BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7328

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615365.1|  PREDICTED: aldose 1-epimerase                      261   6e-83   Nicotiana tomentosiformis
ref|XP_009803676.1|  PREDICTED: aldose 1-epimerase                      260   1e-82   Nicotiana sylvestris
ref|XP_006344389.1|  PREDICTED: aldose 1-epimerase-like                 256   4e-81   Solanum tuberosum [potatoes]
ref|XP_004236201.1|  PREDICTED: aldose 1-epimerase                      250   1e-78   Solanum lycopersicum
ref|XP_011071623.1|  PREDICTED: aldose 1-epimerase                      246   4e-77   
gb|EYU35859.1|  hypothetical protein MIMGU_mgv1a008920mg                239   2e-74   Erythranthe guttata [common monkey flower]
ref|XP_002268039.1|  PREDICTED: aldose 1-epimerase                      229   2e-70   Vitis vinifera
gb|KJB39892.1|  hypothetical protein B456_007G036000                    226   4e-69   Gossypium raimondii
gb|EPS71547.1|  hypothetical protein M569_03212                         223   1e-68   Genlisea aurea
ref|XP_007210522.1|  hypothetical protein PRUPE_ppa007822mg             223   3e-68   
ref|XP_008239819.1|  PREDICTED: aldose 1-epimerase                      224   3e-68   Prunus mume [ume]
ref|XP_004508757.1|  PREDICTED: aldose 1-epimerase-like isoform X1      218   6e-66   Cicer arietinum [garbanzo]
ref|XP_008453190.1|  PREDICTED: aldose 1-epimerase-like                 217   9e-66   Cucumis melo [Oriental melon]
ref|XP_010547806.1|  PREDICTED: aldose 1-epimerase-like                 217   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_011029977.1|  PREDICTED: aldose 1-epimerase-like                 216   3e-65   Populus euphratica
ref|XP_003550776.1|  PREDICTED: aldose 1-epimerase-like                 214   1e-64   Glycine max [soybeans]
ref|XP_010550628.1|  PREDICTED: aldose 1-epimerase-like                 213   4e-64   Tarenaya hassleriana [spider flower]
ref|XP_007037277.1|  Galactose mutarotase-like superfamily protein      215   8e-64   
gb|AFK38126.1|  unknown                                                 211   2e-63   Lotus japonicus
emb|CDP12362.1|  unnamed protein product                                211   2e-63   Coffea canephora [robusta coffee]
ref|XP_002511545.1|  aldose-1-epimerase, putative                       211   3e-63   Ricinus communis
ref|XP_007155325.1|  hypothetical protein PHAVU_003G191500g             209   1e-62   Phaseolus vulgaris [French bean]
ref|XP_004299386.1|  PREDICTED: aldose 1-epimerase                      209   2e-62   Fragaria vesca subsp. vesca
gb|KDO76084.1|  hypothetical protein CISIN_1g043310mg                   208   2e-62   Citrus sinensis [apfelsine]
ref|XP_006439628.1|  hypothetical protein CICLE_v10024457mg             208   2e-62   Citrus clementina [clementine]
emb|CAN61059.1|  hypothetical protein VITISV_011619                     207   4e-62   Vitis vinifera
ref|XP_004138299.1|  PREDICTED: aldose 1-epimerase                      207   4e-62   Cucumis sativus [cucumbers]
ref|XP_002875866.1|  hypothetical protein ARALYDRAFT_906011             207   7e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_006477524.1|  PREDICTED: aldose 1-epimerase-like                 207   9e-62   
ref|XP_002318873.1|  aldose 1-epimerase family protein                  206   1e-61   
ref|XP_003528185.2|  PREDICTED: aldose 1-epimerase-like                 206   1e-61   Glycine max [soybeans]
ref|XP_006377092.1|  hypothetical protein POPTR_0012s14420g             206   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004302346.1|  PREDICTED: aldose 1-epimerase-like                 206   2e-61   Fragaria vesca subsp. vesca
ref|XP_006291372.1|  hypothetical protein CARUB_v10017512mg             205   4e-61   Capsella rubella
ref|XP_012080544.1|  PREDICTED: aldose 1-epimerase                      204   1e-60   Jatropha curcas
ref|XP_006578581.1|  PREDICTED: aldose 1-epimerase-like                 203   2e-60   Glycine max [soybeans]
ref|NP_190364.1|  putative aldose 1-epimerase                           203   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010029392.1|  PREDICTED: aldose 1-epimerase-like                 203   2e-60   Eucalyptus grandis [rose gum]
gb|AAM61410.1|  aldose 1-epimerase-like protein                         203   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003609044.1|  Aldose 1-epimerase-like protein                    202   3e-60   
gb|AES91241.2|  aldose 1-epimerase family protein                       202   3e-60   Medicago truncatula
gb|KHN13632.1|  Aldose 1-epimerase                                      203   4e-60   Glycine soja [wild soybean]
ref|XP_006404339.1|  hypothetical protein EUTSA_v10010502mg             201   1e-59   Eutrema salsugineum [saltwater cress]
ref|XP_004508758.1|  PREDICTED: aldose 1-epimerase-like isoform X2      199   3e-59   
ref|XP_006482555.1|  PREDICTED: aldose 1-epimerase-like                 201   3e-59   Citrus sinensis [apfelsine]
ref|XP_004147466.2|  PREDICTED: aldose 1-epimerase-like                 201   4e-59   Cucumis sativus [cucumbers]
ref|XP_003621162.1|  Aldose 1-epimerase                                 200   5e-59   Medicago truncatula
ref|XP_009149871.1|  PREDICTED: aldose 1-epimerase                      199   9e-59   Brassica rapa
ref|XP_010426233.1|  PREDICTED: aldose 1-epimerase-like                 199   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_008341553.1|  PREDICTED: aldose 1-epimerase                      199   1e-58   Malus domestica [apple tree]
emb|CDY36929.1|  BnaA06g17140D                                          199   1e-58   Brassica napus [oilseed rape]
ref|XP_008443423.1|  PREDICTED: aldose 1-epimerase                      199   1e-58   
ref|XP_006482556.1|  PREDICTED: aldose 1-epimerase-like                 199   1e-58   Citrus sinensis [apfelsine]
ref|XP_003534458.1|  PREDICTED: aldose 1-epimerase-like                 199   2e-58   Glycine max [soybeans]
gb|KFK34079.1|  hypothetical protein AALP_AA5G099600                    198   2e-58   Arabis alpina [alpine rockcress]
gb|KJB75756.1|  hypothetical protein B456_012G055600                    196   2e-58   Gossypium raimondii
ref|XP_009624451.1|  PREDICTED: aldose 1-epimerase-like                 198   2e-58   Nicotiana tomentosiformis
ref|NP_001241992.1|  uncharacterized protein LOC100781853 precursor     198   3e-58   
ref|XP_010503389.1|  PREDICTED: aldose 1-epimerase-like                 198   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006338470.1|  PREDICTED: aldose 1-epimerase-like isoform X2      197   5e-58   Solanum tuberosum [potatoes]
ref|XP_006431103.1|  hypothetical protein CICLE_v10011989mg             197   5e-58   Citrus clementina [clementine]
gb|KDO72518.1|  hypothetical protein CISIN_1g017992mg                   197   7e-58   Citrus sinensis [apfelsine]
ref|XP_007139591.1|  hypothetical protein PHAVU_008G042600g             197   8e-58   Phaseolus vulgaris [French bean]
ref|XP_009779461.1|  PREDICTED: aldose 1-epimerase-like                 196   8e-58   Nicotiana sylvestris
gb|KJB75754.1|  hypothetical protein B456_012G055600                    196   1e-57   Gossypium raimondii
ref|XP_010032358.1|  PREDICTED: aldose 1-epimerase-like                 196   1e-57   Eucalyptus grandis [rose gum]
ref|XP_009593213.1|  PREDICTED: aldose 1-epimerase-like                 196   2e-57   Nicotiana tomentosiformis
gb|KHG05985.1|  Aldose 1-epimerase                                      196   2e-57   Gossypium arboreum [tree cotton]
ref|XP_011098592.1|  PREDICTED: aldose 1-epimerase-like                 196   2e-57   Sesamum indicum [beniseed]
ref|XP_009347058.1|  PREDICTED: aldose 1-epimerase                      196   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_002323842.1|  aldose 1-epimerase family protein                  195   3e-57   Populus trichocarpa [western balsam poplar]
emb|CDY24155.1|  BnaC03g57220D                                          195   3e-57   Brassica napus [oilseed rape]
gb|KDO72516.1|  hypothetical protein CISIN_1g0479222mg                  192   4e-57   Citrus sinensis [apfelsine]
gb|KHN45485.1|  Aldose 1-epimerase                                      194   6e-57   Glycine soja [wild soybean]
ref|XP_006338469.1|  PREDICTED: aldose 1-epimerase-like isoform X1      194   6e-57   Solanum tuberosum [potatoes]
ref|XP_009779450.1|  PREDICTED: aldose 1-epimerase-like                 194   6e-57   Nicotiana sylvestris
ref|XP_007216505.1|  hypothetical protein PRUPE_ppa024124mg             194   7e-57   
ref|XP_008230742.1|  PREDICTED: aldose 1-epimerase-like                 194   9e-57   Prunus mume [ume]
ref|XP_011008940.1|  PREDICTED: aldose 1-epimerase-like                 194   1e-56   Populus euphratica
ref|XP_004489156.1|  PREDICTED: aldose 1-epimerase-like                 194   1e-56   Cicer arietinum [garbanzo]
ref|XP_006338471.1|  PREDICTED: aldose 1-epimerase-like isoform X3      193   1e-56   Solanum tuberosum [potatoes]
ref|NP_001241954.1|  uncharacterized protein LOC100803092 precursor     193   2e-56   Glycine max [soybeans]
ref|XP_009779457.1|  PREDICTED: aldose 1-epimerase-like isoform X6      193   2e-56   Nicotiana sylvestris
gb|AAL09398.1|AF307095_1  non-cell-autonomous protein pathway2          193   2e-56   Nicotiana tabacum [American tobacco]
gb|AFK41318.1|  unknown                                                 192   5e-56   Lotus japonicus
ref|XP_009624446.1|  PREDICTED: aldose 1-epimerase-like                 192   6e-56   Nicotiana tomentosiformis
ref|XP_004232231.2|  PREDICTED: aldose 1-epimerase-like                 194   7e-56   
ref|XP_006338467.1|  PREDICTED: aldose 1-epimerase-like                 191   7e-56   Solanum tuberosum [potatoes]
ref|XP_007099714.1|  Galactose mutarotase-like superfamily protei...    193   1e-55   
gb|KEH24989.1|  aldose 1-epimerase family protein                       191   2e-55   Medicago truncatula
gb|KHN13234.1|  Aldose 1-epimerase                                      191   2e-55   Glycine soja [wild soybean]
ref|XP_009779456.1|  PREDICTED: aldose 1-epimerase-like isoform X5      191   2e-55   Nicotiana sylvestris
emb|CDP18771.1|  unnamed protein product                                190   4e-55   Coffea canephora [robusta coffee]
ref|XP_009779455.1|  PREDICTED: aldose 1-epimerase-like isoform X4      190   4e-55   Nicotiana sylvestris
ref|XP_009779459.1|  PREDICTED: aldose 1-epimerase-like isoform X8      189   7e-55   Nicotiana sylvestris
ref|XP_009779458.1|  PREDICTED: aldose 1-epimerase-like isoform X7      189   8e-55   Nicotiana sylvestris
ref|XP_003543750.1|  PREDICTED: aldose 1-epimerase-like                 189   8e-55   Glycine max [soybeans]
ref|XP_009624447.1|  PREDICTED: aldose 1-epimerase-like                 189   1e-54   Nicotiana tomentosiformis
gb|AAL09397.1|AF307094_1  non-cell-autonomous protein pathway1          188   1e-54   Nicotiana tabacum [American tobacco]
ref|XP_012083064.1|  PREDICTED: aldose 1-epimerase-like                 189   1e-54   Jatropha curcas
ref|XP_011046256.1|  PREDICTED: aldose 1-epimerase-like                 187   2e-54   Populus euphratica
ref|XP_009624450.1|  PREDICTED: aldose 1-epimerase-like isoform X2      187   2e-54   Nicotiana tomentosiformis
gb|AAB94619.1|  aldose-1-epimerase-like protein                         187   3e-54   Nicotiana tabacum [American tobacco]
ref|XP_010256788.1|  PREDICTED: aldose 1-epimerase-like                 187   3e-54   Nelumbo nucifera [Indian lotus]
emb|CDP02212.1|  unnamed protein product                                187   4e-54   Coffea canephora [robusta coffee]
ref|XP_002282868.1|  PREDICTED: aldose 1-epimerase                      186   8e-54   Vitis vinifera
ref|XP_002282831.1|  PREDICTED: aldose 1-epimerase                      186   9e-54   Vitis vinifera
ref|XP_007151211.1|  hypothetical protein PHAVU_004G027000g             186   9e-54   Phaseolus vulgaris [French bean]
ref|XP_010242446.1|  PREDICTED: aldose 1-epimerase-like                 186   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_011008939.1|  PREDICTED: aldose 1-epimerase-like                 186   2e-53   Populus euphratica
ref|XP_002323843.2|  hypothetical protein POPTR_0017s11650g             185   3e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006373311.1|  hypothetical protein POPTR_0017s11660g             185   3e-53   Populus trichocarpa [western balsam poplar]
ref|XP_010256040.1|  PREDICTED: aldose 1-epimerase-like                 184   5e-53   Nelumbo nucifera [Indian lotus]
gb|KEH24988.1|  aldose 1-epimerase family protein                       184   6e-53   Medicago truncatula
ref|XP_006338472.1|  PREDICTED: aldose 1-epimerase-like                 184   7e-53   Solanum tuberosum [potatoes]
ref|XP_002305327.1|  hypothetical protein POPTR_0004s13470g             183   9e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006404338.1|  hypothetical protein EUTSA_v10010502mg             182   3e-52   
ref|XP_007032473.1|  Galactose mutarotase-like superfamily protein      182   3e-52   Theobroma cacao [chocolate]
ref|XP_009779460.1|  PREDICTED: aldose 1-epimerase-like isoform X9      182   3e-52   Nicotiana sylvestris
emb|CBA10127.1|  non-cell-autonomous protein pathway                    181   7e-52   Nicotiana benthamiana
ref|XP_004232229.1|  PREDICTED: aldose 1-epimerase-like                 181   8e-52   Solanum lycopersicum
ref|XP_006338468.1|  PREDICTED: aldose 1-epimerase-like                 181   1e-51   Solanum tuberosum [potatoes]
ref|XP_009624445.1|  PREDICTED: aldose 1-epimerase-like                 180   2e-51   Nicotiana tomentosiformis
gb|EYU34099.1|  hypothetical protein MIMGU_mgv1a008692mg                180   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_006400031.1|  hypothetical protein EUTSA_v10013324mg             183   2e-51   Eutrema salsugineum [saltwater cress]
gb|KDP31227.1|  hypothetical protein JCGZ_11603                         179   3e-51   Jatropha curcas
ref|XP_002871651.1|  hypothetical protein ARALYDRAFT_488355             182   3e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_009624449.1|  PREDICTED: aldose 1-epimerase-like isoform X1      179   5e-51   Nicotiana tomentosiformis
emb|CDX69547.1|  BnaA10g18960D                                          180   5e-51   
ref|XP_010693333.1|  PREDICTED: aldose 1-epimerase                      179   6e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002517486.1|  aldose-1-epimerase, putative                       178   9e-51   Ricinus communis
emb|CBI22179.3|  unnamed protein product                                187   1e-50   Vitis vinifera
ref|XP_010317286.1|  PREDICTED: aldose 1-epimerase-like                 179   1e-50   
dbj|BAK04813.1|  predicted protein                                      178   1e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006287626.1|  hypothetical protein CARUB_v10000838mg             180   2e-50   Capsella rubella
gb|KFK25751.1|  hypothetical protein AALP_AA8G154800                    181   2e-50   Arabis alpina [alpine rockcress]
ref|XP_008453675.1|  PREDICTED: aldose 1-epimerase                      177   2e-50   
ref|XP_009121605.1|  PREDICTED: aldose 1-epimerase isoform X1           180   3e-50   Brassica rapa
ref|XP_010453642.1|  PREDICTED: aldose 1-epimerase-like                 179   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_003579892.1|  PREDICTED: aldose 1-epimerase-like                 177   4e-50   Brachypodium distachyon [annual false brome]
ref|XP_010420168.1|  PREDICTED: aldose 1-epimerase-like                 179   5e-50   Camelina sativa [gold-of-pleasure]
ref|NP_197018.1|  aldose 1-epimerase-like protein                       179   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131443.1|  PREDICTED: aldose 1-epimerase-like                 179   8e-50   Brassica rapa
ref|XP_006384345.1|  hypothetical protein POPTR_0004s13470g             176   8e-50   
ref|XP_010524327.1|  PREDICTED: aldose 1-epimerase isoform X1           177   1e-49   Tarenaya hassleriana [spider flower]
gb|KJB33630.1|  hypothetical protein B456_006G023000                    176   1e-49   Gossypium raimondii
ref|XP_010492338.1|  PREDICTED: aldose 1-epimerase-like                 178   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002517487.1|  aldose-1-epimerase, putative                       175   2e-49   Ricinus communis
ref|XP_009779451.1|  PREDICTED: aldose 1-epimerase-like isoform X1      177   3e-49   Nicotiana sylvestris
ref|XP_010916998.1|  PREDICTED: aldose 1-epimerase-like                 174   5e-49   Elaeis guineensis
ref|XP_009779452.1|  PREDICTED: aldose 1-epimerase-like isoform X2      174   1e-48   Nicotiana sylvestris
ref|XP_010102873.1|  Aldose 1-epimerase                                 172   2e-48   Morus notabilis
ref|XP_012083800.1|  PREDICTED: aldose 1-epimerase-like                 172   2e-48   Jatropha curcas
ref|XP_008784468.1|  PREDICTED: aldose 1-epimerase-like                 172   2e-48   Phoenix dactylifera
ref|XP_008811569.1|  PREDICTED: aldose 1-epimerase-like                 172   3e-48   
ref|XP_008784475.1|  PREDICTED: aldose 1-epimerase-like                 171   5e-48   Phoenix dactylifera
ref|XP_009779453.1|  PREDICTED: aldose 1-epimerase-like isoform X3      173   5e-48   Nicotiana sylvestris
ref|XP_003575218.1|  PREDICTED: aldose 1-epimerase-like                 171   7e-48   Brachypodium distachyon [annual false brome]
gb|EMS48169.1|  Aldose 1-epimerase                                      167   2e-47   Triticum urartu
ref|XP_006653480.1|  PREDICTED: aldose 1-epimerase-like                 169   2e-47   
ref|XP_006648778.1|  PREDICTED: aldose 1-epimerase-like                 169   2e-47   
gb|KDP45488.1|  hypothetical protein JCGZ_09737                         169   2e-47   Jatropha curcas
ref|XP_008661291.1|  PREDICTED: hypothetical protein isoform X1         169   2e-47   Zea mays [maize]
ref|XP_010937062.1|  PREDICTED: aldose 1-epimerase-like                 169   2e-47   Elaeis guineensis
gb|EAZ23543.1|  hypothetical protein OsJ_07241                          169   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130052.1|  hypothetical protein precursor                     169   5e-47   Zea mays [maize]
dbj|BAK00680.1|  predicted protein                                      169   6e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001047214.1|  Os02g0575800                                       168   8e-47   
ref|XP_009414392.1|  PREDICTED: aldose 1-epimerase-like                 168   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001169820.1|  hypothetical protein precursor                     168   1e-46   Zea mays [maize]
ref|XP_004975839.1|  PREDICTED: aldose 1-epimerase-like                 167   1e-46   Setaria italica
ref|XP_009121606.1|  PREDICTED: aldose 1-epimerase isoform X2           170   2e-46   Brassica rapa
ref|XP_002452332.1|  hypothetical protein SORBIDRAFT_04g023830          167   4e-46   Sorghum bicolor [broomcorn]
ref|XP_009401394.1|  PREDICTED: aldose 1-epimerase-like                 165   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY86398.1|  hypothetical protein OsI_07776                          165   1e-45   Oryza sativa Indica Group [Indian rice]
gb|EMT25695.1|  Aldose 1-epimerase                                      162   1e-45   
gb|KGN46963.1|  hypothetical protein Csa_6G153465                       164   2e-45   Cucumis sativus [cucumbers]
ref|XP_006827141.1|  PREDICTED: aldose 1-epimerase                      164   4e-45   Amborella trichopoda
ref|XP_004952870.1|  PREDICTED: aldose 1-epimerase-like                 164   4e-45   Setaria italica
gb|EEC77395.1|  hypothetical protein OsI_16152                          164   6e-45   Oryza sativa Indica Group [Indian rice]
gb|EEE61117.1|  hypothetical protein OsJ_15041                          162   2e-44   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052977.1|  Os04g0458300                                       162   2e-44   
gb|ACF81147.1|  unknown                                                 160   3e-44   Zea mays [maize]
ref|XP_003579893.1|  PREDICTED: aldose 1-epimerase-like                 161   3e-44   Brachypodium distachyon [annual false brome]
ref|XP_012086275.1|  PREDICTED: aldose 1-epimerase-like                 160   4e-44   Jatropha curcas
ref|XP_011039151.1|  PREDICTED: aldose 1-epimerase-like                 160   6e-44   Populus euphratica
ref|XP_004975843.1|  PREDICTED: aldose 1-epimerase-like                 160   9e-44   Setaria italica
gb|EMS49869.1|  Aldose 1-epimerase                                      156   1e-43   Triticum urartu
gb|EMT00805.1|  Aldose 1-epimerase                                      160   1e-43   
gb|EMS49614.1|  Aldose 1-epimerase                                      158   2e-43   Triticum urartu
gb|EYU24186.1|  hypothetical protein MIMGU_mgv1a009569mg                158   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_002317867.1|  aldose 1-epimerase family protein                  158   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002446606.1|  hypothetical protein SORBIDRAFT_06g018800          159   4e-43   Sorghum bicolor [broomcorn]
tpg|DAA45585.1|  TPA: aldose 1-epimerase                                157   8e-43   
ref|XP_010679093.1|  PREDICTED: aldose 1-epimerase                      157   8e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001149545.1|  aldose 1-epimerase precursor                       157   8e-43   Zea mays [maize]
ref|XP_007036806.1|  Galactose mutarotase-like superfamily protei...    157   9e-43   
emb|CAH67072.1|  OSIGBa0097P08.2                                        157   1e-42   Oryza sativa [red rice]
ref|XP_002455882.1|  hypothetical protein SORBIDRAFT_03g026790          157   2e-42   Sorghum bicolor [broomcorn]
ref|XP_002530475.1|  aldose-1-epimerase, putative                       156   2e-42   Ricinus communis
ref|NP_001169236.1|  hypothetical protein precursor                     156   2e-42   Zea mays [maize]
gb|KJB30177.1|  hypothetical protein B456_005G132500                    155   2e-42   Gossypium raimondii
ref|XP_006651441.1|  PREDICTED: aldose 1-epimerase-like                 155   3e-42   
ref|XP_010099722.1|  Aldose 1-epimerase                                 155   3e-42   Morus notabilis
ref|XP_002465201.1|  hypothetical protein SORBIDRAFT_01g033970          156   3e-42   Sorghum bicolor [broomcorn]
gb|ACG28451.1|  aldose 1-epimerase precursor                            155   4e-42   Zea mays [maize]
ref|NP_001137118.1|  aldose 1-epimerase precursor                       155   4e-42   Zea mays [maize]
gb|KHG22159.1|  Aldose 1-epimerase                                      155   4e-42   Gossypium arboreum [tree cotton]
ref|XP_002282634.1|  PREDICTED: aldose 1-epimerase                      155   5e-42   Vitis vinifera
ref|XP_004975836.1|  PREDICTED: aldose 1-epimerase-like                 155   5e-42   Setaria italica
ref|XP_003559722.1|  PREDICTED: aldose 1-epimerase-like isoform X1      157   5e-42   Brachypodium distachyon [annual false brome]
ref|XP_011073000.1|  PREDICTED: aldose 1-epimerase                      154   6e-42   Sesamum indicum [beniseed]
ref|XP_002453661.1|  hypothetical protein SORBIDRAFT_04g010030          155   8e-42   
ref|XP_009620755.1|  PREDICTED: aldose 1-epimerase                      154   9e-42   Nicotiana tomentosiformis
ref|XP_004984206.1|  PREDICTED: aldose 1-epimerase-like                 155   9e-42   Setaria italica
ref|XP_008644102.1|  PREDICTED: hypothetical protein isoform X1         155   1e-41   
ref|XP_006298977.1|  hypothetical protein CARUB_v10015102mg             154   1e-41   Capsella rubella
gb|EMS54789.1|  Aldose 1-epimerase                                      152   3e-41   Triticum urartu
ref|NP_566594.2|  putative aldose 1-epimerase                           152   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008393430.1|  PREDICTED: aldose 1-epimerase-like                 152   4e-41   
gb|EAY90251.1|  hypothetical protein OsI_11823                          153   4e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_004235803.1|  PREDICTED: aldose 1-epimerase                      152   5e-41   Solanum lycopersicum
ref|XP_004975840.1|  PREDICTED: aldose 1-epimerase-like                 153   5e-41   Setaria italica
ref|NP_001050238.1|  Os03g0381000                                       153   6e-41   
ref|XP_002531177.1|  aldose-1-epimerase, putative                       152   6e-41   Ricinus communis
ref|XP_010034276.1|  PREDICTED: aldose 1-epimerase-like                 152   7e-41   Eucalyptus grandis [rose gum]
ref|XP_002885235.1|  aldose 1-epimerase family protein                  152   9e-41   
ref|XP_006451602.1|  hypothetical protein CICLE_v10008981mg             151   9e-41   
ref|XP_009360073.1|  PREDICTED: aldose 1-epimerase-like                 151   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_006341518.1|  PREDICTED: aldose 1-epimerase-like                 151   1e-40   Solanum tuberosum [potatoes]
ref|XP_002446608.1|  hypothetical protein SORBIDRAFT_06g018820          152   1e-40   
ref|XP_008374865.1|  PREDICTED: aldose 1-epimerase                      151   1e-40   Malus domestica [apple tree]
gb|KDO47395.1|  hypothetical protein CISIN_1g019518mg                   150   2e-40   Citrus sinensis [apfelsine]
gb|KFK39119.1|  hypothetical protein AALP_AA3G203500                    151   2e-40   Arabis alpina [alpine rockcress]
ref|XP_006490787.1|  PREDICTED: aldose 1-epimerase-like                 150   2e-40   Citrus sinensis [apfelsine]
ref|XP_010265811.1|  PREDICTED: aldose 1-epimerase-like                 150   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_009356028.1|  PREDICTED: aldose 1-epimerase-like                 150   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_002446609.1|  hypothetical protein SORBIDRAFT_06g018830          151   3e-40   Sorghum bicolor [broomcorn]
gb|ABK26409.1|  unknown                                                 151   3e-40   Picea sitchensis
gb|ABK21947.1|  unknown                                                 151   3e-40   Picea sitchensis
emb|CDJ26298.1|  unnamed protein product                                151   3e-40   Triticum aestivum [Canadian hard winter wheat]
emb|CDX70595.1|  BnaC03g06790D                                          149   3e-40   
emb|CDX78613.1|  BnaA03g05250D                                          149   3e-40   
emb|CDX92179.1|  BnaA05g22280D                                          150   3e-40   
ref|XP_009145951.1|  PREDICTED: aldose 1-epimerase                      150   3e-40   Brassica rapa
ref|XP_009766422.1|  PREDICTED: aldose 1-epimerase                      150   4e-40   Nicotiana sylvestris
gb|EMT09273.1|  Aldose 1-epimerase                                      149   4e-40   
gb|ADY61345.1|  aldose 1-epimerase                                      150   5e-40   Rubinisphaera brasiliensis DSM 5305
ref|XP_002446607.1|  hypothetical protein SORBIDRAFT_06g018810          150   5e-40   Sorghum bicolor [broomcorn]
ref|XP_010549060.1|  PREDICTED: aldose 1-epimerase                      149   5e-40   Tarenaya hassleriana [spider flower]
ref|XP_010274745.1|  PREDICTED: aldose 1-epimerase-like                 149   6e-40   Nelumbo nucifera [Indian lotus]
ref|XP_009113609.1|  PREDICTED: aldose 1-epimerase-like                 149   8e-40   Brassica rapa
ref|XP_006482094.1|  PREDICTED: aldose 1-epimerase-like                 149   9e-40   Citrus sinensis [apfelsine]
gb|EMT25696.1|  Aldose 1-epimerase                                      149   9e-40   
emb|CDX95801.1|  BnaC05g35520D                                          149   9e-40   
emb|CDM64824.1|  aldose 1-epimerase                                     149   1e-39   Pyrinomonas methylaliphatogenes
emb|CAD40900.2|  OSJNBa0036B21.18                                       150   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|WP_041974916.1|  aldose epimerase                                   149   1e-39   
ref|XP_010465867.1|  PREDICTED: aldose 1-epimerase-like                 149   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010930434.1|  PREDICTED: aldose 1-epimerase-like isoform X1      149   1e-39   Elaeis guineensis
emb|CDY18482.1|  BnaA01g27130D                                          148   1e-39   Brassica napus [oilseed rape]
gb|EMS48570.1|  Aldose 1-epimerase                                      146   2e-39   Triticum urartu
ref|XP_012077819.1|  PREDICTED: aldose 1-epimerase-like                 148   2e-39   Jatropha curcas
gb|EAZ30964.1|  hypothetical protein OsJ_15042                          148   3e-39   Oryza sativa Japonica Group [Japonica rice]
emb|CAD40901.2|  OSJNBa0036B21.19                                       148   3e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006406670.1|  hypothetical protein EUTSA_v10021070mg             147   3e-39   Eutrema salsugineum [saltwater cress]
gb|EAY94387.1|  hypothetical protein OsI_16154                          148   4e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_009417229.1|  PREDICTED: aldose 1-epimerase-like                 147   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI15585.3|  unnamed protein product                                147   4e-39   Vitis vinifera
ref|XP_006652377.1|  PREDICTED: aldose 1-epimerase-like                 147   4e-39   
emb|CDX91954.1|  BnaC03g32560D                                          149   5e-39   
ref|XP_003573719.1|  PREDICTED: aldose 1-epimerase                      147   5e-39   Brachypodium distachyon [annual false brome]
ref|XP_006372578.1|  hypothetical protein POPTR_0017s02950g             147   6e-39   Populus trichocarpa [western balsam poplar]
emb|CDX95566.1|  BnaC01g34580D                                          146   6e-39   
ref|XP_007037270.1|  Galactose mutarotase-like superfamily protein      148   7e-39   
gb|AEQ94127.1|  putative aldose 1-epimerase                             145   8e-39   Elaeis guineensis
ref|XP_006372579.1|  hypothetical protein POPTR_0017s02950g             147   8e-39   Populus trichocarpa [western balsam poplar]
ref|WP_033125852.1|  aldose epimerase                                   146   8e-39   Eubacterium sp. ER2
gb|KJB30178.1|  hypothetical protein B456_005G132500                    146   9e-39   Gossypium raimondii
ref|XP_002453662.1|  hypothetical protein SORBIDRAFT_04g010040          147   1e-38   
ref|XP_010918323.1|  PREDICTED: aldose 1-epimerase-like                 146   1e-38   
ref|XP_010487703.1|  PREDICTED: aldose 1-epimerase-like                 146   1e-38   
ref|XP_010506176.1|  PREDICTED: aldose 1-epimerase-like                 146   1e-38   
ref|WP_040664109.1|  aldose epimerase                                   146   1e-38   
gb|ABK22097.1|  unknown                                                 146   1e-38   
ref|WP_036841458.1|  hypothetical protein                               147   1e-38   
ref|XP_007225012.1|  hypothetical protein PRUPE_ppa020267mg             142   1e-38   
ref|XP_004975841.1|  PREDICTED: aldose 1-epimerase-like isoform X1      146   2e-38   
ref|WP_018107995.1|  hypothetical protein                               146   2e-38   
ref|XP_006430571.1|  hypothetical protein CICLE_v10012137mg             145   2e-38   
emb|CAH67073.1|  OSIGBa0097P08.3                                        141   2e-38   
ref|WP_038559255.1|  aldose epimerase                                   146   2e-38   
gb|AAK64036.1|  putative aldose 1-epimerase                             144   3e-38   
ref|WP_007659321.1|  aldose 1-epimerase                                 145   4e-38   
ref|XP_003579891.1|  PREDICTED: aldose 1-epimerase-like                 145   4e-38   
ref|XP_011001586.1|  PREDICTED: aldose 1-epimerase-like isoform X2      145   4e-38   
emb|CDX74292.1|  BnaA03g27550D                                          146   4e-38   
ref|WP_045027250.1|  aldose epimerase                                   145   5e-38   
ref|XP_011001585.1|  PREDICTED: aldose 1-epimerase-like isoform X1      144   6e-38   
ref|NP_001052979.1|  Os04g0458600                                       144   6e-38   
ref|WP_027621617.1|  aldose epimerase [                                 144   7e-38   
ref|XP_009134623.1|  PREDICTED: aldose 1-epimerase                      146   7e-38   
ref|XP_008669323.1|  PREDICTED: aldose 1-epimerase-like                 144   8e-38   
ref|XP_004137351.1|  PREDICTED: aldose 1-epimerase                      144   8e-38   
ref|XP_004975838.1|  PREDICTED: aldose 1-epimerase-like                 144   1e-37   
ref|WP_013071577.1|  aldose 1-epimerase                                 144   1e-37   
ref|XP_008453487.1|  PREDICTED: aldose 1-epimerase                      143   1e-37   
ref|XP_007209327.1|  hypothetical protein PRUPE_ppa008258mg             143   1e-37   
ref|WP_044217291.1|  hypothetical protein                               144   1e-37   
ref|XP_002466911.1|  hypothetical protein SORBIDRAFT_01g016500          145   1e-37   
ref|XP_008240141.1|  PREDICTED: aldose 1-epimerase                      143   1e-37   
ref|WP_041400237.1|  aldose epimerase                                   143   2e-37   
dbj|BAJ88499.1|  predicted protein                                      144   2e-37   
gb|EYU33340.1|  hypothetical protein MIMGU_mgv1a009621mg                142   2e-37   
ref|XP_006826839.1|  PREDICTED: aldose 1-epimerase                      143   2e-37   
ref|WP_018478674.1|  aldose 1-epimerase                                 144   2e-37   
gb|AEW20149.1|  aldose 1-epimerase                                      143   3e-37   
ref|XP_008644114.1|  PREDICTED: uncharacterized protein LOC100383...    144   3e-37   
dbj|BAJ86209.1|  predicted protein                                      143   3e-37   
ref|WP_041590639.1|  aldose epimerase                                   143   3e-37   
ref|XP_004982549.1|  PREDICTED: aldose 1-epimerase-like                 144   3e-37   
gb|KHN30819.1|  Aldose 1-epimerase                                      141   3e-37   
gb|ADE77915.1|  unknown                                                 143   3e-37   
ref|XP_009405677.1|  PREDICTED: aldose 1-epimerase-like                 142   4e-37   
ref|XP_002467340.1|  hypothetical protein SORBIDRAFT_01g025920          142   4e-37   
ref|WP_034838382.1|  aldose epimerase [                                 142   4e-37   
gb|AFK40570.1|  unknown                                                 142   4e-37   
emb|CBW45774.1|  ORW1943Ba0077G13.2                                     143   5e-37   
ref|WP_041869949.1|  aldose epimerase                                   142   6e-37   
ref|WP_041623122.1|  aldose epimerase                                   142   6e-37   
ref|WP_019540801.1|  hypothetical protein                               142   8e-37   
gb|ADN01229.1|  aldose 1-epimerase                                      142   1e-36   
ref|WP_028788649.1|  aldose epimerase                                   141   1e-36   
ref|WP_006863461.1|  aldose 1-epimerase                                 140   1e-36   
gb|EMI57219.1|  aldose 1-epimerase                                      141   2e-36   
ref|WP_006926540.1|  aldose 1-epimerase                                 141   2e-36   
ref|WP_014623924.1|  aldose epimerase                                   140   3e-36   
ref|NP_001140553.1|  aldose 1-epimerase                                 140   3e-36   
ref|WP_021653970.1|  putative aldose 1-epimerase                        140   3e-36   
ref|WP_045687938.1|  aldose epimerase                                   140   3e-36   
emb|CDO98338.1|  unnamed protein product                                139   4e-36   
ref|XP_004299522.1|  PREDICTED: aldose 1-epimerase                      139   4e-36   
ref|WP_022016167.1|  aldose 1-epimerase                                 139   6e-36   
ref|WP_036940895.1|  aldose epimerase                                   139   6e-36   
ref|WP_016218482.1|  hypothetical protein                               139   6e-36   
ref|WP_013445643.1|  aldose 1-epimerase                                 139   6e-36   
ref|WP_040352079.1|  aldose epimerase                                   139   7e-36   
gb|EAQ79063.1|  putative aldose 1-epimerase                             139   7e-36   
ref|WP_020211621.1|  hypothetical protein                               139   7e-36   
ref|WP_044018224.1|  aldose epimerase                                   139   7e-36   
gb|AII50869.1|  hypothetical protein N008_02595                         139   8e-36   
ref|WP_017553761.1|  aldose 1-epimerase                                 139   9e-36   
ref|WP_044237505.1|  aldose epimerase                                   139   9e-36   
ref|WP_015561453.1|  aldose 1-epimerase                                 138   9e-36   
ref|WP_015521587.1|  aldose 1-epimerase                                 138   9e-36   
ref|WP_026463540.1|  aldose epimerase                                   139   9e-36   
gb|EEV00091.1|  aldose 1-epimerase                                      139   1e-35   
ref|XP_006651555.1|  PREDICTED: uncharacterized protein LOC102719852    142   1e-35   
ref|WP_004064637.1|  hypothetical protein                               138   1e-35   
ref|WP_004617403.1|  aldose 1-epimerase [                               138   1e-35   
ref|WP_022307330.1|  aldose 1-epimerase                                 139   1e-35   
gb|EMI57069.1|  aldose 1-epimerase                                      138   2e-35   
ref|XP_003619838.1|  Aldose 1-epimerase family protein expressed        137   2e-35   
ref|WP_045144314.1|  aldose epimerase                                   138   2e-35   
gb|KJZ83745.1|  hypothetical protein ClosIBUN125C_CONTIG69g03860        138   2e-35   
ref|WP_037518354.1|  aldose epimerase                                   135   2e-35   
ref|WP_019721657.1|  aldose 1-epimerase                                 137   2e-35   
ref|WP_008508962.1|  aldose 1-epimerase                                 138   2e-35   
ref|WP_003424848.1|  aldose 1-epimerase                                 137   2e-35   
ref|WP_014312835.1|  aldose 1-epimerase                                 137   2e-35   
ref|WP_020816729.1|  aldose 1-epimerase [                               137   2e-35   
gb|EDS00721.1|  aldose 1-epimerase [ [                                  137   2e-35   
ref|WP_044301469.1|  aldose epimerase                                   137   2e-35   
ref|WP_026684383.1|  aldose epimerase                                   137   2e-35   
ref|WP_019662762.1|  hypothetical protein [                             137   3e-35   
ref|WP_013858582.1|  aldose 1-epimerase                                 137   3e-35   
ref|WP_022278891.1|  aldose 1-epimerase                                 137   3e-35   
ref|WP_018358534.1|  hypothetical protein                               137   3e-35   
ref|WP_005339463.1|  aldose 1-epimerase                                 137   3e-35   
ref|WP_029731461.1|  aldose epimerase                                   137   3e-35   
ref|WP_005333146.1|  aldose 1-epimerase                                 137   3e-35   
ref|WP_026993202.1|  aldose epimerase                                   138   3e-35   
ref|WP_024039225.1|  Aldose 1-epimerase Mutarotase                      137   4e-35   
ref|WP_025865487.1|  aldose epimerase                                   137   4e-35   
ref|WP_021861593.1|  hypothetical protein                               137   4e-35   
ref|WP_022270370.1|  galactose mutarotase                               137   4e-35   
ref|NP_001064192.1|  Os10g0155500                                       137   4e-35   
ref|WP_034257000.1|  aldose epimerase                                   137   4e-35   
ref|WP_005951654.1|  aldose 1-epimerase                                 136   5e-35   
ref|WP_022146723.1|  glycoside hydrolase family 2                       141   6e-35   
emb|CBL34753.1|  Galactose mutarotase and related enzymes [ [           136   6e-35   
ref|WP_027613879.1|  aldose epimerase                                   137   6e-35   
ref|XP_006661643.1|  PREDICTED: aldose 1-epimerase-like                 136   7e-35   
ref|WP_040547305.1|  aldose epimerase                                   137   7e-35   
gb|EZP33393.1|  aldose 1-epimerase                                      137   7e-35   
gb|EEF62009.1|  Aldose 1-epimerase                                      137   7e-35   
ref|WP_038239171.1|  aldose epimerase                                   137   8e-35   
ref|WP_041074064.1|  aldose epimerase                                   136   8e-35   
gb|EMS49868.1|  Aldose 1-epimerase                                      136   9e-35   
ref|WP_021845887.1|  hypothetical protein                               135   9e-35   
ref|WP_027635444.1|  aldose epimerase                                   136   9e-35   
ref|WP_038538988.1|  aldose epimerase                                   136   9e-35   
ref|WP_008421962.1|  galactose mutarotase-like enzyme                   135   1e-34   
ref|WP_043662418.1|  aldose epimerase                                   135   1e-34   
gb|ENZ35675.1|  hypothetical protein HMPREF1084_00256                   135   1e-34   
ref|XP_004512748.1|  PREDICTED: aldose 1-epimerase-like                 135   1e-34   
ref|WP_033127854.1|  aldose epimerase                                   135   1e-34   
ref|WP_035778694.1|  aldose epimerase                                   135   1e-34   
ref|WP_024994124.1|  aldose epimerase                                   136   1e-34   
ref|WP_022744046.1|  aldose 1-epimerase Mro                             135   2e-34   
ref|WP_029142561.1|  aldose epimerase                                   135   2e-34   
ref|WP_035763642.1|  aldose epimerase                                   135   2e-34   
dbj|BAK01606.1|  predicted protein                                      135   2e-34   
ref|WP_017551613.1|  aldose 1-epimerase                                 135   2e-34   
ref|WP_022211643.1|  aldose 1-epimerase (Mutarotase)                    135   2e-34   
ref|WP_007966636.1|  aldose 1-epimerase                                 135   2e-34   
ref|WP_044250763.1|  aldose epimerase                                   135   3e-34   
emb|CBK96441.1|  Galactose mutarotase and related enzymes [ [           134   3e-34   
ref|WP_030131542.1|  aldose epimerase                                   135   3e-34   
ref|WP_013409208.1|  aldose 1-epimerase                                 135   3e-34   
ref|WP_014066170.1|  aldose 1-epimerase                                 135   3e-34   
ref|WP_024833661.1|  aldose epimerase [                                 134   3e-34   
ref|WP_012842988.1|  aldose 1-epimerase                                 135   3e-34   
ref|WP_011120973.1|  aldose 1-epimerase                                 135   3e-34   
gb|EEP54346.1|  aldose 1-epimerase (Mutarotase)                         134   4e-34   
ref|WP_014095915.1|  aldose 1-epimerase                                 134   4e-34   
ref|WP_022318568.1|  hypothetical protein                               134   4e-34   
ref|WP_007334035.1|  aldose 1-epimerase                                 135   4e-34   
ref|WP_003408331.1|  aldose 1-epimerase                                 134   4e-34   
ref|WP_013073698.1|  aldose 1-epimerase                                 135   4e-34   
ref|WP_035567082.1|  aldose epimerase                                   134   4e-34   
ref|WP_022931478.1|  aldose-1-epimerase                                 134   5e-34   
gb|EAY77740.1|  hypothetical protein OsI_32784                          134   5e-34   
ref|WP_020733607.1|  aldose 1-epimerase                                 134   5e-34   
ref|WP_034631172.1|  aldose epimerase                                   134   5e-34   
gb|ELP31737.1|  aldose 1-epimerase                                      134   5e-34   
ref|WP_019110338.1|  hypothetical protein                               134   5e-34   
ref|WP_036161484.1|  aldose epimerase                                   134   5e-34   
ref|WP_019113234.1|  MULTISPECIES: hypothetical protein                 134   5e-34   
ref|WP_040205202.1|  MULTISPECIES: aldose epimerase                     134   5e-34   
ref|WP_026564614.1|  aldose epimerase                                   134   5e-34   
ref|WP_037247654.1|  aldose epimerase                                   134   6e-34   
ref|WP_044054627.1|  aldose epimerase                                   134   6e-34   
ref|XP_002964577.1|  hypothetical protein SELMODRAFT_230384             134   6e-34   
ref|WP_011335064.1|  aldose 1-epimerase                                 134   6e-34   
ref|WP_039767651.1|  aldose epimerase                                   134   6e-34   
ref|WP_025108882.1|  aldose epimerase                                   134   6e-34   
ref|WP_020150087.1|  hypothetical protein                               134   6e-34   
ref|WP_015924930.1|  aldose 1-epimerase [                               134   6e-34   
ref|WP_010165749.1|  aldose 1-epimerase precursor                       133   6e-34   
ref|WP_026573630.1|  aldose epimerase                                   134   6e-34   
ref|WP_015333715.1|  aldose 1-epimerase                                 134   6e-34   
ref|WP_022061811.1|  aldose 1-epimerase                                 134   6e-34   
ref|WP_011521952.1|  aldose 1-epimerase                                 134   7e-34   
ref|WP_025762496.1|  aldose epimerase                                   134   7e-34   
gb|EMI46871.1|  aldose 1-epimerase                                      134   7e-34   
ref|WP_039652883.1|  aldose epimerase                                   134   7e-34   
ref|WP_006442118.1|  aldose 1-epimerase [                               133   7e-34   
emb|CEA15864.1|  Aldose 1-epimerase                                     134   8e-34   
ref|WP_014081245.1|  aldose 1-epimerase                                 133   8e-34   
ref|WP_045089631.1|  aldose epimerase                                   134   8e-34   
tpg|DAA52461.1|  TPA: hypothetical protein ZEAMMB73_264756              128   9e-34   
ref|XP_002988820.1|  hypothetical protein SELMODRAFT_159754             133   1e-33   
ref|WP_034673504.1|  aldose epimerase                                   133   1e-33   
dbj|BAK02841.1|  predicted protein                                      133   1e-33   
dbj|GAA79177.1|  aldose 1-epimerase                                     133   1e-33   
ref|WP_003223585.1|  aldose 1-epimerase                                 133   1e-33   
ref|WP_027294600.1|  aldose epimerase                                   133   1e-33   
ref|WP_003217768.1|  aldose 1-epimerase                                 133   1e-33   
gb|EMS45763.1|  Aldose 1-epimerase                                      132   1e-33   
tpg|DAA52459.1|  TPA: hypothetical protein ZEAMMB73_264756              127   1e-33   
ref|WP_015812285.1|  aldose 1-epimerase                                 133   1e-33   
ref|WP_028665552.1|  aldose epimerase                                   133   1e-33   
gb|KCW84110.1|  hypothetical protein EUGRSUZ_B00995                     132   1e-33   
ref|WP_005789502.1|  aldose 1-epimerase                                 133   2e-33   
dbj|GAE90470.1|  aldose 1-epimerase [ [                                 129   2e-33   
ref|WP_032880420.1|  aldose epimerase                                   133   2e-33   
gb|EKX60342.1|  putative aldose 1-epimerase                             132   2e-33   
ref|WP_026753440.1|  aldose epimerase                                   133   2e-33   
gb|AAL75737.1|AC091724_10  Putative aldose 1-epimerase - like pro...    132   2e-33   
ref|WP_017480282.1|  aldose 1-epimerase                                 133   2e-33   
ref|WP_009280335.1|  aldose 1-epimerase                                 133   2e-33   
ref|WP_033015491.1|  aldose epimerase                                   133   2e-33   
ref|WP_022455255.1|  putative aldose 1-epimerase                        133   2e-33   
ref|WP_044117718.1|  aldose epimerase                                   132   2e-33   
ref|WP_031425197.1|  aldose epimerase                                   133   2e-33   
ref|WP_008695088.1|  aldose 1-epimerase                                 132   2e-33   
ref|WP_026314142.1|  aldose epimerase                                   132   2e-33   
ref|WP_012741263.1|  aldose 1-epimerase                                 132   2e-33   
ref|WP_044743631.1|  aldose epimerase                                   132   2e-33   
dbj|BAC43284.1|  putative aldose 1-epimerase                            131   2e-33   
ref|WP_033103073.1|  MULTISPECIES: aldose epimerase                     133   2e-33   
ref|WP_044295053.1|  aldose epimerase                                   132   2e-33   
ref|XP_004983378.1|  PREDICTED: aldose 1-epimerase-like                 132   2e-33   
ref|WP_044301337.1|  aldose epimerase                                   132   2e-33   
ref|WP_022285289.1|  glycoside hydrolase family 2                       137   2e-33   
ref|WP_007951598.1|  aldose 1-epimerase                                 132   3e-33   
ref|WP_008373642.1|  MULTISPECIES: aldose 1-epimerase                   132   3e-33   
ref|WP_042394740.1|  aldose epimerase                                   132   3e-33   
ref|WP_028846628.1|  aldose epimerase                                   132   3e-33   



