BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7316

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP00784.1|  unnamed protein product                                207   5e-60   Coffea canephora [robusta coffee]
ref|XP_009615526.1|  PREDICTED: uncharacterized protein LOC104108246    199   7e-60   Nicotiana tomentosiformis
gb|EYU30069.1|  hypothetical protein MIMGU_mgv1a003875mg                200   4e-57   Erythranthe guttata [common monkey flower]
ref|XP_009785420.1|  PREDICTED: uncharacterized protein At1g04910...    196   2e-56   Nicotiana sylvestris
ref|XP_009785418.1|  PREDICTED: uncharacterized protein At1g04910...    196   9e-56   Nicotiana sylvestris
ref|XP_002284457.1|  PREDICTED: uncharacterized protein At1g04910       194   4e-55   Vitis vinifera
emb|CAN77011.1|  hypothetical protein VITISV_036881                     194   9e-55   Vitis vinifera
ref|XP_010066619.1|  PREDICTED: uncharacterized protein At1g04910       191   6e-54   Eucalyptus grandis [rose gum]
ref|XP_008389213.1|  PREDICTED: uncharacterized protein LOC103451575    182   1e-53   
ref|XP_012072229.1|  PREDICTED: uncharacterized protein At1g04910       189   3e-53   Jatropha curcas
ref|XP_004238827.1|  PREDICTED: uncharacterized protein At1g04910       189   5e-53   Solanum lycopersicum
ref|XP_006355101.1|  PREDICTED: uncharacterized protein At1g04910...    187   6e-53   Solanum tuberosum [potatoes]
ref|XP_011655460.1|  PREDICTED: uncharacterized protein At1g04910...    188   9e-53   Cucumis sativus [cucumbers]
ref|XP_008467134.1|  PREDICTED: uncharacterized protein At1g04910...    188   1e-52   Cucumis melo [Oriental melon]
gb|KDO64644.1|  hypothetical protein CISIN_1g008637mg                   183   1e-52   Citrus sinensis [apfelsine]
ref|XP_006355100.1|  PREDICTED: uncharacterized protein At1g04910...    187   3e-52   Solanum tuberosum [potatoes]
ref|XP_008243446.1|  PREDICTED: uncharacterized protein At1g04910       186   4e-52   Prunus mume [ume]
ref|XP_010262908.1|  PREDICTED: uncharacterized protein At1g04910...    186   4e-52   
gb|EPS64269.1|  hypothetical protein M569_10511                         183   4e-52   Genlisea aurea
ref|XP_010262779.1|  PREDICTED: uncharacterized protein At1g04910...    186   6e-52   
ref|XP_007225729.1|  hypothetical protein PRUPE_ppa003622mg             186   7e-52   Prunus persica
ref|XP_010262851.1|  PREDICTED: uncharacterized protein At1g04910...    185   7e-52   
ref|XP_010262622.1|  PREDICTED: uncharacterized protein At1g04910...    186   8e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010262705.1|  PREDICTED: uncharacterized protein At1g04910...    185   9e-52   Nelumbo nucifera [Indian lotus]
gb|KDO64643.1|  hypothetical protein CISIN_1g008637mg                   183   1e-51   Citrus sinensis [apfelsine]
gb|KDO64642.1|  hypothetical protein CISIN_1g008637mg                   183   7e-51   Citrus sinensis [apfelsine]
ref|XP_006448248.1|  hypothetical protein CICLE_v10014776mg             183   7e-51   Citrus clementina [clementine]
ref|XP_006469184.1|  PREDICTED: uncharacterized protein At1g04910...    183   7e-51   Citrus sinensis [apfelsine]
ref|XP_011023536.1|  PREDICTED: uncharacterized protein At1g04910...    183   9e-51   Populus euphratica
ref|XP_002311505.2|  hypothetical protein POPTR_0008s12960g             182   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_004505284.1|  PREDICTED: uncharacterized protein At1g04910...    182   2e-50   Cicer arietinum [garbanzo]
ref|XP_009339689.1|  PREDICTED: uncharacterized protein At1g04910...    181   3e-50   Pyrus x bretschneideri [bai li]
ref|XP_007157752.1|  hypothetical protein PHAVU_002G095600g             181   4e-50   Phaseolus vulgaris [French bean]
ref|XP_003556095.1|  PREDICTED: uncharacterized protein At1g04910...    181   4e-50   Glycine max [soybeans]
gb|KFK33363.1|  hypothetical protein AALP_AA5G004000                    181   5e-50   Arabis alpina [alpine rockcress]
ref|XP_010695805.1|  PREDICTED: uncharacterized protein At1g04910...    181   5e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003529417.1|  PREDICTED: uncharacterized protein At1g04910...    180   8e-50   Glycine max [soybeans]
ref|XP_009351481.1|  PREDICTED: uncharacterized protein At1g04910...    179   1e-49   Pyrus x bretschneideri [bai li]
ref|XP_009351480.1|  PREDICTED: uncharacterized protein At1g04910...    179   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_010513871.1|  PREDICTED: uncharacterized protein At1g04910...    179   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010502128.1|  PREDICTED: uncharacterized protein At1g04910...    179   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006290827.1|  hypothetical protein CARUB_v10016938mg             179   2e-49   Capsella rubella
ref|XP_010274715.1|  PREDICTED: uncharacterized protein At1g04910...    179   2e-49   Nelumbo nucifera [Indian lotus]
ref|NP_178257.1|  O-fucosyltransferase family protein                   179   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875074.1|  hypothetical protein ARALYDRAFT_484066             178   5e-49   
ref|XP_009101345.1|  PREDICTED: uncharacterized protein At1g04910...    178   5e-49   Brassica rapa
ref|XP_008339538.1|  PREDICTED: uncharacterized protein At1g04910...    178   6e-49   Malus domestica [apple tree]
emb|CDY65925.1|  BnaC07g48790D                                          176   2e-48   Brassica napus [oilseed rape]
gb|KJB50369.1|  hypothetical protein B456_008G166900                    176   2e-48   Gossypium raimondii
gb|KHG19963.1|  hypothetical protein F383_04918                         176   3e-48   Gossypium arboreum [tree cotton]
ref|XP_009129233.1|  PREDICTED: uncharacterized protein At1g04910...    175   5e-48   Brassica rapa
gb|KEH30846.1|  O-fucosyltransferase family protein                     175   7e-48   Medicago truncatula
ref|XP_010093364.1|  hypothetical protein L484_022926                   174   9e-48   Morus notabilis
ref|XP_009101344.1|  PREDICTED: uncharacterized protein At1g04910...    174   1e-47   Brassica rapa
ref|XP_011038632.1|  PREDICTED: uncharacterized protein At1g04910       174   1e-47   Populus euphratica
ref|XP_002315879.1|  hypothetical protein POPTR_0010s12160g             174   1e-47   Populus trichocarpa [western balsam poplar]
emb|CDY52384.1|  BnaCnng22220D                                          174   1e-47   Brassica napus [oilseed rape]
ref|XP_006398540.1|  hypothetical protein EUTSA_v10000838mg             174   2e-47   Eutrema salsugineum [saltwater cress]
gb|KHG09806.1|  hypothetical protein F383_15167                         171   2e-46   Gossypium arboreum [tree cotton]
gb|KHG09805.1|  hypothetical protein F383_15167                         171   3e-46   Gossypium arboreum [tree cotton]
gb|KJB30799.1|  hypothetical protein B456_005G161000                    169   1e-45   Gossypium raimondii
gb|KJB15425.1|  hypothetical protein B456_002G178200                    167   3e-45   Gossypium raimondii
gb|KJB15424.1|  hypothetical protein B456_002G178200                    167   4e-45   Gossypium raimondii
ref|XP_006307153.1|  hypothetical protein CARUB_v10008744mg             165   2e-44   Capsella rubella
gb|AES59903.2|  O-fucosyltransferase family protein                     163   9e-44   Medicago truncatula
ref|XP_010527785.1|  PREDICTED: uncharacterized protein At1g04910       163   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_002526030.1|  conserved hypothetical protein                     162   2e-43   Ricinus communis
ref|XP_002892842.1|  hypothetical protein ARALYDRAFT_471685             162   4e-43   
ref|XP_006416955.1|  hypothetical protein EUTSA_v10007261mg             160   9e-43   Eutrema salsugineum [saltwater cress]
ref|XP_007045152.1|  O-fucosyltransferase family protein                160   1e-42   Theobroma cacao [chocolate]
ref|XP_004498295.1|  PREDICTED: uncharacterized protein At1g04910...    159   2e-42   
ref|XP_004297377.1|  PREDICTED: uncharacterized protein At1g04910       160   2e-42   Fragaria vesca subsp. vesca
ref|XP_004498294.1|  PREDICTED: uncharacterized protein At1g04910...    158   4e-42   Cicer arietinum [garbanzo]
ref|XP_004498293.1|  PREDICTED: uncharacterized protein At1g04910...    159   5e-42   Cicer arietinum [garbanzo]
ref|XP_010496695.1|  PREDICTED: uncharacterized protein At1g04910...    158   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010459015.1|  PREDICTED: uncharacterized protein At1g04910...    157   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010496702.1|  PREDICTED: uncharacterized protein At1g04910...    157   1e-41   
ref|XP_010459016.1|  PREDICTED: uncharacterized protein At1g04910...    157   1e-41   
emb|CDX81687.1|  BnaC08g39140D                                          157   2e-41   
ref|XP_010318109.1|  PREDICTED: uncharacterized protein At1g04910...    156   2e-41   
ref|XP_011070621.1|  PREDICTED: uncharacterized protein At1g04910...    157   2e-41   Sesamum indicum [beniseed]
ref|XP_010931259.1|  PREDICTED: uncharacterized protein At1g04910...    155   4e-41   
ref|XP_010476573.1|  PREDICTED: uncharacterized protein At1g04910...    156   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010476572.1|  PREDICTED: uncharacterized protein At1g04910...    156   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004235088.1|  PREDICTED: uncharacterized protein At1g04910...    156   5e-41   Solanum lycopersicum
ref|XP_006342313.1|  PREDICTED: uncharacterized protein At1g04910...    154   5e-41   Solanum tuberosum [potatoes]
