLIFLISIPTGVIDPS  850



>ref|XP_009124708.1| PREDICTED: ABC transporter C family member 3 [Brassica rapa]
Length=1477

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ ++A SIWYQ   I++      AREL+R+ G  KAP+  HFSE+ISG  TIR FNQE 
Sbjct  1057  FIPVVAASIWYQRYYIAA------ARELSRLDGVCKAPLIQHFSETISGSTTIRSFNQES  1110

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             R    N+ L D YSR  FY +  +EWL  R++ L +L F F LI L+++P   IDPS
Sbjct  1111  RFRGDNMRLSDAYSRPKFYLAGAVEWLCFRLDMLSSLVFAFSLIFLISIPTGVIDPS  1167



>ref|XP_006645551.1| PREDICTED: ABC transporter C family member 3-like [Oryza brachyantha]
Length=1446

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = -1

Query  581   FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
             F+ +IA   WYQ   I       TAREL R+VG  KAP+  HF+ESI+G  TIR F +E+
Sbjct  1028  FIPVIAACFWYQRYYID------TARELQRLVGVCKAPIIQHFAESITGSTTIRSFGKEN  1081

Query  401   RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
             + +  N  L+D +SR  FYN+A MEWL  R++ L ++ F F LI LVNLP   IDP 
Sbjct  1082  QFVSTNSHLMDAFSRPKFYNAAAMEWLCFRLDTLSSVTFAFSLIFLVNLPTGLIDPG  1138



>emb|CDY24221.1| BnaC01g38010D [Brassica napus]
Length=1063

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 6/117 (5%)
 Frame = -1

Query  581  FLIIIAISIWYQVKTISSKITRTTARELARMVGTQKAPVQHHFSESISGVVTIRCFNQED  402
            F+ ++A SIWYQ   I++      AREL+R+ G  KAP+  HFSE+ISG  TIR FNQE 
Sbjct  680  FIPVVAASIWYQRYYIAA------ARELSRLDGVCKAPLIQHFSETISGSTTIRSFNQES  733

Query  401  RLLKKNLSLIDCYSRVAFYNSATMEWLSVRinflfnlgflflliilvnLPRSAIDPS  231
            R    N+ L D YSR  FY +  +EWL  R++ L +L F+F LI L+++P   IDPS
Sbjct  734  RFRGDNMRLSDAYSRPKFYLAGAVEWLCFRLDMLSSLVFVFSLIFLISIPTGVIDPS  790



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737809437560