>ref|XP_009615365.1| PREDICTED: aldose 1-epimerase [Nicotiana tomentosiformis]
Length=353

 Score =   261 bits (667),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            LL    L + + G+ C A E++ +YE+K+G FSVKITNYGATV+SVILPDKNG L DVVL
Sbjct  6    LLYCFALIILILGNPCTAEEEIKVYELKKGDFSVKITNYGATVLSVILPDKNGNLDDVVL  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G++S++DYKNDT YFG ++GRVANRIGGA F+LNGVEYKLPANDHGNTLHGG KGFSDVI
Sbjct  66   GYNSIEDYKNDTTYFGGLIGRVANRIGGAKFELNGVEYKLPANDHGNTLHGGSKGFSDVI  125

Query  424  WTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            WTVEDY++DSHLTL+YNS+DGEQGFPG+LSV VTY+FIG NKL I
Sbjct  126  WTVEDYQEDSHLTLTYNSFDGEQGFPGDLSVKVTYMFIGTNKLAI  170



>ref|XP_009803676.1| PREDICTED: aldose 1-epimerase [Nicotiana sylvestris]
Length=353

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            LL    L + + G+ C A E++ +YE+K+G FSVKITNYGATV+SV+LPDKNGKL DVVL
Sbjct  6    LLYCFALVILILGNICRAEEEIKVYELKKGDFSVKITNYGATVLSVVLPDKNGKLDDVVL  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G++S+DDYKNDT YFG ++GRVANRIGGA F+LNGVEYKLPANDHGNTLHGG KGFSDVI
Sbjct  66   GYNSIDDYKNDTTYFGGLIGRVANRIGGAKFELNGVEYKLPANDHGNTLHGGSKGFSDVI  125

Query  424  WTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            WTVEDY+ DSHLTL+Y S+DGEQGFPG+LSV V Y+FIG NKL I
Sbjct  126  WTVEDYQADSHLTLTYKSFDGEQGFPGDLSVKVKYMFIGTNKLAI  170



>ref|XP_006344389.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=355

 Score =   256 bits (655),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +1

Query  94   LTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKN  273
            L  + C A+E+V +YE+K+G FSVKITNYGATV+SVILPDKNGKL DVVLG+DS+DDYKN
Sbjct  17   LCKNSCRATEEVKVYELKKGDFSVKITNYGATVLSVILPDKNGKLDDVVLGYDSIDDYKN  76

Query  274  DTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDS  453
            DT YFG ++GRVANRIGGA F+LNGVEYKLPANDHGNTLHGG KGFS VIWTVED+++DS
Sbjct  77   DTTYFGGLIGRVANRIGGAKFELNGVEYKLPANDHGNTLHGGSKGFSSVIWTVEDFEEDS  136

Query  454  HLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            HLTL+YNS+DGEQGFPGNLSV VTY+FI  NKL +
Sbjct  137  HLTLTYNSFDGEQGFPGNLSVEVTYMFIETNKLAL  171



>ref|XP_004236201.1| PREDICTED: aldose 1-epimerase [Solanum lycopersicum]
Length=355

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +1

Query  94   LTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKN  273
            L  + C A+E++ +YE+K+G FSVKITNYGATV+SVILPDKNGKL DVVLG+DS+DDYKN
Sbjct  17   LCKNSCKATEEIKVYELKKGDFSVKITNYGATVLSVILPDKNGKLDDVVLGYDSIDDYKN  76

Query  274  DTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDS  453
            DT YFG ++GRVANRIGGA F+LNGVEY LPANDHGNTLHGG KGFS VIWTVED+++DS
Sbjct  77   DTTYFGGLIGRVANRIGGAKFELNGVEYILPANDHGNTLHGGSKGFSSVIWTVEDFEEDS  136

Query  454  HLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            HLTL+Y+S+DGEQGFPGN+SV VTY+FI  NKL +
Sbjct  137  HLTLTYDSFDGEQGFPGNVSVEVTYMFIETNKLAL  171



>ref|XP_011071623.1| PREDICTED: aldose 1-epimerase [Sesamum indicum]
Length=353

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 140/171 (82%), Gaps = 3/171 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            M   Y  L  L+    L+   C+A+E++GIYE++RG FSVKITNYGATV+SV+LPD+NGK
Sbjct  1    MGKAYLCLCVLITAFALS---CEAAEKIGIYELQRGDFSVKITNYGATVLSVVLPDRNGK  57

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            L DVVLG+ S+D+YKNDT YFGAIVGRVANRIGGA F LNG  Y LPANDHGNTLHGG  
Sbjct  58   LDDVVLGYGSIDEYKNDTTYFGAIVGRVANRIGGAKFTLNGKLYNLPANDHGNTLHGGTI  117

Query  406  GFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GFSDV+WTVE Y K+SHLTL+Y+S+DGEQGFPG+LSV VTY+ I  NKLGI
Sbjct  118  GFSDVVWTVESYVKNSHLTLTYHSHDGEQGFPGDLSVMVTYMLIDTNKLGI  168



>gb|EYU35859.1| hypothetical protein MIMGU_mgv1a008920mg [Erythranthe guttata]
Length=358

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 142/168 (85%), Gaps = 3/168 (2%)
 Frame = +1

Query  64   LLSFLVLGVF-LTGSFCDAS--EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGD  234
            LL F ++  F L  + C AS  +++GIY ++RG FSVKITNYGATV+S+++PD+NGKL D
Sbjct  5    LLCFSLIAAFALILNVCIASSDQEIGIYHLQRGKFSVKITNYGATVLSLLVPDRNGKLDD  64

Query  235  VVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFS  414
            +VLG+ S+DDYKNDT YFGA++GRVANRIGGA F LNG  YKLPANDHGNTLHGG KGFS
Sbjct  65   IVLGYGSIDDYKNDTTYFGALIGRVANRIGGAKFTLNGRVYKLPANDHGNTLHGGSKGFS  124

Query  415  DVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            DVIWTV+++ K SHLTL+Y S+DGEQGFPG L+VTVTY+FIGK+KL I
Sbjct  125  DVIWTVKEHVKRSHLTLTYLSHDGEQGFPGKLAVTVTYMFIGKHKLAI  172



>ref|XP_002268039.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
 emb|CBI15252.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            MA +  L  FL+L  F      +AS ++G+YE+KRG+FSVK+TNYGATV+SVILPD+NGK
Sbjct  1    MAKIRELCCFLLLA-FAIAKVSEASSEIGVYELKRGNFSVKLTNYGATVVSVILPDRNGK  59

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            L DVVLGFDSV+DYKNDT YFGAIVGRVANRI GA F LNG +YKL  N+  N LHGG K
Sbjct  60   LDDVVLGFDSVEDYKNDTTYFGAIVGRVANRIKGAQFTLNGKKYKLVPNEGKNMLHGGPK  119

Query  406  GFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GFSDVIW V+ Y K+SH+T  Y+S+DGE+GFPG+L V+VTY+F   NKL I
Sbjct  120  GFSDVIWHVQSYDKNSHVTFVYHSFDGEEGFPGDLHVSVTYMFFQTNKLVI  170



>gb|KJB39892.1| hypothetical protein B456_007G036000 [Gossypium raimondii]
Length=352

 Score =   226 bits (575),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 133/172 (77%), Gaps = 6/172 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFC-DASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            MA ++    F+VL      S C   ++ V +YE+KRG FS K TNYGAT++SVILPDK G
Sbjct  1    MANIFSFCVFIVLS-----SLCFSKAQHVKVYELKRGYFSAKFTNYGATMLSVILPDKTG  55

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
            KL DVVLG+D V+DYKNDT YFGAIVGRVANRIGGA F LNGV YK  AND  NTLHGG 
Sbjct  56   KLDDVVLGYDMVNDYKNDTTYFGAIVGRVANRIGGAKFILNGVTYKTDANDGKNTLHGGS  115

Query  403  KGFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            KGFSDVIWTV+ YKK SH+T SY S+DGE+GFPGNLSV+VTY+ + K+KL +
Sbjct  116  KGFSDVIWTVKSYKKHSHVTFSYESFDGEEGFPGNLSVSVTYMLLHKSKLAV  167



>gb|EPS71547.1| hypothetical protein M569_03212, partial [Genlisea aurea]
Length=329

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  127  VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGR  306
            +G+YE+ RG FS KITNYGATV+S++ PDKNG+LGDVVLGF +VD YKNDT YFGAIVGR
Sbjct  1    IGVYELGRGDFSAKITNYGATVVSIVFPDKNGELGDVVLGFPTVDGYKNDTTYFGAIVGR  60

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLSYNSYDG  486
            VANRI GA F LNG  Y LPANDHGNTLHGG  GFSDV+W VE++ +DSHL LSY+S+DG
Sbjct  61   VANRIAGAKFSLNGTVYHLPANDHGNTLHGGRIGFSDVVWNVEEHVEDSHLVLSYDSFDG  120

Query  487  EQGFPGNLSVTVTYLFIGKNKLGI  558
            +QGFPG +SVTVTYL IG ++L I
Sbjct  121  DQGFPGEISVTVTYLLIGTDRLAI  144



>ref|XP_007210522.1| hypothetical protein PRUPE_ppa007822mg [Prunus persica]
 gb|EMJ11721.1| hypothetical protein PRUPE_ppa007822mg [Prunus persica]
Length=354

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +1

Query  70   SFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGF  249
             FL+L +    S  +A+++VGIYE+K+G FSVK+TNYGATV+SV+LPDKNGKL DVVL F
Sbjct  10   CFLLLPLVFYCS--EANQKVGIYELKKGDFSVKLTNYGATVLSVVLPDKNGKLDDVVLAF  67

Query  250  DSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWT  429
            +S+ DY ND+ YFGAIVGRVANRIG A F LNGV YKL AN+  NTLHGG+KGFSDV+WT
Sbjct  68   ESLKDYSNDSVYFGAIVGRVANRIGSAQFSLNGVHYKLVANEGKNTLHGGLKGFSDVVWT  127

Query  430  VEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            V+ Y +DSH+T +YNS DGEQGFPG+L V+VTY+ +  NKL I
Sbjct  128  VKSYIEDSHITFTYNSLDGEQGFPGDLVVSVTYMLVETNKLAI  170



>ref|XP_008239819.1| PREDICTED: aldose 1-epimerase [Prunus mume]
Length=366

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +1

Query  70   SFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGF  249
             FL+L +    S  +A+++VGIYE+K+G FSVK+TNYGATV+SV+LPDKNGKL DVVL F
Sbjct  22   CFLLLPLVFYCS--EANQKVGIYELKKGDFSVKLTNYGATVLSVVLPDKNGKLDDVVLAF  79

Query  250  DSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWT  429
            +S+ DY ND+ YFGAIVGRVANRIG A F LNGV YKL AN+  NTLHGG+KGFSDV+WT
Sbjct  80   ESLKDYSNDSVYFGAIVGRVANRIGSAQFSLNGVHYKLVANEGKNTLHGGLKGFSDVVWT  139

Query  430  VEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            V+ Y +DSH+T +YNS DGEQGFPG+L V+VTY+ +  NKL I
Sbjct  140  VKSYIEDSHITFTYNSLDGEQGFPGDLVVSVTYMLVETNKLAI  182



>ref|XP_004508757.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Cicer arietinum]
Length=353

 Score =   218 bits (554),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +1

Query  103  SFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA  282
            +     E++G YE+KRG+  + +TNYGATVISVI+PDK+G L DVVLG+DS++ Y+NDT 
Sbjct  18   THAHQHEKIGFYELKRGNMRLNLTNYGATVISVIVPDKHGNLADVVLGYDSINSYENDTC  77

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLT  462
            YFGA++GRVANRIGGA F L+G  YKLP NDHGNTLHGG KGFSDVIWTV+ +++D+H+T
Sbjct  78   YFGALIGRVANRIGGAQFTLDGKTYKLPVNDHGNTLHGGTKGFSDVIWTVKSHREDNHIT  137

Query  463  LSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             +Y+S+D EQGFPG L V+VTY+  G+N LG+
Sbjct  138  FTYDSFDNEQGFPGKLEVSVTYMLFGRNLLGV  169



>ref|XP_008453190.1| PREDICTED: aldose 1-epimerase-like [Cucumis melo]
Length=353

 Score =   217 bits (552),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 4/171 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            MA +  L+  LV+ V     F + ++ VGIYE++RG+FS+K+TNYGAT++S+ILPDKNGK
Sbjct  1    MAKVLPLIFLLVVSVI---GFSNGND-VGIYELRRGNFSIKLTNYGATILSLILPDKNGK  56

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
              DVVL F SVDD++NDT YFG IVGRVANRIGGA F +NGV YKL  ND  N LHGG K
Sbjct  57   WDDVVLSFPSVDDFRNDTTYFGNIVGRVANRIGGAQFGINGVFYKLTPNDGRNLLHGGKK  116

Query  406  GFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GF DVIW +E Y KDSH+T +Y+S+DGEQGFPG+L V+VTY+FI  NKLG+
Sbjct  117  GFGDVIWKMESYVKDSHITFTYDSFDGEQGFPGDLPVSVTYMFIETNKLGV  167



>ref|XP_010547806.1| PREDICTED: aldose 1-epimerase-like [Tarenaya hassleriana]
Length=357

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 133/174 (76%), Gaps = 3/174 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVL--GVFLTGS-FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDK  216
            MA L  +   LVL   V L+ S +    E++GIYE+KRG FSVK TNYGA +IS++ PDK
Sbjct  1    MAKLMSVSGVLVLMMSVLLSCSEYSVCEEKIGIYELKRGDFSVKFTNYGAVMISLLTPDK  60

Query  217  NGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHG  396
            NGK+ DVVLGFDS D YKNDT YFGAIVGRVANRIGGA F LNG  +KL  ND  NTLHG
Sbjct  61   NGKVDDVVLGFDSPDGYKNDTTYFGAIVGRVANRIGGAKFMLNGHLHKLAPNDGKNTLHG  120

Query  397  GIKGFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G KGFSDV+W V+ YK DSH+T +Y+S+DGE+GFPG++SV VTY+ +  NKLG+
Sbjct  121  GKKGFSDVVWKVQSYKPDSHITFTYDSFDGEEGFPGDVSVKVTYMLMETNKLGV  174



>ref|XP_011029977.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=354

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            MA ++    F+ L +F        +E +GIYE+K G FSVK+TNYGATVISVILPDKNGK
Sbjct  1    MANIFLFSCFVYLILFFANDVEAVNEDIGIYELKMGDFSVKLTNYGATVISVILPDKNGK  60

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            L D+VLGFDSVDDYKNDT YFGAIVGRVANRIG A F L+G +YKL  ND  N LHGG+K
Sbjct  61   LDDIVLGFDSVDDYKNDTTYFGAIVGRVANRIGRAQFTLDGTDYKLVPNDGRNMLHGGLK  120

Query  406  GFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GFS+VIW V  +  D+H+T +YNS+DGE+GFPG+++V+VTY+ +  NKL +
Sbjct  121  GFSEVIWGVGSH-DDNHVTFTYNSFDGEEGFPGDVAVSVTYMLVKTNKLAV  170



>ref|XP_003550776.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
 gb|KHN18538.1| Aldose 1-epimerase [Glycine soja]
Length=351

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            +++G YE+KRG   + +TNYGAT+ISVI PDK+GKL D+VLG+DS+D YKNDT YFGA++
Sbjct  24   KKIGFYELKRGDLRLNLTNYGATIISVITPDKHGKLADIVLGYDSIDSYKNDTVYFGALI  83

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLSYNSY  480
            GRVANRI GA F L+G  YKLPANDHGNTLHGG +GF DV+W+VE +KK  H+T +Y+S+
Sbjct  84   GRVANRIRGAKFTLDGKTYKLPANDHGNTLHGGARGFGDVVWSVESHKKHRHVTFTYDSF  143

Query  481  DGEQGFPGNLSVTVTYLFIGKNKLGI  558
            + EQGFPG L V+VTY+ IG++KL +
Sbjct  144  ENEQGFPGKLKVSVTYMLIGRHKLAV  169



>ref|XP_010550628.1| PREDICTED: aldose 1-epimerase-like [Tarenaya hassleriana]
Length=356

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  109  CDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYF  288
             +   ++GIYE+KRG FSVK TNYGA +IS+++PDK+GK+ DVVLGFDSVD YKNDT YF
Sbjct  21   SEEDRKIGIYELKRGDFSVKFTNYGAVMISLLIPDKHGKVDDVVLGFDSVDSYKNDTTYF  80

Query  289  GAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLS  468
            GAIVGRVANRIGGA F+L G  YKL  N+  NTLHGG KGFSDVIWTV  YK DSH+T +
Sbjct  81   GAIVGRVANRIGGAKFELEGHLYKLVPNEGRNTLHGGKKGFSDVIWTVRSYKPDSHVTFT  140

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y+S+DGE+GFPG++ V VTY+ +G N+LG+
Sbjct  141  YHSFDGEEGFPGDVEVKVTYMIMGTNELGV  170



>ref|XP_007037277.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
 gb|EOY21778.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
Length=455

 Score =   215 bits (547),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            E++G+YE+K+G F    TNYGA ++S++LPDK GKL D+VLG+DSV+DYKNDT YFGAIV
Sbjct  126  EEIGVYELKKGDFFANFTNYGAVMLSLVLPDKTGKLDDIVLGYDSVEDYKNDTTYFGAIV  185

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLSYNSY  480
            GRVANRI GA F +NGV YKL AN+  NTLHGG KGF+DVIW V +YK+DSH+T +Y S+
Sbjct  186  GRVANRIKGAEFTINGVSYKLVANEGKNTLHGGSKGFADVIWHVRNYKQDSHVTFTYYSF  245

Query  481  DGEQGFPGNLSVTVTYLFIGKNKLGI  558
            DGEQGFPGNL V+VTY+ IG NKLG+
Sbjct  246  DGEQGFPGNLQVSVTYMIIGTNKLGV  271



>gb|AFK38126.1| unknown [Lotus japonicus]
Length=354

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 130/171 (76%), Gaps = 1/171 (1%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            M  +Y + SFL LG+ +         ++G YE+K+G+F + +TNYGATV+SVI+PDK+G 
Sbjct  1    MYKVYLVSSFL-LGLLVLSQAQANDNKIGFYELKKGNFRLNLTNYGATVVSVIVPDKHGN  59

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            L D+ LG+D+VD YKND  YFGA+VGRVANRIG A F L+G  YKLPAND  NTLHGG  
Sbjct  60   LADIALGYDTVDGYKNDGVYFGALVGRVANRIGNAQFTLDGKTYKLPANDKDNTLHGGPT  119

Query  406  GFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GF DV+WTV+ +K+DSH+T +Y+S+D EQGFPG L V+VTY+ IG NKLG+
Sbjct  120  GFGDVVWTVKTHKEDSHITFTYHSFDNEQGFPGQLEVSVTYMIIGTNKLGV  170



>emb|CDP12362.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 129/166 (78%), Gaps = 4/166 (2%)
 Frame = +1

Query  73   FLVLGVFLTGS----FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVV  240
            F+++G+ L  S      D    + +YE+  G  S+K+TNYGAT++SV +PD+NGKL DVV
Sbjct  12   FVLIGLTLLFSNNVYATDYDNYINVYELTNGKISIKVTNYGATLLSVTVPDRNGKLDDVV  71

Query  241  LGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDV  420
            LG+ +++ YKND+ YFG ++GRVANRIGGA F LNGVEY LPANDHGNTLHGG +GFSDV
Sbjct  72   LGYPTIEGYKNDSTYFGGLIGRVANRIGGAKFTLNGVEYNLPANDHGNTLHGGTRGFSDV  131

Query  421  IWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            IW V  Y+K+SH++L Y+SYDGEQGFPG + V VTY+ IG N+LG+
Sbjct  132  IWEVTSYEKNSHVSLHYHSYDGEQGFPGAVDVYVTYMIIGGNRLGL  177



>ref|XP_002511545.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF52147.1| aldose-1-epimerase, putative [Ricinus communis]
Length=364

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 1/166 (1%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            LL  L++     G     +E+VG+YE+KRG FS+K TN+GA++IS ILPDK+G L DVVL
Sbjct  15   LLVALLVADNYNGCRAGGTEEVGVYELKRGDFSIKFTNFGASMISAILPDKHGNLADVVL  74

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHG-NTLHGGIKGFSDV  420
            GFDSVD YKNDT YFG IVGRVANRIG A F L+G+ YKL  ND+  N LHGG KGFS+V
Sbjct  75   GFDSVDAYKNDTTYFGNIVGRVANRIGKAQFTLDGILYKLVPNDNKVNILHGGPKGFSEV  134

Query  421  IWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +W+V  Y+KDSH+T +Y S+DGEQGFPG+LSV+VTY  IG N+LG+
Sbjct  135  VWSVYSYRKDSHITFTYESFDGEQGFPGDLSVSVTYSIIGTNRLGV  180



>ref|XP_007155325.1| hypothetical protein PHAVU_003G191500g [Phaseolus vulgaris]
 gb|ESW27319.1| hypothetical protein PHAVU_003G191500g [Phaseolus vulgaris]
Length=354

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +1

Query  112  DASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFG  291
            D   ++  YE++RG F + +TNYGAT+IS+  PDK+GK  D+VLG+DS+D Y+ND +YFG
Sbjct  22   DHHRKIEFYELERGDFKLNLTNYGATIISLTTPDKHGKPADIVLGYDSIDSYENDKSYFG  81

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLSY  471
            A++GRVANRI GA F L+G  Y+LPANDHGNTLHGG +GFSDV+W+VE +KK SH+T +Y
Sbjct  82   ALIGRVANRIAGAKFTLDGKTYQLPANDHGNTLHGGSRGFSDVVWSVESHKKHSHITFTY  141

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            NSY+ EQGFPG L V VTY+ IG ++L +
Sbjct  142  NSYENEQGFPGKLKVKVTYMLIGAHELAV  170



>ref|XP_004299386.1| PREDICTED: aldose 1-epimerase [Fragaria vesca subsp. vesca]
Length=380

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 138/172 (80%), Gaps = 6/172 (3%)
 Frame = +1

Query  52   ALYRLLSFLVLGVFLTGSFCDAS-EQVG-IYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            +LY    FL+  +    +F +A+ E+VG IYE+K+G+ SVK+TNYGATV+SV+LPDKNGK
Sbjct  28   SLYWCFLFLLPLIL---NFSEANDEKVGDIYELKKGNISVKLTNYGATVLSVVLPDKNGK  84

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHG-NTLHGGI  402
            L DVVLGF+++ DY ND+ YFGA VGRVANRIG A F LNG  YKL ANDHG NTLHGG 
Sbjct  85   LDDVVLGFEALKDYTNDSVYFGATVGRVANRIGRAEFTLNGNHYKLVANDHGKNTLHGGS  144

Query  403  KGFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            KGFSDV+WTV+ + +DSH+T +Y+S DGE+GFPG+LSV+VTY+F+G + L I
Sbjct  145  KGFSDVLWTVKRHIEDSHITFTYDSRDGEEGFPGDLSVSVTYMFVGHDVLAI  196



>gb|KDO76084.1| hypothetical protein CISIN_1g043310mg [Citrus sinensis]
Length=359

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 126/163 (77%), Gaps = 3/163 (2%)
 Frame = +1

Query  73   FLVLGVFLTGSFCDASEQ---VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            F+VL +F T   C A+E    VG+Y++KRG  S+K TNYGAT++S ++PDKNGKL D+VL
Sbjct  11   FIVLVLFFTNKKCQATESCEAVGVYKLKRGDLSLKFTNYGATMLSAVIPDKNGKLADIVL  70

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            GFDSV DYK D  YFGAIVGRVANRI  A F LNG  Y+L  ND  N LHGG +GFS+VI
Sbjct  71   GFDSVKDYKTDNTYFGAIVGRVANRISRAQFTLNGTRYQLINNDGDNMLHGGPRGFSEVI  130

Query  424  WTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKL  552
            W V+ ++ +SH+T +YNS +GEQGFPG+L+V+VTY+F+G+N L
Sbjct  131  WKVKSHEVNSHITFTYNSLEGEQGFPGDLAVSVTYMFVGENNL  173



>ref|XP_006439628.1| hypothetical protein CICLE_v10024457mg [Citrus clementina]
 gb|ESR52868.1| hypothetical protein CICLE_v10024457mg [Citrus clementina]
Length=359

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 130/173 (75%), Gaps = 4/173 (2%)
 Frame = +1

Query  46   MAALYRLLS-FLVLGVFLTGSFCDASEQ---VGIYEIKRGSFSVKITNYGATVISVILPD  213
            MA L  +   F+VL +F T   C A+E    VG+Y++KRG  S+K TNYGAT++S ++PD
Sbjct  1    MAKLSLVFCYFIVLVLFFTNKKCQATESCEAVGVYKLKRGDLSLKFTNYGATMLSAVIPD  60

Query  214  KNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLH  393
            KNGKL D+VLGFDSV DYK D  YFGAIVGRVANRI  A F LNG  Y+L  ND  N LH
Sbjct  61   KNGKLADIVLGFDSVKDYKTDNTYFGAIVGRVANRISRAQFSLNGTRYQLINNDGDNMLH  120

Query  394  GGIKGFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKL  552
            GG +GFS+VIW V+ ++ +SH+T +YNS +GEQGFPG+L+V+VTY+F+G+N L
Sbjct  121  GGPRGFSEVIWKVKSHEVNSHITFTYNSLEGEQGFPGDLAVSVTYMFVGENNL  173



>emb|CAN61059.1| hypothetical protein VITISV_011619 [Vitis vinifera]
Length=329

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            MA +  L  FL+L  F      +AS ++G+YE+KRG+FSVK+TNYGATV+SVILPD+NGK
Sbjct  1    MAKIRELCCFLLLA-FAIAKVSEASSEIGVYELKRGNFSVKLTNYGATVVSVILPDRNGK  59

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            L DVVLGFDSV+DYKNDT YFGAIVGRVANRI GA F LNG +YKL  N+  N LHGG K
Sbjct  60   LDDVVLGFDSVEDYKNDTTYFGAIVGRVANRIKGAQFTLNGKKYKLVPNEGKNMLHGGPK  119

Query  406  GFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTV  522
            GFSDVIW V+ Y K+SH+T  Y+S+DGE+G P N +  V
Sbjct  120  GFSDVIWHVQSYDKNSHVTFVYHSFDGEEGRPLNKATPV  158



>ref|XP_004138299.1| PREDICTED: aldose 1-epimerase [Cucumis sativus]
 gb|KGN63659.1| hypothetical protein Csa_1G009630 [Cucumis sativus]
Length=354

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            LL  + L V     F + ++ VGIYE++RG+ S+K+TNYGAT++SVILPDKNGKL DVVL
Sbjct  5    LLPLIFLLVVAAIGFSNGND-VGIYELRRGNVSIKLTNYGATILSVILPDKNGKLDDVVL  63

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
             F S+DD++NDT YFG IVGRVANRIGGA F +NGV YKL  ND  N LHGG KGF DVI
Sbjct  64   SFPSIDDFRNDTTYFGNIVGRVANRIGGAKFGINGVFYKLIPNDGRNLLHGGKKGFGDVI  123

Query  424  WTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W VE Y K +H+  +Y+S+DGEQGFPG+L V+VTY+F+  NKLG+
Sbjct  124  WKVESYVKGNHIIFTYDSFDGEQGFPGDLQVSVTYMFLETNKLGV  168