ref|XP_010931258.1|  PREDICTED: uncharacterized protein At1g04910...    155   8e-41   Elaeis guineensis
emb|CDY33727.1|  BnaA09g45330D                                          155   8e-41   Brassica napus [oilseed rape]
ref|XP_006342312.1|  PREDICTED: uncharacterized protein At1g04910...    154   1e-40   Solanum tuberosum [potatoes]
gb|KFK43757.1|  hypothetical protein AALP_AA1G168900                    155   1e-40   Arabis alpina [alpine rockcress]
ref|XP_006342311.1|  PREDICTED: uncharacterized protein At1g04910...    155   1e-40   Solanum tuberosum [potatoes]
ref|XP_010553860.1|  PREDICTED: uncharacterized protein At1g04910...    154   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_009420104.1|  PREDICTED: uncharacterized protein At1g04910...    154   3e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_172950.1|  O-fucosyltransferase family protein                   153   6e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117860.1|  PREDICTED: uncharacterized protein At1g04910...    151   2e-39   Brassica rapa
ref|XP_008776785.1|  PREDICTED: uncharacterized protein At1g04910...    151   3e-39   
ref|XP_009407491.1|  PREDICTED: uncharacterized protein At1g04910...    150   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010922337.1|  PREDICTED: uncharacterized protein At1g04910...    150   8e-39   Elaeis guineensis
ref|XP_009416135.1|  PREDICTED: uncharacterized protein At1g04910...    148   3e-38   
ref|XP_006826849.1|  PREDICTED: uncharacterized protein At1g04910       140   3e-35   Amborella trichopoda
emb|CDY39592.1|  BnaC05g11210D                                          137   2e-34   Brassica napus [oilseed rape]
ref|XP_009148881.1|  PREDICTED: uncharacterized protein At1g04910       135   2e-33   Brassica rapa
ref|XP_002458744.1|  hypothetical protein SORBIDRAFT_03g039450          134   3e-33   Sorghum bicolor [broomcorn]
emb|CDY36519.1|  BnaA06g09720D                                          134   3e-33   Brassica napus [oilseed rape]
ref|XP_008656363.1|  PREDICTED: uncharacterized protein At1g04910...    131   2e-32   
ref|XP_008656364.1|  PREDICTED: uncharacterized protein At1g04910...    130   3e-32   
ref|XP_008656362.1|  PREDICTED: uncharacterized protein At1g04910...    131   4e-32   Zea mays [maize]
gb|AFW82218.1|  hypothetical protein ZEAMMB73_014086                    131   4e-32   
ref|XP_008674838.1|  PREDICTED: uncharacterized protein At1g04910...    130   5e-32   
ref|XP_008674839.1|  PREDICTED: uncharacterized protein At1g04910...    130   5e-32   Zea mays [maize]
ref|XP_008649713.1|  PREDICTED: uncharacterized protein At1g04910...    129   2e-31   Zea mays [maize]
gb|AFW78262.1|  hypothetical protein ZEAMMB73_416738                    129   3e-31   
ref|XP_008649712.1|  PREDICTED: uncharacterized protein At1g04910...    129   3e-31   Zea mays [maize]
ref|XP_008649711.1|  PREDICTED: uncharacterized protein At1g04910...    129   3e-31   Zea mays [maize]
dbj|BAJ88036.1|  predicted protein                                      123   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003589652.1|  hypothetical protein MTR_1g031590                  123   3e-29   
ref|XP_004963730.1|  PREDICTED: uncharacterized protein At1g04910...    119   6e-28   
gb|AAF31019.1|AC012189_1  Contains similarity to atypical PKC spe...    112   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004970534.1|  PREDICTED: uncharacterized protein At1g04910...    117   3e-27   
ref|XP_003564587.1|  PREDICTED: uncharacterized protein At1g04910...    117   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_003568305.1|  PREDICTED: uncharacterized protein At1g04910...    112   2e-25   Brachypodium distachyon [annual false brome]
gb|AAF79229.1|AC006917_14  F10B6.36                                     106   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004499554.1|  PREDICTED: uncharacterized protein At1g04910...    102   6e-22   Cicer arietinum [garbanzo]
ref|XP_009379526.1|  PREDICTED: uncharacterized protein At1g04910...    101   7e-22   Pyrus x bretschneideri [bai li]
ref|XP_004499553.1|  PREDICTED: uncharacterized protein At1g04910...    102   7e-22   Cicer arietinum [garbanzo]
ref|XP_006582446.1|  PREDICTED: uncharacterized protein At1g04910...    102   9e-22   Glycine max [soybeans]
ref|XP_003526401.1|  PREDICTED: uncharacterized protein At1g04910...    102   1e-21   Glycine max [soybeans]
ref|XP_011622189.1|  PREDICTED: uncharacterized protein At1g04910       101   2e-21   Amborella trichopoda
ref|XP_009379518.1|  PREDICTED: uncharacterized protein At1g04910...    101   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_007148603.1|  hypothetical protein PHAVU_005G000400g             101   3e-21   Phaseolus vulgaris [French bean]
ref|XP_012075789.1|  PREDICTED: uncharacterized protein At1g04910     99.8    9e-21   Jatropha curcas
ref|XP_011096470.1|  PREDICTED: uncharacterized protein At1g04910     99.8    1e-20   Sesamum indicum [beniseed]
ref|XP_006579000.1|  PREDICTED: uncharacterized protein At1g04910...  99.0    1e-20   
gb|KHN47089.1|  DUF246 domain-containing protein                      99.0    1e-20   Glycine soja [wild soybean]
ref|XP_006578999.1|  PREDICTED: uncharacterized protein At1g04910...  99.0    1e-20   Glycine max [soybeans]
ref|XP_010104480.1|  hypothetical protein L484_025449                 96.7    2e-20   
gb|KJB28878.1|  hypothetical protein B456_005G074200                  97.8    2e-20   Gossypium raimondii
ref|XP_007222464.1|  hypothetical protein PRUPE_ppa003505mg           98.6    3e-20   
ref|XP_007020035.1|  O-fucosyltransferase family protein isoform 1    98.6    3e-20   
gb|KJB28877.1|  hypothetical protein B456_005G074200                  97.8    4e-20   Gossypium raimondii
ref|XP_002439920.1|  hypothetical protein SORBIDRAFT_09g022540        93.6    4e-20   
ref|XP_009362462.1|  PREDICTED: uncharacterized protein At1g04910...  96.7    1e-19   Pyrus x bretschneideri [bai li]
gb|EMT14891.1|  hypothetical protein F775_28466                       95.1    1e-19   
ref|XP_007020036.1|  O-fucosyltransferase family protein isoform 2    95.5    2e-19   Theobroma cacao [chocolate]
ref|XP_008459666.1|  PREDICTED: uncharacterized protein At1g04910     95.1    4e-19   Cucumis melo [Oriental melon]
ref|XP_008352830.1|  PREDICTED: uncharacterized protein YGR130C-like  95.1    4e-19   
ref|XP_004299893.1|  PREDICTED: uncharacterized protein At1g04910     94.7    4e-19   Fragaria vesca subsp. vesca
gb|EMS48050.1|  hypothetical protein TRIUR3_23455                     93.2    5e-19   Triticum urartu
ref|XP_008339228.1|  PREDICTED: uncharacterized protein At1g04910...  92.8    6e-19   
gb|EYU22809.1|  hypothetical protein MIMGU_mgv1a003510mg              93.6    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_008368398.1|  PREDICTED: uncharacterized protein At1g04910...  92.8    2e-18   
gb|ERN02976.1|  hypothetical protein AMTR_s00134p00089540             86.3    8e-18   Amborella trichopoda
ref|XP_004141562.1|  PREDICTED: uncharacterized protein At1g04910     91.3    8e-18   Cucumis sativus [cucumbers]
ref|XP_002325978.2|  hypothetical protein POPTR_0019s11020g           90.9    1e-17   
ref|XP_010246042.1|  PREDICTED: uncharacterized protein At1g04910...  90.1    1e-17   Nelumbo nucifera [Indian lotus]
emb|CDY03127.1|  BnaC06g08460D                                        90.5    2e-17   
emb|CDY66921.1|  BnaAnng23210D                                        90.5    2e-17   Brassica napus [oilseed rape]
ref|XP_010246041.1|  PREDICTED: uncharacterized protein At1g04910...  90.1    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010246040.1|  PREDICTED: uncharacterized protein At1g04910...  90.1    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_009781764.1|  PREDICTED: uncharacterized protein At1g04910     90.1    2e-17   Nicotiana sylvestris
ref|XP_010538926.1|  PREDICTED: uncharacterized protein At1g04910...  90.1    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_009114709.1|  PREDICTED: uncharacterized protein At1g04910     89.7    3e-17   Brassica rapa
ref|XP_009594772.1|  PREDICTED: uncharacterized protein At1g04910     89.7    3e-17   Nicotiana tomentosiformis
ref|XP_002984324.1|  hypothetical protein SELMODRAFT_268854           89.4    3e-17   
ref|XP_002533585.1|  conserved hypothetical protein                   89.4    4e-17   Ricinus communis
ref|XP_011003993.1|  PREDICTED: uncharacterized protein At1g04910     89.0    6e-17   Populus euphratica
gb|EEC79353.1|  hypothetical protein OsI_20224                        88.6    7e-17   Oryza sativa Indica Group [Indian rice]
ref|NP_001055751.1|  Os05g0459600                                     87.8    1e-16   
gb|KFK27807.1|  hypothetical protein AALP_AA8G431600                  87.4    2e-16   Arabis alpina [alpine rockcress]
gb|AAK93632.1|  putative growth regulator protein                     87.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564461.1|  O-fucosyltransferase-like protein                   87.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008347877.1|  PREDICTED: DDB1- and CUL4-associated factor ...  84.7    2e-16   
gb|AAF79365.1|AC007887_24  F15O4.45                                   87.0    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397450.1|  hypothetical protein EUTSA_v10001813mg           86.7    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_002272758.2|  PREDICTED: uncharacterized protein At1g04910     86.3    5e-16   Vitis vinifera