>ref|XP_002875866.1| hypothetical protein ARALYDRAFT_906011 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52125.1| hypothetical protein ARALYDRAFT_906011 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  61   RLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVV  240
             +L   VL V L        E++  Y++ RGS SV  TNYGA + S++LPD++GK  DVV
Sbjct  9    HVLGVSVLMVLLCCVNYSLCEKIKTYKLTRGSLSVTFTNYGAVMTSLLLPDRHGKQDDVV  68

Query  241  LGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDV  420
            LGFD+VD YKNDT YFGAIVGRVANRIGGA FKLNG  YK   N+  NTLHGG KGFSDV
Sbjct  69   LGFDTVDGYKNDTTYFGAIVGRVANRIGGAKFKLNGQLYKTDPNEGHNTLHGGTKGFSDV  128

Query  421  IWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            IW+V++Y   SH+T +YNS+DGE+GFPGN++V VTY+ IG+NKLG+
Sbjct  129  IWSVQNYVPTSHITFTYNSFDGEEGFPGNVTVKVTYMLIGENKLGV  174



>ref|XP_006477524.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
Length=359

 Score =   207 bits (526),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 127/163 (78%), Gaps = 3/163 (2%)
 Frame = +1

Query  73   FLVLGVFLTGSFCDASEQ---VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            F+VL +FLT + C A+E    VG+Y++KRG  S+K TNYGAT++S ++PDK GKL D+VL
Sbjct  11   FIVLVLFLTNNKCQATESCEAVGVYKLKRGDLSLKFTNYGATMLSAVIPDKYGKLADIVL  70

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            GFDSV DYK D  YFGAIVGRVANRI  A F LNG  Y+L  ND  N LHGG +GFS+VI
Sbjct  71   GFDSVKDYKTDNTYFGAIVGRVANRISRAQFTLNGTRYQLINNDGDNMLHGGPRGFSEVI  130

Query  424  WTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKL  552
            W V+ ++ +SH+T +YNS +GEQGFPG+L+V+VTY+F+G+N L
Sbjct  131  WKVKSHEVNSHITFTYNSLEGEQGFPGDLAVSVTYMFVGENNL  173



>ref|XP_002318873.1| aldose 1-epimerase family protein [Populus trichocarpa]
 gb|EEE97093.1| aldose 1-epimerase family protein [Populus trichocarpa]
Length=345

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDA-SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            MA  +    F+ L +F      +A +E +GIYE+K G FSVK+TNYGATVISVILPDKNG
Sbjct  1    MAKFFLFSCFVYLILFFANDDVEAVNEDIGIYELKMGDFSVKLTNYGATVISVILPDKNG  60

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
            KL D+VLGFDSVDDYKNDT YFGAIVGRVANRIG A F L+G +YKL  ND  N LHGG 
Sbjct  61   KLDDIVLGFDSVDDYKNDTTYFGAIVGRVANRIGRAQFTLDGTDYKLVPNDGRNMLHGGP  120

Query  403  KGFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKL  552
            KGFS+VIW V  +  D+H+  +Y S+DGE+GFPG+++V+VTY+ +  NKL
Sbjct  121  KGFSEVIWGVGSH-DDNHVKFTYYSFDGEEGFPGDVAVSVTYMLVETNKL  169



>ref|XP_003528185.2| PREDICTED: aldose 1-epimerase-like [Glycine max]
Length=353

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            M  +YR+ SFL+  +    +    ++++G Y++KRG+  + +TNYGA+VISV +PDK+G 
Sbjct  1    MFKVYRVSSFLLWLL--LLAQAHGNDKIGFYQLKRGNLHLNLTNYGASVISVFVPDKHGN  58

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            LGD+ LG+D ++ YKND+ YFGA +GRVANRIG A F L+G  YKLPANDHGNTLHGG  
Sbjct  59   LGDITLGYDDIEQYKNDSWYFGATIGRVANRIGHAQFTLDGHTYKLPANDHGNTLHGGFT  118

Query  406  GFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GFSDV+WTV+ +K+D H+T +Y+SYD EQGFPG L V+VTY+ IG NK  +
Sbjct  119  GFSDVVWTVKSHKEDDHVTFTYDSYDHEQGFPGRLEVSVTYMVIGTNKYSV  169



>ref|XP_006377092.1| hypothetical protein POPTR_0012s14420g [Populus trichocarpa]
 gb|ERP54889.1| hypothetical protein POPTR_0012s14420g [Populus trichocarpa]
Length=355

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDA-SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            MA  +    F+ L +F      +A +E +GIYE+K G FSVK+TNYGATVISVILPDKNG
Sbjct  1    MAKFFLFSCFVYLILFFANDDVEAVNEDIGIYELKMGDFSVKLTNYGATVISVILPDKNG  60

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
            KL D+VLGFDSVDDYKNDT YFGAIVGRVANRIG A F L+G +YKL  ND  N LHGG 
Sbjct  61   KLDDIVLGFDSVDDYKNDTTYFGAIVGRVANRIGRAQFTLDGTDYKLVPNDGRNMLHGGP  120

Query  403  KGFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKL  552
            KGFS+VIW V  +  D+H+  +Y S+DGE+GFPG+++V+VTY+ +  NKL
Sbjct  121  KGFSEVIWGVGSH-DDNHVKFTYYSFDGEEGFPGDVAVSVTYMLVETNKL  169



>ref|XP_004302346.1| PREDICTED: aldose 1-epimerase-like [Fragaria vesca subsp. vesca]
Length=365

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 129/171 (75%), Gaps = 3/171 (2%)
 Frame = +1

Query  55   LYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGD  234
            L  +++ LV   F  GS  +  E++G+YE+K+G  SVK TN+GAT+IS+ILPDKNGKL D
Sbjct  8    LCLVITILVASGFANGSGYEPKEKIGVYELKKGDLSVKFTNWGATIISLILPDKNGKLAD  67

Query  235  VVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFS  414
            VVLG+DSV++YKNDT+Y GAIVGRVANRIGGA F LNG  YKL AN+  N LHGG++GFS
Sbjct  68   VVLGYDSVNEYKNDTSYIGAIVGRVANRIGGAQFTLNGTHYKLVANEGKNILHGGLRGFS  127

Query  415  DVIWTVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            DV+W V+ YK   H   +  +Y+S DGEQGFPG++ VTVTY  +G  +L I
Sbjct  128  DVVWKVKKYKNGGHTPSIAFTYHSADGEQGFPGDVIVTVTYTLLGDKQLSI  178



>ref|XP_006291372.1| hypothetical protein CARUB_v10017512mg [Capsella rubella]
 gb|EOA24270.1| hypothetical protein CARUB_v10017512mg [Capsella rubella]
Length=358

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            +LS  VL V L+      SE++  Y++ RGS SV  TNYGA + S++LPD++GK  DVVL
Sbjct  10   VLSVSVLMVLLSCVDYSVSEKIKTYKLTRGSLSVTFTNYGAVMTSLLLPDRHGKQDDVVL  69

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            GFD+VD YKNDT YFGAIVGRVANRIGGA FKLNG  +K   N+  NTLHGG KGFSDVI
Sbjct  70   GFDTVDAYKNDTTYFGAIVGRVANRIGGAKFKLNGQFFKTDPNEGHNTLHGGTKGFSDVI  129

Query  424  WTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W+V +Y   SH+T +Y+S+DGE+GFPG+++V VTY+ IG+NKLG+
Sbjct  130  WSVRNYDPTSHITFTYDSFDGEEGFPGDVTVKVTYMLIGENKLGV  174



>ref|XP_012080544.1| PREDICTED: aldose 1-epimerase [Jatropha curcas]
Length=359

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 133/176 (76%), Gaps = 5/176 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV-FLTGSFCDASE----QVGIYEIKRGSFSVKITNYGATVISVILP  210
            MA       FL++ + F   + C+A++    +  IYE+KRG+FSVK TN+GAT++S++LP
Sbjct  1    MAWRSSFCCFLLVALLFSNNNGCEAADSSENKAEIYELKRGNFSVKFTNFGATMLSIVLP  60

Query  211  DKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTL  390
            DKNG   D+VLGF+S+++YKNDT YFG+IVGRVANRIG + F LNG  YKL  N+  N+L
Sbjct  61   DKNGNYADIVLGFESIEEYKNDTTYFGSIVGRVANRIGKSQFTLNGTVYKLVPNNGKNSL  120

Query  391  HGGIKGFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            HGG KGFS+V+W V  Y KDSH+T +Y+S+DGE+G+PG+LSV+VTY  IG NK+ +
Sbjct  121  HGGPKGFSEVLWKVYSYNKDSHITFTYDSFDGEEGYPGDLSVSVTYFVIGTNKIAV  176



>ref|XP_006578581.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
Length=355

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            +++G Y++KRG   + +TNYGA++ISVI+PDK+G L D+ LG+D ++ YKND+ YFGA +
Sbjct  25   KKIGFYQLKRGDLHLNLTNYGASLISVIVPDKHGNLDDITLGYDDIEQYKNDSWYFGATI  84

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLSYNSY  480
            GRVANRIG A F L+G  YKLPANDHGNTLHGG KGFSDV+WTV+ +K+D H+T +Y+S+
Sbjct  85   GRVANRIGHAQFTLDGHTYKLPANDHGNTLHGGFKGFSDVVWTVKSHKEDDHITFTYDSH  144

Query  481  DGEQGFPGNLSVTVTYLFIGKNKLGI  558
            D EQGFPG L V+VTY+ IG NK  +
Sbjct  145  DNEQGFPGRLEVSVTYMLIGTNKYSL  170



>ref|NP_190364.1| putative aldose 1-epimerase [Arabidopsis thaliana]
 emb|CAB41863.1| aldose 1-epimerase-like protein [Arabidopsis thaliana]
 gb|AAL36040.1| AT3g47800/T23J7_130 [Arabidopsis thaliana]
 gb|AAO42757.1| At3g47800/T23J7_130 [Arabidopsis thaliana]
 dbj|BAE99082.1| aldose 1-epimerase - like protein [Arabidopsis thaliana]
 gb|AEE78330.1| putative aldose 1-epimerase [Arabidopsis thaliana]
Length=358

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +1

Query  79   VLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSV  258
            VL V L        E++  Y++ RGS SV  TNYGA + S++LPD++GK  DVVLGFD+V
Sbjct  15   VLMVLLCSVNYSLCEKIKTYKLTRGSLSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDTV  74

Query  259  DDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVED  438
            D YKNDT YFGAIVGRVANRIGGA FKLNG  YK   N+  NTLHGG KGFSDVIW+V+ 
Sbjct  75   DGYKNDTTYFGAIVGRVANRIGGAKFKLNGHLYKTDPNEGRNTLHGGSKGFSDVIWSVQK  134

Query  439  YKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y   SH+T +Y+S+DGE+GFPGN++V VTY+ IG+NKLG+
Sbjct  135  YVPTSHITFTYDSFDGEEGFPGNVTVKVTYMLIGENKLGV  174



>ref|XP_010029392.1| PREDICTED: aldose 1-epimerase-like [Eucalyptus grandis]
 gb|KCW83563.1| hypothetical protein EUGRSUZ_B00459 [Eucalyptus grandis]
Length=356

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = +1

Query  127  VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGR  306
            +G+YE++ G F+ + TNYGAT++S++LPD+NGKL DVVLGFDS+  YKNDT YFGA+VGR
Sbjct  29   IGVYELRSGYFTAQFTNYGATMLSLVLPDRNGKLDDVVLGFDSLKGYKNDTTYFGAVVGR  88

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLSYNSYDG  486
            VANRI GA F LNG  YKL AND  NTLHGG KGF+DVIW V  Y  +SH+T +Y+S++G
Sbjct  89   VANRIAGAQFTLNGTAYKLVANDGNNTLHGGSKGFADVIWRVHSYDTESHVTFTYDSFNG  148

Query  487  EQGFPGNLSVTVTYLFIGKNKLGI  558
            EQGFPG+LSV VTY+ IG +KLG+
Sbjct  149  EQGFPGDLSVYVTYMLIGTDKLGV  172



>gb|AAM61410.1| aldose 1-epimerase-like protein [Arabidopsis thaliana]
Length=358

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +1

Query  79   VLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSV  258
            VL V L        E++  Y++ RGS SV  TNYGA + S++LPD++GK  DVVLGFD+V
Sbjct  15   VLMVLLCSVNYSLCEKIKTYKLTRGSLSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDTV  74

Query  259  DDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVED  438
            D YKNDT YFGAIVGRVANRIGGA FKLNG  YK   N+  NTLHGG KGFSDVIW+V+ 
Sbjct  75   DGYKNDTTYFGAIVGRVANRIGGAKFKLNGHLYKTDPNEGHNTLHGGSKGFSDVIWSVQK  134

Query  439  YKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y   SH+T +Y+S+DGE+GFPGN++V VTY+ IG+NKLG+
Sbjct  135  YVPTSHITFTYDSFDGEEGFPGNVTVKVTYMLIGENKLGV  174



>ref|XP_003609044.1| Aldose 1-epimerase-like protein [Medicago truncatula]
Length=337

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +1

Query  109  CDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYF  288
             + SE++G YE+K+GS  V +TNYGA++++V +PDK+GK+ DVVLG+DS++ Y+ D  YF
Sbjct  25   SEKSEKIGFYELKKGSMRVNLTNYGASIVAVYVPDKHGKVADVVLGYDSIEQYETDGVYF  84

Query  289  GAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLS  468
            G ++GRVANRIGGA F L+G  YKLPANDHGNTLHGG KGF D +W V+ +K DSH+T +
Sbjct  85   GGLIGRVANRIGGAQFTLDGKTYKLPANDHGNTLHGGQKGFGDNVWKVKIHKDDSHVTFT  144

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y S+DGEQGFPG L V+VTY+ + KN LG+
Sbjct  145  YESFDGEQGFPGKLDVSVTYMLLEKNILGV  174



>gb|AES91241.2| aldose 1-epimerase family protein [Medicago truncatula]
Length=340

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +1

Query  109  CDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYF  288
             + SE++G YE+K+GS  V +TNYGA++++V +PDK+GK+ DVVLG+DS++ Y+ D  YF
Sbjct  25   SEKSEKIGFYELKKGSMRVNLTNYGASIVAVYVPDKHGKVADVVLGYDSIEQYETDGVYF  84

Query  289  GAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLS  468
            G ++GRVANRIGGA F L+G  YKLPANDHGNTLHGG KGF D +W V+ +K DSH+T +
Sbjct  85   GGLIGRVANRIGGAQFTLDGKTYKLPANDHGNTLHGGQKGFGDNVWKVKIHKDDSHVTFT  144

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y S+DGEQGFPG L V+VTY+ + KN LG+
Sbjct  145  YESFDGEQGFPGKLDVSVTYMLLEKNILGV  174



>gb|KHN13632.1| Aldose 1-epimerase [Glycine soja]
Length=371

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  91   FLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYK  270
            F+  S  +  E++GI+E+K+G  S+++TN+GA+++S+++PDKNGKLGDVVLG+DSV DY 
Sbjct  20   FVNCSDVEKEEKIGIFELKKGDLSLRVTNWGASILSLVIPDKNGKLGDVVLGYDSVKDYS  79

Query  271  NDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD  450
            NDT YFGA VGRVANRIGGA F LNG+ YKL AN+  NTLHGG +GFSDV+W V+ Y+K+
Sbjct  80   NDTTYFGATVGRVANRIGGAQFTLNGIYYKLVANEGNNTLHGGARGFSDVLWKVKRYQKE  139

Query  451  ---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
                 +T SY+S DGEQGFPG+L VTV+Y+  GKN+L I
Sbjct  140  GPSPSITFSYHSADGEQGFPGDLLVTVSYILTGKNQLVI  178



>ref|XP_006404339.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
 gb|ESQ45792.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
Length=350

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 3/154 (2%)
 Frame = +1

Query  97   TGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKND  276
            T S C   E++  Y++ RG+ SV  TNYGA + S++LPD++GK  DVVLGFD+VD YKND
Sbjct  16   TYSLC---EEIQTYKLTRGNLSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDTVDGYKND  72

Query  277  TAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH  456
            T YFGAIVGRVANRIGGA F+LNG  YK   N+  NTLHGG KGFSDVIW+VE+Y   SH
Sbjct  73   TTYFGAIVGRVANRIGGAEFELNGQMYKTDPNEGHNTLHGGAKGFSDVIWSVENYVPTSH  132

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y+S+DGE+GFPGN++V VTY+ IG+NKL +
Sbjct  133  ITFKYDSFDGEEGFPGNVTVKVTYMLIGENKLAV  166



>ref|XP_004508758.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Cicer arietinum]
Length=318

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  157  FSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASF  336
              + +TNYGATVISVI+PDK+G L DVVLG+DS++ Y+NDT YFGA++GRVANRIGGA F
Sbjct  1    MRLNLTNYGATVISVIVPDKHGNLADVVLGYDSINSYENDTCYFGALIGRVANRIGGAQF  60

Query  337  KLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSV  516
             L+G  YKLP NDHGNTLHGG KGFSDVIWTV+ +++D+H+T +Y+S+D EQGFPG L V
Sbjct  61   TLDGKTYKLPVNDHGNTLHGGTKGFSDVIWTVKSHREDNHITFTYDSFDNEQGFPGKLEV  120

Query  517  TVTYLFIGKNKLGI  558
            +VTY+  G+N LG+
Sbjct  121  SVTYMLFGRNLLGV  134



>ref|XP_006482555.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
Length=373

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 130/187 (70%), Gaps = 16/187 (9%)
 Frame = +1

Query  46   MAALYRLLSFLVL---GVFLTGSFCDA----------SEQVGIYEIKRGSFSVKITNYGA  186
            MA LY  L F+ L   G  + GS  D           SE+V  YE+K+G FSVK TN+GA
Sbjct  1    MARLYLSLCFVALVAIGFIVNGSVADEDKKNECDKNNSEEVKFYELKKGDFSVKFTNWGA  60

Query  187  TVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLP  366
            T++SV LPDK+GK+ DVVLG+DSVDDYKNDT YFG++VGRVANRIGGA F L+G  YKL 
Sbjct  61   TIVSVFLPDKDGKVDDVVLGYDSVDDYKNDTTYFGSVVGRVANRIGGAQFTLDGTHYKLV  120

Query  367  ANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFI  537
            AN+  N LHGG KGFSDVIW V+ Y+ +     +  SY+S DGE+GFPG+L VTV+Y   
Sbjct  121  ANEKSNMLHGGPKGFSDVIWKVKTYENEGPTPKIVFSYHSTDGEEGFPGDLDVTVSYSLT  180

Query  538  GKNKLGI  558
            G+ +L +
Sbjct  181  GEKELSV  187



>ref|XP_004147466.2| PREDICTED: aldose 1-epimerase-like [Cucumis sativus]
 gb|KGN59582.1| hypothetical protein Csa_3G827250 [Cucumis sativus]
Length=383

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 130/175 (74%), Gaps = 4/175 (2%)
 Frame = +1

Query  46   MAALY-RLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            MA L+  L   + L VF   +  +   ++GI+E+KRG FSVK TN+GAT++S+++PDK+G
Sbjct  24   MAKLFLALFCVIALAVFGFANGYEKKGEIGIFELKRGDFSVKFTNWGATIVSLLVPDKHG  83

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
            KL DVVLG+DS+ +Y+NDT YFG+IVGRVANRIGGA F L+GV YKL AN+  NTLHGG 
Sbjct  84   KLDDVVLGYDSIQEYQNDTTYFGSIVGRVANRIGGAKFTLDGVLYKLIANEGNNTLHGGT  143

Query  403  KGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +GFSDV+W V  Y+KD     +  SY S+DGE+GFPG+L VT TY  I KN+L +
Sbjct  144  RGFSDVVWKVTKYQKDGRSPQIVFSYRSFDGEEGFPGDLLVTATYTLIAKNQLKL  198



>ref|XP_003621162.1| Aldose 1-epimerase [Medicago truncatula]
 gb|AES77380.1| aldose 1-epimerase family protein [Medicago truncatula]
Length=362

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 132/174 (76%), Gaps = 3/174 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            M  ++ LL  L++  F   +  D  E+VGI+E+K+G  S+K+TN+GA+++S++LPDKNGK
Sbjct  1    MTKIFVLLLCLLIVAFGFVNGSDEKEKVGIFELKKGGLSLKVTNWGASIVSLVLPDKNGK  60

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            L D+VLG+DS+ +Y ND+ YFGA VGRVANRIGGA F LNG  YKL AN+  NTLHGG +
Sbjct  61   LADIVLGYDSIKEYTNDSTYFGATVGRVANRIGGAQFNLNGKHYKLVANEGNNTLHGGSR  120

Query  406  GFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GFSDVIW V+ Y+K+     +T +Y+S+DGE+GFPG+L  TV+Y+  GKN+L I
Sbjct  121  GFSDVIWKVKRYQKEGPSPSVTFTYHSFDGEEGFPGDLLATVSYILTGKNQLVI  174



>ref|XP_009149871.1| PREDICTED: aldose 1-epimerase [Brassica rapa]
Length=357

 Score =   199 bits (506),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAI  297
            S+Q+  Y++ RG  SV  TNYGA +IS++LPD++GK  DVVLGFD+VD YKNDT YFGAI
Sbjct  27   SKQIKTYKLTRGKLSVTFTNYGAVMISLLLPDRHGKQDDVVLGFDTVDAYKNDTTYFGAI  86

Query  298  VGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLSYNS  477
            VGRVANRIGGA F+LNG  YK   N+  NTLHGG KGF DVIW+VE+Y   SH+T  Y+S
Sbjct  87   VGRVANRIGGAKFELNGQLYKTDPNEGHNTLHGGTKGFGDVIWSVENYVPTSHITFIYHS  146

Query  478  YDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +DGE+GFPGN++V VTY+ IG+NKL +
Sbjct  147  FDGEEGFPGNVTVKVTYMLIGENKLAL  173



>ref|XP_010426233.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=360

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 127/171 (74%), Gaps = 5/171 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            +  +Y L+  L   V    S C+  +++  Y++ RG+FSV  TNYGA + S++LPD++GK
Sbjct  11   VTGVYVLMVLLCCCV--DYSLCE--KKIKTYKLTRGNFSVTFTNYGAVMTSLLLPDRHGK  66

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
              DVVLGFDS+D YKNDT YFGAIVGRVANRIGGA FKLNG  YK   ND  NTLHGG K
Sbjct  67   QDDVVLGFDSLDSYKNDTTYFGAIVGRVANRIGGAQFKLNGQLYKTSPNDGYNTLHGGTK  126

Query  406  GFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GFSDVIW+V+ Y   SH+T  YNS+DGE+GFPGN++V VTY+ IGKN LG+
Sbjct  127  GFSDVIWSVQSYVPTSHITFKYNSFDGEEGFPGNVTVKVTYM-IGKNILGV  176



>ref|XP_008341553.1| PREDICTED: aldose 1-epimerase [Malus domestica]
Length=367

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 126/176 (72%), Gaps = 5/176 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFL--TGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKN  219
            M+    LL F+VL  F     S  ++ E++G+Y +K+G  SVK TN+GAT+IS++LPDKN
Sbjct  6    MSNTSVLLCFIVLAAFAIANASGSESKERIGVYALKKGDLSVKFTNWGATIISLVLPDKN  65

Query  220  GKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGG  399
            GKL DVVLG+DSV +Y NDT+Y G++VGRVANRIGGA F LNG  YKL AN+  N LHGG
Sbjct  66   GKLADVVLGYDSVKEYTNDTSYIGSVVGRVANRIGGAQFTLNGTHYKLVANEGKNILHGG  125

Query  400  IKGFSDVIWTVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             KGFSDV+W V  YK + H   +  +Y+S DGEQGFPG++  TV+Y   G N+L I
Sbjct  126  KKGFSDVVWKVRKYKNEGHSPSIAFTYHSADGEQGFPGDVLATVSYTLTGDNQLSI  181



>emb|CDY36929.1| BnaA06g17140D [Brassica napus]
Length=357

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAI  297
            S+Q+  Y++ RG  SV  TNYGA +IS++LPD++GK  DVVLGFD+VD YKNDT YFGAI
Sbjct  27   SKQIKTYKLTRGKLSVTFTNYGAVMISLLLPDRHGKQDDVVLGFDTVDAYKNDTTYFGAI  86

Query  298  VGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLSYNS  477
            VGRVANRIGGA F+LNG  YK   N+  NTLHGG KGF DVIW+VE+Y   SH+T  Y+S
Sbjct  87   VGRVANRIGGAKFELNGQLYKTDPNEGHNTLHGGTKGFGDVIWSVENYVPTSHITFIYHS  146

Query  478  YDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +DGE+GFPGN++V VTY+ IG+NKL +
Sbjct  147  FDGEEGFPGNVTVKVTYMLIGENKLAL  173



>ref|XP_008443423.1| PREDICTED: aldose 1-epimerase [Cucumis melo]
Length=383

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 134/187 (72%), Gaps = 5/187 (3%)
 Frame = +1

Query  7    RSKGVHCIC*SELMAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGA  186
            R++ +H +  + +      L   + L VF   +  +   ++GI+E+KRG FSVK TN+GA
Sbjct  14   RARFLHSL--ANMAKFFLALFCVVALAVFGFANGYEKKGEIGIFELKRGDFSVKFTNWGA  71

Query  187  TVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLP  366
            T++S+++PDK+GKL DVVLG+DS+ +Y+NDTAYFG+IVGRVANRIGGA F L+GV YKL 
Sbjct  72   TIVSLLVPDKHGKLDDVVLGYDSIQEYQNDTAYFGSIVGRVANRIGGAKFTLDGVLYKLI  131

Query  367  ANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFI  537
            AN+  NTLHGG +GFSDV+W V  Y+KD     +  SY S+DGE+GFPG+L VT TY  I
Sbjct  132  ANEGNNTLHGGTRGFSDVVWKVTKYQKDGSSPQIVFSYRSFDGEEGFPGDLLVTATYTLI  191

Query  538  GKNKLGI  558
              N+L +
Sbjct  192  ANNQLKL  198



>ref|XP_006482556.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
Length=362

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 130/171 (76%), Gaps = 8/171 (5%)
 Frame = +1

Query  64   LLSFLVL---GVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGD  234
            +L F+VL   G  + GS   AS  VG+Y++K+G+FSVK+TN+GAT+ISV+LPDKNGKL D
Sbjct  6    VLCFVVLVAFGFVVHGSV--ASNAVGVYDLKKGNFSVKLTNWGATLISVVLPDKNGKLID  63

Query  235  VVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFS  414
            V LG+DSV+DYKND++Y GA VGRVANRIGGA F L+G+ YKL AN+  N LHGG  GFS
Sbjct  64   VALGYDSVNDYKNDSSYIGATVGRVANRIGGAQFTLDGIHYKLVANEGKNMLHGGKIGFS  123

Query  415  DVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            DV+W VE Y+ +    H+  +Y SYDGEQGFPG+LSVTV Y  +G  +L +
Sbjct  124  DVVWKVEKYQNEGHAPHIIFAYRSYDGEQGFPGDLSVTVGYTLVGDKQLRV  174



>ref|XP_003534458.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
 gb|KHN11594.1| Aldose 1-epimerase [Glycine soja]
Length=371

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = +1

Query  109  CDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYF  288
             +  E++GI+E+ +G  S+K+TN+GA+++S+++PDKNGKL DVVLG+DSV DY NDT YF
Sbjct  26   VEKKEKIGIFELNKGDLSLKVTNWGASILSLVIPDKNGKLSDVVLGYDSVKDYTNDTTYF  85

Query  289  GAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHL  459
            GA VGRVANRIGGA F LNG+ YKL AN+  NTLHGG +GFSDV+W V+ Y+K+     +
Sbjct  86   GATVGRVANRIGGAQFTLNGIHYKLVANEGNNTLHGGARGFSDVLWKVKRYQKEGPSPSI  145

Query  460  TLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            T SY+S DGEQGFPG+L VTV+Y+  GKN+L I
Sbjct  146  TFSYHSIDGEQGFPGDLLVTVSYILTGKNQLVI  178



>gb|KFK34079.1| hypothetical protein AALP_AA5G099600 [Arabis alpina]
Length=359

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 118/152 (78%), Gaps = 3/152 (2%)
 Frame = +1

Query  103  SFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA  282
            S C    ++  Y + RG+ SV  TNYGA + S++LPD++GK  DVVLGFDSVD YKNDT 
Sbjct  27   SLC---AKIKTYTLTRGNLSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDSVDGYKNDTT  83

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLT  462
            YFGAIVGRVANRIGGA F+LNG  YK   N+  NTLHGG KGFSDVIW+V++Y  +SH+T
Sbjct  84   YFGAIVGRVANRIGGAQFELNGQTYKTDPNEGQNTLHGGTKGFSDVIWSVQNYVPNSHIT  143

Query  463  LSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
              Y+S+DGE+GFPGN++V VTY+ IG+NKL +
Sbjct  144  FKYDSFDGEEGFPGNVTVKVTYMLIGQNKLAL  175



>gb|KJB75756.1| hypothetical protein B456_012G055600 [Gossypium raimondii]
Length=299

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 124/167 (74%), Gaps = 5/167 (3%)
 Frame = +1

Query  67   LSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLG  246
            L  +V    + GS  +A E+VGIYE+K+G  SVK TN+GAT++SV LPDK GK+GD+VLG
Sbjct  11   LFIIVASAIINGS--EAVEKVGIYELKKGDLSVKFTNWGATIVSVFLPDKYGKMGDIVLG  68

Query  247  FDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIW  426
            +DS++DYKNDT+Y G++VGRVANRIGGA F LNGV YKL  N+  N LHGG  GFSDV+W
Sbjct  69   YDSINDYKNDTSYIGSVVGRVANRIGGAQFTLNGVHYKLIPNEGKNMLHGGPVGFSDVVW  128

Query  427  TVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             V  YKKD +   +  +Y+SYDGE+GFPG L VTVTY     N+L +
Sbjct  129  KVNKYKKDGYAPSIVFAYDSYDGEEGFPGALRVTVTYTLYPGNRLTV  175



>ref|XP_009624451.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=356

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 126/168 (75%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+ F +L +    S  +   ++GIYEIK+G FSVK+TNYGA +ISV+LPDK+GK+GDVVL
Sbjct  8    LICFFILHLCAAASVRE--RKIGIYEIKKGDFSVKVTNYGARIISVLLPDKDGKIGDVVL  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++ +Y+NDT+ FGAIVGRVANRIGGA F LNG  YKL AND  NTLHGG KGFS V+
Sbjct  66   GYDTIKEYENDTSSFGAIVGRVANRIGGAQFTLNGTLYKLIANDGNNTLHGGPKGFSHVV  125

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y+KD    H+TL+Y+S DGEQGFP +L V+VTY      KL +
Sbjct  126  WKVSKYEKDGSHPHITLTYHSADGEQGFPSDLLVSVTYGLKDPYKLSV  173



>ref|NP_001241992.1| uncharacterized protein LOC100781853 precursor [Glycine max]
 gb|ACU17623.1| unknown [Glycine max]
Length=371

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 124/159 (78%), Gaps = 3/159 (2%)
 Frame = +1

Query  91   FLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYK  270
            F+  S  +  E++GI+E K+G   +++TN+GA+++S+++PDKNGKLGDVVLG+DSV DY 
Sbjct  20   FVNCSDVEKEEKIGIFEPKKGDLPLRVTNWGASILSLVIPDKNGKLGDVVLGYDSVKDYS  79

Query  271  NDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD  450
            NDT YFGA VGRVANRIGGA F LNG+ YKL AN+  NTLHGG +GFSDV+W V+ Y+K+
Sbjct  80   NDTTYFGATVGRVANRIGGAQFTLNGIYYKLVANEGNNTLHGGARGFSDVLWEVKRYQKE  139

Query  451  ---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
                 +T  Y+S DGEQGFPG+L VTV+Y+  GKN+L I
Sbjct  140  GPSPSITFRYHSVDGEQGFPGDLLVTVSYILTGKNQLVI  178



>ref|XP_010503389.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=360

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = +1

Query  73   FLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFD  252
             ++L   +  S C+  +++  Y++ RG+FSV  TNYGA + S++LPD++GK  DVVLGFD
Sbjct  18   MVLLCCCVDYSLCE--KKIKTYKLTRGNFSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFD  75

Query  253  SVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTV  432
            S+D YKNDT YFGAIVGRVANRIGGA FKLNG  YK   ND  NTLHGG KGFSDVIW+V
Sbjct  76   SLDSYKNDTTYFGAIVGRVANRIGGAQFKLNGQLYKTSPNDGYNTLHGGTKGFSDVIWSV  135

Query  433  EDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            + Y   SH+T  Y+S+DGE+GFPGN++V VTY+ IGKN LG+
Sbjct  136  QSYVPTSHITFKYDSFDGEEGFPGNVTVKVTYM-IGKNILGV  176



>ref|XP_006338470.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Solanum tuberosum]
Length=357

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 123/164 (75%), Gaps = 3/164 (2%)
 Frame = +1

Query  76   LVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDS  255
            L++  F+   +  A  ++GIYEIK+G FSVK+TNYGA +ISV+LPDKNGK+GDVVLG+D+
Sbjct  7    LLICFFILHLWAAAGHKIGIYEIKKGDFSVKVTNYGARIISVLLPDKNGKIGDVVLGYDT  66

Query  256  VDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVE  435
            + +Y NDT+ FGAIVGRVANRIGGA F LNG  YKL AND  NT+HGG KGF  V+W V 
Sbjct  67   IGEYVNDTSSFGAIVGRVANRIGGARFTLNGTLYKLIANDGENTIHGGPKGFGHVVWKVS  126

Query  436  DYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             YKKD     +TL+Y+S DGEQGFPG+L V+VTY      KL +
Sbjct  127  KYKKDGPHPRITLTYHSTDGEQGFPGDLLVSVTYALKNPYKLSV  170



>ref|XP_006431103.1| hypothetical protein CICLE_v10011989mg [Citrus clementina]
 gb|ESR44343.1| hypothetical protein CICLE_v10011989mg [Citrus clementina]
Length=373

 Score =   197 bits (502),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 129/187 (69%), Gaps = 16/187 (9%)
 Frame = +1

Query  46   MAALYRLLSFLVL---GVFLTGSFCDA----------SEQVGIYEIKRGSFSVKITNYGA  186
            MA +Y  L F+ L   G  + GS  D           SE+V  YE+K+G FSVK TN+GA
Sbjct  1    MARVYLSLCFVALVAIGFIVNGSVADEDKKNECDKNNSEEVKFYELKKGDFSVKFTNWGA  60

Query  187  TVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLP  366
            T++SV LPDK+GK+ DVVLG+DSVDDYKNDT YFG++VGRVANRIGGA F L+G  YKL 
Sbjct  61   TIVSVFLPDKDGKVDDVVLGYDSVDDYKNDTTYFGSVVGRVANRIGGAQFTLDGTHYKLV  120

Query  367  ANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFI  537
            AN+  N LHGG KGFSDVIW V+ Y+ +     +  SY+S DGE+GFPG+L VTV+Y   
Sbjct  121  ANEKSNMLHGGPKGFSDVIWKVKTYENEGPTPKIVFSYHSTDGEEGFPGDLDVTVSYSLT  180

Query  538  GKNKLGI  558
             + +L +
Sbjct  181  SEKELSV  187



>gb|KDO72518.1| hypothetical protein CISIN_1g017992mg [Citrus sinensis]
Length=362

 Score =   197 bits (500),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 131/171 (77%), Gaps = 8/171 (5%)
 Frame = +1

Query  64   LLSFLVL---GVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGD  234
            +L F+VL   G  + GS   AS  VG+Y++K+G+FSVK+TN+GAT+ISV+LPDK+GKL D
Sbjct  6    VLCFVVLVAFGFVVHGSV--ASNAVGVYDLKKGNFSVKLTNWGATLISVVLPDKHGKLID  63

Query  235  VVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFS  414
            V LG+DSV+DYKND++Y GA VGRVANRIGGA F L+G+ YKL AN+  N LHGG  GFS
Sbjct  64   VALGYDSVNDYKNDSSYIGATVGRVANRIGGAQFTLDGIHYKLVANEGKNMLHGGKIGFS  123

Query  415  DVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            DV+W VE Y+ +    H+  +Y+SYDGEQGFPG+LSVTV Y  +G  +L +
Sbjct  124  DVVWKVEKYQNEGHAPHVIFAYHSYDGEQGFPGDLSVTVGYTLVGDKQLRV  174



>ref|XP_007139591.1| hypothetical protein PHAVU_008G042600g [Phaseolus vulgaris]
 gb|ESW11585.1| hypothetical protein PHAVU_008G042600g [Phaseolus vulgaris]
Length=364

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 131/176 (74%), Gaps = 6/176 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV--FLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKN  219
            M  ++ LL  L+L    F   S  +  E + I+++K+G  S+K+TN+GA+++S++LPD+N
Sbjct  1    MTKIFVLLLCLILAASGFANCSVVE-KENIRIFQLKKGELSLKVTNWGASIVSLLLPDRN  59

Query  220  GKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGG  399
            GKLGDVVLG+DSV DY +D+ YFGA VGRVANRIGGA F LNG  YKL AN+  NTLHGG
Sbjct  60   GKLGDVVLGYDSVKDYTSDSTYFGATVGRVANRIGGAQFTLNGTHYKLVANEGNNTLHGG  119

Query  400  IKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             +GFSDV+W VE Y+K+     +T SY+S DGE+GFPG+L VTV+Y+  GKN+L I
Sbjct  120  SRGFSDVLWKVERYQKEGPSPSITFSYHSVDGEEGFPGDLIVTVSYILTGKNQLVI  175



>ref|XP_009779461.1| PREDICTED: aldose 1-epimerase-like [Nicotiana sylvestris]
Length=355

 Score =   196 bits (499),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 122/158 (77%), Gaps = 7/158 (4%)
 Frame = +1

Query  106  FCDAS----EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKN  273
             C A+     ++GIYEIK+G F+VK+TN+GA VISV+LPDK+GK+GDVVLG+D++ +Y+N
Sbjct  16   LCAAASVRGHKIGIYEIKKGDFTVKVTNFGARVISVLLPDKHGKIGDVVLGYDTIKEYEN  75

Query  274  DTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD-  450
            DT+ FGAIVGRVANRIGGA F LNG  YKL AND  NT+HGG KGFS VIW V  Y+KD 
Sbjct  76   DTSSFGAIVGRVANRIGGAQFTLNGTLYKLIANDGNNTIHGGPKGFSHVIWKVSKYEKDG  135