ref|XP_003598018.1|  DUF246 domain-containing protein                 85.9    6e-16   
ref|XP_002891187.1|  hypothetical protein ARALYDRAFT_473680           85.5    7e-16   
ref|XP_010061980.1|  PREDICTED: uncharacterized protein At1g04910...  84.0    2e-15   
ref|XP_006473172.1|  PREDICTED: uncharacterized protein At1g04910...  83.6    2e-15   
gb|EPS61677.1|  hypothetical protein M569_13117                       83.2    2e-15   Genlisea aurea
gb|KDO83868.1|  hypothetical protein CISIN_1g008308mg                 83.2    3e-15   Citrus sinensis [apfelsine]
ref|XP_010543593.1|  PREDICTED: uncharacterized protein At1g04910...  84.0    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_010543575.1|  PREDICTED: uncharacterized protein At1g04910...  84.0    3e-15   
gb|KCW69027.1|  hypothetical protein EUGRSUZ_F02582                   83.6    3e-15   Eucalyptus grandis [rose gum]
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...  83.6    4e-15   Eucalyptus grandis [rose gum]
gb|KDO83867.1|  hypothetical protein CISIN_1g008308mg                 83.2    4e-15   Citrus sinensis [apfelsine]
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...  83.2    4e-15   
ref|XP_002972493.1|  hypothetical protein SELMODRAFT_441812           84.0    4e-15   
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg           83.2    5e-15   
ref|XP_004237568.1|  PREDICTED: uncharacterized protein At1g04910...  82.8    5e-15   Solanum lycopersicum
ref|XP_006387763.1|  hypothetical protein POPTR_0603s002101g          79.0    6e-15   
ref|XP_010319880.1|  PREDICTED: uncharacterized protein At1g04910...  82.8    6e-15   Solanum lycopersicum
ref|XP_006434581.1|  hypothetical protein CICLE_v10000533mg           82.8    7e-15   
ref|XP_010680244.1|  PREDICTED: uncharacterized protein At1g04910...  82.8    7e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010680324.1|  PREDICTED: uncharacterized protein At1g04910...  82.4    8e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006349651.1|  PREDICTED: uncharacterized protein At1g04910...  82.0    1e-14   Solanum tuberosum [potatoes]
ref|XP_010500036.1|  PREDICTED: uncharacterized protein At1g04910...  82.0    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010461317.1|  PREDICTED: uncharacterized protein At1g04910...  81.6    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008781543.1|  PREDICTED: uncharacterized protein At1g04910...  80.9    2e-14   
emb|CDP10650.1|  unnamed protein product                              81.6    2e-14   Coffea canephora [robusta coffee]
ref|XP_008781542.1|  PREDICTED: uncharacterized protein At1g04910...  80.9    2e-14   
ref|XP_001760728.1|  predicted protein                                80.1    5e-14   
ref|XP_010478945.1|  PREDICTED: uncharacterized protein At1g04910...  76.6    7e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006304663.1|  hypothetical protein CARUB_v10011867mg           74.7    4e-12   Capsella rubella
ref|XP_010930789.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  72.8    2e-11   
ref|XP_010930931.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   Elaeis guineensis
emb|CAN77312.1|  hypothetical protein VITISV_026198                   68.9    8e-11   Vitis vinifera
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    9e-11   Elaeis guineensis
ref|XP_006847061.1|  PREDICTED: uncharacterized protein At1g04910     68.9    2e-10   Amborella trichopoda
ref|XP_008784225.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   Phoenix dactylifera
gb|KHN08072.1|  DUF246 domain-containing protein                      68.6    3e-10   Glycine soja [wild soybean]
ref|XP_004513833.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    7e-10   
ref|XP_010664246.1|  PREDICTED: uncharacterized protein At1g04910...  66.2    2e-09   Vitis vinifera
ref|XP_002284399.1|  PREDICTED: uncharacterized protein At1g04910...  66.2    2e-09   Vitis vinifera
emb|CBI19065.3|  unnamed protein product                              66.2    2e-09   Vitis vinifera
gb|EMS66777.1|  hypothetical protein TRIUR3_19446                     65.1    3e-09   Triticum urartu
ref|XP_003614789.1|  Growth regulator-related protein                 64.7    6e-09   Medicago truncatula
gb|EEC71770.1|  hypothetical protein OsI_04380                        63.2    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_006596302.1|  PREDICTED: uncharacterized protein At1g04910...  63.5    2e-08   Glycine max [soybeans]
gb|KJB28879.1|  hypothetical protein B456_005G074200                  63.2    2e-08   Gossypium raimondii
ref|XP_007141089.1|  hypothetical protein PHAVU_008G166600g           62.8    3e-08   Phaseolus vulgaris [French bean]
gb|EEE55649.1|  hypothetical protein OsJ_04031                        62.0    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010091349.1|  hypothetical protein L484_020151                 62.4    5e-08   
ref|XP_009379852.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    5e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002513766.1|  conserved hypothetical protein                   61.6    6e-08   Ricinus communis
gb|EEE63981.1|  hypothetical protein OsJ_18808                        61.2    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008219032.1|  PREDICTED: uncharacterized protein At1g04910     60.5    1e-07   Prunus mume [ume]
ref|XP_010272863.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_004142690.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    5e-07   Cucumis sativus [cucumbers]
ref|XP_006396012.1|  hypothetical protein EUTSA_v10003892mg           57.4    1e-06   
ref|XP_006396013.1|  hypothetical protein EUTSA_v10003892mg           57.4    1e-06   Eutrema salsugineum [saltwater cress]
ref|XP_010461373.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_012078175.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    2e-06   Jatropha curcas
ref|XP_012078174.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    2e-06   
ref|XP_010478971.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_008444126.1|  PREDICTED: uncharacterized protein At1g04910...  57.0    2e-06   Cucumis melo [Oriental melon]
ref|XP_010461371.1|  PREDICTED: uncharacterized protein At1g04910...  56.6    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_011097784.1|  PREDICTED: uncharacterized protein At1g04910...  56.2    3e-06   Sesamum indicum [beniseed]
ref|NP_683362.1|  O-fucosyltransferase-like protein                   56.2    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478972.1|  PREDICTED: uncharacterized protein At1g04910...  55.8    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_001753325.1|  predicted protein                                55.8    5e-06   
ref|XP_002893927.1|  hypothetical protein ARALYDRAFT_473732           55.5    6e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_009145111.1|  PREDICTED: uncharacterized protein At1g04910     55.5    7e-06   Brassica rapa
ref|XP_010500091.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010461370.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006306299.1|  hypothetical protein CARUB_v10012165mg           54.7    1e-05   Capsella rubella
emb|CDP12443.1|  unnamed protein product                              54.7    1e-05   Coffea canephora [robusta coffee]
ref|XP_010478969.1|  PREDICTED: uncharacterized protein At1g04910...  54.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010530190.1|  PREDICTED: uncharacterized protein At1g04910...  53.9    2e-05   Tarenaya hassleriana [spider flower]
gb|KFK32890.1|  hypothetical protein AALP_AA6G300900                  53.9    2e-05   Arabis alpina [alpine rockcress]
ref|XP_010500090.1|  PREDICTED: uncharacterized protein At1g04910...  52.4    7e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006351921.1|  PREDICTED: uncharacterized protein LOC102600500  50.8    7e-05   
emb|CDX73383.1|  BnaC05g27230D                                        52.4    8e-05   
ref|XP_004292679.1|  PREDICTED: uncharacterized protein At1g04910     52.0    9e-05   Fragaria vesca subsp. vesca
gb|KHG28222.1|  hypothetical protein F383_11890                       51.6    1e-04   Gossypium arboreum [tree cotton]
ref|XP_009341670.1|  PREDICTED: uncharacterized protein At1g04910...  51.6    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_009367298.1|  PREDICTED: uncharacterized protein At1g04910...  51.6    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_006644988.1|  PREDICTED: uncharacterized protein At1g04910...  50.4    2e-04   
gb|KCW70566.1|  hypothetical protein EUGRSUZ_F03754                   49.7    5e-04   Eucalyptus grandis [rose gum]
ref|XP_008365206.1|  PREDICTED: uncharacterized protein At1g04910...  49.7    5e-04   
gb|KCW70567.1|  hypothetical protein EUGRSUZ_F03754                   49.7    5e-04   Eucalyptus grandis [rose gum]
ref|XP_010063352.1|  PREDICTED: uncharacterized protein At1g04910...  49.7    5e-04   Eucalyptus grandis [rose gum]
ref|XP_008338786.1|  PREDICTED: uncharacterized protein At1g04910     49.7    6e-04   
ref|XP_010274355.1|  PREDICTED: uncharacterized protein At1g04910...  49.7    6e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009390064.1|  PREDICTED: uncharacterized protein At1g04910...  49.3    6e-04   
ref|XP_009390063.1|  PREDICTED: uncharacterized protein At1g04910...  49.3    7e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009366982.1|  PREDICTED: uncharacterized protein At1g04910...  48.9    0.001   Pyrus x bretschneideri [bai li]



>emb|CDP00784.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FTPGQP P+T AQR AW++LS+LLRRQGIFLFAPLLYISGMLFYMGTVSFD VPII HR 
Sbjct  35   FTPGQPGPKTAAQRIAWLILSLLLRRQGIFLFAPLLYISGMLFYMGTVSFDVVPIINHRR  94

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY KL+PEMDSDNSSADAIS+IWKHSYK  EWRPC N SSGGLPE
Sbjct  95   APGSVYRSPQLYAKLKPEMDSDNSSADAISSIWKHSYKVGEWRPCINVSSGGLPE  149



>ref|XP_009615526.1| PREDICTED: uncharacterized protein LOC104108246 [Nicotiana tomentosiformis]
Length=246

 Score =   199 bits (505),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FTPGQP PRTLA R AW++LSVLLRRQGIFLFAPLLYI+GMLFYMGTVSFD VP I+H  
Sbjct  48   FTPGQPGPRTLAHRLAWVILSVLLRRQGIFLFAPLLYIAGMLFYMGTVSFDVVPNIRHHP  107

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGG  568
             PGS+YRSPQLY KL+PEMDSDNS+A AISTIWK+SY+G EWRPC NKSSGG
Sbjct  108  APGSLYRSPQLYAKLRPEMDSDNSTAHAISTIWKNSYRGGEWRPCINKSSGG  159



>gb|EYU30069.1| hypothetical protein MIMGU_mgv1a003875mg [Erythranthe guttata]
Length=558

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  421
            G+P P+TLAQR AWI+LSVLL+RQGIFLFAPLLYI+GMLFYMGTVSFD VP+IKHR  PG
Sbjct  37   GRPPPKTLAQRLAWIVLSVLLKRQGIFLFAPLLYIAGMLFYMGTVSFDVVPVIKHRPAPG  96

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+YRSPQLY KL+PEMDSDNSSADAISTIWK+SYKG EWRPC  K+S GLPE
Sbjct  97   SVYRSPQLYAKLRPEMDSDNSSADAISTIWKNSYKGGEWRPCIKKASEGLPE  148



>ref|XP_009785420.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nicotiana 
sylvestris]
Length=468

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT GQP  RTLA R AW +LSVLLRRQGIFLFAPLLYI+GMLFYMGTVSFD VP I+H  
Sbjct  48   FTSGQPGQRTLAHRLAWFILSVLLRRQGIFLFAPLLYIAGMLFYMGTVSFDVVPNIRHHP  107

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY KL PEMDSDNS+A AISTIWK+SY+G EWRPC NKSSGGLPE
Sbjct  108  APGSLYRSPQLYAKLLPEMDSDNSTAHAISTIWKNSYRGGEWRPCINKSSGGLPE  162



>ref|XP_009785418.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009785419.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT GQP  RTLA R AW +LSVLLRRQGIFLFAPLLYI+GMLFYMGTVSFD VP I+H  
Sbjct  48   FTSGQPGQRTLAHRLAWFILSVLLRRQGIFLFAPLLYIAGMLFYMGTVSFDVVPNIRHHP  107

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY KL PEMDSDNS+A AISTIWK+SY+G EWRPC NKSSGGLPE
Sbjct  108  APGSLYRSPQLYAKLLPEMDSDNSTAHAISTIWKNSYRGGEWRPCINKSSGGLPE  162



>ref|XP_002284457.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI26895.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F  GQ   RT AQR AW++LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR 
Sbjct  35   FAAGQQPGRTFAQRLAWLILSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHRP  94

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y KL+PEMDSDNS++D IST+WKHSYK  EW+PC N+SSGGLPE
Sbjct  95   APGSVYRSPQVYAKLRPEMDSDNSTSDTISTVWKHSYKSGEWQPCVNRSSGGLPE  149