Query  451  --SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
               H+TL+Y+S DGEQGFPG+L V+VTY      KL +
Sbjct  136  PHPHITLTYHSADGEQGFPGDLLVSVTYALKDPYKLSV  173



>gb|KJB75754.1| hypothetical protein B456_012G055600 [Gossypium raimondii]
Length=359

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 124/167 (74%), Gaps = 5/167 (3%)
 Frame = +1

Query  67   LSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLG  246
            L  +V    + GS  +A E+VGIYE+K+G  SVK TN+GAT++SV LPDK GK+GD+VLG
Sbjct  11   LFIIVASAIINGS--EAVEKVGIYELKKGDLSVKFTNWGATIVSVFLPDKYGKMGDIVLG  68

Query  247  FDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIW  426
            +DS++DYKNDT+Y G++VGRVANRIGGA F LNGV YKL  N+  N LHGG  GFSDV+W
Sbjct  69   YDSINDYKNDTSYIGSVVGRVANRIGGAQFTLNGVHYKLIPNEGKNMLHGGPVGFSDVVW  128

Query  427  TVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             V  YKKD +   +  +Y+SYDGE+GFPG L VTVTY     N+L +
Sbjct  129  KVNKYKKDGYAPSIVFAYDSYDGEEGFPGALRVTVTYTLYPGNRLTV  175



>ref|XP_010032358.1| PREDICTED: aldose 1-epimerase-like [Eucalyptus grandis]
 gb|KCW51761.1| hypothetical protein EUGRSUZ_J01219 [Eucalyptus grandis]
Length=382

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 124/163 (76%), Gaps = 4/163 (2%)
 Frame = +1

Query  79   VLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSV  258
            VLG +    F +  E VGIYE+K+G+ S+++TN+GAT++S++LPDKNGKL DV+LGFDSV
Sbjct  36   VLGTYHRHGFAEDGE-VGIYELKKGNISLRLTNWGATIMSLLLPDKNGKLDDVILGFDSV  94

Query  259  DDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVED  438
            +DYKND+AYFG++VGRVANRI  A F LNG  YKL  N+  N LHGG KGFSDV+W V  
Sbjct  95   NDYKNDSAYFGSVVGRVANRIANAQFTLNGTRYKLTPNEGKNMLHGGPKGFSDVVWKVTR  154

Query  439  YKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y+KD H   +  SY S++GE+GFPG+L V+V+Y  +G N L I
Sbjct  155  YQKDGHTPRIVFSYFSHNGEEGFPGDLQVSVSYTILGDNHLSI  197



>ref|XP_009593213.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=359

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            M++    L   +  + L  +      ++GIYEIK+G FSVKITNYGA +ISV++PDKNGK
Sbjct  1    MSSKVNSLLICLFILHLWSALIVRGRKIGIYEIKKGDFSVKITNYGARIISVLVPDKNGK  60

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            +GDVVLG+D++ +YKNDT+YFGAIVGRVANRIGGA F LNG  YKL AN+  NTLHGG K
Sbjct  61   IGDVVLGYDTIKEYKNDTSYFGAIVGRVANRIGGAQFTLNGTLYKLIANNGNNTLHGGPK  120

Query  406  GFSDVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GFS V+W V  +++     H+TL+Y+S DGE+GFPG+L V+VTY      KL +
Sbjct  121  GFSHVVWKVSKHERHGSHPHITLTYHSGDGEEGFPGDLRVSVTYALKDPYKLSV  174



>gb|KHG05985.1| Aldose 1-epimerase [Gossypium arboreum]
Length=359

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 123/167 (74%), Gaps = 5/167 (3%)
 Frame = +1

Query  67   LSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLG  246
            L  +V    + GS   A E+VGIYE+K+G  SVK TN+GAT++SV LPDK GK+GD+VLG
Sbjct  11   LFIIVASAIINGS--AAVEKVGIYELKKGDLSVKFTNWGATIVSVFLPDKYGKMGDIVLG  68

Query  247  FDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIW  426
            +DSV+DYKNDT+Y G+IVGRVANRIGGA F LNGV YKL  N+  N LHGG  GFSDV+W
Sbjct  69   YDSVNDYKNDTSYIGSIVGRVANRIGGAQFTLNGVHYKLIPNEGKNMLHGGPIGFSDVVW  128

Query  427  TVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             V  YKKD +   +  +Y+SYDGE+GFPG L VTVTY     N+L +
Sbjct  129  KVNKYKKDGYSPSIVFAYDSYDGEEGFPGALRVTVTYTLYPGNRLTV  175



>ref|XP_011098592.1| PREDICTED: aldose 1-epimerase-like [Sesamum indicum]
Length=360

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 127/175 (73%), Gaps = 7/175 (4%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQ-VGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            M+ +  L  F++L     G F + SE  +GIYEIK+G FSVK+TNYGA ++SV+LPDKNG
Sbjct  1    MSKISILFCFIILAF---GIFANGSENGLGIYEIKKGDFSVKVTNYGARIVSVVLPDKNG  57

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
            KL DVVLG+D++ +Y NDT YFGAIVGRVANRIGGA F LNG  YKL AN+  NTLHGG 
Sbjct  58   KLADVVLGYDTIKEYMNDTCYFGAIVGRVANRIGGAKFTLNGTLYKLDANEGNNTLHGGK  117

Query  403  KGFSDVIWTVE---DYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            KGFS+V W V     Y +  ++TLSY+S DGE+GFPG++  +VTY  I   KL +
Sbjct  118  KGFSEVAWKVTKHVKYGRSPYITLSYHSVDGEEGFPGDVLASVTYALIEPYKLSV  172



>ref|XP_009347058.1| PREDICTED: aldose 1-epimerase [Pyrus x bretschneideri]
Length=369

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 126/176 (72%), Gaps = 5/176 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFL--TGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKN  219
            M+    LL F+VL  F     S  ++ E++G+Y +K+G  SVK TN+GAT+IS++LPDKN
Sbjct  8    MSNTRVLLCFIVLAAFAIANASGSESKERIGVYALKKGDLSVKFTNWGATIISLVLPDKN  67

Query  220  GKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGG  399
            GKL DVVLG+DSV +Y NDT+Y G++VGRVANRIGGA F LNG  YKL AN+  N LHGG
Sbjct  68   GKLADVVLGYDSVKEYTNDTSYIGSVVGRVANRIGGAQFTLNGTHYKLVANEGKNMLHGG  127

Query  400  IKGFSDVIWTVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             KGFSDV+W V  +K + H   +  +Y+S DGEQGFPG++  TV+Y   G N+L I
Sbjct  128  KKGFSDVVWKVIKHKNEGHSPSIVFTYHSADGEQGFPGDVLATVSYTLTGDNQLSI  183



>ref|XP_002323842.1| aldose 1-epimerase family protein [Populus trichocarpa]
 gb|EEF03975.1| aldose 1-epimerase family protein [Populus trichocarpa]
Length=359

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 124/174 (71%), Gaps = 3/174 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            MA +  LL F +L VF + +     E+VGIYE+KRG  S+K TN+GAT++S +LPDKNGK
Sbjct  1    MAKVTVLLCFCILAVFGSVNAHTGKEKVGIYELKRGDMSLKFTNWGATLVSFVLPDKNGK  60

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            L D+VLG+D++  YKNDT YFGAIVGRVANRI GA FKLNG  YKL  N+  N LHGG K
Sbjct  61   LIDIVLGYDTIKQYKNDTTYFGAIVGRVANRIKGAQFKLNGHTYKLVPNEGKNMLHGGPK  120

Query  406  GFSDVIWTVEDYK---KDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G++DV+W V  Y+      H+  SY+S+DGE+GFPG + VTV Y  +  N++ +
Sbjct  121  GYADVVWEVTKYQNKGHKPHIVFSYHSFDGEEGFPGEILVTVRYTLLADNQVTV  174



>emb|CDY24155.1| BnaC03g57220D [Brassica napus]
Length=359

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAI  297
            S+Q+  Y++ RG  SV  TNYGA + S++LPD++GK  DVVLGFD+VD YKNDT YFGAI
Sbjct  29   SKQIKTYKLTRGKLSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDTVDAYKNDTTYFGAI  88

Query  298  VGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLTLSYNS  477
            VGRVANRIGGA F+LNG  YK   N+  NTLHGG KGF DV W+VE+Y   SH+T  Y S
Sbjct  89   VGRVANRIGGAKFELNGQLYKTDPNEGHNTLHGGTKGFGDVTWSVENYVPTSHITFIYQS  148

Query  478  YDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +DGE+GFPGN++V VTY+ IG+NKL +
Sbjct  149  FDGEEGFPGNVTVKVTYMLIGENKLAL  175



>gb|KDO72516.1| hypothetical protein CISIN_1g0479222mg, partial [Citrus sinensis]
Length=288

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 118/155 (76%), Gaps = 5/155 (3%)
 Frame = +1

Query  109  CDA--SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA  282
            CD   SE+V  YE+K+G FSVK TN+GAT++SV LPDK+GK+ DVVLG+DSVDDYKNDT 
Sbjct  2    CDKNNSEEVKFYELKKGDFSVKFTNWGATIVSVFLPDKDGKVDDVVLGYDSVDDYKNDTT  61

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---S  453
            YFG++VGRVANRIGGA F L+G  YKL AN+  N LHGG KGFSDVIW V+ Y+ +    
Sbjct  62   YFGSVVGRVANRIGGAQFTLDGTHYKLVANEKSNMLHGGPKGFSDVIWKVKTYENEGPTP  121

Query  454  HLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             +  SY+S DGE+GFPG+L VTV+Y    + +L +
Sbjct  122  KIVFSYHSTDGEEGFPGDLDVTVSYSLTSEKELSV  156



>gb|KHN45485.1| Aldose 1-epimerase [Glycine soja]
Length=368

 Score =   194 bits (494),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 128/176 (73%), Gaps = 8/176 (5%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV--FLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKN  219
            M  ++ LL  L L    F+ GS     + + ++E+K+G FS+K+TN+GAT++SVILPDKN
Sbjct  1    MTKIFVLLCLLFLASSGFVHGS--SKKDHIRLFELKKGDFSIKVTNWGATLVSVILPDKN  58

Query  220  GKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGG  399
            GKLGD+VLG+DS   Y NDT+YFGA VGRVANRIGGA F LNG+ YKL AN+  NTLH G
Sbjct  59   GKLGDIVLGYDSPKAYTNDTSYFGATVGRVANRIGGAQFTLNGIHYKLVANEGNNTLHSG  118

Query  400  IKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             K FSDV+W V  Y KD     +T SY+SYDGE GFPG+L VTV+Y+ +GKN L I
Sbjct  119  PKAFSDVLWKVTRYIKDDDKPRITFSYHSYDGEGGFPGDLLVTVSYI-LGKNSLSI  173



>ref|XP_006338469.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Solanum tuberosum]
Length=360

 Score =   194 bits (494),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 125/168 (74%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+   +L ++   S     + VG+YEIK+G FSVK+TNYGA +ISV LPDK+G+ GDVVL
Sbjct  8    LICVFILHLWAVNSVT--GQNVGVYEIKKGDFSVKVTNYGARIISVFLPDKHGETGDVVL  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++++YKNDT  FGA++GRVANRIGGA F +NG  YKL AND  NTLHGGIKGFS V+
Sbjct  66   GYDTIEEYKNDTTSFGALLGRVANRIGGAQFTMNGTLYKLVANDGVNTLHGGIKGFSRVV  125

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y++D    H+TL+Y+S DGE+GFPG+L V+VTY      KL +
Sbjct  126  WNVSKYQQDGPYPHITLTYHSADGEEGFPGDLLVSVTYALKNPYKLSV  173



>ref|XP_009779450.1| PREDICTED: aldose 1-epimerase-like [Nicotiana sylvestris]
Length=355

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 124/168 (74%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+   +L ++  GS      ++GIYEIK+G FSVK+TNYGA +ISV++PDKNGK+ DVVL
Sbjct  9    LICLFILHLWAVGSVT--GRKIGIYEIKKGDFSVKVTNYGARIISVLVPDKNGKIDDVVL  66

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++ +YKNDT YFGAIVGRVANRIGGA F LNG  YKL AN+  NTLHGG KGFS V+
Sbjct  67   GYDTIKEYKNDTNYFGAIVGRVANRIGGAQFTLNGTLYKLIANNGNNTLHGGPKGFSHVV  126

Query  424  WTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  +++     H+TL++ S DGE+GFPG+L V+VTY      KL +
Sbjct  127  WKVSKHERHGSHPHITLTFRSADGEEGFPGDLRVSVTYALKDPYKLSV  174



>ref|XP_007216505.1| hypothetical protein PRUPE_ppa024124mg [Prunus persica]
 gb|EMJ17704.1| hypothetical protein PRUPE_ppa024124mg [Prunus persica]
Length=366

 Score =   194 bits (494),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 128/177 (72%), Gaps = 6/177 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV--FLTGSFCDASEQ-VGIYEIKRGSFSVKITNYGATVISVILPDK  216
            MA +  LL F++L    F   S  +  E+ VGIYE+K+G  SVK TN+GAT+IS++ PDK
Sbjct  1    MAKICVLLCFILLAASGFANVSGSEPKEKKVGIYELKKGDLSVKFTNWGATIISLVFPDK  60

Query  217  NGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHG  396
            NGKL DVVLG+D++ +Y NDT+Y GAIVGRVANRIGGA F LNG  YKL AN+  N LHG
Sbjct  61   NGKLADVVLGYDTIKEYTNDTSYIGAIVGRVANRIGGAQFTLNGTHYKLVANEGKNVLHG  120

Query  397  GIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G+ GFSDV+W V+ Y+ +    H+  +Y+S DGE+GFPG+L VTV+Y  +G  +L +
Sbjct  121  GLIGFSDVVWKVQKYQNEGDAPHIVFTYHSADGEEGFPGDLLVTVSYTLLGDKQLSV  177



>ref|XP_008230742.1| PREDICTED: aldose 1-epimerase-like [Prunus mume]
Length=366

 Score =   194 bits (493),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 128/177 (72%), Gaps = 6/177 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV--FLTGSFCDASEQ-VGIYEIKRGSFSVKITNYGATVISVILPDK  216
            MA +  LL F++L    F   S  +  E+ VGIYE+K+G  SVK TN+GAT+IS++ PDK
Sbjct  1    MAKICVLLCFILLAASGFANVSGSEPKEKKVGIYELKKGDLSVKFTNWGATIISLVFPDK  60

Query  217  NGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHG  396
            NGKL DVVLG+D++ +Y NDT+Y GAIVGRVANRIGGA F LNG  YKL AN+  N LHG
Sbjct  61   NGKLADVVLGYDTIKEYTNDTSYIGAIVGRVANRIGGAQFTLNGTHYKLVANEGKNILHG  120

Query  397  GIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G+ GFSDV+W V+ Y+ +    H+  +Y+S DGE+GFPG+L VTV+Y  +G  +L +
Sbjct  121  GLIGFSDVVWKVQKYQNEGDAPHIVFTYHSADGEEGFPGDLLVTVSYTLLGDKQLSV  177



>ref|XP_011008940.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=359

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 124/174 (71%), Gaps = 3/174 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            MA +  LL F VL VF +        +VGIYE+KRG  S+K TN+GAT++S +LPDKNGK
Sbjct  1    MAKVTVLLCFCVLAVFGSVKAHTEKGKVGIYELKRGDMSLKFTNWGATLVSFVLPDKNGK  60

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            L D+VLG+D+++ YKNDT YFGAIVGRVANRI GA FKLNG  YKL  N+  N LHGG K
Sbjct  61   LIDIVLGYDTINQYKNDTTYFGAIVGRVANRIKGAQFKLNGHTYKLVPNEGKNMLHGGPK  120

Query  406  GFSDVIWTVEDYK---KDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G++DV+W V  Y+      H+  SY+S+DGE+GFPG + VTV Y  + +N++ +
Sbjct  121  GYADVVWEVTKYQNKGHKPHIVFSYHSFDGEEGFPGEILVTVRYTLLAENQVTV  174



>ref|XP_004489156.1| PREDICTED: aldose 1-epimerase-like [Cicer arietinum]
Length=364

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 126/159 (79%), Gaps = 4/159 (3%)
 Frame = +1

Query  91   FLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYK  270
            F+ GS  +  E++GI+E+K+G  S+K+TN+GA+++S+++PDKNGKLGDVVLG+DSV +Y 
Sbjct  19   FVNGSLVE-KEKIGIFELKKGDISLKVTNWGASIMSLVIPDKNGKLGDVVLGYDSVKEYT  77

Query  271  NDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD  450
            ND+ YFGA VGRVANRIGGA F LN   YKL AN+  NTLHGG +GFSDVIW V+ Y+++
Sbjct  78   NDSTYFGATVGRVANRIGGAQFTLNRHHYKLVANEGNNTLHGGSRGFSDVIWKVKRYQRE  137

Query  451  ---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
                 +T +Y+S+DGE+GFPG+L  TV+Y+  GKN+L I
Sbjct  138  GPSPTVTFTYHSFDGEEGFPGDLLATVSYILTGKNQLVI  176



>ref|XP_006338471.1| PREDICTED: aldose 1-epimerase-like isoform X3 [Solanum tuberosum]
Length=353

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 121/164 (74%), Gaps = 3/164 (2%)
 Frame = +1

Query  76   LVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDS  255
            L++  F+   +  A  ++GIYEIK+G FSVK+TNYGA +ISV+LPDKNGK+GDVVLG+D+
Sbjct  7    LLICFFILHLWAAAGHKIGIYEIKKGDFSVKVTNYGARIISVLLPDKNGKIGDVVLGYDT  66

Query  256  VDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVE  435
            + +Y NDT+ FGAIVGRVANRIGGA F LNG  YKL AND  NT+HGG KGF  V+W V 
Sbjct  67   IGEYVNDTSSFGAIVGRVANRIGGARFTLNGTLYKLIANDGENTIHGGPKGFGHVVWKVS  126

Query  436  DYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             YKKD     +TL+Y+S DGEQGFPG L  +VTY      KL +
Sbjct  127  KYKKDGPHPRITLTYHSTDGEQGFPGVLLASVTYALEDPYKLSV  170



>ref|NP_001241954.1| uncharacterized protein LOC100803092 precursor [Glycine max]
 gb|ACU21056.1| unknown [Glycine max]
Length=368

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 127/176 (72%), Gaps = 8/176 (5%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV--FLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKN  219
            M  ++ LL  L L    F+ G      + + ++E+K+G FS+K+TN+GAT++SVILPDKN
Sbjct  1    MTKIFVLLCLLFLASSGFVHGP--SKKDHIRLFELKKGDFSIKVTNWGATLVSVILPDKN  58

Query  220  GKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGG  399
            GKLGD+VLG+DS   Y NDT+YFGA VGRVANRIGGA F LNG+ YKL AN+  NTLH G
Sbjct  59   GKLGDIVLGYDSPKAYTNDTSYFGATVGRVANRIGGAQFTLNGIHYKLVANEGNNTLHSG  118

Query  400  IKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             K FSDV+W V  Y KD     +T SY+SYDGE GFPG+L VTV+Y+ +GKN L I
Sbjct  119  PKAFSDVLWKVTRYIKDDDKPRITFSYHSYDGEGGFPGDLLVTVSYI-LGKNSLSI  173



>ref|XP_009779457.1| PREDICTED: aldose 1-epimerase-like isoform X6 [Nicotiana sylvestris]
Length=357

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 128/171 (75%), Gaps = 8/171 (5%)
 Frame = +1

Query  67   LSFLVLGVFLTGSFCDAS----EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGD  234
            +S L++ +F+    C A+     ++GIYEIK+G FSVKITNYGAT+ISV+LPDK+GK+GD
Sbjct  5    ISLLLICLFIL-HLCAAASVRGRKIGIYEIKKGDFSVKITNYGATIISVLLPDKHGKIGD  63

Query  235  VVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFS  414
            VVLG+D++ +YKNDT+YFGA +GRVANRIGGA F LNG  YKL AN+  N LHGG+KGFS
Sbjct  64   VVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLKGFS  123

Query  415  DVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             V+W V  Y +     ++TL+Y S DGE+GFPG++ V+VTY      KL +
Sbjct  124  KVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKDPYKLSV  174



>gb|AAL09398.1|AF307095_1 non-cell-autonomous protein pathway2 [Nicotiana tabacum]
Length=357

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 128/171 (75%), Gaps = 8/171 (5%)
 Frame = +1

Query  67   LSFLVLGVFLTGSFCDAS----EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGD  234
            +S L++ +F+    C A+     ++GIYEIK+G FSVKITNYGAT+ISV+LPDK+GK+GD
Sbjct  5    ISLLLICLFIL-HLCAAASVRGRKIGIYEIKKGDFSVKITNYGATIISVLLPDKHGKIGD  63

Query  235  VVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFS  414
            VVLG+D++ +YKNDT+YFGA +GRVANRIGGA F LNG  YKL AN+  N LHGG+KGFS
Sbjct  64   VVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLKGFS  123

Query  415  DVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             V+W V  Y +     ++TL+Y S DGE+GFPG++ V+VTY      KL +
Sbjct  124  KVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKDPYKLSV  174



>gb|AFK41318.1| unknown [Lotus japonicus]
Length=372

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = +1

Query  43   LMAALYRLLSFLVLGV--FLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDK  216
            +   ++ LL  L L    F+ GS     + V ++E+K+G  S+K++N+GAT++S++LPDK
Sbjct  1    MKTKIFVLLCLLFLAASGFVNGSAKKEKDHVRLFELKKGDLSLKVSNWGATLVSLVLPDK  60

Query  217  NGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHG  396
            +GKLGDVVLG+DS+  Y ND+ YFG   GRVANRIGGA F LNG+ YKL AN+  NTLHG
Sbjct  61   HGKLGDVVLGYDSLKQYTNDSTYFGTTAGRVANRIGGAQFTLNGIHYKLIANEGNNTLHG  120

Query  397  GIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G +GFSDV+W VE Y K+     +T SY+S+DGE+GFPG+L VTV+Y+   KN L I
Sbjct  121  GPRGFSDVLWKVERYVKEGDKPRITFSYHSFDGEEGFPGDLLVTVSYILGSKNSLSI  177



>ref|XP_009624446.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=356

 Score =   192 bits (487),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 124/167 (74%), Gaps = 6/167 (4%)
 Frame = +1

Query  76   LVLGVFLTGSFCDAS---EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLG  246
            L++ +F+      AS    ++GIYEIK+G FSVKITNYGAT+ISV+LPDK+GK+GDVVLG
Sbjct  7    LLVCLFIFHLLAAASVRGHKIGIYEIKKGDFSVKITNYGATIISVLLPDKHGKIGDVVLG  66

Query  247  FDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIW  426
            +D++ +YKNDT+YFGA +GRVANRIGGA F LNG+ YKL  N+  N LHGG KGFS V+W
Sbjct  67   YDTIQEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPKGFSKVVW  126

Query  427  TVEDYKKDS---HLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             V  Y KDS   ++TL+Y S DGE+GFPG +  +VTY      KL +
Sbjct  127  KVSKYVKDSPSPYITLTYYSADGEEGFPGAVLASVTYALKDPYKLSV  173



>ref|XP_004232231.2| PREDICTED: aldose 1-epimerase-like [Solanum lycopersicum]
Length=464

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 125/168 (74%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+   +L ++   S  +  +++G+YEIK+G FSVKITNYGA +ISV LPDK+G +GDVVL
Sbjct  112  LICLFILHLWAAVSVTE--QKIGVYEIKKGDFSVKITNYGARIISVFLPDKHGVIGDVVL  169

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D+ ++YKNDT  FGA++GRVANRIGGA F LNG  YKL AND  NTLHGGI GFS V+
Sbjct  170  GYDTTEEYKNDTTSFGALLGRVANRIGGAQFTLNGTLYKLVANDGANTLHGGINGFSRVV  229

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y++D    H+TL+Y+S DGE+GFPG+L V+VTY      KL +
Sbjct  230  WNVSKYQQDGPYPHITLTYHSVDGEEGFPGDLLVSVTYALKDPYKLSV  277


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +1

Query  76   LVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDS  255
            L++  F+   +     ++GIYEIK+G FSVK+TNYGA +ISV+LPDKNGK+GD+VLG+D+
Sbjct  7    LLICFFILHLWAATGHKIGIYEIKKGDFSVKVTNYGARIISVLLPDKNGKIGDIVLGYDT  66

Query  256  VDDY  267
            + +Y
Sbjct  67   IGEY  70



>ref|XP_006338467.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=358

 Score =   191 bits (486),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 124/164 (76%), Gaps = 3/164 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            M++   LL  L   + L  +      ++ IYEIK+G FSVK+TNYGAT+ISV+LPDKNGK
Sbjct  1    MSSKISLLICLFFILHLLAADSVTGHKIEIYEIKKGDFSVKVTNYGATIISVLLPDKNGK  60

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            +GDVVLG+D++ +Y+NDT+YFGA +GRVANRIGGA F LNG  YKL AN+  N LHGG+K
Sbjct  61   IGDVVLGYDTIKEYRNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLK  120

Query  406  GFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTY  528
            GFS V+W V  Y +D    ++TL+Y+S DGE+GFPG++ V+VTY
Sbjct  121  GFSKVVWKVRKYVQDGPSPYITLTYHSADGEEGFPGDVVVSVTY  164



>ref|XP_007099714.1| Galactose mutarotase-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY20329.1| Galactose mutarotase-like superfamily protein, putative [Theobroma 
cacao]
Length=438

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 112/149 (75%), Gaps = 3/149 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            E+VGIYE+K+G  SVK TN+GAT++ V+LPDK GKLGD+ LG+DSV +Y NDT+Y G+IV
Sbjct  106  EEVGIYELKKGDLSVKFTNWGATIVQVVLPDKYGKLGDIALGYDSVQEYMNDTSYVGSIV  165

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH---LTLSY  471
            GRVANRI GA F L GV YKL  N+  N LHGG  GFSDV+W VE YKKD H   +  +Y
Sbjct  166  GRVANRIAGAQFTLKGVHYKLIPNEGKNMLHGGPIGFSDVVWKVEKYKKDGHAPSIVFAY  225

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +SYDGEQGFPG L VTV Y  +  NKL +
Sbjct  226  DSYDGEQGFPGALKVTVAYTLLPGNKLTV  254



>gb|KEH24989.1| aldose 1-epimerase family protein [Medicago truncatula]
Length=375

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 129/179 (72%), Gaps = 9/179 (5%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV--FLTGSFCDASEQ---VGIYEIKRGSFSVKITNYGATVISVILP  210
            M  ++ LL  L L    F+ GS     +    + ++E+K+G  ++K+TN+GAT++S++LP
Sbjct  1    MTKIFMLLCLLFLAFSGFVNGSMNKKEKNHDDIKLFELKKGDLTLKVTNWGATLVSLVLP  60

Query  211  DKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTL  390
            DKNGKLGD+VLG+D+   Y NDT+YFGA VGRVANRIGGA F LNG  YKL AN+  NTL
Sbjct  61   DKNGKLGDIVLGYDTPKAYTNDTSYFGATVGRVANRIGGAQFTLNGTHYKLIANEGNNTL  120

Query  391  HGGIKGFSDVIWTVEDYKKDSHLTL---SYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            HGG +GFSDV+W VE Y ++    L   SY+S+DGEQGFPG+L VTV+Y+ +GKN L I
Sbjct  121  HGGTRGFSDVLWKVERYVREGDQPLIKFSYHSFDGEQGFPGDLKVTVSYI-LGKNSLTI  178



>gb|KHN13234.1| Aldose 1-epimerase [Glycine soja]
Length=367

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 117/149 (79%), Gaps = 4/149 (3%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            E + ++E+K+G FS+K+TN+GAT++SVILPDKNGKLGD+VLG+DS   Y NDT+YFGA V
Sbjct  26   EYIRLFELKKGDFSIKVTNWGATLVSVILPDKNGKLGDIVLGYDSPKAYTNDTSYFGATV  85

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSY  471
            GRVANRIGGA F LNG+ YKL AN+  NTLH G K FSDV+W V  Y KD     +T SY
Sbjct  86   GRVANRIGGAQFTLNGIHYKLVANEGNNTLHSGPKAFSDVLWKVTRYIKDGEKPRITFSY  145

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +SYDGE GFPG+L VTV+Y+ +GKN L I
Sbjct  146  HSYDGEGGFPGDLLVTVSYI-LGKNSLRI  173



>ref|XP_009779456.1| PREDICTED: aldose 1-epimerase-like isoform X5 [Nicotiana sylvestris]
Length=373

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+ F +L   L+ +      ++GIYEIK+G FSVKITNYGA +ISV+LPDK+GK+GDVVL
Sbjct  25   LICFFIL--HLSAAASVRGRKIGIYEIKKGDFSVKITNYGARIISVLLPDKHGKIGDVVL  82

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++++YKNDT+YFGA +GRVANRIGGA F LNG+ YKL  N+  N LHGG KGFS V+
Sbjct  83   GYDTIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPKGFSKVV  142

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y KD    ++TL+Y S DGE+GFPG +  +VTY      KL +
Sbjct  143  WKVSKYVKDGPWPYITLTYYSADGEEGFPGAVLASVTYTLKDSYKLSV  190



>emb|CDP18771.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 124/175 (71%), Gaps = 6/175 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASE-QVGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            M+ L  LL  ++  +F+     + SE +VGIYE+K+G FS+K+TN+GA +IS++LPDKNG
Sbjct  1    MSKLSFLLCLILATIFVV--VVNGSESEVGIYELKKGDFSLKVTNFGARIISLVLPDKNG  58

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
            K  DVVLG+DSV +Y NDT YFGAIVGRV NRIGGA F LNGV YKL AN+  N LHGG 
Sbjct  59   KPTDVVLGYDSVKEYLNDTQYFGAIVGRVVNRIGGAQFTLNGVHYKLDANEKPNMLHGGR  118

Query  403  KGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            KGFS + W VE Y KD     + LSY S DGE+GFPGNL V VTY  +   KL +
Sbjct  119  KGFSLLTWNVEKYVKDRANPFIVLSYYSPDGEEGFPGNLLVRVTYALLEPYKLSV  173



>ref|XP_009779455.1| PREDICTED: aldose 1-epimerase-like isoform X4 [Nicotiana sylvestris]
Length=377

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 124/168 (74%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+ F +L   L+ +      ++GIYEIK+G FSVKITNYGA +ISV+LPDK+G++ DV L
Sbjct  25   LICFFIL--HLSAAASVRGRKIGIYEIKKGDFSVKITNYGARIISVLLPDKHGRIDDVAL  82

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D+V++Y+NDT  FGA++GRVANRIGGA F LNG  YKL AND  NTLHGG +GFS V+
Sbjct  83   GYDTVEEYENDTTSFGALLGRVANRIGGAQFTLNGTLYKLIANDGANTLHGGPEGFSRVV  142

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y++D    H+TL+Y+S DGE+GFPG++  +VTY      KL +
Sbjct  143  WNVSKYEQDGPYPHITLTYHSADGEEGFPGDVLASVTYALEDPYKLSV  190



>ref|XP_009779459.1| PREDICTED: aldose 1-epimerase-like isoform X8 [Nicotiana sylvestris]
Length=356

 Score =   189 bits (479),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            M+    LL  L++   L  +      ++GIYEIK+G FSVKITNYGA++ISV+LPDK+GK
Sbjct  1    MSLKINLLVCLIIFHLLVAASVRG-HKIGIYEIKKGDFSVKITNYGASIISVLLPDKHGK  59

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            +GDVVLG+D++ +YKNDT+YFGA +GRVANRIGGA F LNG  YKL AN+  N LHGG+K
Sbjct  60   IGDVVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLK  119

Query  406  GFSDVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GFS V+W V  Y +     ++TL+Y S DGE+GFPG++ V+VTY      KL +
Sbjct  120  GFSKVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKDPYKLSV  173



>ref|XP_009779458.1| PREDICTED: aldose 1-epimerase-like isoform X7 [Nicotiana sylvestris]
Length=356

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            M+    LL  L++   L  +      ++GIYEIK+G FSVKITNYGA++ISV+LPDK+GK
Sbjct  1    MSLKINLLVCLIIFHLLVAASVRG-HKIGIYEIKKGDFSVKITNYGASIISVLLPDKHGK  59

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            +GDVVLG+D++++YKNDT+YFGA +GRVANRIGGA F LNG+ YKL  N+  N LHGG K
Sbjct  60   IGDVVLGYDTIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPK  119

Query  406  GFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GFS V+W V  Y KD    ++TL+Y S DGE+GFPG +  +VTY      KL +
Sbjct  120  GFSKVVWKVSKYVKDGPWPYITLTYYSADGEEGFPGAVLASVTYTLKDSYKLSV  173



>ref|XP_003543750.1| PREDICTED: aldose 1-epimerase-like [Glycine max]
Length=367

 Score =   189 bits (480),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 116/147 (79%), Gaps = 4/147 (3%)
 Frame = +1

Query  127  VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGR  306
            + ++E+K+G FS+K+TN+GAT++SVILPDKNGKLGD+VLG+DS   Y NDT+YFGA VGR
Sbjct  28   IRLFELKKGDFSIKVTNWGATLVSVILPDKNGKLGDIVLGYDSPKAYTNDTSYFGATVGR  87

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNS  477
            VANRIGGA F LNG+ YKL AN+  NTLH G K FSDV+W V  Y KD     +T SY+S
Sbjct  88   VANRIGGAQFTLNGIHYKLVANEGNNTLHSGPKAFSDVLWKVTRYIKDGEKPRITFSYHS  147

Query  478  YDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            YDGE GFPG+L VTV+Y+ +GKN L I
Sbjct  148  YDGEGGFPGDLLVTVSYI-LGKNSLRI  173



>ref|XP_009624447.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
 ref|XP_009624448.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=357

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 125/168 (74%), Gaps = 8/168 (5%)
 Frame = +1

Query  76   LVLGVFLTGSFCDAS----EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L++ +F+    C A+     ++GIYEIK+G FSVKITNYGA++ISV LPDK+GK+GDVVL
Sbjct  7    LLICLFIL-HLCAAASVRGRKIGIYEIKKGDFSVKITNYGASIISVFLPDKHGKIGDVVL  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++ +YKNDT+YFGA +GRVANRIGGA F LNG  YKL AN+  N LHGG+KGFS V+
Sbjct  66   GYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLKGFSKVV  125

Query  424  WTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y +     ++TL+Y S DGE+GFPG++ V+VTY      KL +
Sbjct  126  WKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKDPYKLSV  173



>gb|AAL09397.1|AF307094_1 non-cell-autonomous protein pathway1 [Nicotiana tabacum]
Length=357

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 125/168 (74%), Gaps = 8/168 (5%)
 Frame = +1

Query  76   LVLGVFLTGSFCDAS----EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L++ +F+    C A+     ++GIYEIK+G FSVKITNYGA++ISV LPDK+GK+GDVVL
Sbjct  7    LLICLFIL-HLCAAASVRGRKIGIYEIKKGDFSVKITNYGASIISVFLPDKHGKIGDVVL  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++ +YKNDT+YFGA +GRVANRIGGA F LNG  YKL AN+  N LHGG+KGFS V+
Sbjct  66   GYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLHGGLKGFSKVV  125

Query  424  WTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y +     ++TL+Y S DGE+GFPG++ V+VTY      KL +
Sbjct  126  WKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKDPYKLSV  173



>ref|XP_012083064.1| PREDICTED: aldose 1-epimerase-like [Jatropha curcas]
 gb|KDP45491.1| hypothetical protein JCGZ_09740 [Jatropha curcas]
Length=364

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 126/177 (71%), Gaps = 8/177 (5%)
 Frame = +1

Query  46   MAALYRLLSFLVL---GVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDK  216
            MA    L+ F ++   G  + G  C A E++GIYE+K+G+ S+K+TNYGA +IS+ LPDK
Sbjct  1    MAKFCGLVCFCIVIAFGFIING--CIAEEKIGIYELKKGNLSIKVTNYGAHIISLFLPDK  58

Query  217  NGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHG  396
            +GKL DV+LG+D++ +Y NDT+ FGA +GRVANRI GA F LNG  YKL  N+  NTLHG
Sbjct  59   HGKLDDVLLGYDTIKEYLNDTSSFGATIGRVANRIAGAQFTLNGTLYKLIPNEGKNTLHG  118

Query  397  GIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G KGFS V+W V+ Y+ +    H+  +Y+S+DGEQGFPG+L VT  Y   G+N+L I
Sbjct  119  GPKGFSKVVWKVKKYQPEGDAPHIIFTYHSFDGEQGFPGDLLVTTAYTLHGENQLSI  175



>ref|XP_011046256.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
 ref|XP_011046257.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=358

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 127/175 (73%), Gaps = 4/175 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDAS-EQVGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            MA    LL F +L +F   +   A+ E++G+YE+K+G+FS+K+TNYGA +IS++LPDK G
Sbjct  1    MAKFSVLLCFSLLLIFGFPAIGSATKEEIGMYELKKGNFSMKLTNYGAHIISLLLPDKYG  60

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
            KL D+VLG+D++ +YKND++ FGA VGRVANRI GA F LNG  YKL AND  NTLHGG 
Sbjct  61   KLADIVLGYDTIKEYKNDSSNFGATVGRVANRIAGAQFTLNGTLYKLVANDGKNTLHGGP  120

Query  403  KGFSDVIWTVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            KGFS V+W V+ Y  +     +  +Y+S+DGE+GFPG+L V V Y  +G NKL I
Sbjct  121  KGFSKVVWKVKKYSPEGRKPFIVFAYHSFDGEEGFPGDLHVIVGYKLLGDNKLRI  175



>ref|XP_009624450.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Nicotiana tomentosiformis]
Length=360

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 122/168 (73%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+ F +L   L  +      ++GIYEIK+G FSV+ITNYGA +ISV+LPDK+G +GDV L
Sbjct  8    LICFFIL--HLLAATNVRGRKIGIYEIKKGDFSVRITNYGARIISVLLPDKHGNIGDVAL  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D+V +Y+NDT  FGA++GRVANRIGGA F LNG  YKL AND  NTLHGG KGFS V+
Sbjct  66   GYDTVKEYENDTTSFGALLGRVANRIGGAQFTLNGTIYKLIANDGANTLHGGPKGFSRVV  125