>emb|CAN77011.1| hypothetical protein VITISV_036881 [Vitis vinifera]
Length=575

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F  GQ   RT AQR AW++LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR 
Sbjct  35   FAAGQQPGRTFAQRLAWLILSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHRP  94

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y KL+PEMDSDNS++D IST+WKHSYK  EW+PC N+SSGGLPE
Sbjct  95   APGSVYRSPQVYAKLRPEMDSDNSTSDTISTVWKHSYKSGEWQPCVNRSSGGLPE  149



>ref|XP_010066619.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW64583.1| hypothetical protein EUGRSUZ_G02181 [Eucalyptus grandis]
Length=564

 Score =   191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 100/117 (85%), Gaps = 2/117 (2%)
 Frame = +2

Query  233  FTPG--QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKH  406
            FTP   Q   RTLAQR AW+LLS LLRRQG+FLFAPL+YISGML YMGTV FD VP+IKH
Sbjct  36   FTPAAAQQPGRTLAQRVAWLLLSCLLRRQGVFLFAPLIYISGMLLYMGTVKFDVVPVIKH  95

Query  407  RATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            R  PGS+YRSPQLY KL+P+MD+DNSSADAI TIWKHSYKG EW+PC N+S+GGLPE
Sbjct  96   RPAPGSVYRSPQLYAKLRPDMDADNSSADAILTIWKHSYKGGEWKPCINQSTGGLPE  152



>ref|XP_008389213.1| PREDICTED: uncharacterized protein LOC103451575 [Malus domestica]
Length=217

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  421
             QP  RTL QR  W LLSVL+RRQG FLFAPLLYI+GML YMG+VSF+ VP+I HR  PG
Sbjct  39   NQPG-RTLIQRIVWHLLSVLIRRQGFFLFAPLLYIAGMLLYMGSVSFEVVPVISHRLAPG  97

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+YRSPQLY KL+PEMD+DNSSADAIST+WKHSYK  EWRPC NKSSGGL E
Sbjct  98   SVYRSPQLYAKLRPEMDADNSSADAISTVWKHSYKSGEWRPCVNKSSGGLAE  149



>ref|XP_012072229.1| PREDICTED: uncharacterized protein At1g04910 [Jatropha curcas]
 gb|KDP38063.1| hypothetical protein JCGZ_04706 [Jatropha curcas]
Length=561

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = +2

Query  233  FTPG-QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  409
            FTP   P  RT+A R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKH+
Sbjct  36   FTPASHPPGRTVAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHK  95

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              PGS+YRSPQLY KL+PEMD+DNSSADA+STIWK+SYKG EWR C NKSSG LPE
Sbjct  96   PAPGSVYRSPQLYQKLRPEMDADNSSADALSTIWKNSYKGGEWRSCVNKSSGELPE  151



>ref|XP_004238827.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
 ref|XP_010320701.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=581

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT GQ  PRTLA R +  +LSVL+RRQGIFLFAPLLYI+G+LFYMGTV FD VPII+HR 
Sbjct  55   FTSGQQLPRTLANRISGAILSVLVRRQGIFLFAPLLYIAGILFYMGTVPFDVVPIIRHRP  114

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY KL+PEMDSDNS+ADAISTIWK+SY+G EWRPC NKSSG +PE
Sbjct  115  APGSVYRSPQLYDKLRPEMDSDNSTADAISTIWKNSYRGGEWRPCINKSSGEIPE  169



>ref|XP_006355101.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=472

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT GQ  PRTLA R    +LSVL+RRQGIFLFAPLLYI+G+LFYMGTV FD VPII+HR 
Sbjct  52   FTSGQQPPRTLANRITGAILSVLVRRQGIFLFAPLLYIAGILFYMGTVPFDVVPIIRHRP  111

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY KL+PEM+SDNS+ADAISTIWK+SY+G EWRPC NKSSG +PE
Sbjct  112  APGSVYRSPQLYDKLRPEMNSDNSTADAISTIWKNSYRGGEWRPCINKSSGEIPE  166



>ref|XP_011655460.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis sativus]
 gb|KGN51494.1| hypothetical protein Csa_5G570390 [Cucumis sativus]
Length=563

 Score =   188 bits (477),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT  Q   RT  QR AW++LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR 
Sbjct  37   FTQAQQPGRTFPQRLAWLILSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHRP  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQL  KL+ EMDSDN+S DAISTIWKHSYKG +W+PC N SSGGLPE
Sbjct  97   APGSVYRSPQLLAKLRHEMDSDNTSTDAISTIWKHSYKGGQWKPCINNSSGGLPE  151



>ref|XP_008467134.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=563

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT  Q   RT  QR AW++LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR 
Sbjct  37   FTQAQQPGRTFPQRLAWLILSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHRP  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQL  KL+ EMDSDN+S DAISTIWKHSYKG +W+PC N SSGGLPE
Sbjct  97   APGSVYRSPQLLAKLRHEMDSDNTSTDAISTIWKHSYKGGQWKPCINNSSGGLPE  151



>gb|KDO64644.1| hypothetical protein CISIN_1g008637mg [Citrus sinensis]
Length=360

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  233  FTP-GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  409
            FTP G P    LA R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR
Sbjct  37   FTPVGPPGRANLAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHR  96

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              PGS+YRSPQ+Y KL+PEMD+DNSS+DAISTIWK S+KG EW+PC  +SSG LPE
Sbjct  97   PAPGSVYRSPQVYAKLKPEMDADNSSSDAISTIWKASHKGVEWKPCVKRSSGELPE  152



>ref|XP_006355100.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=578

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT GQ  PRTLA R    +LSVL+RRQGIFLFAPLLYI+G+LFYMGTV FD VPII+HR 
Sbjct  52   FTSGQQPPRTLANRITGAILSVLVRRQGIFLFAPLLYIAGILFYMGTVPFDVVPIIRHRP  111

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY KL+PEM+SDNS+ADAISTIWK+SY+G EWRPC NKSSG +PE
Sbjct  112  APGSVYRSPQLYDKLRPEMNSDNSTADAISTIWKNSYRGGEWRPCINKSSGEIPE  166



>ref|XP_008243446.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=540

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  421
             QP  RTL QR  W LLSVL+RRQG FLFAPLLYISGML YMG+VSF+ VP+I HR  PG
Sbjct  39   NQPG-RTLIQRIVWHLLSVLIRRQGFFLFAPLLYISGMLLYMGSVSFEVVPVISHRPAPG  97

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+YRSPQLY KL+PEMD+DNSSADAIST+WKHSYKG EWRPC NKSSGGL E
Sbjct  98   SVYRSPQLYAKLRPEMDADNSSADAISTVWKHSYKGAEWRPCVNKSSGGLAE  149



>ref|XP_010262908.1| PREDICTED: uncharacterized protein At1g04910-like isoform X5 
[Nelumbo nucifera]
Length=510

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT G   PRTLAQR AW LLS L RRQG+FLFAPL+YI+GML YMGT SFD VP IKHR 
Sbjct  38   FTAGH-QPRTLAQRLAWTLLSFLHRRQGVFLFAPLIYIAGMLLYMGTASFDVVPHIKHRL  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y KL+PEMDSDNSSAD ++T+W+H YKG EWRPC N++SGGLPE
Sbjct  97   APGSVYRSPQVYEKLRPEMDSDNSSADGLATVWRHPYKGGEWRPCINRTSGGLPE  151



>gb|EPS64269.1| hypothetical protein M569_10511, partial [Genlisea aurea]
Length=390

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            +  P+TL QR + I+LSVLLRRQGIFLFAPLLYI+GMLFYMGTVSFD VP+IKHR  PGS
Sbjct  37   RSTPKTLRQRLSGIVLSVLLRRQGIFLFAPLLYIAGMLFYMGTVSFDVVPVIKHRKPPGS  96

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            IYRSPQLY KL+PEMDSDNSS DAI TIWK+SYKG EW+PC +KS  GLPE
Sbjct  97   IYRSPQLYSKLRPEMDSDNSSCDAILTIWKNSYKGGEWKPCISKSHQGLPE  147



>ref|XP_010262779.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Nelumbo nucifera]
Length=542

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT G   PRTLAQR AW LLS L RRQG+FLFAPL+YI+GML YMGT SFD VP IKHR 
Sbjct  38   FTAGH-QPRTLAQRLAWTLLSFLHRRQGVFLFAPLIYIAGMLLYMGTASFDVVPHIKHRL  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y KL+PEMDSDNSSAD ++T+W+H YKG EWRPC N++SGGLPE
Sbjct  97   APGSVYRSPQVYEKLRPEMDSDNSSADGLATVWRHPYKGGEWRPCINRTSGGLPE  151



>ref|XP_007225729.1| hypothetical protein PRUPE_ppa003622mg [Prunus persica]
 gb|EMJ26928.1| hypothetical protein PRUPE_ppa003622mg [Prunus persica]
Length=561

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  421
             QP  RTL QR  W LLSVL+RRQG FLFAPLLYISGML YMG+VSF+ VP+I HR  PG
Sbjct  39   NQPG-RTLIQRIVWHLLSVLIRRQGFFLFAPLLYISGMLLYMGSVSFEVVPVISHRPAPG  97

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+YRSPQLY KL+PEMD+DNSSADAIST+WKHSYKG EWRPC NKSSGGL E
Sbjct  98   SVYRSPQLYAKLRPEMDADNSSADAISTVWKHSYKGAEWRPCVNKSSGGLAE  149



>ref|XP_010262851.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Nelumbo nucifera]
Length=539

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT G   PRTLAQR AW LLS L RRQG+FLFAPL+YI+GML YMGT SFD VP IKHR 
Sbjct  38   FTAGH-QPRTLAQRLAWTLLSFLHRRQGVFLFAPLIYIAGMLLYMGTASFDVVPHIKHRL  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y KL+PEMDSDNSSAD ++T+W+H YKG EWRPC N++SGGLPE
Sbjct  97   APGSVYRSPQVYEKLRPEMDSDNSSADGLATVWRHPYKGGEWRPCINRTSGGLPE  151



>ref|XP_010262622.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=563

 Score =   186 bits (471),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT G   PRTLAQR AW LLS L RRQG+FLFAPL+YI+GML YMGT SFD VP IKHR 
Sbjct  38   FTAGH-QPRTLAQRLAWTLLSFLHRRQGVFLFAPLIYIAGMLLYMGTASFDVVPHIKHRL  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y KL+PEMDSDNSSAD ++T+W+H YKG EWRPC N++SGGLPE
Sbjct  97   APGSVYRSPQVYEKLRPEMDSDNSSADGLATVWRHPYKGGEWRPCINRTSGGLPE  151



>ref|XP_010262705.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=551

 Score =   185 bits (470),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            FT G   PRTLAQR AW LLS L RRQG+FLFAPL+YI+GML YMGT SFD VP IKHR 
Sbjct  38   FTAGH-QPRTLAQRLAWTLLSFLHRRQGVFLFAPLIYIAGMLLYMGTASFDVVPHIKHRL  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y KL+PEMDSDNSSAD ++T+W+H YKG EWRPC N++SGGLPE
Sbjct  97   APGSVYRSPQVYEKLRPEMDSDNSSADGLATVWRHPYKGGEWRPCINRTSGGLPE  151



>gb|KDO64643.1| hypothetical protein CISIN_1g008637mg [Citrus sinensis]
Length=448

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  233  FTP-GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  409
            FTP G P    LA R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR
Sbjct  37   FTPVGPPGRANLAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHR  96

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              PGS+YRSPQ+Y KL+PEMD+DNSS+DAISTIWK S+KG EW+PC  +SSG LPE
Sbjct  97   PAPGSVYRSPQVYAKLKPEMDADNSSSDAISTIWKASHKGVEWKPCVKRSSGELPE  152



>gb|KDO64642.1| hypothetical protein CISIN_1g008637mg [Citrus sinensis]
Length=558

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  233  FTP-GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  409
            FTP G P    LA R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR
Sbjct  37   FTPVGPPGRANLAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHR  96

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              PGS+YRSPQ+Y KL+PEMD+DNSS+DAISTIWK S+KG EW+PC  +SSG LPE
Sbjct  97   PAPGSVYRSPQVYAKLKPEMDADNSSSDAISTIWKASHKGVEWKPCVKRSSGELPE  152



>ref|XP_006448248.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
 gb|ESR61488.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
Length=558

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  233  FTP-GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  409
            FTP G P    LA R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR
Sbjct  37   FTPVGPPGRANLAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHR  96

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              PGS+YRSPQ+Y KL+PEMD+DNSS+DAISTIWK S+KG EW+PC  +SSG LPE
Sbjct  97   PAPGSVYRSPQVYAKLKPEMDADNSSSDAISTIWKASHKGVEWKPCVKRSSGELPE  152



>ref|XP_006469184.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=558

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  233  FTP-GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  409
            FTP G P    LA R AW+ LSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR
Sbjct  37   FTPVGPPGRANLAHRLAWLFLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHR  96

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              PGS+YRSPQ+Y KL+PEMD+DNSS+DAISTIWK S+KG EW+PC  +SSG LPE
Sbjct  97   PAPGSVYRSPQVYAKLKPEMDADNSSSDAISTIWKASHKGVEWKPCVKRSSGELPE  152



>ref|XP_011023536.1| PREDICTED: uncharacterized protein At1g04910-like [Populus euphratica]
Length=569

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +2

Query  233  FTPGQ-PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  409
            FTP   P  R LA R AW LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD  PII H+
Sbjct  42   FTPSSYPPGRNLAHRLAWFLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVGPIIDHK  101

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              PGS+YRSPQ+Y KL+PEMD+DNSSADA+ST+WK+SYK  EWRPC NKSS GLPE
Sbjct  102  PAPGSVYRSPQIYEKLRPEMDADNSSADALSTVWKNSYKSGEWRPCINKSSEGLPE  157



>ref|XP_002311505.2| hypothetical protein POPTR_0008s12960g [Populus trichocarpa]
 gb|EEE88872.2| hypothetical protein POPTR_0008s12960g [Populus trichocarpa]
Length=569

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +2

Query  233  FTPGQ-PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  409
            FTP   P  R LA R AW LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD  PII H+
Sbjct  42   FTPSSYPPGRNLAHRLAWFLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVGPIIDHK  101

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              PGS+YRSPQ+Y KL+PEMD+DNSSADA+ST+WK+SYK  EWRPC NKSS GLPE
Sbjct  102  PAPGSVYRSPQIYEKLRPEMDADNSSADALSTVWKNSYKSGEWRPCINKSSEGLPE  157



>ref|XP_004505284.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=560

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            ++LAQR +W+LLSVLLRRQGIFLFAPL+YISGML YMGT SFD VPIIKHR  PGSIYRS
Sbjct  42   KSLAQRLSWMLLSVLLRRQGIFLFAPLIYISGMLLYMGTASFDVVPIIKHRPAPGSIYRS  101

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PQLY  LQ +MDSDNSSADAISTIWK  Y+G EW+PC N+SS GLPE
Sbjct  102  PQLYANLQHDMDSDNSSADAISTIWKSPYRGGEWKPCVNRSSEGLPE  148



>ref|XP_009339689.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=561

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  421
             QP  RTL QR  W LLSVL+RRQG FLFAPLLYI+GML YMG+VSF+ VP+I HR  PG
Sbjct  39   NQPG-RTLIQRIVWHLLSVLIRRQGFFLFAPLLYIAGMLLYMGSVSFEVVPVISHRLAPG  97

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+YRSPQLY KL+PEMD+DNSSADAIST+WKHSYK  EWRPC NKSSGGL +
Sbjct  98   SVYRSPQLYAKLRPEMDADNSSADAISTVWKHSYKSGEWRPCVNKSSGGLAD  149



>ref|XP_007157752.1| hypothetical protein PHAVU_002G095600g [Phaseolus vulgaris]
 gb|ESW29746.1| hypothetical protein PHAVU_002G095600g [Phaseolus vulgaris]
Length=563

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F+P + + RT AQR +W+ LSVLLRRQG+FLFAPL+YISGML YMGT SFD VP+IKHR 
Sbjct  37   FSPNRGSGRTAAQRLSWMFLSVLLRRQGVFLFAPLIYISGMLLYMGTASFDVVPVIKHRP  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY K+  EMDSDNSSADAISTIWK  YKG EW PC N+S  GLPE
Sbjct  97   APGSVYRSPQLYAKVHLEMDSDNSSADAISTIWKTPYKGGEWNPCLNRSCEGLPE  151