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y++D    H+TL+Y+S DGE+GFPG++  +VTY      KL +
Sbjct  126  WNVNKYEQDGPYPHITLTYHSADGEEGFPGDVLASVTYALEDPYKLSV  173



>gb|AAB94619.1| aldose-1-epimerase-like protein [Nicotiana tabacum]
Length=356

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 123/167 (74%), Gaps = 6/167 (4%)
 Frame = +1

Query  76   LVLGVFLTGSFCDAS---EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLG  246
            L++ +F+      AS    ++GIYEIK+G FSVKITNYG ++ISV+LPDK+GK+GDVVLG
Sbjct  7    LLVCLFIFHLLVAASVRGHKIGIYEIKKGDFSVKITNYGTSIISVLLPDKHGKIGDVVLG  66

Query  247  FDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIW  426
            +D++++YKNDT+YFGA +GRVANRIGGA F LNG+ YKL  N+  N LHGG KGFS V+W
Sbjct  67   YDTIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPKGFSKVVW  126

Query  427  TVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             V  Y KD    ++TL+Y S DGE+GFPG +  +VTY      KL +
Sbjct  127  KVSKYVKDGPCPYITLTYYSADGEEGFPGAVLASVTYTLKDSYKLSV  173



>ref|XP_010256788.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=359

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 115/147 (78%), Gaps = 3/147 (2%)
 Frame = +1

Query  127  VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGR  306
            V +YEIK+G+FSVK+TN+GAT++SV++PDKNGKL D+VLG+D+++ YKNDT+YFGAIVGR
Sbjct  26   VKVYEIKKGNFSVKLTNWGATILSVVVPDKNGKLDDIVLGYDTLEAYKNDTSYFGAIVGR  85

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNS  477
            VANRIG A F LNG  YKL AN+  NTLHGG++GFSDV+W V  Y  +    H+T  Y S
Sbjct  86   VANRIGRAQFTLNGTTYKLVANEGKNTLHGGVRGFSDVLWKVIRYVPEGHSPHVTFVYRS  145

Query  478  YDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             DG+QGFPGNL  TV+Y   G+  L +
Sbjct  146  PDGDQGFPGNLLTTVSYTIDGEETLSV  172



>emb|CDP02212.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 123/171 (72%), Gaps = 7/171 (4%)
 Frame = +1

Query  67   LSFLVLGVFLTGSF---CDASEQ-VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGD  234
            LSFL+  +    +F    + SE  + IYE+K+G FS+K+TN+GA ++SV+LPDKNGK  D
Sbjct  4    LSFLLGLIIAATTFRVVVNGSESGLEIYELKKGDFSLKVTNFGARIMSVVLPDKNGKPAD  63

Query  235  VVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFS  414
            +VLG+DSV DY NDTAYFGA+VGRVANRIGGA F LNGV YKL AN+  N LHGG KGFS
Sbjct  64   IVLGYDSVKDYLNDTAYFGAVVGRVANRIGGAQFTLNGVHYKLDANEKQNMLHGGKKGFS  123

Query  415  DVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             +IW VE+Y KD     +  +Y S DGE+GFPGNL V V+Y  +   KL +
Sbjct  124  QLIWKVEEYVKDDANPFIVFAYYSLDGEEGFPGNLLVRVSYALLEPYKLRV  174



>ref|XP_002282868.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
Length=359

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 115/167 (69%), Gaps = 9/167 (5%)
 Frame = +1

Query  79   VLGVFLTGSFCDASEQV------GIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVV  240
            V   F+T  FC A+  V      GIYE+++G FS K T +GA ++SV+LPDKNGKL DVV
Sbjct  6    VFVCFITLVFCFATGSVAKKEDGGIYELRKGDFSAKFTKWGAAIVSVVLPDKNGKLADVV  65

Query  241  LGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDV  420
            LG+DS  +YKNDT  FGAIVGRVANRIGGA F LNG  YKL AND  N LHGG KGF  V
Sbjct  66   LGYDSTKEYKNDTTNFGAIVGRVANRIGGAQFTLNGTHYKLVANDGKNMLHGGPKGFGKV  125

Query  421  IWTVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKL  552
             W V  Y+K  H   +  SY+S DGE+GFPG+L  TVTY+ +G  +L
Sbjct  126  AWRVSKYEKGGHSPYIMFSYHSLDGEEGFPGDLIATVTYMLVGDYQL  172



>ref|XP_002282831.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
 emb|CBI22174.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 115/167 (69%), Gaps = 9/167 (5%)
 Frame = +1

Query  79   VLGVFLTGSFCDASEQV------GIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVV  240
            V   F+T  FC A+  V      GIYE+++G FS K T +GA ++SV+LPDKNGKL DVV
Sbjct  6    VFVCFITLVFCFATGSVAKKEDGGIYELRKGDFSAKFTKWGAAIVSVVLPDKNGKLADVV  65

Query  241  LGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDV  420
            LG+DS  +YKNDT  FGAIVGRVANRIGGA F LNG  YKL AN+  N LHGG KGF  V
Sbjct  66   LGYDSAKEYKNDTTNFGAIVGRVANRIGGAQFTLNGTHYKLVANEGKNMLHGGPKGFGKV  125

Query  421  IWTVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKL  552
             W V  YKK  H   +  SY+S DGE+GFPG+L  TVTY+ +G  +L
Sbjct  126  AWRVSKYKKGGHSPYIMFSYHSLDGEEGFPGDLIATVTYMLVGDYQL  172



>ref|XP_007151211.1| hypothetical protein PHAVU_004G027000g [Phaseolus vulgaris]
 gb|ESW23205.1| hypothetical protein PHAVU_004G027000g [Phaseolus vulgaris]
Length=368

 Score =   186 bits (473),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 127/176 (72%), Gaps = 7/176 (4%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV--FLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKN  219
            M  ++ LLS L L    F+ GS     + + ++E+K+   S+K+TN+GAT++S+ILPDKN
Sbjct  1    MTKIFVLLSLLFLATSGFVHGSH-KKKDHIRLFELKKDDLSIKVTNWGATLVSLILPDKN  59

Query  220  GKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGG  399
            G LGD+VLG+DS   Y ND++YFGA VGRV NRIGGA F LNG+ YKL AN+  NTLH G
Sbjct  60   GVLGDIVLGYDSPKAYTNDSSYFGATVGRVGNRIGGAQFTLNGIHYKLVANEGNNTLHAG  119

Query  400  IKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             K FSDV+WTVE Y KD     +T SY+S+DGE GFPG+L V+V+Y+ +GKN L I
Sbjct  120  PKAFSDVLWTVEKYIKDGDRPRVTFSYHSFDGEGGFPGDLIVSVSYI-LGKNSLRI  174



>ref|XP_010242446.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=364

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            MA L +LL F+ +   L          VGIY+IK+G+F V +TN+GA + S++LPDK G 
Sbjct  1    MANLSQLLCFIFVAFALLHVSSANEANVGIYQIKKGNFYVNLTNWGARITSIVLPDKQGN  60

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            LGD+VLG+D++D+YK DT+YFGAIVGRVANRI GA F LN   Y L AND  NTLHGG K
Sbjct  61   LGDIVLGYDTLDEYKTDTSYFGAIVGRVANRIKGAQFTLNDTTYNLVANDGKNTLHGGQK  120

Query  406  GFSDVIWTVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GFSDV+W V+ +   SH   +   Y S DGEQGFPG + V+V Y+   +N+L +
Sbjct  121  GFSDVVWQVKKHSPASHCPYVRFHYQSADGEQGFPGKVIVSVNYMITVENQLSV  174



>ref|XP_011008939.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=404

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 130/190 (68%), Gaps = 11/190 (6%)
 Frame = +1

Query  7    RSKGVHCIC*SELMAALYRLLSFLVLGVFLTGSFCDASE---QVGIYEIKRGSFSVKITN  177
            R+  + C+   E M+    L  F++L   ++G  C  S    ++GIYE+K+G+ S+K+TN
Sbjct  37   RACFIFCV---EKMSKFSALFCFIIL--VISGCACIDSAMGGEIGIYELKKGNLSMKLTN  91

Query  178  YGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEY  357
            YGA +IS++LPDKNGKLGDV LGFD+++++ N ++ FGA VGRVANRI  A F LNG  Y
Sbjct  92   YGARIISLVLPDKNGKLGDVALGFDTIEEFMNASSPFGATVGRVANRISNAQFTLNGTVY  151

Query  358  KLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTY  528
            KLPAN   NT+HGG  GFS V+W V+ Y  D    ++  +Y+S+DGEQGFPG+L V  +Y
Sbjct  152  KLPANSGNNTIHGGPIGFSKVVWKVKKYSPDGLVPYIVFAYHSFDGEQGFPGDLLVKTSY  211

Query  529  LFIGKNKLGI  558
              +G N+L I
Sbjct  212  TLLGDNQLCI  221



>ref|XP_002323843.2| hypothetical protein POPTR_0017s11650g [Populus trichocarpa]
 gb|EEF03976.2| hypothetical protein POPTR_0017s11650g [Populus trichocarpa]
Length=358

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = +1

Query  70   SFLVLGVFLTGSFCDASE---QVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVV  240
            SF  + + ++G  C  S    ++GIYE+K+G+ S+K+TNYGA +IS++LPDKNGKLGDV 
Sbjct  7    SFCFIILVISGCACIDSAMGGEIGIYELKKGNLSMKLTNYGARIISLVLPDKNGKLGDVA  66

Query  241  LGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDV  420
            LGFD+++++ N ++ FGA VGRVANRI  A F LNG  YKLPAN   NT+HGG  GFS V
Sbjct  67   LGFDTIEEFMNASSPFGATVGRVANRISNAQFTLNGTVYKLPANSGNNTIHGGPIGFSKV  126

Query  421  IWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +W V+ Y  D    H+  +Y+S+DGEQGFPG+L V  +Y  +G N+L I
Sbjct  127  VWKVKKYSPDGPVPHIVFAYHSFDGEQGFPGDLLVKTSYTLLGDNQLCI  175



>ref|XP_006373311.1| hypothetical protein POPTR_0017s11660g [Populus trichocarpa]
 gb|ERP51108.1| hypothetical protein POPTR_0017s11660g [Populus trichocarpa]
Length=358

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 124/177 (70%), Gaps = 8/177 (5%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASE---QVGIYEIKRGSFSVKITNYGATVISVILPDK  216
            MA    L  F++L   ++G  C  S    ++GIYE+K+G+ S+K+TNYGA +IS++LPDK
Sbjct  1    MAKFSALFCFIIL--VISGCACIDSAMGGEIGIYELKKGNLSMKLTNYGARIISLVLPDK  58

Query  217  NGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHG  396
            NGKLGDV LGFD+++++ N ++ FGA VGRVANRI  A F LNG  YKLPAN   NT+HG
Sbjct  59   NGKLGDVALGFDTIEEFMNASSPFGATVGRVANRISNAQFTLNGTVYKLPANSGNNTIHG  118

Query  397  GIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G  GFS V+W V+ Y  D    ++  +Y+S+DGEQGFPG+L V  +Y  +G N+L I
Sbjct  119  GPIGFSKVVWKVKKYSPDGLVPYIVFAYHSFDGEQGFPGDLLVETSYTLLGDNQLCI  175



>ref|XP_010256040.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=358

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAI  297
              +VG Y++K G  S+K+TNYGAT++SVI PDK G++ DV LGF  + DY NDT YFG +
Sbjct  25   KPEVGFYDLKDGEISLKVTNYGATILSVIFPDKYGEMADVALGFQKIGDYTNDTIYFGGL  84

Query  298  VGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK---DSHLTLS  468
            VGRVANRI GA F LNG +YK+ AN+  NTLHGG +GFSDV WTV  YK      ++TLS
Sbjct  85   VGRVANRIAGAQFTLNGHKYKVVANEGNNTLHGGHRGFSDVFWTVRKYKPHGSSPYITLS  144

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y S+DGEQGFPG+L V+VTY  +G NKL +
Sbjct  145  YRSFDGEQGFPGDLDVSVTYKIVGWNKLAV  174



>gb|KEH24988.1| aldose 1-epimerase family protein [Medicago truncatula]
Length=375

 Score =   184 bits (468),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 127/179 (71%), Gaps = 9/179 (5%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV--FLTGSFCDASEQ---VGIYEIKRGSFSVKITNYGATVISVILP  210
            M  ++ LL  L L    F+ GS     +    + ++E+K+G  ++K+TN+GAT++S++LP
Sbjct  1    MTKIFMLLCLLFLAFSGFVNGSMNKKEKNHDDIKLFELKKGDLTLKVTNWGATLVSLVLP  60

Query  211  DKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTL  390
            DKNG LGD+VLG+D+   Y NDT+YFGA VGRVANRIGGA F LNGV YKL AN+  NTL
Sbjct  61   DKNGNLGDIVLGYDTPKAYTNDTSYFGATVGRVANRIGGAQFTLNGVRYKLIANEGNNTL  120

Query  391  HGGIKGFSDVIWTVEDYKKDSHLTL---SYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            HGG +GFSDV+W VE Y ++    L    Y+S+DGE+GFPG+L VTV+Y+ + KN L I
Sbjct  121  HGGPRGFSDVLWKVEKYVREGDQPLIKFGYHSFDGEEGFPGDLKVTVSYI-LRKNSLTI  178



>ref|XP_006338472.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=357

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 121/168 (72%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+   +  +   GS   A  ++G+YEIK+G FSVKITNYGA +ISV LPDKNGK+ DVVL
Sbjct  9    LICLFIFHLLAAGSV--AGCKIGVYEIKKGDFSVKITNYGARIISVFLPDKNGKIDDVVL  66

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D+V +Y N+T YFGA++GRV NRIGGA F LNG  YKL  N+  NT+HGG KGFS V+
Sbjct  67   GYDTVKEYINETRYFGALLGRVVNRIGGAQFTLNGTLYKLVPNEGNNTIHGGPKGFSFVV  126

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V +Y +D    H+TL+Y+S +GE+GFPG++ V+VTY      KL +
Sbjct  127  WKVSEYVQDGPCPHITLTYHSAEGEEGFPGDVVVSVTYALKDPYKLSV  174



>ref|XP_002305327.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
 gb|EEE85838.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
Length=358

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDAS-EQVGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            MA    LL F +L +F   +   A+ E++G+YE+K+G+FSVK+TNYGA +IS++LPDK G
Sbjct  1    MAKFCVLLCFSLLLIFGFPAIGSATKEEIGMYELKKGNFSVKLTNYGAHIISLLLPDKYG  60

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
            K+ D+VLG+D++ +YKND++ FGA VGRVANRI GA F LNG  YKL AN+  N LHGG 
Sbjct  61   KVADIVLGYDTIKEYKNDSSNFGATVGRVANRIAGAQFTLNGTLYKLVANEGKNMLHGGR  120

Query  403  KGFSDVIWTVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            KGFS V+W V+ Y  +     +  +Y+S+DGE+GFPG+L V V Y  +G NKL I
Sbjct  121  KGFSTVVWKVKKYSPEGRTPCIVFAYHSFDGEEGFPGDLHVIVGYKLLGDNKLRI  175



>ref|XP_006404338.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
 gb|ESQ45791.1| hypothetical protein EUTSA_v10010502mg [Eutrema salsugineum]
Length=343

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 113/154 (73%), Gaps = 10/154 (6%)
 Frame = +1

Query  97   TGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKND  276
            T S C   E++  Y++ RG+ SV  TNYGA + S++LPD++GK  DVVLGFD+VD YKND
Sbjct  16   TYSLC---EEIQTYKLTRGNLSVTFTNYGAVMTSLLLPDRHGKQDDVVLGFDTVDGYKND  72

Query  277  TAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH  456
            T YFGAIVGRVANRIGGA F+LNG  YK   N+  NTLHGG KGFSDVIW+VE+Y   SH
Sbjct  73   TTYFGAIVGRVANRIGGAEFELNGQMYKTDPNEGHNTLHGGAKGFSDVIWSVENYVPTSH  132

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y+S+DGE+       V VTY+ IG+NKL +
Sbjct  133  ITFKYDSFDGEE-------VKVTYMLIGENKLAV  159



>ref|XP_007032473.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
 gb|EOY03399.1| Galactose mutarotase-like superfamily protein [Theobroma cacao]
Length=364

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 120/159 (75%), Gaps = 5/159 (3%)
 Frame = +1

Query  91   FLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYK  270
            F+ GS     E VG+YE+K G  SVK TN+GAT+ISV+LPDKNGKLGD+ LG++SV +Y 
Sbjct  24   FVNGS--PPKEAVGVYELKNGDMSVKFTNWGATIISVVLPDKNGKLGDIALGYESVKEYM  81

Query  271  NDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD  450
            NDT YFGA+VGRVANRIGGA F LNG +YKL AN+  N LHGG KGF DV+W V+ YKKD
Sbjct  82   NDTTYFGALVGRVANRIGGAKFSLNGTQYKLVANEGKNMLHGGPKGFGDVVWKVKKYKKD  141

Query  451  ---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
                ++  +Y+SYDGE+GFPG L VTV Y  + KNKL +
Sbjct  142  GPAPYILFAYDSYDGEEGFPGALKVTVAYTLLAKNKLSV  180



>ref|XP_009779460.1| PREDICTED: aldose 1-epimerase-like isoform X9 [Nicotiana sylvestris]
Length=356

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 122/168 (73%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+ F +L ++   S      ++GIYEIK+G FSVKITNYGA +ISV+LPDK+GK+GDVV 
Sbjct  8    LICFFILHLWAATSV--RGRKIGIYEIKKGDFSVKITNYGARIISVLLPDKHGKIGDVVS  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++++YKNDT YFGA++GRV NRIGGA F LNG  YKL  N+  NT+HGG KGFS V+
Sbjct  66   GYDAIEEYKNDTRYFGALLGRVVNRIGGAQFTLNGTLYKLIPNEGNNTIHGGPKGFSYVV  125

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y +D     +TL+Y+S DGE+GFPG++  +VT+      KL +
Sbjct  126  WKVSKYVQDGPCPCITLTYHSADGEEGFPGDVLASVTFALKDPYKLSV  173



>emb|CBA10127.1| non-cell-autonomous protein pathway [Nicotiana benthamiana]
Length=357

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = +1

Query  76   LVLGVFLTGSFCDAS----EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+L        C  S     ++GI EIK+G FSVKITNYGAT+ISV LPDK+GK+GDVVL
Sbjct  7    LLLICLFILHLCAVSSVRGRKIGICEIKKGDFSVKITNYGATIISVFLPDKHGKIGDVVL  66

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++ +YKNDT+YFGA +GRVANRIGGA F LNG  +KL AN+  N LHGG+KGFS V+
Sbjct  67   GYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTLFKLVANEGVNMLHGGLKGFSKVV  126

Query  424  WTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y +     ++TL+Y + DGE+GFPG++  +VTY      KL +
Sbjct  127  WKVSKYVRHGPSPYITLTYYNADGEEGFPGDVLASVTYALKDPYKLSV  174



>ref|XP_004232229.1| PREDICTED: aldose 1-epimerase-like [Solanum lycopersicum]
Length=355

 Score =   181 bits (459),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 118/164 (72%), Gaps = 3/164 (2%)
 Frame = +1

Query  76   LVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDS  255
            L + +F+      AS ++GIYE+K+G F+VKIT+YGA +ISV+LPDKNGK+ DVVLG+D+
Sbjct  9    LFICLFIFHLLFAASVKIGIYELKKGDFAVKITDYGARIISVLLPDKNGKIDDVVLGYDT  68

Query  256  VDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVE  435
            +D+Y NDT+YFGA VGRVANRIGGA F LNG  YKL  N+  N LHGG KGFS V+W V 
Sbjct  69   IDEYLNDTSYFGATVGRVANRIGGAQFTLNGTHYKLVPNEGKNMLHGGTKGFSKVVWKVS  128

Query  436  DYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             Y +     ++TL+Y S DGE+GFPG +  +VT+      KL +
Sbjct  129  KYVRYGPSPYITLTYFSADGEEGFPGAVLASVTFALKDPYKLSV  172



>ref|XP_006338468.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=355

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = +1

Query  76   LVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDS  255
            L + +F+      AS ++GIYE+K+G FS+KIT+YGAT+ISV+LPDKNGK+ DVVLG+D+
Sbjct  9    LFICLFIFHLLFAASVKIGIYELKKGDFSIKITDYGATIISVLLPDKNGKIDDVVLGYDT  68

Query  256  VDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVE  435
            + +Y NDT+YFGA +GRVANRIGGA F LNG  YKL  N+  N +HGG KGFS V+W V 
Sbjct  69   IKEYLNDTSYFGATLGRVANRIGGAQFTLNGTHYKLVPNEGKNMIHGGPKGFSKVVWKVS  128

Query  436  DYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             Y +D    ++TL+Y S DGE+GFPG +  +VT+      KL +
Sbjct  129  KYVQDGPSPYITLTYFSADGEEGFPGAVLASVTFALKDPYKLSV  172



>ref|XP_009624445.1| PREDICTED: aldose 1-epimerase-like [Nicotiana tomentosiformis]
Length=356

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 120/168 (71%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+   +L ++   S      ++GIYEIK+G  SVKITNYGA +ISV+LPDK+GK+GDVV 
Sbjct  8    LICLFILHLWAATSV--TGRKIGIYEIKKGDLSVKITNYGARIISVLLPDKHGKIGDVVS  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++++YKNDT YFGA++GRV NRIGGA F LNG  YKL  N+  NT+HGG KGFS V+
Sbjct  66   GYDTIEEYKNDTRYFGALLGRVVNRIGGAQFTLNGTLYKLVPNEGNNTIHGGPKGFSYVV  125

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V  Y +D     +TL+Y+S DGE+GFPG++  +VTY      KL +
Sbjct  126  WKVSKYVQDGLCPCITLTYHSADGEEGFPGDVLASVTYALKDPYKLSV  173



>gb|EYU34099.1| hypothetical protein MIMGU_mgv1a008692mg [Erythranthe guttata]
Length=365

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 112/147 (76%), Gaps = 3/147 (2%)
 Frame = +1

Query  127  VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGR  306
            + IYEIK+G FSVKITNYGA ++SV+LPDKNGKL DVVLG+D++ DY NDT YFGAIVGR
Sbjct  31   LNIYEIKKGDFSVKITNYGARIVSVVLPDKNGKLADVVLGYDTIKDYMNDTCYFGAIVGR  90

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNS  477
            V NRIGGA F LNG  YKL AN+  + LHGG KGFS V W V+++ K+     +TL+Y+S
Sbjct  91   VGNRIGGAKFTLNGTVYKLDANEGTSMLHGGKKGFSQVAWKVKNHVKNGPSPSITLTYHS  150

Query  478  YDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             DGE+GFPG++  +VTY  I   KL +
Sbjct  151  VDGEEGFPGDVLTSVTYAIIEPYKLSV  177



>ref|XP_006400031.1| hypothetical protein EUTSA_v10013324mg [Eutrema salsugineum]
 gb|ESQ41484.1| hypothetical protein EUTSA_v10013324mg [Eutrema salsugineum]
Length=502

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            E +G+YE+K+G+ +VK TN+GA+++S+  PDKNGK GD+VLG+DSV  YK D  YFGA V
Sbjct  170  ENIGLYELKKGNLTVKFTNWGASIMSLHFPDKNGKSGDIVLGYDSVKSYKTDKVYFGATV  229

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLTLSY  471
            GRVANRIG A FKLNG EYK  AND  NTLHGG KGF DV+W V  +K   K  H+  +Y
Sbjct  230  GRVANRIGKAQFKLNGKEYKTVANDGKNTLHGGKKGFGDVVWAVTKHKYDGKKPHIVFTY  289

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             S DG+QGFPG L+VTVTY  +  N+L +
Sbjct  290  TSPDGDQGFPGELNVTVTYQLVKNNELSV  318



>gb|KDP31227.1| hypothetical protein JCGZ_11603 [Jatropha curcas]
Length=352

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 124/176 (70%), Gaps = 12/176 (7%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV-FLTGSFCDASE----QVGIYEIKRGSFSVKITNYGATVISVILP  210
            MA       FL++ + F   + C+A++    +  IYE+KRG+FSVK TN+GAT++S++LP
Sbjct  1    MAWRSSFCCFLLVALLFSNNNGCEAADSSENKAEIYELKRGNFSVKFTNFGATMLSIVLP  60

Query  211  DKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTL  390
            DKNG    + LGF       NDT YFG+IVGRVANRIG + F LNG  YKL  N+  N+L
Sbjct  61   DKNGLHFSLSLGF-------NDTTYFGSIVGRVANRIGKSQFTLNGTVYKLVPNNGKNSL  113

Query  391  HGGIKGFSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            HGG KGFS+V+W V  Y KDSH+T +Y+S+DGE+G+PG+LSV+VTY  IG NK+ +
Sbjct  114  HGGPKGFSEVLWKVYSYNKDSHITFTYDSFDGEEGYPGDLSVSVTYFVIGTNKIAV  169



>ref|XP_002871651.1| hypothetical protein ARALYDRAFT_488355 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47910.1| hypothetical protein ARALYDRAFT_488355 [Arabidopsis lyrata subsp. 
lyrata]
Length=484

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            E +G+YE+K+G+ ++K TN+GA+++S+  PDKNGK+ D+VLG+DSV  YK D  YFGA V
Sbjct  152  ENIGLYELKKGNLTIKFTNWGASIMSLHFPDKNGKMDDIVLGYDSVKSYKTDKVYFGATV  211

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLTLSY  471
            GRVANRIG A FKLNG EYK  AND  NTLHGG KGF DV+W V  +K   K  H+  +Y
Sbjct  212  GRVANRIGNAKFKLNGKEYKTSANDGKNTLHGGKKGFGDVVWAVAKHKYDGKKPHIVFTY  271

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             S DG+QGFPG L+VTVTY  +  N+L +
Sbjct  272  TSPDGDQGFPGELNVTVTYKLVKDNELSV  300



>ref|XP_009624449.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Nicotiana tomentosiformis]
Length=371

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 122/179 (68%), Gaps = 16/179 (9%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKN--------  219
            L+ F +L +    +      ++GIYEIK+G FSV+ITNYGA +ISV+LPDK+        
Sbjct  8    LICFFILHLLAATNV--RGRKIGIYEIKKGDFSVRITNYGARIISVLLPDKHEISVTVSC  65

Query  220  ---GKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTL  390
               G +GDV LG+D+V +Y+NDT  FGA++GRVANRIGGA F LNG  YKL AND  NTL
Sbjct  66   SVPGNIGDVALGYDTVKEYENDTTSFGALLGRVANRIGGAQFTLNGTIYKLIANDGANTL  125

Query  391  HGGIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            HGG KGFS V+W V  Y++D    H+TL+Y+S DGE+GFPG++  +VTY      KL +
Sbjct  126  HGGPKGFSRVVWNVNKYEQDGPYPHITLTYHSADGEEGFPGDVLASVTYALEDPYKLSV  184



>emb|CDX69547.1| BnaA10g18960D [Brassica napus]
Length=398

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = +1

Query  112  DASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFG  291
            +  E +G+YE+K+ + +VK TN+GA+++S+  PDKNGK GD+VLG+DSV+ Y+ D  YFG
Sbjct  165  NEKENIGLYELKKENLTVKFTNWGASIMSLHFPDKNGKSGDIVLGYDSVESYETDKVYFG  224

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLT  462
            A VGRVANRIG A FKLNG EYK  AND  NTLHGG KGF DV+W V  +K   K  H+ 
Sbjct  225  ATVGRVANRIGKAHFKLNGKEYKTVANDGKNTLHGGKKGFGDVVWAVTKHKYDGKKPHIV  284

Query  463  LSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             +Y S DG+QGFPG L VTVTY  +  NKL +
Sbjct  285  FTYTSPDGDQGFPGELIVTVTYKLVKDNKLSV  316



>ref|XP_010693333.1| PREDICTED: aldose 1-epimerase [Beta vulgaris subsp. vulgaris]
Length=380

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 108/148 (73%), Gaps = 3/148 (2%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAI  297
            ++++G+YE+K G+ SVK+TNYGATVISVI+PDK GKL DVVLG+DS  +Y NDT YFGAI
Sbjct  45   NQEIGVYELKNGNVSVKLTNYGATVISVIVPDKYGKLADVVLGYDSAKEYVNDTTYFGAI  104

Query  298  VGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDS---HLTLS  468
            VGRVANRI GA +  N   YKL AN+  N LHGG KGFS VIW V+ Y   +   H+  S
Sbjct  105  VGRVANRIAGAQYTYNEKHYKLIANEGKNILHGGPKGFSRVIWKVDRYSPKAHYPHIKFS  164

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKL  552
            Y S+DGEQGFPG L VTV Y  I  N L
Sbjct  165  YFSFDGEQGFPGKLKVTVIYKIIKGNHL  192



>ref|XP_002517486.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF45028.1| aldose-1-epimerase, putative [Ricinus communis]
Length=359

 Score =   178 bits (452),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 119/174 (68%), Gaps = 5/174 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            M  +  L  F +L  F  G    A E+V  YE+K+G+ S+K+TN+GA+++S ++PDK GK
Sbjct  1    MGKISFLFCFCILVAF--GFANGAEEKVEFYELKKGNISMKLTNWGASIVSFVIPDKTGK  58

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
              DVVLG+D++ +Y+ D+ YFGA+VGRVANRIGGA FKLNG  YKLPAND  N LHGG K
Sbjct  59   PIDVVLGYDTIKEYQTDSTYFGAVVGRVANRIGGAEFKLNGKTYKLPANDGKNMLHGGAK  118

Query  406  GFSDVIWTVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G+SDV+W V  YK   +   +  ++ S DGE+GFPG L V VTY  +   +L +
Sbjct  119  GYSDVVWKVTKYKNSGNAPFIVFTHRSSDGEEGFPGALRVVVTYTLLADGQLSV  172



>emb|CBI22179.3| unnamed protein product [Vitis vinifera]
Length=1699

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 115/167 (69%), Gaps = 9/167 (5%)
 Frame = +1

Query  79   VLGVFLTGSFCDASEQV------GIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVV  240
            V   F+T  FC A+  V      GIYE+++G FS K T +GA ++SV+LPDKNGKL DVV
Sbjct  6    VFVCFITLVFCFATGSVAKKEDGGIYELRKGDFSAKFTKWGAAIVSVVLPDKNGKLADVV  65

Query  241  LGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDV  420
            LG+DS  +YKNDT  FGAIVGRVANRIGGA F LNG  YKL AND  N LHGG KGF  V
Sbjct  66   LGYDSTKEYKNDTTNFGAIVGRVANRIGGAQFTLNGTHYKLVANDGKNMLHGGPKGFGKV  125

Query  421  IWTVEDYKKDSH---LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKL  552
             W V  Y+K  H   +  SY+S DGE+GFPG+L  TVTY+ +G  +L
Sbjct  126  AWRVSKYEKGGHSPYIMFSYHSLDGEEGFPGDLIATVTYMLVGDYQL  172



>ref|XP_010317286.1| PREDICTED: aldose 1-epimerase-like [Solanum lycopersicum]
Length=390

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 118/168 (70%), Gaps = 5/168 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+   +  +   GS   A  ++G+YEIK G FSVKITNYGA +ISV LPDKNGK+ DVVL
Sbjct  9    LICLFIFHLLAAGSV--AGCEIGVYEIKNGDFSVKITNYGARIISVFLPDKNGKIDDVVL  66

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+ +V +Y N+T YFGA++GRV NRI GA F LNG  YKL  N+  NT+HGG KGFS V+
Sbjct  67   GYYTVKEYINETRYFGALLGRVVNRISGAQFTLNGTLYKLVPNEGNNTIHGGPKGFSFVV  126

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            W V +Y +D    H+TL+Y+S DGE+GFPG++ V+VTY      KL +
Sbjct  127  WKVSEYVQDGPCPHITLTYHSTDGEEGFPGDVLVSVTYALKDPYKLSV  174



>dbj|BAK04813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=363

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 118/166 (71%), Gaps = 5/166 (3%)
 Frame = +1

Query  70   SFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGF  249
             F+ LG  L G      + VGIYE+K+G FS+K+TN+GAT++SVILPD  G LGDV+LG+
Sbjct  15   CFVALG--LPGGAAAERKIVGIYELKKGDFSIKVTNWGATLMSVILPDSRGNLGDVILGY  72

Query  250  DSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWT  429
            D+V +Y N TAYFG ++GRVANRI  A F L+G  Y+L  ND  NTLHGG +GF  V+WT
Sbjct  73   DTVAEYVNGTAYFGGLIGRVANRIANARFTLDGKSYRLFPNDGNNTLHGGHRGFDKVVWT  132

Query  430  VEDY---KKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            VE++    +   +TL Y+S+DGEQGFPG++ V VTY   G++ L +
Sbjct  133  VEEHLAGGRSPFITLYYHSFDGEQGFPGDVDVHVTYQITGRHALSV  178



>ref|XP_006287626.1| hypothetical protein CARUB_v10000838mg [Capsella rubella]
 gb|EOA20524.1| hypothetical protein CARUB_v10000838mg [Capsella rubella]
Length=484

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            E +G+YE+K+G+ ++K TN+GA+++S+  PDKNGK+GD+VLG+DSV  Y+ D  YFGA V
Sbjct  152  ENIGLYELKKGNITIKFTNWGASIMSLNFPDKNGKIGDIVLGYDSVKSYQTDKVYFGATV  211

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLTLSY  471
            GRVANRIG A FKLNG EYK  AND  NTLHGG KGF DV+W V  +K   K  H+  +Y
Sbjct  212  GRVANRIGKAQFKLNGKEYKTSANDGKNTLHGGKKGFGDVVWAVTKHKYDGKKPHIVFTY  271

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             S DG+QGFPG L+VTVTY     N+L +
Sbjct  272  TSPDGDQGFPGELNVTVTYTLDKDNELSV  300



>gb|KFK25751.1| hypothetical protein AALP_AA8G154800 [Arabis alpina]
Length=539

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 111/152 (73%), Gaps = 3/152 (2%)
 Frame = +1

Query  112  DASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFG  291
            +  E +G YE+K+G+ +VK TN+GA+++S+  PDKNGK GD+VLG+DS+  YK D  YFG
Sbjct  204  NEKENIGTYELKKGNLTVKFTNWGASIMSLHFPDKNGKSGDIVLGYDSIKSYKTDKVYFG  263

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLT  462
            A VGRVANRIG A FKL+G EYK  AND  NTLHGG+KGF DV+W V  ++   K  H+ 
Sbjct  264  ATVGRVANRIGKAQFKLDGKEYKTSANDGKNTLHGGMKGFGDVVWAVSKHQYDGKKPHIV  323

Query  463  LSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             +Y S DG+QGFPG L+VTVTY  +  N+L +
Sbjct  324  FTYTSPDGDQGFPGELNVTVTYKIVKDNELSV  355



>ref|XP_008453675.1| PREDICTED: aldose 1-epimerase [Cucumis melo]
Length=337

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 119/168 (71%), Gaps = 15/168 (9%)
 Frame = +1

Query  55   LYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGD  234
            + ++L  + L V  T  F +  E VGI+E+KRG FS+++TNYGAT++SVILPDKN     
Sbjct  1    MAKILPPIFLLVVATIGFSNGHE-VGIFELKRGDFSIQLTNYGATILSVILPDKN-----  54

Query  235  VVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFS  414
                      ++NDT YFG IVGRVANRIGGA F +NGV +KL  N+  N LHGG +GF 
Sbjct  55   ---------VWQNDTTYFGNIVGRVANRIGGAQFGINGVFHKLIPNNGRNLLHGGKRGFG  105

Query  415  DVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            DVIW V+ Y K+SH+T +Y+S+DGEQGFPG+L V+VTY+ I  NKLGI
Sbjct  106  DVIWKVKSYVKNSHITFTYDSFDGEQGFPGDLPVSVTYMIIETNKLGI  153



>ref|XP_009121605.1| PREDICTED: aldose 1-epimerase isoform X1 [Brassica rapa]
Length=500

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = +1

Query  112  DASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFG  291
            +  E +G+YE+K+ + +VK TN+GA+++S+  PDKNGK GD+VLG+DSV+ Y+ D  YFG
Sbjct  165  NEKENIGLYELKKENLTVKFTNWGASIMSLHFPDKNGKSGDIVLGYDSVESYETDKVYFG  224

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLT  462
            A VGRVANRIG A FKLNG EYK  AND  NTLHGG KGF DV+W V  +K   K  H+ 
Sbjct  225  ATVGRVANRIGKAHFKLNGKEYKTVANDGKNTLHGGKKGFGDVVWAVTKHKYDGKKPHIV  284

Query  463  LSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             +Y S DG+QGFPG L VTVTY  +  NKL +
Sbjct  285  FTYTSPDGDQGFPGELIVTVTYKLVKDNKLSV  316



>ref|XP_010453642.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=489

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = +1

Query  127  VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGR  306
            +G+YE+K+G+ +VK TN+GA+++S+  PDKNGK+ D+VLG+DSV  YK D  YFGA VGR
Sbjct  159  IGLYELKKGNLTVKFTNWGASIMSLHFPDKNGKIDDIVLGYDSVKSYKTDKVYFGATVGR  218

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLTLSYNS  477
            VANRIG A FKLNG EYK  AND  NTLHGG KGF DV+W V  +K   K  H+  +Y S
Sbjct  219  VANRIGNAQFKLNGKEYKTSANDGKNTLHGGKKGFGDVVWAVSKHKYDGKSPHIVFTYTS  278

Query  478  YDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             DG+QGFPG L+ TVTY  +  N+L +
Sbjct  279  PDGDQGFPGELNATVTYKLVKDNELSV  305



>ref|XP_003579892.1| PREDICTED: aldose 1-epimerase-like [Brachypodium distachyon]
Length=367

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            LL  L L  F +G+     + VG+YE+++G FSVK+TN+GATV SV+ PD  G LGDVVL
Sbjct  6    LLVALCLVCFASGASAAGRKMVGVYELRKGDFSVKVTNWGATVTSVVFPDSKGNLGDVVL  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++ +Y N ++YFGA+VGRVANR+  A F L+G  Y L AND  N LHGG +GFS VI
Sbjct  66   GYDTIAEYVNGSSYFGALVGRVANRVAKARFVLDGKVYNLYANDGKNALHGGHRGFSKVI  125

Query  424  WTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            WTV++Y       H+TL Y+S+DGEQGFPG+L V VTY
Sbjct  126  WTVKEYVAGGDSPHITLYYHSFDGEQGFPGDLDVYVTY  163