>ref|XP_003556095.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 ref|XP_006605495.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=564

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F+P + + RT AQ+ +W+ LSVLLRRQG+FLFAPL+YISGML YMGT SFD VP+IKHR 
Sbjct  38   FSPSRGSGRTAAQQLSWMFLSVLLRRQGVFLFAPLIYISGMLLYMGTASFDVVPVIKHRP  97

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQL+ KL+ +MDSDNSSADAISTIWK+ Y+G EW+PC N+SS GLPE
Sbjct  98   APGSVYRSPQLFAKLRLDMDSDNSSADAISTIWKYPYRGGEWKPCVNRSSEGLPE  152



>gb|KFK33363.1| hypothetical protein AALP_AA5G004000 [Arabis alpina]
Length=565

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 98/111 (88%), Gaps = 1/111 (1%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ +A PGS
Sbjct  42   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRKAPPGS  100

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            +Y+SPQ+Y KL+PEMD+DNS+ADAISTIWKHSYKG EW+P  NKSSG LPE
Sbjct  101  VYKSPQVYAKLRPEMDADNSTADAISTIWKHSYKGGEWKPYVNKSSGELPE  151



>ref|XP_010695805.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
             PG PA RT+A R A+++LS+LLRRQGIFLFAPL+YISGMLFYMGTVSFD  P+I H   
Sbjct  47   APGLPASRTMAHRLAYLVLSILLRRQGIFLFAPLIYISGMLFYMGTVSFDVGPVISHYPA  106

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQLY KL+PEMD++NS+ADAISTIWK+SYKG EWRPC N  +GGL +
Sbjct  107  PGSVYRSPQLYSKLRPEMDAENSTADAISTIWKNSYKGGEWRPCINNFTGGLSD  160



>ref|XP_003529417.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=564

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F+P + + RT AQR +W+ LSVLLRRQG+FLFAPL+YISGML YMGT SFD VP+IKHR 
Sbjct  38   FSPSRGSGRTAAQRLSWMFLSVLLRRQGVFLFAPLIYISGMLLYMGTASFDVVPVIKHRP  97

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQL+ KL+ +MDSDNSSADAISTIWK+ Y+G EW+PC N+SS  LPE
Sbjct  98   APGSVYRSPQLFAKLRLDMDSDNSSADAISTIWKYPYRGGEWKPCVNRSSEDLPE  152



>ref|XP_009351481.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=561

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  421
             QP  RTL QR  W LLSVL+RRQG FLFAPLLYISGML YMG+VSF+ VP+I  R  PG
Sbjct  39   NQPG-RTLIQRIVWNLLSVLIRRQGFFLFAPLLYISGMLLYMGSVSFEVVPVISRRLAPG  97

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+YRSPQLY KL+PEMD+DNSSADAIST+WKHSY+  EWRPC NKSSGGL E
Sbjct  98   SVYRSPQLYAKLRPEMDADNSSADAISTVWKHSYRSGEWRPCVNKSSGGLAE  149



>ref|XP_009351480.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=574

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  421
             QP  RTL QR  W LLSVL+RRQG FLFAPLLYISGML YMG+VSF+ VP+I  R  PG
Sbjct  39   NQPG-RTLIQRIVWNLLSVLIRRQGFFLFAPLLYISGMLLYMGSVSFEVVPVISRRLAPG  97

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+YRSPQLY KL+PEMD+DNSSADAIST+WKHSY+  EWRPC NKSSGGL E
Sbjct  98   SVYRSPQLYAKLRPEMDADNSSADAISTVWKHSYRSGEWRPCVNKSSGGLAE  149



>ref|XP_010513871.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=568

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ R  PGS
Sbjct  45   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS  103

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            +Y+SPQ+Y KL+PEMD+DNS+ADAISTIWKHSYKG EW+P  NKS+G LPE
Sbjct  104  VYKSPQVYAKLRPEMDADNSTADAISTIWKHSYKGGEWKPYVNKSTGDLPE  154



>ref|XP_010502128.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
 ref|XP_010424919.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=568

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ R  PGS
Sbjct  45   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS  103

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            +Y+SPQ+Y KL+PEMD+DNS+ADAISTIWKHSYKG EW+P  NKS+G LPE
Sbjct  104  VYKSPQVYAKLRPEMDADNSTADAISTIWKHSYKGGEWKPYVNKSTGDLPE  154



>ref|XP_006290827.1| hypothetical protein CARUB_v10016938mg [Capsella rubella]
 gb|EOA23725.1| hypothetical protein CARUB_v10016938mg [Capsella rubella]
Length=567

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ R  PGS
Sbjct  44   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS  102

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            +Y+SPQ+Y KL+PEMD+DNS+ADAISTIWKHSYKG EW+P  NKS+G LPE
Sbjct  103  VYKSPQVYAKLRPEMDADNSTADAISTIWKHSYKGGEWKPYVNKSTGDLPE  153



>ref|XP_010274715.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=558

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  242  GQPA--PRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
            G+P   PRTLAQR AW LLSV LRRQG+FLFAPL+YI+GML YMGTVSFD VP IK R  
Sbjct  33   GRPGLQPRTLAQRLAWTLLSVFLRRQGVFLFAPLIYIAGMLLYMGTVSFDVVPHIKPRPA  92

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQLY KL+PEMDSDNSSAD + T+W+H Y+G EWRPC NK+ G LPE
Sbjct  93   PGSVYRSPQLYEKLRPEMDSDNSSADGLVTVWRHPYRGGEWRPCINKTLGDLPE  146



>ref|NP_178257.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAC67324.1| similar to axi 1 protein from Nicotiana tabacum [Arabidopsis 
thaliana]
 gb|AAM13108.1| similar to axi 1 protein [Arabidopsis thaliana]
 gb|AAM91218.1| similar to axi 1 protein [Arabidopsis thaliana]
 dbj|BAE99174.1| similar to axi 1 protein from Nicotiana tabacum [Arabidopsis 
thaliana]
 gb|AEC05459.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=567

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ R  PGS
Sbjct  44   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRPPPGS  102

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            +Y+SPQ+Y KL+PEMD+DNS+ADAI+TIWKHSYKG EW+P  NKS+G LPE
Sbjct  103  VYKSPQVYAKLRPEMDADNSTADAITTIWKHSYKGGEWKPYVNKSTGDLPE  153



>ref|XP_002875074.1| hypothetical protein ARALYDRAFT_484066 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51333.1| hypothetical protein ARALYDRAFT_484066 [Arabidopsis lyrata subsp. 
lyrata]
Length=567

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F   QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ R 
Sbjct  40   FPTVQPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRRP  98

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+Y+SPQ+Y KL+PEMD+DNS+ADAI+TIWKHSYKG EW+P  NKS+G LPE
Sbjct  99   PPGSVYKSPQVYAKLRPEMDADNSTADAITTIWKHSYKGGEWKPYVNKSTGDLPE  153



>ref|XP_009101345.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
 emb|CDY17669.1| BnaA06g34880D [Brassica napus]
Length=564

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            RTLA R +W+++SVLLRRQG+FLFAPL+YIS ML YMGTVSFD  PII+HR+ PGS+Y+S
Sbjct  44   RTLAHRLSWLIVSVLLRRQGVFLFAPLIYISCMLIYMGTVSFDVGPIIRHRSPPGSVYKS  103

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PQLY KL+PEMD+DNS+ADAISTIWKHSYKG EW+P  NKS+G LPE
Sbjct  104  PQLYAKLRPEMDADNSTADAISTIWKHSYKGVEWKPYVNKSTGALPE  150



>ref|XP_008339538.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=561

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  421
             QP  RTL QR  W LLSVL+RRQG FLFAPLLYISGML YMG+VSF+ VP+I  R  PG
Sbjct  39   NQPG-RTLIQRIVWNLLSVLIRRQGFFLFAPLLYISGMLLYMGSVSFEVVPVISRRLAPG  97

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+YRSPQLY KL+PEMD+DNSSADAIST+WKHS++  EWRPC NKSSGGL E
Sbjct  98   SVYRSPQLYAKLRPEMDADNSSADAISTVWKHSHRSGEWRPCVNKSSGGLAE  149