>ref|XP_010420168.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=489

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = +1

Query  127  VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGR  306
            +G+YE+K+G+ +VK TN+GA+++S+  PDKNGK+ D+VLG+DSV  YK D  YFGA VGR
Sbjct  159  IGLYELKKGNLTVKFTNWGASIMSLHFPDKNGKIDDIVLGYDSVKSYKTDKVYFGATVGR  218

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLTLSYNS  477
            VANRIG A FKLNG EYK  AND  NTLHGG KGF DV+W V  +K   K  H+  +Y S
Sbjct  219  VANRIGKAQFKLNGKEYKTSANDGKNTLHGGKKGFGDVVWAVAKHKYDGKSPHIVFTYTS  278

Query  478  YDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             DG+QGFPG L+ TVTY  +  N+L +
Sbjct  279  PDGDQGFPGELNATVTYKLVKDNELSV  305



>ref|NP_197018.1| aldose 1-epimerase-like protein [Arabidopsis thaliana]
 emb|CAB89324.1| putative aldose 1-epimerase-like protein [Arabidopsis thaliana]
 gb|ABE66157.1| aldose 1-epimerase family protein [Arabidopsis thaliana]
 gb|AED92121.1| aldose 1-epimerase [Arabidopsis thaliana]
Length=490

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 110/152 (72%), Gaps = 3/152 (2%)
 Frame = +1

Query  112  DASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFG  291
            +  E++G+YE+K+G+ +VK TN+GA++IS+  PDKNGK+ D+VLG+DSV  YK D  YFG
Sbjct  155  NEKEKIGLYELKKGNLTVKFTNWGASIISLHFPDKNGKMDDIVLGYDSVKTYKTDKVYFG  214

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLT  462
            A VGRVANRIG   FKLNG EYK   ND  NTLHGG KGF DV+W V  ++   K  H+ 
Sbjct  215  ATVGRVANRIGKGKFKLNGKEYKTSVNDGKNTLHGGKKGFGDVVWAVAKHQYDGKKPHIV  274

Query  463  LSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             ++ S DG+QGFPG LSVTVTY  +  N+L +
Sbjct  275  FTHTSPDGDQGFPGELSVTVTYKLVKDNELSV  306



>ref|XP_009131443.1| PREDICTED: aldose 1-epimerase-like [Brassica rapa]
Length=535

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = +1

Query  112  DASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFG  291
            +  + +G+YE+K+G+ ++K+TN+GA+++S+  PDKNGK GD+VLG+DSV  YK D  YFG
Sbjct  200  NEKDNIGLYELKKGNITIKLTNWGASIMSLHFPDKNGKAGDIVLGYDSVKSYKTDKVYFG  259

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLT  462
            A VGRVANRIG A FKLNG EYK  AND  NTLHGG KGF DV+W V+ +K   K  H+ 
Sbjct  260  ATVGRVANRIGKAQFKLNGKEYKTTANDGKNTLHGGKKGFGDVVWGVKKHKYDGKKPHIV  319

Query  463  LSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             +Y S DG+QGFPG ++VTVTY    +N+L +
Sbjct  320  FTYTSPDGDQGFPGEVNVTVTYKLDKENELSV  351



>ref|XP_006384345.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
 gb|ERP62142.1| hypothetical protein POPTR_0004s13470g [Populus trichocarpa]
Length=367

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 126/184 (68%), Gaps = 13/184 (7%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDAS-EQVGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            MA    LL F +L +F   +   A+ E++G+YE+K+G+FSVK+TNYGA +IS++LPDK G
Sbjct  1    MAKFCVLLCFSLLLIFGFPAIGSATKEEIGMYELKKGNFSVKLTNYGAHIISLLLPDKYG  60

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
            K+ D+VLG+D++ +YKND++ FGA VGRVANRI GA F LNG  YKL AN+  N LHGG 
Sbjct  61   KVADIVLGYDTIKEYKNDSSNFGATVGRVANRIAGAQFTLNGTLYKLVANEGKNMLHGGR  120

Query  403  KGFSDVIWTVEDYKKDSH---LTLSYNSYDGEQ---------GFPGNLSVTVTYLFIGKN  546
            KGFS V+W V+ Y  +     +  +Y+S+DGE+         GFPG+L V V Y  +G N
Sbjct  121  KGFSTVVWKVKKYSPEGRTPCIVFAYHSFDGEEVMNTFFIYTGFPGDLHVIVGYKLLGDN  180

Query  547  KLGI  558
            KL I
Sbjct  181  KLRI  184



>ref|XP_010524327.1| PREDICTED: aldose 1-epimerase isoform X1 [Tarenaya hassleriana]
 ref|XP_010524328.1| PREDICTED: aldose 1-epimerase isoform X2 [Tarenaya hassleriana]
Length=451

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAI  297
            S+  G YE+K+G+ +VK TN+GA+++S+ILPDK+GK+GD+VLG+DSV DY NDT YFGA 
Sbjct  118  SKDAGTYELKKGNMTVKFTNWGASIMSLILPDKHGKMGDIVLGYDSVKDYMNDTVYFGAT  177

Query  298  VGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH---LTLS  468
            VGRVANRIG A FKLNG  YK  AN+  NTLHGG +GF DV+W+V   + D +   +  +
Sbjct  178  VGRVANRIGKARFKLNGKTYKTVANEGKNTLHGGKRGFGDVVWSVTKRRFDGNTPFIVFT  237

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y S DG+QGFPG L V VTY  +G N+L +
Sbjct  238  YTSPDGDQGFPGELRVKVTYKLVGTNELRV  267



>gb|KJB33630.1| hypothetical protein B456_006G023000 [Gossypium raimondii]
Length=388

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
             +VGIYE+K G+ SVK TN+GA+VIS+ILPDK+GK GD+VLG+D V +Y +D  YFG+++
Sbjct  46   HEVGIYELKNGNMSVKFTNWGASVISIILPDKDGKPGDIVLGYDDVKEYMSDANYFGSVL  105

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH---LTLSY  471
            GRVANRI GA   LNG ++ LPAND  NTL+GG KGFSDVIW V+  KKD+    +   Y
Sbjct  106  GRVANRISGAKLPLNGAQFTLPANDGKNTLNGGPKGFSDVIWEVKKIKKDAEDPTIVFGY  165

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             S DG++GFPG + VTV YL    N+L +
Sbjct  166  RSKDGDEGFPGEIKVTVRYLLRSDNRLRV  194



>ref|XP_010492338.1| PREDICTED: aldose 1-epimerase-like [Camelina sativa]
Length=508

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = +1

Query  127  VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGR  306
            +G+YE+K+G+ +VK TN+GA+++S+  PDKNGK+ D+VLG+DSV  YK D  YFGA VGR
Sbjct  178  IGLYELKKGNLTVKFTNWGASIMSLHFPDKNGKIDDIVLGYDSVKTYKTDKVYFGATVGR  237

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLTLSYNS  477
            VANRIG A FKLNG EYK  AND  NTLHGG KGF DV+W V  +K   K  H+  +Y S
Sbjct  238  VANRIGKAHFKLNGKEYKTSANDGKNTLHGGKKGFGDVVWAVSKHKYDGKSPHIVFTYTS  297

Query  478  YDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             DG+QGFPG L+ TVTY  +  N+L +
Sbjct  298  PDGDQGFPGELNATVTYKLVKDNELSV  324



>ref|XP_002517487.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF45029.1| aldose-1-epimerase, putative [Ricinus communis]
Length=357

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 123/167 (74%), Gaps = 5/167 (3%)
 Frame = +1

Query  67   LSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLG  246
            LS L+   F+ GS   A E++G+YE+K+G+ ++K+TNYGA VISV LPDK GK+ DVVLG
Sbjct  10   LSILLAFGFINGSL--AEEKIGVYELKKGNITLKLTNYGARVISVYLPDKYGKVDDVVLG  67

Query  247  FDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIW  426
            +DS+D+Y NDT+ FGA VGRVANRI GA F LNG  YKL  N+  N LHGG KGFS V+W
Sbjct  68   YDSIDEYLNDTSSFGATVGRVANRIAGAQFTLNGTTYKLVPNEGKNMLHGGRKGFSKVVW  127

Query  427  TVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             V+ YK+     H+TL+Y S+DGE+GFPGNL VT+ Y  +  N+L I
Sbjct  128  KVKKYKQAGHTPHITLTYRSFDGEEGFPGNLRVTLAYTLLENNQLSI  174



>ref|XP_009779451.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Nicotiana sylvestris]
Length=467

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 115/152 (76%), Gaps = 5/152 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+ F +L   L+ +      ++GIYEIK+G FSVKITNYGA +ISV+LPDK+GK+GDVVL
Sbjct  25   LICFFIL--HLSAAASVRGRKIGIYEIKKGDFSVKITNYGARIISVLLPDKHGKIGDVVL  82

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++++YKNDT+YFGA +GRVANRIGGA F LNG+ YKL  N+  N LHGG KGFS V+
Sbjct  83   GYDTIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPKGFSKVV  142

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNL  510
            W V  Y KD    ++TL+Y S DGE+G  G++
Sbjct  143  WKVSKYVKDGPWPYITLTYYSADGEEGKIGDV  174


 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = +1

Query  214  KNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLH  393
            + GK+GDVVLG+D++ +YKNDT+YFGA +GRVANRIGGA F LNG  YKL AN+  N LH
Sbjct  167  EEGKIGDVVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLH  226

Query  394  GGIKGFSDVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GG+KGFS V+W V  Y +     ++TL+Y S DGE+GFPG++ V+VTY      KL +
Sbjct  227  GGLKGFSKVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKDPYKLSV  284



>ref|XP_010916998.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
 ref|XP_010916999.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
 ref|XP_010917000.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
Length=358

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 115/159 (72%), Gaps = 5/159 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQ-VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVV  240
            LL   VL + L G    A  + VGIYE+KRG FSVK+TN+GAT++SVILPD  GKL DVV
Sbjct  6    LLFISVLLLALMGVSNGAPRKMVGIYELKRGDFSVKVTNWGATILSVILPDSKGKLNDVV  65

Query  241  LGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDV  420
            LG+D +  Y NDT YFGA+VGRVANRI  A F +NG  YKL  ND  NTLHGG +GF+ V
Sbjct  66   LGYDKIGSYVNDTTYFGALVGRVANRIADARFSINGTVYKLIRNDGNNTLHGGHRGFNRV  125

Query  421  IWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTY  528
            IWTV++ K D    ++T  Y+S+DGEQGFPG+L V VTY
Sbjct  126  IWTVKE-KVDGEFPYITFYYHSFDGEQGFPGDLDVFVTY  163



>ref|XP_009779452.1| PREDICTED: aldose 1-epimerase-like isoform X2 [Nicotiana sylvestris]
Length=450

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 117/158 (74%), Gaps = 4/158 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            M+    LL  L++   L  +      ++GIYEIK+G FSVKITNYGA++ISV+LPDK+GK
Sbjct  1    MSLKINLLVCLIIFHLLVAASVRG-HKIGIYEIKKGDFSVKITNYGASIISVLLPDKHGK  59

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            +GDVVLG+D++++YKNDT+YFGA +GRVANRIGGA F LNG+ YKL  N+  N LHGG K
Sbjct  60   IGDVVLGYDTIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPK  119

Query  406  GFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNL  510
            GFS V+W V  Y KD    ++TL+Y S DGE+G  G++
Sbjct  120  GFSKVVWKVSKYVKDGPWPYITLTYYSADGEEGKIGDV  157


 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = +1

Query  214  KNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLH  393
            + GK+GDVVLG+D++ +YKNDT+YFGA +GRVANRIGGA F LNG  YKL AN+  N LH
Sbjct  150  EEGKIGDVVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLH  209

Query  394  GGIKGFSDVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GG+KGFS V+W V  Y +     ++TL+Y S DGE+GFPG++ V+VTY      KL +
Sbjct  210  GGLKGFSKVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKDPYKLSV  267



>ref|XP_010102873.1| Aldose 1-epimerase [Morus notabilis]
 gb|EXB94289.1| Aldose 1-epimerase [Morus notabilis]
Length=364

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 120/177 (68%), Gaps = 6/177 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGV---FLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDK  216
            M  +  LL F++L +    +  +   A ++V  YE+K+G FSV  TN+GA++IS++LPD+
Sbjct  1    MTNISVLLCFIILAIGSSMVMPNVSSAKQEVHTYELKKGDFSVNFTNWGASIISLVLPDR  60

Query  217  NGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHG  396
             GKL DVVLG+DS+ +Y ND++Y GA+VGR ANRIGGA F L G  Y + AN+  NTLHG
Sbjct  61   YGKLADVVLGYDSLKEYMNDSSYIGAVVGRFANRIGGAQFTLEGKHYSVVANEGKNTLHG  120

Query  397  GIKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G +GFSDV+W V+ Y  +     +  +Y+S DGE+GFPG+L V+V Y   G  +L +
Sbjct  121  GKRGFSDVVWKVKKYDNEGDAPSIVFTYHSSDGEEGFPGDLLVSVKYTLFGDKRLKV  177



>ref|XP_012083800.1| PREDICTED: aldose 1-epimerase-like [Jatropha curcas]
Length=362

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 117/170 (69%), Gaps = 4/170 (2%)
 Frame = +1

Query  61   RLLSFL-VLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDV  237
            R ++FL    + +   F   + +   +E+K+G+ ++K+TN+GAT++S+I+PDK GK  DV
Sbjct  2    RNITFLFCFSILVAFEFASTNAKAEFFELKKGNITLKLTNWGATIVSLIIPDKTGKPVDV  61

Query  238  VLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSD  417
            VLG+D++ +Y+ DT YFGA VGRVANRIGGA FKLNG  YKL AN+  NT+HGG KGFS 
Sbjct  62   VLGYDTIAEYEKDTEYFGATVGRVANRIGGAQFKLNGKVYKLVANEGKNTIHGGPKGFSK  121

Query  418  VIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            V+W     KKD     ++ +YNS DG+QGFPG +  TVTY  I  N+  I
Sbjct  122  VLWKAIKNKKDGPTPSISFAYNSPDGDQGFPGAIRATVTYSIIADNQFSI  171



>ref|XP_008784468.1| PREDICTED: aldose 1-epimerase-like [Phoenix dactylifera]
Length=358

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +1

Query  127  VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGR  306
            VG YE+K+G FSVK+TN+GAT++S++LPD  G L DVVLGFD +  Y N++AYFGA+VGR
Sbjct  29   VGFYELKKGDFSVKVTNWGATIVSIVLPDSKGNLADVVLGFDGLGPYINNSAYFGALVGR  88

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNS  477
            V NRI GA F LNG  Y+L AND  N+LHGG +GFS VIWTV++ K D    ++TL Y+S
Sbjct  89   VGNRISGARFVLNGKAYRLYANDGNNSLHGGHRGFSHVIWTVKE-KVDGEFPYITLYYHS  147

Query  478  YDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +DGEQGFPG+L V+VTY   G  +L +
Sbjct  148  FDGEQGFPGDLDVSVTYKISGAYELSV  174



>ref|XP_008811569.1| PREDICTED: aldose 1-epimerase-like [Phoenix dactylifera]
Length=358

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 107/141 (76%), Gaps = 4/141 (3%)
 Frame = +1

Query  115  ASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGA  294
            + + VGIYE+KRG FSVK+TN+GAT+ISVILPD  GKL DVVLG+D +  Y N+T YFGA
Sbjct  24   SRKTVGIYELKRGDFSVKVTNWGATIISVILPDSKGKLNDVVLGYDKIGSYVNETTYFGA  83

Query  295  IVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTL  465
            +VGRVANRI  A F +NG  YKL  ND  NTLHGG +GF+ VIWTV + + D    ++T 
Sbjct  84   LVGRVANRIADARFSINGTVYKLFPNDGNNTLHGGHRGFNQVIWTVRE-RVDGEFPYITF  142

Query  466  SYNSYDGEQGFPGNLSVTVTY  528
             Y+S+DGEQGFPG+L V VTY
Sbjct  143  YYHSFDGEQGFPGDLDVFVTY  163



>ref|XP_008784475.1| PREDICTED: aldose 1-epimerase-like [Phoenix dactylifera]
Length=364

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 113/153 (74%), Gaps = 4/153 (3%)
 Frame = +1

Query  109  CDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYF  288
                + VG YE+K+G FSVK+TN+GAT++SV+LPD  G L DVVLGFD +  Y N++AYF
Sbjct  23   ASPRKMVGFYELKKGDFSVKVTNWGATIVSVVLPDSKGNLADVVLGFDGLGPYINNSAYF  82

Query  289  GAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHL  459
            GA+VGRV NRI GA F L+G  Y+L AND  N+LHGG +GFS VIWTV++ K D    ++
Sbjct  83   GALVGRVGNRISGARFVLDGKAYRLYANDGNNSLHGGHRGFSHVIWTVKE-KVDGEFPYI  141

Query  460  TLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            TL Y+S+DGEQGFPG+L V+VTY   G  +L +
Sbjct  142  TLYYHSFDGEQGFPGDLDVSVTYKISGAYELSV  174



>ref|XP_009779453.1| PREDICTED: aldose 1-epimerase-like isoform X3 [Nicotiana sylvestris]
Length=450

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 5/152 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            L+ F +L ++   S      ++GIYEIK+G FSVKITNYGA +ISV+LPDK+GK+GDVV 
Sbjct  8    LICFFILHLWAATSV--RGRKIGIYEIKKGDFSVKITNYGARIISVLLPDKHGKIGDVVS  65

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G+D++++YKNDT+YFGA +GRVANRIGGA F LNG+ YKL  N+  N LHGG KGFS V+
Sbjct  66   GYDAIEEYKNDTSYFGATLGRVANRIGGAQFTLNGIHYKLVPNEGKNMLHGGPKGFSKVV  125

Query  424  WTVEDYKKD---SHLTLSYNSYDGEQGFPGNL  510
            W V  Y KD    ++TL+Y S DGE+G  G++
Sbjct  126  WKVSKYVKDGPWPYITLTYYSADGEEGKIGDV  157


 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = +1

Query  214  KNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLH  393
            + GK+GDVVLG+D++ +YKNDT+YFGA +GRVANRIGGA F LNG  YKL AN+  N LH
Sbjct  150  EEGKIGDVVLGYDTIKEYKNDTSYFGAALGRVANRIGGAQFTLNGTHYKLVANEGVNMLH  209

Query  394  GGIKGFSDVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            GG+KGFS V+W V  Y +     ++TL+Y S DGE+GFPG++ V+VTY      KL +
Sbjct  210  GGLKGFSKVVWKVSKYVRHGPSPYITLTYYSADGEEGFPGDVLVSVTYALKDPYKLSV  267



>ref|XP_003575218.1| PREDICTED: aldose 1-epimerase-like [Brachypodium distachyon]
Length=378

 Score =   171 bits (434),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 122/172 (71%), Gaps = 7/172 (4%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDAS----EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLG  231
            +L++ ++ + L+G   DA+    + VG+YE+K+G FS+K+TN+GAT++SVILPD  G L 
Sbjct  11   VLAWCLVALALSGGGTDAAGEKRKMVGVYELKKGDFSIKVTNWGATLMSVILPDSRGNLA  70

Query  232  DVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGF  411
            DVVLG+D+V +Y N +AYFG ++GRVANRI  A F L+G  ++L  ND  NTLHGG +GF
Sbjct  71   DVVLGYDTVAEYVNGSAYFGGLIGRVANRIADARFTLDGKAHRLFPNDGNNTLHGGHRGF  130

Query  412  SDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            S V+WTV+++        +TL Y S+DGEQGFPG+L V VTY   G + L +
Sbjct  131  SKVVWTVKEHVDGGDYPFITLFYRSFDGEQGFPGDLDVYVTYEISGPHALSV  182



>gb|EMS48169.1| Aldose 1-epimerase [Triticum urartu]
Length=273

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = +1

Query  88   VFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY  267
             F  G+     + VG+YE+ +G FS K+TN+GATV SV+ PD  G LGDVVLG+D++ +Y
Sbjct  17   CFAPGANAAGRKMVGVYELSKGDFSAKVTNWGATVTSVVFPDSKGNLGDVVLGYDTIGEY  76

Query  268  KNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK  447
             N ++YFGA+VGRVANR+  A F L+G  Y L AND  N LHGG +GFS VIWTV++Y  
Sbjct  77   VNGSSYFGALVGRVANRVAKARFVLDGKVYHLYANDGKNALHGGHRGFSKVIWTVKEYVS  136

Query  448  ---DSHLTLSYNSYDGEQGFPGNLSVTVTY  528
                 H+TL Y+S+DGEQGFPG L V VTY
Sbjct  137  GGDSPHITLYYHSFDGEQGFPGALDVYVTY  166



>ref|XP_006653480.1| PREDICTED: aldose 1-epimerase-like [Oryza brachyantha]
Length=316

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 108/139 (78%), Gaps = 3/139 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + VG+YE+K+G FS+++TN+GAT++SV+LPD  GKLGDVVLG+D++ +Y N + YFGA+V
Sbjct  32   KTVGVYELKKGDFSIRVTNWGATIMSVVLPDSRGKLGDVVLGYDTIAEYVNGSNYFGALV  91

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLTLSY  471
            GRVANRI  A F L+G  Y L AND  NTLHGG +GFS VIWTV+++       ++TL Y
Sbjct  92   GRVANRIAKARFVLDGKTYHLYANDGNNTLHGGHRGFSKVIWTVKEHNGGGDSPYITLYY  151

Query  472  NSYDGEQGFPGNLSVTVTY  528
            +S+DGEQGFPG + V VTY
Sbjct  152  HSFDGEQGFPGAVDVYVTY  170



>ref|XP_006648778.1| PREDICTED: aldose 1-epimerase-like [Oryza brachyantha]
Length=328

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            +  L   L+ LV             + VG+YE+K+G FS+++TN+GAT++SV+LPD NG 
Sbjct  8    LTVLALCLAALVFSSRAGADAAAGRKMVGVYELKKGDFSIRVTNWGATLMSVVLPDSNGN  67

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            LGDVVLG+D+V +Y N TAYFG ++GRVANR+  A F L+G  Y+L  ND  N+LHGG +
Sbjct  68   LGDVVLGYDTVAEYVNGTAYFGGLIGRVANRVANARFTLDGKTYRLFRNDGNNSLHGGHR  127

Query  406  GFSDVIWTVEDY---KKDSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            GFS V+WTV ++        +TL Y+S+DGEQGFPG+L V VTY
Sbjct  128  GFSKVVWTVREHVGGGASPCITLFYHSFDGEQGFPGDLDVYVTY  171



>gb|KDP45488.1| hypothetical protein JCGZ_09737 [Jatropha curcas]
Length=357

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 110/155 (71%), Gaps = 3/155 (2%)
 Frame = +1

Query  103  SFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA  282
             F   + +   +E+K+G+ ++K+TN+GAT++S+I+PDK GK  DVVLG+D++ +Y+ DT 
Sbjct  12   EFASTNAKAEFFELKKGNITLKLTNWGATIVSLIIPDKTGKPVDVVLGYDTIAEYEKDTE  71

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---S  453
            YFGA VGRVANRIGGA FKLNG  YKL AN+  NT+HGG KGFS V+W     KKD    
Sbjct  72   YFGATVGRVANRIGGAQFKLNGKVYKLVANEGKNTIHGGPKGFSKVLWKAIKNKKDGPTP  131

Query  454  HLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             ++ +YNS DG+QGFPG +  TVTY  I  N+  I
Sbjct  132  SISFAYNSPDGDQGFPGAIRATVTYSIIADNQFSI  166



>ref|XP_008661291.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW58464.1| hypothetical protein ZEAMMB73_892927 [Zea mays]
Length=361

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 114/177 (64%), Gaps = 8/177 (5%)
 Frame = +1

Query  52   ALYRLLSFLVLGVFLTGSF-----CDASEQVGIYEIKRGSFSVKITNYGATVISVILPDK  216
            A  R LS  +L V L          DAS+ VG+YE+++G FSV++TN+GA V+SV+LPD+
Sbjct  2    ATRRELSLALLCVCLAACALAPGPADASKMVGVYELRKGDFSVRLTNWGARVMSVVLPDR  61

Query  217  NGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHG  396
             G L DVVLG D+V +Y NDT+YFG I GR+A R+    F L+G  Y +  ND  NT+HG
Sbjct  62   KGNLADVVLGRDTVAEYVNDTSYFGPITGRIAQRVARGRFVLDGKVYHMHRNDGRNTIHG  121

Query  397  GIKGFSDVIWTVEDY---KKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G +GFS  IWTV++Y    +  H+T  Y S+DGEQG PGN+   VTY   G   LG+
Sbjct  122  GDRGFSRSIWTVKEYVAGGESPHMTFYYRSFDGEQGLPGNVDAYVTYRVSGAYTLGV  178



>ref|XP_010937062.1| PREDICTED: aldose 1-epimerase-like [Elaeis guineensis]
Length=358

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = +1

Query  115  ASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGA  294
              + VG YE+K+G F VK+TN+GAT++SV+LPD  G L DVVLGFD +  Y N++AYFGA
Sbjct  25   PRKMVGFYELKKGDFCVKVTNWGATIVSVVLPDSKGNLADVVLGFDGLGPYINNSAYFGA  84

Query  295  IVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTL  465
            +VGRV NRI GA F LNG  Y+L AND  N+LHGG +GFS VIWTV++ K D    ++TL
Sbjct  85   LVGRVGNRISGARFVLNGKAYRLYANDGNNSLHGGHRGFSHVIWTVKE-KVDGEFPYITL  143

Query  466  SYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             Y+S+DGEQGFPG+L V VTY   G  +L +
Sbjct  144  YYHSFDGEQGFPGDLDVYVTYKISGAYELSV  174



>gb|EAZ23543.1| hypothetical protein OsJ_07241 [Oryza sativa Japonica Group]
Length=358

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 115/164 (70%), Gaps = 9/164 (5%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDAS-----EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKL  228
            +L+FL L         +A+     + VG+YE+K+G FS+++TN+GAT++SVILPD  G L
Sbjct  10   VLAFLCLVALGLSGRANANATAGRKMVGVYELKKGDFSIRVTNWGATIMSVILPDSKGNL  69

Query  229  GDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKG  408
             DVVLG+D+V +Y N TAYFG ++GRVANRI  A F L+G  Y+L  ND  N+LHGG +G
Sbjct  70   ADVVLGYDTVAEYVNGTAYFGGLIGRVANRIANARFTLDGKTYRLFRNDGNNSLHGGHRG  129

Query  409  FSDVIWTVEDYKK----DSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            FS VIWTV+  ++       +TL Y+S+DGEQGFPG+L V VTY
Sbjct  130  FSKVIWTVKGARRPGGDSPRITLYYHSFDGEQGFPGDLDVFVTY  173



>ref|NP_001130052.1| hypothetical protein precursor [Zea mays]
 gb|ACF78170.1| unknown [Zea mays]
 gb|ACF87232.1| unknown [Zea mays]
 gb|AFW58465.1| hypothetical protein ZEAMMB73_892927 [Zea mays]
Length=365

 Score =   169 bits (427),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 114/177 (64%), Gaps = 8/177 (5%)
 Frame = +1

Query  52   ALYRLLSFLVLGVFLTGSF-----CDASEQVGIYEIKRGSFSVKITNYGATVISVILPDK  216
            A  R LS  +L V L          DAS+ VG+YE+++G FSV++TN+GA V+SV+LPD+
Sbjct  2    ATRRELSLALLCVCLAACALAPGPADASKMVGVYELRKGDFSVRLTNWGARVMSVVLPDR  61

Query  217  NGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHG  396
             G L DVVLG D+V +Y NDT+YFG I GR+A R+    F L+G  Y +  ND  NT+HG
Sbjct  62   KGNLADVVLGRDTVAEYVNDTSYFGPITGRIAQRVARGRFVLDGKVYHMHRNDGRNTIHG  121

Query  397  GIKGFSDVIWTVEDY---KKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G +GFS  IWTV++Y    +  H+T  Y S+DGEQG PGN+   VTY   G   LG+
Sbjct  122  GDRGFSRSIWTVKEYVAGGESPHMTFYYRSFDGEQGLPGNVDAYVTYRVSGAYTLGV  178



>dbj|BAK00680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 106/146 (73%), Gaps = 3/146 (2%)
 Frame = +1

Query  100  GSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDT  279
            G+     + VG+YE+++G FS K+TN+GATV SV+ PD  G LGDVVLG+D++ +Y N +
Sbjct  25   GAIAAGRKTVGVYELRKGDFSAKVTNWGATVTSVVFPDSKGNLGDVVLGYDTIAEYVNGS  84

Query  280  AYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK---D  450
            +YFGA+VGRVANR+  A F L+G  Y L AND  N LHGG +GFS VIWTV++Y      
Sbjct  85   SYFGALVGRVANRVAKARFVLDGKVYHLYANDGKNALHGGHRGFSKVIWTVKEYVSGGDS  144

Query  451  SHLTLSYNSYDGEQGFPGNLSVTVTY  528
             H+TL Y+S+DGEQGFPG L V VTY
Sbjct  145  PHITLYYHSFDGEQGFPGALDVYVTY  170



>ref|NP_001047214.1| Os02g0575800 [Oryza sativa Japonica Group]
 dbj|BAD34245.1| putative non-cell-autonomous protein pathway2; plasmodesmal receptor 
[Oryza sativa Japonica Group]
 dbj|BAD33358.1| putative non-cell-autonomous protein pathway2; plasmodesmal receptor 
[Oryza sativa Japonica Group]
 dbj|BAF09128.1| Os02g0575800 [Oryza sativa Japonica Group]
 dbj|BAG98815.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 115/163 (71%), Gaps = 8/163 (5%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDAS-----EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKL  228
            +L+FL L         +A+     + VG+YE+K+G FS+++TN+GAT++SVILPD  G L
Sbjct  10   VLAFLCLVALGLSGRANANATAGRKMVGVYELKKGDFSIRVTNWGATIMSVILPDSKGNL  69

Query  229  GDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKG  408
             DVVLG+D+V +Y N TAYFG ++GRVANRI  A F L+G  Y+L  ND  N+LHGG +G
Sbjct  70   ADVVLGYDTVAEYVNGTAYFGGLIGRVANRIANARFTLDGKTYRLFRNDGNNSLHGGHRG  129

Query  409  FSDVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            FS VIWTV+++        +TL Y+S+DGEQGFPG+L V VTY
Sbjct  130  FSKVIWTVKEHVAGGDSPRITLYYHSFDGEQGFPGDLDVFVTY  172



>ref|XP_009414392.1| PREDICTED: aldose 1-epimerase-like [Musa acuminata subsp. malaccensis]
Length=361

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 103/141 (73%), Gaps = 4/141 (3%)
 Frame = +1

Query  115  ASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGA  294
             +++VGIYE++RG FSVK+TN+GAT+ SV+LPD  GK+ D+ LG+D +  Y NDT  FGA
Sbjct  26   PTKRVGIYELRRGEFSVKVTNWGATITSVVLPDSKGKVADIALGYDGIRPYTNDTTNFGA  85

Query  295  IVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTL  465
            +VGRVANRI  A F LNG  Y L  ND  NTLHGG KGF  VIWTV+D K D    ++TL
Sbjct  86   LVGRVANRIANARFTLNGRTYHLLPNDGNNTLHGGPKGFGRVIWTVKD-KVDGEYPYITL  144

Query  466  SYNSYDGEQGFPGNLSVTVTY  528
             Y S DGEQGFPG+L V VTY
Sbjct  145  YYRSVDGEQGFPGDLDVYVTY  165



>ref|NP_001169820.1| hypothetical protein precursor [Zea mays]
 gb|ACN34992.1| unknown [Zea mays]
 gb|AFW71980.1| hypothetical protein ZEAMMB73_754437 [Zea mays]
Length=381

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 120/170 (71%), Gaps = 12/170 (7%)
 Frame = +1

Query  55   LYRL--LSFLVLGV---FLTGSFCDASEQ----VGIYEIKRGSFSVKITNYGATVISVIL  207
            L+RL  L+ L L V   F  G    A+      VG++E++ G FSVK+TN+GAT++SVIL
Sbjct  10   LHRLPGLALLCLAVAVCFSGGENAAAAAWTRKIVGVHELRVGDFSVKVTNWGATLMSVIL  69

Query  208  PDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNT  387
            PD  G LGDVVLG+D+V +Y N TAYFG ++GRVANR+ GA F L+G  Y+L  ND  N+
Sbjct  70   PDSKGNLGDVVLGYDTVAEYVNGTAYFGGLIGRVANRVAGARFTLDGKAYRLYRNDGNNS  129

Query  388  LHGGIKGFSDVIWTVEDY---KKDSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            LHGG +GFS V+WTV+++       ++TL Y+S+DGEQGFPG+L V VTY
Sbjct  130  LHGGHRGFSKVVWTVKEHVGGGDSPYITLYYHSFDGEQGFPGDLDVYVTY  179



>ref|XP_004975839.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=368

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + VG+YE+++G FSVK+TN+GAT+ SV+LPD  G L DVVLG+D++ DY N + YFGA+V
Sbjct  29   KMVGVYELRKGDFSVKVTNWGATLTSVVLPDCKGNLADVVLGYDTIADYVNGSNYFGALV  88

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLSY  471
            GRVANR+  A F L+G  Y L  ND  N LHGG +GFS VIWTV+DY       ++TL Y
Sbjct  89   GRVANRVANARFVLDGKVYHLVPNDGKNALHGGKRGFSKVIWTVKDYVGGGDSPYITLYY  148

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +S+DGE+GFPG+L V VTY  +G+ +L +
Sbjct  149  HSFDGEEGFPGDLDVYVTYRLLGRYELSL  177



>ref|XP_009121606.1| PREDICTED: aldose 1-epimerase isoform X2 [Brassica rapa]
Length=497

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 107/152 (70%), Gaps = 6/152 (4%)
 Frame = +1

Query  112  DASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFG  291
            +  E +G+YE+K+ + +VK TN+GA+++S+  PDKNGK GD+VLG+DSV+ Y+ D  YFG
Sbjct  165  NEKENIGLYELKKENLTVKFTNWGASIMSLHFPDKNGKSGDIVLGYDSVESYETDKVYFG  224

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK---KDSHLT  462
            A VGRVANRIG A FKLNG EYK  AND  NTLHGG KGF DV+W V  +K   K  H+ 
Sbjct  225  ATVGRVANRIGKAHFKLNGKEYKTVANDGKNTLHGGKKGFGDVVWAVTKHKYDGKKPHIV  284

Query  463  LSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             +Y S D   GFPG L VTVTY  +  NKL +
Sbjct  285  FTYTSPD---GFPGELIVTVTYKLVKDNKLSV  313



>ref|XP_002452332.1| hypothetical protein SORBIDRAFT_04g023830 [Sorghum bicolor]
 gb|EES05308.1| hypothetical protein SORBIDRAFT_04g023830 [Sorghum bicolor]
Length=394

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + VG++E++ G FS+K+TN+GAT++SVILPD  G LGDVVLG+D+V +Y N +AYFG ++
Sbjct  48   KMVGVHELRMGDFSIKVTNWGATLMSVILPDSKGNLGDVVLGYDTVAEYVNGSAYFGGLI  107

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLSY  471
            GRVANRI GA F L+G  Y+L  ND  N+LHGG +GFS VIWTV+++       ++TL Y
Sbjct  108  GRVANRIAGARFVLDGKAYRLYRNDGNNSLHGGHRGFSKVIWTVKEHVGGGDSPYITLYY  167

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +S+DGEQGFPG+L V VTY       L +
Sbjct  168  HSFDGEQGFPGDLDVYVTYRLSSPYALSV  196



>ref|XP_009401394.1| PREDICTED: aldose 1-epimerase-like [Musa acuminata subsp. malaccensis]
Length=360

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 117/176 (66%), Gaps = 6/176 (3%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDAS--EQVGIYEIKRGSFSVKITNYGATVISVILPDKN  219
            MA    L   L +   L  + C A+  ++V  YE+K+G FSVK+TN+GA + SV+LPD  
Sbjct  1    MAKPPFLPFLLFVASALLSTSCSAAPRKKVAFYELKKGDFSVKVTNWGAIITSVVLPDSK  60

Query  220  GKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGG  399
            G LGDVVLG+D +  Y N++A FGA+VGRVANRI GA F LNG  Y+L  N   NTLHGG
Sbjct  61   GNLGDVVLGYDGLGPYINNSANFGAVVGRVANRISGARFVLNGKVYRLSKNSGNNTLHGG  120

Query  400  IKGFSDVIWTVEDYKKD---SHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             +GFS VIWTV++ K D    ++TL Y+S+DGEQGFPG L V VTY      +L I
Sbjct  121  HRGFSHVIWTVKE-KVDGEFPYITLYYHSFDGEQGFPGALDVFVTYKISAPYELSI  175



>gb|EAY86398.1| hypothetical protein OsI_07776 [Oryza sativa Indica Group]
Length=378

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 114/163 (70%), Gaps = 8/163 (5%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDAS-----EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKL  228
            +L+FL L         +A+     + VG+YE+K+G FS+++TN+GA ++SVILPD  G L
Sbjct  10   VLAFLCLVALGLSGRANANATAGRKMVGVYELKKGDFSIRVTNWGAILMSVILPDSKGNL  69

Query  229  GDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKG  408
             DVVLG+D+V +Y N TAYFG ++GRVANRI  A F L+G  Y+L  ND  N+LHGG +G
Sbjct  70   ADVVLGYDTVAEYVNGTAYFGGLIGRVANRIANARFTLDGKTYQLFRNDGNNSLHGGHRG  129

Query  409  FSDVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            FS VIWTV+++        +TL Y+S+DGEQGFPG+L V VTY
Sbjct  130  FSKVIWTVKEHVAGGDSPRITLYYHSFDGEQGFPGDLDVYVTY  172



>gb|EMT25695.1| Aldose 1-epimerase [Aegilops tauschii]
Length=265

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 105/153 (69%), Gaps = 3/153 (2%)
 Frame = +1

Query  109  CDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYF  288
             DA + VG+YE+KRG FSVK+TN+GAT++S+++PD  G L DVVLG D++ +Y NDT+YF
Sbjct  22   ADARKMVGVYELKRGDFSVKMTNWGATIMSILVPDSKGNLADVVLGMDTLAEYVNDTSYF  81

Query  289  GAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK---DSHL  459
            G + GRVA R+    F L+G  Y    ND  N +HGG +GFS VIWTV++Y       ++
Sbjct  82   GPLNGRVAQRMARGRFVLDGKVYHTYINDGKNAIHGGKRGFSKVIWTVKEYVAGGDSPYI  141

Query  460  TLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            T+ Y S+DGEQGFPG+L V  TY   G  +L I
Sbjct  142  TMYYRSFDGEQGFPGDLDVYATYQLTGPYELSI  174



>gb|KGN46963.1| hypothetical protein Csa_6G153465 [Cucumis sativus]
Length=358

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 118/177 (67%), Gaps = 10/177 (6%)
 Frame = +1

Query  43   LMAALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            + + L++++  + +G  + G  C+  + +G+YE+K+G+FSVK TNYGA++IS+++PDK G
Sbjct  3    MFSTLFQVILIISIGR-VNGCICN--QNIGVYELKKGNFSVKFTNYGASIISIVVPDKYG  59

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
             L D+VLGFD+  DY      FGAIVGRVANRI  A F LNG  Y+L  ND  NT+HGG 
Sbjct  60   NLDDIVLGFDTTQDYVRRRGNFGAIVGRVANRISNAQFILNGTLYRLEPNDGNNTIHGGS  119

Query  403  KGFSDVIWTV-----EDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +GFS VIW V     +D     H T  Y S++GE+GFPG+L  TV+Y  + + +L +
Sbjct  120  RGFSHVIWEVNTKSTQDPNPQIHFT--YRSFNGEEGFPGDLIATVSYYLLSETQLAV  174



>ref|XP_006827141.1| PREDICTED: aldose 1-epimerase [Amborella trichopoda]
 gb|ERM94378.1| hypothetical protein AMTR_s00010p00250550 [Amborella trichopoda]
Length=368

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVA  312
            IYE+K+G   V++TN+GA ++SV++PD  GKL DVVLGF+ +  Y NDT YFGAIVGRVA
Sbjct  39   IYELKKGDMQVRVTNWGAIILSVVIPDSKGKLDDVVLGFEKLGSYINDTTYFGAIVGRVA  98

Query  313  NRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNSYD  483
            NRI    F LNG  Y+L  ND  NTLHGG +GFS V WT+++ K+D    ++TL+Y+S+D
Sbjct  99   NRIKDGRFVLNGQAYRLFRNDGNNTLHGGHRGFSKVFWTMKE-KQDGEFPYITLTYHSFD  157

Query  484  GEQGFPGNLSVTVTYLFIGKNKLGI  558
            GEQGFPG+L V+VTY  +G  ++ +
Sbjct  158  GEQGFPGDLDVSVTYKLVGDLQISV  182



>ref|XP_004952870.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=378

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 115/162 (71%), Gaps = 6/162 (4%)
 Frame = +1

Query  91   FLTGSFCDASEQ--VGIYEIKRGS-FSVKITNYGATVISVILPDKNGKLGDVVLGFDSVD  261
            F  G    A+E+  VG++E+KRG  FS+K+TN+GAT++SVILPD  G L DVVLG+D+V 
Sbjct  25   FCGGGNAAAAERKTVGVHELKRGDDFSIKVTNWGATLMSVILPDSKGNLDDVVLGYDTVA  84

Query  262  DYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY  441
            +Y N TAYFG ++GRVANR+ GA F L+G  Y+L  ND  N+LHGG +GFS VIWTV ++
Sbjct  85   EYVNGTAYFGGLIGRVANRVAGARFTLDGKAYRLYPNDGNNSLHGGHRGFSKVIWTVMEH  144

Query  442  ---KKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
                   +++L Y+S+DGEQGFPG+L V VTY     + L +
Sbjct  145  VGGGDSPYISLYYHSFDGEQGFPGDLDVYVTYRLSPPHVLSV  186



>gb|EEC77395.1| hypothetical protein OsI_16152 [Oryza sativa Indica Group]
Length=382

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 108/150 (72%), Gaps = 3/150 (2%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAI  297
            +  VG+YE+++G FS+++TN+GA ++SV+LPD  GKL DVVLG+D++ +Y N + YFGA+
Sbjct  32   ATTVGVYELRKGDFSIRVTNWGAVIMSVVLPDSRGKLDDVVLGYDTIAEYVNSSTYFGAL  91

Query  298  VGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLS  468
            VGRVANRI  A F L+G  Y L  ND  NTLHGG +GFS+V WTV+++       ++TL 
Sbjct  92   VGRVANRIAKARFVLDGKAYHLYPNDGKNTLHGGHRGFSNVTWTVKEHVGGGDAPYITLY  151

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y+S+DGEQGFPG L V VTY   G   L +
Sbjct  152  YHSFDGEQGFPGALDVYVTYQLSGPYVLSV  181



>gb|EEE61117.1| hypothetical protein OsJ_15041 [Oryza sativa Japonica Group]
Length=380

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 108/150 (72%), Gaps = 3/150 (2%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAI  297
            +  VG+YE+++G FS+++TN+GA ++SV+LPD  GKL DVVLG+D++ +Y N + YFGA+
Sbjct  32   ATTVGVYELRKGDFSIRVTNWGAVIMSVVLPDSRGKLDDVVLGYDTIAEYVNSSTYFGAL  91

Query  298  VGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLS  468
            VGRVANRI  A F L+G  Y L  ND  NTLHGG +GFS+V WTV+++       ++TL 
Sbjct  92   VGRVANRIAKARFVLDGKAYHLYPNDGKNTLHGGHRGFSNVTWTVKEHVGGGDAPYITLY  151

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y+S+DGEQGFPG L V VTY   G   L +
Sbjct  152  YHSFDGEQGFPGALDVYVTYQLSGPYVLSV  181



>ref|NP_001052977.1| Os04g0458300 [Oryza sativa Japonica Group]
 dbj|BAF14891.1| Os04g0458300 [Oryza sativa Japonica Group]
Length=380

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 108/150 (72%), Gaps = 3/150 (2%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAI  297
            +  VG+YE+++G FS+++TN+GA ++SV+LPD  GKL DVVLG+D++ +Y N + YFGA+
Sbjct  32   ATTVGVYELRKGDFSIRVTNWGAVIMSVVLPDSRGKLDDVVLGYDTIAEYVNSSTYFGAL  91

Query  298  VGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLS  468
            VGRVANRI  A F L+G  Y L  ND  NTLHGG +GFS+V WTV+++       ++TL 
Sbjct  92   VGRVANRIAKARFVLDGKAYHLYPNDGKNTLHGGHRGFSNVTWTVKEHVGGGDAPYITLY  151

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y+S+DGEQGFPG L V VTY   G   L +
Sbjct  152  YHSFDGEQGFPGALDVYVTYQLSGPYVLSV  181



>gb|ACF81147.1| unknown [Zea mays]
Length=331

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = +1

Query  124  QVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVG  303
             VG+YE+++G FSV++TN+GA V+SV+LPD+ G L DVVLG D+V +Y NDT+YFG I G
Sbjct  1    MVGVYELRKGDFSVRLTNWGARVMSVVLPDRKGNLADVVLGRDTVAEYVNDTSYFGPITG  60

Query  304  RVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLSYN  474
            R+A R+    F L+G  Y +  ND  NT+HGG +GFS  IWTV++Y    +  H+T  Y 
Sbjct  61   RIAQRVARGRFVLDGKVYHMHRNDGRNTIHGGDRGFSRSIWTVKEYVAGGESPHMTFYYR  120

Query  475  SYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            S+DGEQG PGN+   VTY   G   LG+
Sbjct  121  SFDGEQGLPGNVDAYVTYRVSGAYTLGV  148



>ref|XP_003579893.1| PREDICTED: aldose 1-epimerase-like [Brachypodium distachyon]
Length=362

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 108/158 (68%), Gaps = 4/158 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVL  243
            LLS +V+   L  +  DA + VG+Y +K+G FSVKITN+GAT++S++ PD  G LGDVVL
Sbjct  10   LLSLVVVASALATT-ADARKMVGVYVLKKGDFSVKITNWGATIMSIVFPDSKGNLGDVVL  68

Query  244  GFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVI  423
            G D++ +Y NDT+YFG + GRVA R+    F L+G  Y    ND  N +HGG +GFS VI
Sbjct  69   GKDTLAEYVNDTSYFGPLTGRVAQRMARGRFVLDGKVYHTYINDGRNAIHGGHRGFSKVI  128

Query  424  WTVEDY---KKDSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            WTV++Y       H+TL Y S+DGEQGFPG+L V  TY
Sbjct  129  WTVKEYVGGGDSPHITLYYRSFDGEQGFPGDLDVYATY  166



>ref|XP_012086275.1| PREDICTED: aldose 1-epimerase-like [Jatropha curcas]
 gb|KDP25982.1| hypothetical protein JCGZ_22712 [Jatropha curcas]
Length=339

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 103/154 (67%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTA  282
              D +++  I+E+  G+  VKITN G T+ S+ +PDKNG L DVVLGFDSV+ Y K    
Sbjct  1    MADHTQKPEIFELNNGTMVVKITNLGCTITSLSVPDKNGNLADVVLGFDSVEPYLKGVAP  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSH  456
            YFGAIVGRVANRI    F LNGVEY LP N   N+LHGG+KGF  +IW V ++KK  +  
Sbjct  61   YFGAIVGRVANRIKDGKFSLNGVEYTLPINRPPNSLHGGLKGFDKMIWEVTEHKKGENPS  120

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y S+DGE+G+PG+LSVT TY       + +
Sbjct  121  ITFKYESHDGEEGYPGDLSVTATYALTSSTTMRL  154



>ref|XP_011039151.1| PREDICTED: aldose 1-epimerase-like [Populus euphratica]
Length=337

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 99/143 (69%), Gaps = 3/143 (2%)
 Frame = +1

Query  115  ASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFG  291
            A ++  I+E+  G+  VKITN G T+ S+ LPDKNG L DVVLGFDSV+ Y N  A YFG
Sbjct  2    ADQKPQIFELNNGTMQVKITNLGCTITSLSLPDKNGNLADVVLGFDSVEPYLNRVAPYFG  61

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSHLTL  465
            AIVGRVANRI    F LNGV+Y LP N   N+LHGG KGF  V+W V +YKK     +T 
Sbjct  62   AIVGRVANRIKDGKFTLNGVDYTLPVNRPPNSLHGGHKGFDIVVWEVAEYKKGEKPSITF  121

Query  466  SYNSYDGEQGFPGNLSVTVTYLF  534
             Y+S DGE+G+PG+LSVT TY  
Sbjct  122  KYHSRDGEEGYPGDLSVTATYTL  144



>ref|XP_004975843.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=362

 Score =   160 bits (404),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 101/149 (68%), Gaps = 3/149 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + VG+YE+++G FSVK+TN+GAT++SVILPD  G L DVVLG D+V  Y NDT++FG + 
Sbjct  27   KMVGVYELRKGDFSVKVTNWGATIMSVILPDSKGNLADVVLGRDTVAQYVNDTSFFGPVA  86

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLSY  471
            GRVA RI    F L+G  Y L  ND  NTL GG +GF  VIWTV +Y       ++TL Y
Sbjct  87   GRVAQRIAQGRFVLDGKVYHLNINDGRNTLQGGGRGFHKVIWTVREYVCAGDSPYITLYY  146

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             S+DGEQGFPGNL V VTY       LG+
Sbjct  147  RSFDGEQGFPGNLDVHVTYRVSSPYTLGV  175



>gb|EMS49869.1| Aldose 1-epimerase [Triticum urartu]
Length=232

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 105/154 (68%), Gaps = 4/154 (3%)
 Frame = +1

Query  109  CDASEQ-VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAY  285
             DA  + VG+YE+KRG FSVK+TN+GAT++SV++PD  G L DVVLG D++ +Y NDT+Y
Sbjct  22   ADARRKMVGVYELKRGDFSVKMTNWGATIMSVLVPDSKGNLADVVLGMDTLAEYVNDTSY  81

Query  286  FGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSH  456
            FG + GRVA R+    F L+G  Y    ND  N +HGG +GFS VIWTV++Y       +
Sbjct  82   FGPLNGRVAQRMARGRFVLDGKVYHTYINDGKNAIHGGKRGFSKVIWTVKEYVAGGDSPY  141

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T+ Y S+DGEQGFPG+L V  TY   G  +L I
Sbjct  142  ITMYYRSFDGEQGFPGDLDVYATYQLTGPYELSI  175



>gb|EMT00805.1| Aldose 1-epimerase [Aegilops tauschii]
Length=369

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 110/164 (67%), Gaps = 6/164 (4%)
 Frame = +1

Query  55   LYRLLSFLVLGVFLTGSF-C--DASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGK  225
            + R L FL L   +T +  C  +A + VG+Y +K+G FSVK+TN+GAT++S+ILPD  G 
Sbjct  1    MARALVFLALLCLVTSALVCVGEARKMVGVYMLKKGDFSVKVTNWGATIMSIILPDSKGN  60

Query  226  LGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIK  405
            L DVVLG D++ +Y NDTAYFG + GRVA R+    F L+G  Y    ND  N +HGG +
Sbjct  61   LADVVLGKDTLAEYVNDTAYFGPLSGRVAQRMARGRFVLDGKVYHTYINDGRNAIHGGHR  120

Query  406  GFSDVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            GFS VIWTV++Y       ++TL Y S+DGEQGFPG+L V  TY
Sbjct  121  GFSKVIWTVKEYVAGGDSPYITLYYRSFDGEQGFPGDLDVYATY  164



>gb|EMS49614.1| Aldose 1-epimerase [Triticum urartu]
Length=330

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 111/165 (67%), Gaps = 8/165 (5%)
 Frame = +1

Query  55   LYRLLSFLVLGVFLTGS----FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNG  222
            + R+L FL L ++L  S      +A + VGIY +K+G FSVK+TN+GAT++S+I+PD  G
Sbjct  1    MARVLPFLAL-LYLVASTLVYVSEARKMVGIYMLKKGDFSVKVTNWGATIMSIIVPDNKG  59

Query  223  KLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGI  402
             L DVVLG D++ +Y NDTAYFG + GRVA R+    F L+G  Y    ND  N +HGG 
Sbjct  60   NLADVVLGKDTLAEYVNDTAYFGPLSGRVAQRMARGRFVLDGKVYHTYINDGRNAIHGGH  119

Query  403  KGFSDVIWTVEDYKK---DSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            +GFS VIWTV++Y       ++TL Y S+DGEQGFPG+L V  TY
Sbjct  120  RGFSKVIWTVKEYVAGGDSPYITLYYRSFDGEQGFPGDLDVYATY  164



>gb|EYU24186.1| hypothetical protein MIMGU_mgv1a009569mg [Erythranthe guttata]
Length=338

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 100/145 (69%), Gaps = 3/145 (2%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFGAIVGRV  309
            I+E+  GS  VK++NYG T+ S+ +PDK+GKLGDVVLGFD+++ Y+   A YFG IVGRV
Sbjct  7    IFELNNGSMQVKVSNYGCTITSLFVPDKDGKLGDVVLGFDTIEPYQRGAAPYFGCIVGRV  66

Query  310  ANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSHLTLSYNSYD  483
            ANRI    F LNG EY LP N   N+LHGG KGF  VIW V +YK+     +T  Y+S+D
Sbjct  67   ANRIKEGKFTLNGTEYSLPINKPPNSLHGGQKGFDKVIWEVAEYKQGDTPSITFKYHSHD  126

Query  484  GEQGFPGNLSVTVTYLFIGKNKLGI  558
            GE+G+PG++S T TY    K  + +
Sbjct  127  GEEGYPGDVSFTATYTLTSKTTMRL  151



>ref|XP_002317867.1| aldose 1-epimerase family protein [Populus trichocarpa]
 gb|EEE96087.1| aldose 1-epimerase family protein [Populus trichocarpa]
Length=337

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 98/143 (69%), Gaps = 3/143 (2%)
 Frame = +1

Query  115  ASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFG  291
            A ++  I+E+  G+  VKITN G T+ S+ LPDKNG L DVVLGFDSV+ Y N  A YFG
Sbjct  2    ADQKPQIFELNNGTMQVKITNLGCTITSLSLPDKNGNLADVVLGFDSVEPYLNRVAPYFG  61

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSHLTL  465
            AIVGRVANRI    F LNG +Y LP N   N+LHGG KGF  V+W V +YKK     +T 
Sbjct  62   AIVGRVANRIKDGKFTLNGADYTLPVNRPPNSLHGGNKGFDIVVWEVAEYKKGEKPSITF  121

Query  466  SYNSYDGEQGFPGNLSVTVTYLF  534
             Y+S DGE+G+PG+LSVT TY  
Sbjct  122  KYHSRDGEEGYPGDLSVTATYTL  144



>ref|XP_002446606.1| hypothetical protein SORBIDRAFT_06g018800 [Sorghum bicolor]
 gb|EES10934.1| hypothetical protein SORBIDRAFT_06g018800 [Sorghum bicolor]
Length=373

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 3/149 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + VG+YE+K G FSV +TN+GAT+ SV+LPD  G L DVVLG+D++  Y +  +YFGA+V
Sbjct  33   KMVGVYELKAGDFSVSVTNWGATITSVVLPDSKGNLADVVLGYDTIGGYVSGKSYFGALV  92

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK---DSHLTLSY  471
            GRVANRI  A F L+G  Y L  ND  NTLHGG +GFS VIWTV+++       ++TL Y
Sbjct  93   GRVANRIAYARFVLDGKAYHLFKNDGNNTLHGGHRGFSQVIWTVKEFVAGGDSPYITLYY  152

Query  472  NSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +S+DGEQGFPG+L V VTY      +L +
Sbjct  153  HSFDGEQGFPGDLDVYVTYELASPYELRV  181



>tpg|DAA45585.1| TPA: aldose 1-epimerase [Zea mays]
Length=367

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 98/138 (71%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + +G YE++RG FS+ +TN+GAT++SV LPDKNG + DVVLG+ ++  Y NDT YFGA+V
Sbjct  34   QSLGFYELRRGEFSMVVTNWGATILSVRLPDKNGHIDDVVLGYKNIGSYVNDTTYFGALV  93

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY--KKDSHLTLSYN  474
            GRVANRI G  F +    Y    ND  NTLHGG +GF+ V W+V +    +  H+T +Y 
Sbjct  94   GRVANRIAGGRFTIRDHAYHTYRNDGNNTLHGGHRGFNQVFWSVRERVTGEFPHITFAYR  153

Query  475  SYDGEQGFPGNLSVTVTY  528
            SYDGEQGFPGNL V VTY
Sbjct  154  SYDGEQGFPGNLDVLVTY  171



>ref|XP_010679093.1| PREDICTED: aldose 1-epimerase [Beta vulgaris subsp. vulgaris]
Length=339

 Score =   157 bits (397),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 103/154 (67%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTA  282
              D  ++  I+E+  GS +VKITNYG T+ S+ LPDK+GKL DVVLGFD+VD Y +   +
Sbjct  1    MADQGKKAEIFELDNGSINVKITNYGCTITSLSLPDKDGKLADVVLGFDTVDPYLQGAGS  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD--SH  456
            Y+G IVGRVANRI    F LNGV+Y LP N   N+LHGG KGF   IW V +Y+K     
Sbjct  61   YYGCIVGRVANRIKDGKFTLNGVQYTLPLNKPPNSLHGGNKGFDKQIWDVAEYRKSDTPS  120

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y+S+DGE+G+PG+L VT TY    K  + +
Sbjct  121  ITFKYHSHDGEEGYPGDLFVTATYTLTSKTTMRL  154



>ref|NP_001149545.1| aldose 1-epimerase precursor [Zea mays]
 gb|ACG35785.1| aldose 1-epimerase [Zea mays]
Length=367

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 98/138 (71%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + +G YE++RG FS+ +TN+GAT++SV LPDKNG + DVVLG+ ++  Y NDT YFGA+V
Sbjct  34   QSLGFYELRRGEFSMVVTNWGATILSVRLPDKNGHIDDVVLGYKNIGSYVNDTTYFGALV  93

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY--KKDSHLTLSYN  474
            GRVANRI G  F +    Y    ND  NTLHGG +GF+ V W+V +    +  H+T +Y 
Sbjct  94   GRVANRIAGGRFTIRDHAYHTYRNDGNNTLHGGHRGFNQVFWSVRERVTGEFPHITFAYR  153

Query  475  SYDGEQGFPGNLSVTVTY  528
            SYDGEQGFPGNL V VTY
Sbjct  154  SYDGEQGFPGNLDVLVTY  171



>ref|XP_007036806.1| Galactose mutarotase-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY21307.1| Galactose mutarotase-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=336

 Score =   157 bits (396),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 101/148 (68%), Gaps = 3/148 (2%)
 Frame = +1

Query  124  QVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFGAIV  300
            Q  I+E+  G+  VKITNYG T+ S+ +PDKNG+L DVVLGFDS++ Y +  + +FG IV
Sbjct  4    QPEIFELNNGTMQVKITNYGCTITSLSVPDKNGQLADVVLGFDSLEPYVQGASPFFGCIV  63

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSHLTLSYN  474
            GRVANRI    F LNGVEY LP N+  N+LHGG KGF   IW V +YKK  +  +T  Y+
Sbjct  64   GRVANRIKEGKFTLNGVEYSLPINNPPNSLHGGFKGFDKKIWEVVEYKKGENPSITFKYH  123

Query  475  SYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            S DGE+G+PG++SVT TY       + +
Sbjct  124  SADGEEGYPGDVSVTATYTLTSSTTMKL  151



>emb|CAH67072.1| OSIGBa0097P08.2 [Oryza sativa Indica Group]
Length=380

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAI  297
            +  VG+YE+++G FS+++TN GA ++SV+LPD  GK  DVVLG+D++ +Y N + YFGA+
Sbjct  32   ATTVGVYELRKGDFSIRVTNGGAVIMSVVLPDSRGKWDDVVLGYDTIAEYVNSSTYFGAL  91

Query  298  VGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLS  468
            VGRVANRI  A F L+G  Y L  ND  NTLHGG +GFS+V WTV+++       ++TL 
Sbjct  92   VGRVANRIAKARFVLDGKAYHLYPNDGKNTLHGGHRGFSNVTWTVKEHVGGGDAPYITLY  151

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y+S+DGEQGFPG L V VTY   G   L +
Sbjct  152  YHSFDGEQGFPGALDVYVTYQLSGPYVLSV  181



>ref|XP_002455882.1| hypothetical protein SORBIDRAFT_03g026790 [Sorghum bicolor]
 gb|EES01002.1| hypothetical protein SORBIDRAFT_03g026790 [Sorghum bicolor]
Length=368

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 105/143 (73%), Gaps = 5/143 (3%)
 Frame = +1

Query  115  ASEQVGIYEIK--RGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYF  288
            A + VG+YE+K  +  FS+K+TN+GAT++SVI+PD  G L DVVLG+D+V +Y N ++YF
Sbjct  25   ARKTVGVYELKNKKWDFSIKVTNWGATLMSVIVPDSKGNLADVVLGYDTVAEYVNGSSYF  84

Query  289  GAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHL  459
            GA+VGRVANR+    F L+G  Y L  ND  N LHGG +GFS VIWTV++Y  D    ++
Sbjct  85   GALVGRVANRVAKGRFVLDGKAYHLYINDGKNALHGGHRGFSKVIWTVKEYVPDCDSPYI  144

Query  460  TLSYNSYDGEQGFPGNLSVTVTY  528
            T  Y+S+DGEQGFPG+L V VTY
Sbjct  145  TFYYHSFDGEQGFPGDLDVYVTY  167



>ref|XP_002530475.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF31898.1| aldose-1-epimerase, putative [Ricinus communis]
Length=340

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 98/135 (73%), Gaps = 3/135 (2%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFGAIVGRV  309
            ++E+  G+  VKITN G T+ S+ LPDKNG L DVVLGFDS++ Y K    YFG+IVGRV
Sbjct  11   LFELNNGTMLVKITNLGCTITSLTLPDKNGNLADVVLGFDSLEPYLKGVAPYFGSIVGRV  70

Query  310  ANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSHLTLSYNSYD  483
            ANRI    F L+GV+Y LP N   N+LHGG+KGF  +IW V DYKK  +  +T  Y+S+D
Sbjct  71   ANRIKDGKFTLDGVDYTLPLNRPPNSLHGGLKGFDKMIWEVADYKKGENPSITFKYHSHD  130

Query  484  GEQGFPGNLSVTVTY  528
            GE+G+PG+LSVT TY
Sbjct  131  GEEGYPGDLSVTATY  145



>ref|NP_001169236.1| hypothetical protein precursor [Zea mays]
 gb|ACN32047.1| unknown [Zea mays]
 tpg|DAA37474.1| TPA: hypothetical protein ZEAMMB73_929316 [Zea mays]
Length=361

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  52   ALYRLLSFLVLGVFL-----TGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDK  216
            A   LL+ L L   L      G   DA  +VG+YE+K G FSVK+TN+GA ++SV+LPD 
Sbjct  2    ARVELLALLCLAGTLGAQATAGPRPDA--RVGVYELKLGDFSVKVTNWGARLMSVVLPDC  59

Query  217  NGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHG  396
             G L D+VLG D+V +Y NDT+YFG I GRVA RI    F L+G  Y L  ND  NT+HG
Sbjct  60   KGNLADIVLGRDTVAEYFNDTSYFGPITGRVAQRISRGRFVLDGKVYHLQRNDGRNTIHG  119

Query  397  GIKGFSDVIWTVEDY---KKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            G   FS  +WTV++Y       ++TL Y+S+DGEQGFPGNL   VTY   G   LG+
Sbjct  120  GGTAFSKSVWTVKEYVGGGDSPYVTLYYHSFDGEQGFPGNLDAYVTYRVSGPYTLGV  176



>gb|KJB30177.1| hypothetical protein B456_005G132500 [Gossypium raimondii]
Length=336

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 96/142 (68%), Gaps = 3/142 (2%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFGA  294
            ++Q  IYE+  G+  VKITNYG T+ S+ +PDKNGKL DVVLGFD+V+ Y K  + YFG 
Sbjct  2    ADQPQIYELNNGTVVVKITNYGCTITSLSVPDKNGKLADVVLGFDTVEPYVKGTSPYFGC  61

Query  295  IVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSHLTLS  468
            IVGRVANRI    F LNG  Y LP N   N+LHGG KGF   IW V +YKK     +T  
Sbjct  62   IVGRVANRIKNGKFTLNGTGYSLPINKPPNSLHGGFKGFDKRIWEVAEYKKGDKPSITFK  121

Query  469  YNSYDGEQGFPGNLSVTVTYLF  534
            Y S DGE+G+PG++SVT TY  
Sbjct  122  YRSSDGEEGYPGDVSVTATYTL  143



>ref|XP_006651441.1| PREDICTED: aldose 1-epimerase-like [Oryza brachyantha]
Length=340

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 99/141 (70%), Gaps = 2/141 (1%)
 Frame = +1

Query  112  DASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFG  291
            +  + +G YE++RG FS+ +TN+GAT++SV LPDKNG++ DVVLG+ ++  Y NDT YFG
Sbjct  34   EGKQDIGYYELRRGEFSIVVTNWGATILSVNLPDKNGRIDDVVLGYKNIGSYVNDTTYFG  93

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY--KKDSHLTL  465
            A+VGRVANRI G  F + G  Y    ND  NTLHGG +GF+ V W+V +    +  ++T 
Sbjct  94   ALVGRVANRIAGGRFTVKGQAYHTYKNDGNNTLHGGHRGFNQVFWSVRERVTGQFPYVTF  153

Query  466  SYNSYDGEQGFPGNLSVTVTY  528
             Y SYDGEQGFPG L V VTY
Sbjct  154  YYRSYDGEQGFPGALDVLVTY  174



>ref|XP_010099722.1| Aldose 1-epimerase [Morus notabilis]
 gb|EXB80299.1| Aldose 1-epimerase [Morus notabilis]
Length=337

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-  282
              + +++  I+E+  G+    ITNYG T+ S+ +PDK+GKL DVVLGFD+++ Y N +A 
Sbjct  1    MANPNQKAEIFELSNGTMRALITNYGCTITSLSIPDKDGKLADVVLGFDTLEPYLNGSAP  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSHLT  462
            YFG IVGRVANRI    F LNGVEY LP N   N+LHGG KGF   IW V +YK+D  +T
Sbjct  61   YFGCIVGRVANRIKDGKFTLNGVEYFLPLNKPPNSLHGGNKGFDKQIWDVVEYKQDEKIT  120

Query  463  LSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
              Y+S+D E+G+PG++++T TY       + +
Sbjct  121  FKYHSHDSEEGYPGDVTITATYTLTSSTTMRL  152



>ref|XP_002465201.1| hypothetical protein SORBIDRAFT_01g033970 [Sorghum bicolor]
 gb|EER92199.1| hypothetical protein SORBIDRAFT_01g033970 [Sorghum bicolor]
Length=371

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 97/138 (70%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + +G YE++RG FS+ +TN+GAT+++V LPDKNG + DVVLG+  +  Y NDT YFGA+V
Sbjct  36   QSLGFYELRRGEFSMIVTNWGATILAVRLPDKNGHIDDVVLGYKDIGSYVNDTTYFGALV  95

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY--KKDSHLTLSYN  474
            GRVANRI G  F +    Y    ND  NTLHGG +GF+ V W+V +    +  H+T +Y 
Sbjct  96   GRVANRIAGGRFTIKDRPYHTYQNDGNNTLHGGHRGFNQVFWSVRERVTGEFPHITFAYR  155

Query  475  SYDGEQGFPGNLSVTVTY  528
            SYDGEQGFPGNL V VTY
Sbjct  156  SYDGEQGFPGNLDVLVTY  173



>gb|ACG28451.1| aldose 1-epimerase precursor [Zea mays]
Length=364

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 101/139 (73%), Gaps = 3/139 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + VG+YE+K G FSV +TN+GAT+ SV+LPD  G   DVVLG+D++  Y +  +YFGA+V
Sbjct  28   KMVGVYELKAGDFSVGVTNWGATITSVVLPDSKGDFADVVLGYDTIGGYVSGKSYFGALV  87

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLSY  471
            GRVANRI  A F L+G  Y L  ND  NTLHGG +GFS V+WTV+++       ++TL Y
Sbjct  88   GRVANRIANARFVLDGKAYHLFKNDGNNTLHGGHRGFSQVVWTVKEFVGGGDSPYITLYY  147

Query  472  NSYDGEQGFPGNLSVTVTY  528
            +S+DGEQGFPG+L V VTY
Sbjct  148  HSFDGEQGFPGDLDVYVTY  166



>ref|NP_001137118.1| aldose 1-epimerase precursor [Zea mays]
 gb|ACF83300.1| unknown [Zea mays]
 tpg|DAA37476.1| TPA: aldose 1-epimerase [Zea mays]
Length=363

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 101/139 (73%), Gaps = 3/139 (2%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + VG+YE+K G FSV +TN+GAT+ SV+LPD  G   DVVLG+D++  Y +  +YFGA+V
Sbjct  27   KMVGVYELKAGDFSVGVTNWGATITSVVLPDSKGDFADVVLGYDTIGGYVSGKSYFGALV  86

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLSY  471
            GRVANRI  A F L+G  Y L  ND  NTLHGG +GFS V+WTV+++       ++TL Y
Sbjct  87   GRVANRIANARFVLDGKAYHLFKNDGNNTLHGGHRGFSQVVWTVKEFVGGGDSPYITLYY  146

Query  472  NSYDGEQGFPGNLSVTVTY  528
            +S+DGEQGFPG+L V VTY
Sbjct  147  HSFDGEQGFPGDLDVYVTY  165



>gb|KHG22159.1| Aldose 1-epimerase [Gossypium arboreum]
Length=336

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 95/142 (67%), Gaps = 3/142 (2%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFGA  294
            ++Q  IYE+  G+  V ITNYG T+ S+ +PDKNGKL DVVLGFD+V+ Y K  + YFG 
Sbjct  2    ADQPQIYELNNGTVVVTITNYGCTITSLSVPDKNGKLADVVLGFDTVEPYVKGASPYFGC  61

Query  295  IVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSHLTLS  468
            IVGRVANRI    F LNG EY LP N   N+LHGG KGF   IW V +YKK     +T  
Sbjct  62   IVGRVANRIKNGKFTLNGTEYTLPINKPPNSLHGGFKGFDKRIWEVAEYKKGDKPSITFK  121

Query  469  YNSYDGEQGFPGNLSVTVTYLF  534
            Y S DGE+G+P ++SVT TY  
Sbjct  122  YRSSDGEEGYPSDVSVTATYTL  143



>ref|XP_002282634.1| PREDICTED: aldose 1-epimerase [Vitis vinifera]
Length=338

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 103/152 (68%), Gaps = 4/152 (3%)
 Frame = +1

Query  115  ASEQ-VGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYF  288
            ASE+   I+E+  G+  VKITNYGAT+ S+ +PDK+G L DVVLG DS++ Y K D  YF
Sbjct  2    ASERKPEIFELNNGTMQVKITNYGATITSLSVPDKDGNLADVVLGCDSLEPYLKGDVPYF  61

Query  289  GAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK--KDSHLT  462
            G IVGRVANRI    F LNG+EY+LP N   N+LHGG KGFS  +W V + K  K   +T
Sbjct  62   GCIVGRVANRIKDGKFTLNGIEYQLPINKPPNSLHGGHKGFSKKVWEVAERKEGKTPSIT  121

Query  463  LSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
              Y+S+DGE+G+PG++SVT TY       + +
Sbjct  122  FKYHSHDGEEGYPGDVSVTATYTLTSSTTMRL  153



>ref|XP_004975836.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=361

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 105/151 (70%), Gaps = 5/151 (3%)
 Frame = +1

Query  121  EQVGIYEIK--RGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGA  294
            + VG+YE+K  +G FS+K+TN+GAT++SVI PD  G L DVVLG+D+V  + N ++YFGA
Sbjct  27   KTVGVYELKNKKGDFSIKVTNWGATLMSVIAPDSKGNLADVVLGYDTVAGFVNGSSYFGA  86

Query  295  IVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTL  465
            +VGRVANR+    F L+G  Y L  ND  N LHGG +GFS VIWTV++Y  D    ++T 
Sbjct  87   LVGRVANRVAKGRFVLDGKAYHLYINDGKNALHGGHRGFSKVIWTVKEYVPDCDSPYITF  146

Query  466  SYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             Y S+DGEQGFPG+L V VTY   G   L +
Sbjct  147  YYRSFDGEQGFPGDLDVYVTYQLSGPYDLSL  177



>ref|XP_003559722.1| PREDICTED: aldose 1-epimerase-like isoform X1 [Brachypodium distachyon]
Length=444

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 110/180 (61%), Gaps = 18/180 (10%)
 Frame = +1

Query  43   LMAALYRLLSFLVLG---------------VFLTGSFCDASEQVGIYEIKRGSFSVKITN  177
            L+AA+Y L SF +L                + L  +         I+E+  G    +I+N
Sbjct  69   LLAAVYLLASFTILSAPAASSLRATENPNRLVLPMAAPSRPRSPEIFELDNGRMRARISN  128

Query  178  YGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFGAIVGRVANRIGGASFKLNGVE  354
             GATV S+++PDKNG LGDVVLGFDS+D Y N T+ YFG IVGRVANRI  A F LNGV+
Sbjct  129  VGATVTSLLVPDKNGVLGDVVLGFDSLDPYLNGTSPYFGCIVGRVANRIKDAMFTLNGVQ  188

Query  355  YKLPANDHGNTLHGGIKGFSDVIWTVEDYK--KDSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            Y L  N+  NTLHGG KGF  VIW V +Y   K   +TL Y S DGE+G+PG++SVT  Y
Sbjct  189  YSLGINNPPNTLHGGFKGFDKVIWEVTEYNEGKTPSVTLKYYSKDGEEGYPGDVSVTARY  248



>ref|XP_011073000.1| PREDICTED: aldose 1-epimerase [Sesamum indicum]
Length=335

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 100/148 (68%), Gaps = 3/148 (2%)
 Frame = +1

Query  124  QVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFGAIV  300
            +  I+E+  G+  VK++NYG T+ S+++PDK+GKL DVVLGFD+++ Y K    YFG IV
Sbjct  3    EAKIFELNNGTMQVKVSNYGCTITSLLVPDKDGKLADVVLGFDTLEPYMKGAAPYFGCIV  62

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSHLTLSYN  474
            GRVANRI    F LNGVEY LP N   N+LHGG KG+  VIW V +YK+  +  +T  Y 
Sbjct  63   GRVANRIKDGKFTLNGVEYALPINKPPNSLHGGHKGYDKVIWEVAEYKQGDNPSITFKYR  122

Query  475  SYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            S DGE+G+PG++S T TY    K  + +
Sbjct  123  SRDGEEGYPGDVSFTATYTLTSKTTMRL  150



>ref|XP_002453661.1| hypothetical protein SORBIDRAFT_04g010030 [Sorghum bicolor]
 gb|EES06637.1| hypothetical protein SORBIDRAFT_04g010030 [Sorghum bicolor]
Length=363

 Score =   155 bits (391),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 106/163 (65%), Gaps = 3/163 (2%)
 Frame = +1

Query  49   AALYRLLSFLVLGVFLTGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKL  228
            A + RL   LV           A + +G+YE++ G FSVKITN+G T++SVILPD  G L
Sbjct  4    AEMLRLALCLVASALAATGAGGARKTIGVYELRHGDFSVKITNWGTTIMSVILPDSKGNL  63

Query  229  GDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKG  408
             DVVLG D++ +Y NDT++FG + GRVA RI    F L+G  Y L  ND  NTL GG +G
Sbjct  64   ADVVLGKDTIAEYINDTSFFGPVAGRVAGRIARGRFVLDGKVYHLDINDGRNTLQGGGRG  123

Query  409  FSDVIWTVEDY---KKDSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            F+ VIWTV++Y       ++TL Y S+DGEQGFPG+L V VTY
Sbjct  124  FNKVIWTVKEYVAGGDSPYVTLYYRSFDGEQGFPGDLDVYVTY  166



>ref|XP_009620755.1| PREDICTED: aldose 1-epimerase [Nicotiana tomentosiformis]
Length=335

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 101/145 (70%), Gaps = 3/145 (2%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFGAIVGRV  309
            I+E+  GS  VK++N G T++S+ +PDK+G LGDVVLGFD+V+ Y+   A +FG IVGRV
Sbjct  6    IFELNNGSMQVKVSNLGCTILSLSVPDKDGNLGDVVLGFDTVEPYQKGLAPFFGCIVGRV  65

Query  310  ANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH--LTLSYNSYD  483
            ANRI    F LNGV+Y LP N   N+LHGG KGF  V+W V ++K+  H  +T  Y+S D
Sbjct  66   ANRIKEGKFSLNGVDYTLPINKPPNSLHGGHKGFDKVVWEVAEHKEGKHPSITFKYHSRD  125

Query  484  GEQGFPGNLSVTVTYLFIGKNKLGI  558
            GE+G+PG+LSVT TY    K  L +
Sbjct  126  GEEGYPGDLSVTATYTLTSKTTLRL  150



>ref|XP_004984206.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=368

 Score =   155 bits (391),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 96/138 (70%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            + +G YE++RG FS+ +TN+GAT+++V +PDKNG + DVVLG+  +  Y N+T YFGA+V
Sbjct  35   QSLGFYELRRGEFSMVVTNWGATILAVRIPDKNGHINDVVLGYKDIGSYVNETTYFGALV  94

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD--SHLTLSYN  474
            GRVANRI G  F +    Y    ND  NTLHGG +GF+ V W+V +       H+T SY 
Sbjct  95   GRVANRIAGGRFTIKDRAYHTYRNDGNNTLHGGHRGFNQVFWSVRERVTGDFPHITFSYR  154

Query  475  SYDGEQGFPGNLSVTVTY  528
            SYDGEQGFPGNL V VTY
Sbjct  155  SYDGEQGFPGNLDVLVTY  172



>ref|XP_008644102.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=409

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 121/198 (61%), Gaps = 40/198 (20%)
 Frame = +1

Query  55   LYRL--LSFLVLGV---FLTGSFCDASEQ----VGIYEIKRGSFSVKITNYGATVISVIL  207
            L+RL  L+ L L V   F  G    A+      VG++E++ G FSVK+TN+GAT++SVIL
Sbjct  10   LHRLPGLALLCLAVAVCFSGGENAAAAAWTRKIVGVHELRVGDFSVKVTNWGATLMSVIL  69

Query  208  PDKNGKLGDVVLGFDSVDDY----------------------------KNDTAYFGAIVG  303
            PD  G LGDVVLG+D+V +Y                            +N TAYFG ++G
Sbjct  70   PDSKGNLGDVVLGYDTVAEYVVRSIVSAQHIRCVPETESLKLCRTETVQNGTAYFGGLIG  129

Query  304  RVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLSYN  474
            RVANR+ GA F L+G  Y+L  ND  N+LHGG +GFS V+WTV+++       ++TL Y+
Sbjct  130  RVANRVAGARFTLDGKAYRLYRNDGNNSLHGGHRGFSKVVWTVKEHVGGGDSPYITLYYH  189

Query  475  SYDGEQGFPGNLSVTVTY  528
            S+DGEQGFPG+L V VTY
Sbjct  190  SFDGEQGFPGDLDVYVTY  207



>ref|XP_006298977.1| hypothetical protein CARUB_v10015102mg [Capsella rubella]
 gb|EOA31875.1| hypothetical protein CARUB_v10015102mg [Capsella rubella]
Length=341

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 95/138 (69%), Gaps = 4/138 (3%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFGAIVGRV  309
            I+E+  GS  VKI+NYGAT+ S+ +PDKNGKL DVVLGFDSVD Y N  A YFG IVGRV
Sbjct  11   IFELNNGSMLVKISNYGATITSLSVPDKNGKLADVVLGFDSVDPYVNGLAPYFGCIVGRV  70

Query  310  ANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH---LTLSYNSY  480
            ANRI    F LNGV Y LP N   N+LHGG KGF   IW V  +KKD     +T  Y+S 
Sbjct  71   ANRIKEGKFSLNGVNYTLPINKPPNSLHGGNKGFDKKIWEVAGHKKDGEKPFITFKYHSA  130

Query  481  DGEQGFPGNLSVTVTYLF  534
            DGE+G+PG ++VT TY  
Sbjct  131  DGEEGYPGAVAVTATYTL  148



>gb|EMS54789.1| Aldose 1-epimerase [Triticum urartu]
Length=296

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 103/151 (68%), Gaps = 5/151 (3%)
 Frame = +1

Query  55   LYRLLSFLVLGVFLTGSFCDASEQ--VGIYEIKRGSFSVKITNYGATVISVILPDKNGKL  228
            + R L   VL          A+E+  VG+YE+ +G FS+K+TN+GAT++SVILPD  G L
Sbjct  1    MARALFIAVLATCFVALGQAAAERKTVGVYELNKGDFSIKVTNWGATLMSVILPDSRGNL  60

Query  229  GDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKG  408
            GDV+LG+D+V +Y N TAYFG ++GRVANRI  A F L+G  Y+L  ND  NTLHGG +G
Sbjct  61   GDVILGYDTVAEYMNGTAYFGGLIGRVANRIANARFTLDGKVYRLVPNDGNNTLHGGHRG  120

Query  409  FSDVIWTVEDY---KKDSHLTLSYNSYDGEQ  492
            F  V+WTV+++        +TL Y+S+DGEQ
Sbjct  121  FDKVVWTVKEHVAGGSSPFITLYYHSFDGEQ  151



>ref|NP_566594.2| putative aldose 1-epimerase [Arabidopsis thaliana]
 dbj|BAB02717.1| aldose 1-epimerase-like protein [Arabidopsis thaliana]
 gb|AEE76027.1| putative aldose 1-epimerase [Arabidopsis thaliana]
Length=341

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 94/138 (68%), Gaps = 4/138 (3%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFGAIVGRV  309
            I+E+  G+  VKI+NYG T+ S+ +PDKNGKLGDVVLGFDSVD Y K    YFG IVGRV
Sbjct  11   IFELNNGTMQVKISNYGTTITSLSVPDKNGKLGDVVLGFDSVDPYVKGLAPYFGCIVGRV  70

Query  310  ANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH---LTLSYNSY  480
            ANRI    F LNGV Y LP N   N+LHGG KGF   IW V  +K+D     +T  Y+S 
Sbjct  71   ANRIKEGKFSLNGVNYTLPINKPPNSLHGGNKGFDKKIWEVAGHKRDGEKPFITFKYHSA  130

Query  481  DGEQGFPGNLSVTVTYLF  534
            DGE+G+PG +SVT TY  
Sbjct  131  DGEEGYPGAVSVTATYTL  148



>ref|XP_008393430.1| PREDICTED: aldose 1-epimerase-like [Malus domestica]
Length=339

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 99/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTA  282
              DA++   I+E+  GS    ITN+G T+ S+ +P K+GKL DVVLGFDSVD Y K    
Sbjct  1    MADANQNPEIFELNNGSMRALITNFGCTITSLSVPGKDGKLADVVLGFDSVDPYVKGLAP  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSH  456
            YFG IVGRVANRI    FKLNG EY LP N   N+LHGG KG+   IW V ++KK  +  
Sbjct  61   YFGCIVGRVANRIKDGKFKLNGTEYSLPINRPPNSLHGGHKGYDKQIWKVAEHKKGDNPS  120

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y+S+DGE+ +PGNLS+T TY       + +
Sbjct  121  ITFKYHSHDGEEXYPGNLSLTATYTLTSSTTMRL  154



>gb|EAY90251.1| hypothetical protein OsI_11823 [Oryza sativa Indica Group]
Length=376

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (69%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            E +G YE++RG FSV +TN+GAT+++V LPDKNG + DVVLG+  +  Y NDT YFGA+V
Sbjct  39   ESIGFYELRRGEFSVVVTNWGATILTVNLPDKNGHIDDVVLGYKDIGSYVNDTTYFGALV  98

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD--SHLTLSYN  474
            GRVANRI G  F + G  +    ND  NTLHGG +GF+ V W+V +       ++T  Y 
Sbjct  99   GRVANRIAGGRFTVKGHAFHTYKNDGNNTLHGGHRGFNQVFWSVRERATGHFPYITFYYR  158

Query  475  SYDGEQGFPGNLSVTVTY  528
            SYDGEQGFPG L V VTY
Sbjct  159  SYDGEQGFPGALDVLVTY  176



>ref|XP_004235803.1| PREDICTED: aldose 1-epimerase [Solanum lycopersicum]
Length=335

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 100/145 (69%), Gaps = 3/145 (2%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFGAIVGRV  309
            I E+  GS  VK++N G T++S+ +PDK+G LGDVVLGFD+++ Y+   A YFG IVGRV
Sbjct  6    IIELNNGSMQVKVSNLGCTILSLSVPDKDGNLGDVVLGFDTLEPYQKGLAPYFGCIVGRV  65

Query  310  ANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH--LTLSYNSYD  483
            ANRI    F LNGV+Y LP N   N+LHGG KGF  V+W V ++K+  H  +T +Y+  D
Sbjct  66   ANRIRDGKFSLNGVDYSLPINRPPNSLHGGHKGFDKVVWEVAEHKEGEHPSITFTYHCRD  125

Query  484  GEQGFPGNLSVTVTYLFIGKNKLGI  558
            GE+G+PG+LSVT TY    K  L +
Sbjct  126  GEEGYPGDLSVTATYTLTSKTTLRL  150



>ref|XP_004975840.1| PREDICTED: aldose 1-epimerase-like [Setaria italica]
Length=363

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 100/151 (66%), Gaps = 3/151 (2%)
 Frame = +1

Query  115  ASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGA  294
            A + VG+YE+++G FSVK+TN+GA V+S++ PD  G L DVVLG D++ +Y ND +YFG 
Sbjct  28   ARKMVGVYELRKGDFSVKVTNFGARVMSIVFPDSKGNLADVVLGMDTIAEYVNDASYFGP  87

Query  295  IVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTL  465
            I GR+A R+    F L+G  Y +  ND  NT+HGG +GFS  IWTV++Y       ++T 
Sbjct  88   ITGRIAQRVARGRFVLDGKVYHMYKNDGNNTIHGGGRGFSKSIWTVKEYVGGGDSPYITF  147

Query  466  SYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             Y S+DGE+G PGN+   VTY   G   LG+
Sbjct  148  YYRSFDGEEGLPGNVDAYVTYRMSGPYTLGV  178



>ref|NP_001050238.1| Os03g0381000 [Oryza sativa Japonica Group]
 gb|AAR96220.1| putative aldose 1-epimerase [Oryza sativa Japonica Group]
 gb|ABF96267.1| Aldose 1-epimerase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12152.1| Os03g0381000 [Oryza sativa Japonica Group]
 gb|EAZ27132.1| hypothetical protein OsJ_11063 [Oryza sativa Japonica Group]
Length=376

 Score =   153 bits (386),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (69%), Gaps = 2/138 (1%)
 Frame = +1

Query  121  EQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIV  300
            E +G YE++RG FSV +TN+GAT+++V LPDKNG + DVVLG+  +  Y NDT YFGA+V
Sbjct  39   ESIGFYELRRGEFSVVVTNWGATILTVNLPDKNGHIDDVVLGYKDIGSYVNDTTYFGALV  98

Query  301  GRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD--SHLTLSYN  474
            GRVANRI G  F + G  +    ND  NTLHGG +GF+ V W+V +       ++T  Y 
Sbjct  99   GRVANRIAGGRFTVKGHAFHTYKNDGKNTLHGGHRGFNQVFWSVRERATGHFPYITFYYR  158

Query  475  SYDGEQGFPGNLSVTVTY  528
            SYDGEQGFPG L V VTY
Sbjct  159  SYDGEQGFPGALDVLVTY  176



>ref|XP_002531177.1| aldose-1-epimerase, putative [Ricinus communis]
 gb|EEF31192.1| aldose-1-epimerase, putative [Ricinus communis]
Length=335

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 103/150 (69%), Gaps = 5/150 (3%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFGA  294
            SEQ  ++E+  G+ SV++TNYGAT+ S+ +PDK GKL D+VLGFDSV+ Y K +  YFG 
Sbjct  2    SEQ--LFELNNGTISVRLTNYGATITSLFVPDKQGKLDDIVLGFDSVEAYMKGNAPYFGC  59

Query  295  IVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK--KDSHLTLS  468
            IVGRVANRI    F LNGVEY L  N+  N+LHGGIKGF  V+W V ++K  +   +T  
Sbjct  60   IVGRVANRIKEGKFSLNGVEYSLAINNGPNSLHGGIKGFDKVVWDVVEHKSGEQPSITFK  119

Query  469  YNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            Y S+DGE+G+PG+++VT  Y       + +
Sbjct  120  YESHDGEEGYPGDVTVTAKYTLTSSKSMRL  149



>ref|XP_010034276.1| PREDICTED: aldose 1-epimerase-like [Eucalyptus grandis]
 gb|KCW84109.1| hypothetical protein EUGRSUZ_B00995 [Eucalyptus grandis]
Length=340

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 100/154 (65%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTA  282
              D + Q  ++E+  G+  VKI N G T+ S+ +P K+GKL DVVLGFDSV+ Y K    
Sbjct  1    MADQARQAELFELDNGTMRVKIANLGCTIASLSVPGKDGKLADVVLGFDSVEPYLKGAAP  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSH  456
            +FG IVGRVANRI    F L+GVE+ LP N   N+LHGG KGF  VIW V DYKK  +  
Sbjct  61   FFGCIVGRVANRIKEGKFTLDGVEHSLPINKPPNSLHGGHKGFDKVIWEVADYKKGENPS  120

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y+S+DGE+G+PG+++VT TY       + +
Sbjct  121  ITFKYHSHDGEEGYPGDVAVTATYTLTSSTTMRL  154



>ref|XP_002885235.1| aldose 1-epimerase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61494.1| aldose 1-epimerase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 93/138 (67%), Gaps = 4/138 (3%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFGAIVGRV  309
            I+E+  G+  VKI+NYG T+ S+ +PDKNGKL DVVLGFDSVD Y K    YFG IVGRV
Sbjct  11   IFELNNGTMQVKISNYGTTITSLSVPDKNGKLADVVLGFDSVDPYVKGLAPYFGCIVGRV  70

Query  310  ANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH---LTLSYNSY  480
            ANRI    F LNGV Y LP N   N+LHGG KGF   IW V  +KKD     +T  Y+S 
Sbjct  71   ANRIKEGKFSLNGVNYTLPINKPPNSLHGGNKGFDKKIWEVAGHKKDGEKPFITFKYHSA  130

Query  481  DGEQGFPGNLSVTVTYLF  534
            DGE+G+PG +SVT TY  
Sbjct  131  DGEEGYPGAVSVTATYTL  148



>ref|XP_006451602.1| hypothetical protein CICLE_v10008981mg [Citrus clementina]
 gb|ESR64842.1| hypothetical protein CICLE_v10008981mg [Citrus clementina]
Length=312

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTA  282
              D + +  ++E+  GS  VKITNYGA + S+ +PDK+G   DVVLGFDSV+ Y K    
Sbjct  1    MADHTLKPEVFELNNGSMQVKITNYGAIITSLSVPDKHGNWADVVLGFDSVEPYVKGAAP  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSH  456
            +FG IVGRVANRI    F L+GVEY LP N   N+LHGG KGF  V+W V +YKK  +  
Sbjct  61   FFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPS  120

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y S DGE+G+PG++SV  TY       + +
Sbjct  121  ITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRL  154



>ref|XP_009360073.1| PREDICTED: aldose 1-epimerase-like [Pyrus x bretschneideri]
Length=339

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 99/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-  282
              DA+++  I+E+  GS    ITN G T+ S+ +P K+GKL DVVLGFDSV+ Y N  A 
Sbjct  1    MADANQKPEIFELNNGSMRALITNLGCTITSLSVPGKDGKLADVVLGFDSVEPYVNGLAP  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSH  456
            YFG IVGRVANRI    F LNG EY LP N   N+LHGG KG+   IW V ++KK  +  
Sbjct  61   YFGCIVGRVANRIKDGKFTLNGTEYSLPINGPPNSLHGGHKGYDKQIWKVAEHKKGDNPS  120

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y S+DGE+G+PGNLS+T TY       + +
Sbjct  121  ITFKYQSHDGEEGYPGNLSLTATYTLTSSTTMRL  154



>ref|XP_006341518.1| PREDICTED: aldose 1-epimerase-like [Solanum tuberosum]
Length=335

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 100/145 (69%), Gaps = 3/145 (2%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFGAIVGRV  309
            I E+  GS  VK++N G T++S+ +PDK+G LGDVVLGFD+++ Y+   A YFG+IVGRV
Sbjct  6    IIELNNGSMQVKVSNLGCTILSLSVPDKDGNLGDVVLGFDTLEPYQKGLAPYFGSIVGRV  65

Query  310  ANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH--LTLSYNSYD  483
            ANRI    F LNGV+Y LP N   N+LHGG KGF   +W V ++K+  H  +T  Y+S D
Sbjct  66   ANRIKDGKFSLNGVDYTLPINKPPNSLHGGHKGFDKAVWEVAEHKEGEHPSVTFKYHSRD  125

Query  484  GEQGFPGNLSVTVTYLFIGKNKLGI  558
            GE+G+PG+LSVT TY    K  L +
Sbjct  126  GEEGYPGDLSVTATYTLTSKTTLRL  150



>ref|XP_002446608.1| hypothetical protein SORBIDRAFT_06g018820 [Sorghum bicolor]
 gb|EES10936.1| hypothetical protein SORBIDRAFT_06g018820 [Sorghum bicolor]
Length=379

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 3/157 (2%)
 Frame = +1

Query  97   TGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKND  276
            TG      + VG YE+++G FSV++TN+GA V+SV+LPD  G L DVVLG D++ +Y ND
Sbjct  32   TGPADATRKMVGAYELRKGDFSVRLTNWGARVMSVVLPDCKGNLADVVLGRDTIAEYVND  91

Query  277  TAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KK  447
            T YFG I GR+A R+    F L+G  Y++  N   NT+HGG +GFS  IWTV++Y    +
Sbjct  92   TEYFGPITGRIAQRVARGRFVLDGKVYQMYRNAGRNTIHGGDRGFSRSIWTVKEYVGGGE  151

Query  448  DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
              ++T  Y S+DGEQG PGN+   VTY   G   LG+
Sbjct  152  SPYITFYYRSFDGEQGLPGNVDAYVTYRMSGPYTLGV  188



>ref|XP_008374865.1| PREDICTED: aldose 1-epimerase [Malus domestica]
Length=339

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 99/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTA  282
              DA+++  I+E+  GS    ITN G T+ S+ +P K+GKL DVVLGFDSVD Y K    
Sbjct  1    MADANQKPEIFELNNGSMRALITNLGCTITSLSVPGKDGKLADVVLGFDSVDPYVKGVAP  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSH  456
            YFG+IVGRVANRI    F LNG EY LP N   N+LHGG +G+   IW V + KK  +  
Sbjct  61   YFGSIVGRVANRIKDGKFTLNGTEYSLPVNKPPNSLHGGHRGYDKQIWEVAELKKGDNPS  120

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y+S+DGE+G+PGNLS+T TY       + +
Sbjct  121  ITFKYHSHDGEEGYPGNLSLTATYTLTSSTTMRL  154



>gb|KDO47395.1| hypothetical protein CISIN_1g019518mg [Citrus sinensis]
Length=326

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTA  282
              D + +  ++E+  GS  VKITNYGA + S+ +PDK+G   DVVLGFDSV+ Y K    
Sbjct  1    MADHTLKPEVFELNNGSMQVKITNYGAIITSLSVPDKHGNWADVVLGFDSVEPYVKGAAP  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSH  456
            +FG IVGRVANRI    F L+GVEY LP N   N+LHGG KGF  V+W V +YKK  +  
Sbjct  61   FFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPS  120

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y S DGE+G+PG++SV  TY       + +
Sbjct  121  ITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRL  154



>gb|KFK39119.1| hypothetical protein AALP_AA3G203500 [Arabis alpina]
Length=341

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 94/138 (68%), Gaps = 4/138 (3%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFGAIVGRV  309
            I+E+  G+  VKI+NYGAT+ S+ +PD NGKL DVVLGFDSVD Y K    YFG IVGRV
Sbjct  11   IFELNNGTMQVKISNYGATITSLSVPDNNGKLADVVLGFDSVDPYVKGLAPYFGCIVGRV  70

Query  310  ANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNSY  480
            ANRI    F LNGV+Y LP N   N+LHGG KGF   IW V  +KKD     +T  Y+S 
Sbjct  71   ANRIKEGKFSLNGVDYTLPINKPPNSLHGGNKGFDKKIWEVAGHKKDGDKPFITFKYHSA  130

Query  481  DGEQGFPGNLSVTVTYLF  534
            DGE+G+PG ++VT TY  
Sbjct  131  DGEEGYPGAVTVTATYTL  148



>ref|XP_006490787.1| PREDICTED: aldose 1-epimerase-like [Citrus sinensis]
 gb|KDO47396.1| hypothetical protein CISIN_1g019518mg [Citrus sinensis]
Length=340

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTA  282
              D + +  ++E+  GS  VKITNYGA + S+ +PDK+G   DVVLGFDSV+ Y K    
Sbjct  1    MADHTLKPEVFELNNGSMQVKITNYGAIITSLSVPDKHGNWADVVLGFDSVEPYVKGAAP  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSH  456
            +FG IVGRVANRI    F L+GVEY LP N   N+LHGG KGF  V+W V +YKK  +  
Sbjct  61   FFGCIVGRVANRIKDGKFSLDGVEYTLPINKPPNSLHGGFKGFDKVVWEVAEYKKGENPS  120

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y S DGE+G+PG++SV  TY       + +
Sbjct  121  ITFKYRSRDGEEGYPGDVSVMATYTLTSSTTMRL  154



>ref|XP_010265811.1| PREDICTED: aldose 1-epimerase-like [Nelumbo nucifera]
Length=339

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 100/140 (71%), Gaps = 3/140 (2%)
 Frame = +1

Query  118  SEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFGA  294
            +++  ++E+  G+  VKI+NYGAT+ S+++PDK G L DVVLGFDS++ Y K    YFG 
Sbjct  4    TQKAELFELDNGTVRVKISNYGATITSLLVPDKQGNLTDVVLGFDSLEPYLKGAAPYFGC  63

Query  295  IVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYK--KDSHLTLS  468
            IVGRVANRI    F LNGVEY LP N+  N+LHGG KGF  V+W V + K  ++  +T  
Sbjct  64   IVGRVANRIKDGKFMLNGVEYSLPINNPPNSLHGGNKGFDKVVWEVIERKDGENPSITFR  123

Query  469  YNSYDGEQGFPGNLSVTVTY  528
            Y+S+DGE+G+PGN+ +T TY
Sbjct  124  YHSHDGEEGYPGNVIITATY  143



>ref|XP_009356028.1| PREDICTED: aldose 1-epimerase-like [Pyrus x bretschneideri]
Length=339

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 97/154 (63%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  FCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTA  282
              DA+++  I+E+  GS    ITN G T+ S+ +P K+GKL DVVLGFDSVD Y K    
Sbjct  1    MADANQKPEIFELNNGSMRALITNLGCTITSLSVPGKDGKLADVVLGFDSVDPYVKGVAP  60

Query  283  YFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKK--DSH  456
            YFG+IVGRVANRI    F LNG EY LP N   N+LHGG KG+   IW V + KK  +  
Sbjct  61   YFGSIVGRVANRIKDGKFTLNGTEYSLPVNRPPNSLHGGHKGYDQQIWEVAELKKGDNPS  120

Query  457  LTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            +T  Y S DGE+G+PGNLS+T TY       + +
Sbjct  121  ITFKYRSQDGEEGYPGNLSLTATYTLTSSTTMRL  154



>ref|XP_002446609.1| hypothetical protein SORBIDRAFT_06g018830 [Sorghum bicolor]
 gb|EES10937.1| hypothetical protein SORBIDRAFT_06g018830 [Sorghum bicolor]
Length=369

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 99/148 (67%), Gaps = 3/148 (2%)
 Frame = +1

Query  124  QVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVG  303
            +VG+YE+K G FSVK+TN+GA ++SV+LPD  G L DVVLG D++ +Y NDT+YFG I G
Sbjct  33   RVGVYELKLGDFSVKVTNWGARLMSVVLPDSKGNLADVVLGRDTLAEYFNDTSYFGPITG  92

Query  304  RVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KKDSHLTLSYN  474
            RVA RI    F L+G  Y L  ND  NT+HGG   FS   WTV++Y       ++TL Y+
Sbjct  93   RVAQRISRGRFVLDGKVYHLQLNDGNNTIHGGGTAFSKSAWTVKEYVCGGDSPYITLYYH  152

Query  475  SYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            S+DGEQGFPG+L   VTY       LG+
Sbjct  153  SFDGEQGFPGSLDAYVTYRVTSPYTLGV  180



>gb|ABK26409.1| unknown [Picea sitchensis]
Length=383

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 117/190 (62%), Gaps = 22/190 (12%)
 Frame = +1

Query  55   LYRLLSFLVLGVFLTGSFCDASEQ-----------------VGIYEIKRGSFSVKITNYG  183
            + +++ FL + VF+    C+A EQ                  G + +++G   + +TN+G
Sbjct  1    MAKIVYFLWILVFIQLCRCEAFEQGKGKLGGHGYFHRRINGPGFFHLQKGDLHINVTNWG  60

Query  184  ATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA---YFGAIVGRVANRIGGASFKLNGVE  354
            AT++S+ LPD  G + DV LG+DS+  Y N ++   Y GAI+GRV+NR+  A F LNG  
Sbjct  61   ATLVSLTLPDAKGHIADVALGYDSLASYMNVSSTRPYLGAILGRVSNRVKNAQFMLNGET  120

Query  355  YKLPANDHGNTLHGGIKGFSDVIWTVEDYK--KDSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            Y LP ND  NTLHGG++GF +V+W V++Y+  +   +  +Y+S+DGEQGFPG+L V+VTY
Sbjct  121  YHLPKNDGNNTLHGGLRGFDNVLWKVKEYRGGRRPSVKFTYHSFDGEQGFPGDLDVSVTY  180

Query  529  LFIGKNKLGI  558
               G  +L +
Sbjct  181  TISGDMELRL  190



>gb|ABK21947.1| unknown [Picea sitchensis]
Length=383

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 117/190 (62%), Gaps = 22/190 (12%)
 Frame = +1

Query  55   LYRLLSFLVLGVFLTGSFCDASEQ-----------------VGIYEIKRGSFSVKITNYG  183
            + +++ FL + VF+    C+A EQ                  G + +++G   + +TN+G
Sbjct  1    MAKIVYFLWILVFIQLCRCEAFEQGKGKLGGHGYFHRRINGPGFFHLQKGDLHINVTNWG  60

Query  184  ATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA---YFGAIVGRVANRIGGASFKLNGVE  354
            AT++S+ LPD  G + DV LG+DS+  Y N ++   Y GAI+GRV+NR+  A F LNG  
Sbjct  61   ATLVSLTLPDAKGHIADVALGYDSLASYMNVSSTRPYLGAILGRVSNRVKNAQFMLNGET  120

Query  355  YKLPANDHGNTLHGGIKGFSDVIWTVEDYK--KDSHLTLSYNSYDGEQGFPGNLSVTVTY  528
            Y LP ND  NTLHGG++GF +V+W V++Y+  +   +  +Y+S+DGEQGFPG+L V+VTY
Sbjct  121  YHLPKNDGNNTLHGGLRGFDNVLWKVKEYRGGRRPSVKFTYHSFDGEQGFPGDLDVSVTY  180

Query  529  LFIGKNKLGI  558
               G  +L +
Sbjct  181  TISGDMELRL  190



>emb|CDJ26298.1| unnamed protein product [Triticum aestivum]
Length=371

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 106/168 (63%), Gaps = 7/168 (4%)
 Frame = +1

Query  46   MAALYRLLSFLVLGVFLTGSFCDAS-----EQVGIYEIKRGSFSVKITNYGATVISVILP  210
            M  +  L   L L V ++    +A      E +G YE++RG FS+ +TN+GAT++SV LP
Sbjct  6    MKTMMALAPLLCLAVAVSLGGVEARKHPGKETLGYYELRRGEFSMVVTNWGATILSVRLP  65

Query  211  DKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTL  390
            DKNG++ DVVLG+ ++  Y NDT YFGA+VGRVANRI G  F +    Y    ND  NTL
Sbjct  66   DKNGRIDDVVLGYKTIGGYVNDTTYFGALVGRVANRIAGGRFTIKNHPYHTYTNDGNNTL  125

Query  391  HGGIKGFSDVIWTVEDYKKDS--HLTLSYNSYDGEQGFPGNLSVTVTY  528
            HGG +GF+ V W+V +    +  ++T  Y S DGE+GFPG L V VTY
Sbjct  126  HGGHRGFNQVFWSVRERATGAFPYITFYYRSGDGEEGFPGALDVLVTY  173



>emb|CDX70595.1| BnaC03g06790D [Brassica napus]
Length=309

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 90/125 (72%), Gaps = 3/125 (2%)
 Frame = +1

Query  193  ISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPAN  372
            +S+  PDKNGK GD+VLG+DSV  YK D  YFGA VGRVANRIG A FKLNG EYK  AN
Sbjct  1    MSLHFPDKNGKTGDIVLGYDSVKSYKTDKVYFGATVGRVANRIGKAQFKLNGKEYKTTAN  60

Query  373  DHGNTLHGGIKGFSDVIWTVEDYK---KDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGK  543
            D  NTLHGG KGF DV+W V+ +K   K  H+  +Y S DG+QGFPG ++VTVTY    +
Sbjct  61   DGKNTLHGGKKGFGDVVWGVKKHKYDGKKPHIVFTYTSPDGDQGFPGEVNVTVTYKLDKE  120

Query  544  NKLGI  558
            N+L +
Sbjct  121  NELSV  125



>emb|CDX78613.1| BnaA03g05250D [Brassica napus]
Length=309

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 90/125 (72%), Gaps = 3/125 (2%)
 Frame = +1

Query  193  ISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGAIVGRVANRIGGASFKLNGVEYKLPAN  372
            +S+  PDKNGK GD+VLG+DSV  YK D  YFGA VGRVANRIG A FKLNG EYK  AN
Sbjct  1    MSLHFPDKNGKAGDIVLGYDSVKSYKTDKVYFGATVGRVANRIGKAQFKLNGKEYKTTAN  60

Query  373  DHGNTLHGGIKGFSDVIWTVEDYK---KDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGK  543
            D  NTLHGG KGF DV+W V+ +K   K  H+  +Y S DG+QGFPG ++VTVTY    +
Sbjct  61   DGKNTLHGGKKGFGDVVWGVKKHKYDGKKPHIVFTYTSPDGDQGFPGEVNVTVTYKLDKE  120

Query  544  NKLGI  558
            N+L +
Sbjct  121  NELSV  125



>emb|CDX92179.1| BnaA05g22280D [Brassica napus]
Length=344

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 97/140 (69%), Gaps = 5/140 (4%)
 Frame = +1

Query  130  GIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFGAIVGR  306
            GI+E+  GS  VKI+NYGAT+ S+ +PDKNGKL DVVLGFDSVD Y N  A YFG IVGR
Sbjct  12   GIFELNNGSLQVKISNYGATITSLSVPDKNGKLADVVLGFDSVDPYVNGLAPYFGCIVGR  71

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNS  477
            VANRI    F LNGV+Y LP N+  N+LHGG KGF    W V  +KKD     +T  Y+S
Sbjct  72   VANRIKEGKFSLNGVDYTLPINNGPNSLHGGNKGFDKKTWEVAGHKKDGDKPFITFKYHS  131

Query  478  YDGEQG-FPGNLSVTVTYLF  534
             DGE+G +PG ++VT TY  
Sbjct  132  ADGEEGCYPGAVTVTATYTL  151



>ref|XP_009145951.1| PREDICTED: aldose 1-epimerase [Brassica rapa]
Length=343

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = +1

Query  130  GIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFGAIVGR  306
            GI+E+  GS  VKI+N+GAT+ S+ +PDKNGKL DVVLGFDSVD Y N  A YFG IVGR
Sbjct  12   GIFELNNGSLQVKISNFGATITSLSVPDKNGKLADVVLGFDSVDPYVNGLAPYFGCIVGR  71

Query  307  VANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTLSYNS  477
            VANRI    F LNG +Y LP N+  N+LHGG  GF    W V  +KKD     +T  Y+S
Sbjct  72   VANRIKEGKFSLNGADYTLPINNGPNSLHGGNNGFDKKTWEVAGHKKDGDKPFITFKYHS  131

Query  478  YDGEQGFPGNLSVTVTYLF  534
             DGE+G+PG ++VT TY  
Sbjct  132  ADGEEGYPGAVTVTATYTL  150



>ref|XP_009766422.1| PREDICTED: aldose 1-epimerase [Nicotiana sylvestris]
Length=335

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 100/145 (69%), Gaps = 3/145 (2%)
 Frame = +1

Query  133  IYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTA-YFGAIVGRV  309
            I+E+  GS  V ++N G T++S+ +PDK+G LGDVVLGFD+++ Y+   A +FG IVGRV
Sbjct  6    IFELNNGSMQVTVSNLGCTILSLSVPDKDGNLGDVVLGFDTLEPYQKGLAPFFGCIVGRV  65

Query  310  ANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKDSH--LTLSYNSYD  483
            ANRI    F LNGV+Y LP N   N+LHGG KG+  V+W V ++K+  H  +T  Y+S D
Sbjct  66   ANRIKEGKFSLNGVDYTLPINKPPNSLHGGHKGYDKVVWEVAEHKEGEHPSITFKYHSRD  125

Query  484  GEQGFPGNLSVTVTYLFIGKNKLGI  558
            GE+G+PG+LSVT TY    K  L +
Sbjct  126  GEEGYPGDLSVTATYTLTSKTTLRL  150



>gb|EMT09273.1| Aldose 1-epimerase [Aegilops tauschii]
Length=292

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 105/151 (70%), Gaps = 5/151 (3%)
 Frame = +1

Query  121  EQVGIYEIK--RGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKNDTAYFGA  294
            + VG Y +K  +G FS+K+TN+GAT++SV++PD  G L DV+LG+D++  Y N T  FGA
Sbjct  26   KPVGFYGLKNKKGDFSIKVTNWGATLVSVLVPDCQGNLADVILGYDTLRGYVNGTGSFGA  85

Query  295  IVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLTL  465
             VGRV NRI  + F L+G  Y+L  ND  N++HGG +GF  VIWTV++Y +D    ++T 
Sbjct  86   TVGRVVNRIAKSRFVLDGKAYRLFRNDGNNSIHGGHRGFGKVIWTVKEYVRDGDTPYITF  145

Query  466  SYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
             Y+S+DGEQGFPG+L V VTY   G  +L I
Sbjct  146  FYHSFDGEQGFPGDLDVYVTYQLSGPYELSI  176



>gb|ADY61345.1| aldose 1-epimerase [Planctomyces brasiliensis DSM 5305]
Length=364

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 107/170 (63%), Gaps = 5/170 (3%)
 Frame = +1

Query  64   LLSFLVLGVFLTGSFCDASE--QVGIYEIKRGS-FSVKITNYGATVISVILPDKNGKLGD  234
            L+S L L +F TG+     +   + +Y +K  S  +VK+TNYGA + S+++PD+NG L D
Sbjct  4    LISLLALQIFATGANAQVEDFDSIKLYTLKNDSGMTVKVTNYGAIITSIVVPDRNGNLAD  63

Query  235  VVLGFDSVDDYKN--DTAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKG  408
            V LG+DS+  Y N  D  YFGA+VGR  NRI    FKLNG  Y L  N+  N LHGG+ G
Sbjct  64   VALGYDSLKHYMNAVDKPYFGAVVGRYGNRIANGLFKLNGETYSLATNNGANHLHGGVIG  123

Query  409  FSDVIWTVEDYKKDSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
            F  V+W  +  +K + +TLSY + DGE+G+PGNL + VTY     N+L +
Sbjct  124  FDKVVWDADYDRKGNRITLSYQAKDGEEGYPGNLDLQVTYHLTVDNQLEV  173



>ref|XP_002446607.1| hypothetical protein SORBIDRAFT_06g018810 [Sorghum bicolor]
 gb|EES10935.1| hypothetical protein SORBIDRAFT_06g018810 [Sorghum bicolor]
Length=365

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  97   TGSFCDASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDYKND  276
            TG      + VG+Y +++G FSV++TN+GA V+SV+LPD  G L DVVLG D++ +Y ND
Sbjct  20   TGPADATRKMVGVYVLRKGDFSVRLTNWGARVMSVVLPDCKGNLADVVLGRDTIAEYVND  79

Query  277  TAYFGAIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDY---KK  447
              YFG I GR+A R+    F L+G  Y +  ND  NT+HGG +GFS  IWTV++Y    +
Sbjct  80   DVYFGPITGRIAQRVARGRFVLDGKVYHMHRNDGRNTIHGGDRGFSRSIWTVKEYVAGGE  139

Query  448  DSHLTLSYNSYDGEQGFPGNLSVTVTYLFIGKNKLGI  558
              ++T  Y S+DGEQG PGN+   VTY   G   LG+
Sbjct  140  SPYITFYYRSFDGEQGLPGNVDAYVTYRMSGPYTLGV  176



>ref|XP_010549060.1| PREDICTED: aldose 1-epimerase [Tarenaya hassleriana]
Length=339

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 96/144 (67%), Gaps = 4/144 (3%)
 Frame = +1

Query  115  ASEQVGIYEIKRGSFSVKITNYGATVISVILPDKNGKLGDVVLGFDSVDDY-KNDTAYFG  291
            A ++  I+E+  GS  V I+NYGAT+ S+ +PDKNGKL DVVLGFDSVD Y K    YFG
Sbjct  2    ADQKPEIFELSNGSMQVMISNYGATITSLSVPDKNGKLADVVLGFDSVDPYVKGLAPYFG  61

Query  292  AIVGRVANRIGGASFKLNGVEYKLPANDHGNTLHGGIKGFSDVIWTVEDYKKD---SHLT  462
             IVGRVANRI    F LNGV Y LP N   N+LHGG KGF   +W V ++KKD     +T
Sbjct  62   CIVGRVANRIKEGKFVLNGVLYTLPINKPPNSLHGGNKGFDKKVWDVVEHKKDGEKPSIT  121

Query  463  LSYNSYDGEQGFPGNLSVTVTYLF  534
              Y S DGE+G+PG ++VT TY  
Sbjct  122  FKYFSADGEEGYPGAVTVTATYTL  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 655681405646