>emb|CDY65925.1| BnaC07g48790D [Brassica napus]
Length=564

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            RTLA R +W+++SVLLRRQG+FLFAPL+YIS ML YMGTVSFD  PII+HR+ PGS+Y+S
Sbjct  44   RTLAHRLSWLIVSVLLRRQGVFLFAPLIYISCMLIYMGTVSFDVGPIIRHRSPPGSVYKS  103

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PQLY KL+PEMD+DNS+ADAISTIWKHSYKG EW+P  NKS+G LP+
Sbjct  104  PQLYAKLRPEMDADNSTADAISTIWKHSYKGVEWKPYVNKSTGALPD  150



>gb|KJB50369.1| hypothetical protein B456_008G166900 [Gossypium raimondii]
Length=561

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F+P QP  RT+A   AW+LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP++KHR 
Sbjct  36   FSPFQPG-RTVAHHVAWLLLSVLLRRQGIFLFAPLIYISGMLIYMGTVSFDVVPLVKHRP  94

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y KL+ EM+ D SSADAI TIWK+SYKG EWRPC +K S GLPE
Sbjct  95   APGSVYRSPQVYEKLKIEMNEDYSSADAILTIWKNSYKGGEWRPCVSKPSEGLPE  149



>gb|KHG19963.1| hypothetical protein F383_04918 [Gossypium arboreum]
Length=561

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F+P QP  RT+A   AW+LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP++KHR 
Sbjct  36   FSPFQPG-RTVAHHVAWLLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPLVKHRP  94

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRS Q+Y KL+ EM+ D SSADAI TIWK+SYKG EWRPC NK S GLPE
Sbjct  95   APGSVYRSTQVYEKLKIEMNEDYSSADAILTIWKNSYKGGEWRPCVNKPSEGLPE  149



>ref|XP_009129233.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
 emb|CDY40371.1| BnaA02g26850D [Brassica napus]
Length=568

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            QP+ RTLA R +WI+LS LLRRQG+FLFAPL+YIS ML YMGTVSFD  PII+HR+ PGS
Sbjct  44   QPS-RTLAHRVSWIILSALLRRQGVFLFAPLIYISCMLLYMGTVSFDVGPIIRHRSPPGS  102

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            +Y+SPQLY KL+ +MD+DNSSADAISTIWKHSYKG EW+P  NKS+G LPE
Sbjct  103  VYKSPQLYAKLRHDMDADNSSADAISTIWKHSYKGGEWKPYVNKSTGALPE  153



>gb|KEH30846.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=561

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQ  442
            LAQR +W+LLSVLLRRQGIFLFAPL+YISGML YMGT SFD VPIIKHR  PGS+YRSPQ
Sbjct  45   LAQRLSWMLLSVLLRRQGIFLFAPLIYISGMLLYMGTASFDVVPIIKHRPAPGSLYRSPQ  104

Query  443  LYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            LY  L+ +MDSDNSS DAISTIW+  Y+G EW+PC N+SS GLPE
Sbjct  105  LYSNLKKDMDSDNSSTDAISTIWRSPYRGGEWKPCVNRSSEGLPE  149



>ref|XP_010093364.1| hypothetical protein L484_022926 [Morus notabilis]
 gb|EXB53958.1| hypothetical protein L484_022926 [Morus notabilis]
Length=562

 Score =   174 bits (442),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  260  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSP  439
            TL QR  W +LSVL+RRQG+FLFAPLLYISGML YMG+VSFD VPII HR  PGS+YRSP
Sbjct  45   TLVQRLTWHILSVLIRRQGVFLFAPLLYISGMLLYMGSVSFDVVPIIHHRPAPGSVYRSP  104

Query  440  QLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              Y KL+PEMD+DNSS DAI TIWKHSYKG EW+PC N  SGGLP 
Sbjct  105  HFYSKLRPEMDADNSSTDAILTIWKHSYKGGEWKPCTNTFSGGLPN  150



>ref|XP_009101344.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=568

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 96/111 (86%), Gaps = 4/111 (4%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            RTLA R +W+++SVLLRRQG+FLFAPL+YIS ML YMGTVSFD  PII+HR+ PGS+Y+S
Sbjct  44   RTLAHRLSWLIVSVLLRRQGVFLFAPLIYISCMLIYMGTVSFDVGPIIRHRSPPGSVYKS  103

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGG----LPE  577
            PQLY KL+PEMD+DNS+ADAISTIWKHSYKG EW+P  NKS+GG    LPE
Sbjct  104  PQLYAKLRPEMDADNSTADAISTIWKHSYKGVEWKPYVNKSTGGSYFTLPE  154



>ref|XP_011038632.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=569

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = +2

Query  233  FTPGQ-PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  409
            FTP   P  R+LA R AW LLS LLRRQGIFLFAPL+YISGML YMGTVSFD  P+I H+
Sbjct  42   FTPSSYPPGRSLAHRLAWFLLSALLRRQGIFLFAPLIYISGMLLYMGTVSFDVGPVIDHK  101

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              PGS+YRSPQ+Y KL+PEMD+DNSSADA+ST+WK+SY+  EWR C  KSS GLPE
Sbjct  102  PAPGSVYRSPQIYEKLRPEMDADNSSADALSTVWKNSYRSGEWRQCIKKSSEGLPE  157



>ref|XP_002315879.1| hypothetical protein POPTR_0010s12160g [Populus trichocarpa]
 gb|EEF02050.1| hypothetical protein POPTR_0010s12160g [Populus trichocarpa]
Length=569

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = +2

Query  233  FTPGQ-PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR  409
            FTP   P  R+LA R AW LLS LLRRQGIFLFAPL+YISGML YMGTVSFD  P+I H+
Sbjct  42   FTPSSYPPGRSLAHRLAWFLLSALLRRQGIFLFAPLIYISGMLLYMGTVSFDVGPVIDHK  101

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
              PGS+YRSPQ+Y KL+PEMD+DNSSADA+ST+WK+SY+  EWR C  KSS GLPE
Sbjct  102  PAPGSVYRSPQIYEKLRPEMDADNSSADALSTVWKNSYRSGEWRQCIKKSSEGLPE  157



>emb|CDY52384.1| BnaCnng22220D [Brassica napus]
Length=568

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            QP+ RTLA R +WI+LS LLRRQG+FLFAPL+YIS ML YMGTVSFD  PII+HR+ PGS
Sbjct  44   QPS-RTLAHRVSWIILSALLRRQGVFLFAPLIYISCMLLYMGTVSFDVGPIIRHRSPPGS  102

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            +Y+SPQLY KL+ +MD+DNS+ADAISTIWKHSYKG EW+P  NKS+G LPE
Sbjct  103  VYKSPQLYAKLRHDMDADNSTADAISTIWKHSYKGGEWKPYVNKSTGALPE  153



>ref|XP_006398540.1| hypothetical protein EUTSA_v10000838mg [Eutrema salsugineum]
 gb|ESQ39993.1| hypothetical protein EUTSA_v10000838mg [Eutrema salsugineum]
Length=565

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            QP+ RTLA R +WILLSVLLRRQGIFLFAPL+YIS ML YMGTVSFD VPII+ +  PGS
Sbjct  42   QPS-RTLAHRLSWILLSVLLRRQGIFLFAPLIYISCMLLYMGTVSFDVVPIIQRKPPPGS  100

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            +Y+SPQ+Y KL+PEMD+D+S+ADAISTIWKHSYK  EW+P  NKSSG LP+
Sbjct  101  VYKSPQVYAKLRPEMDADDSTADAISTIWKHSYKAGEWKPYVNKSSGALPD  151



>gb|KHG09806.1| hypothetical protein F383_15167 [Gossypium arboreum]
Length=552

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
            +P QP  RT+A RF+ +LLSVLLRRQ IFLFAPL+YISGML YMGT S D +P++KHR +
Sbjct  37   SPFQPG-RTIAHRFSCLLLSVLLRRQRIFLFAPLIYISGMLLYMGTASVDVIPVVKHRPS  95

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQ+Y KL+  M++DNSSADAIST+WK+SYKG +WRPC NKS  GLPE
Sbjct  96   PGSVYRSPQVYKKLKIYMNADNSSADAISTVWKNSYKGGQWRPCVNKSYEGLPE  149



>gb|KHG09805.1| hypothetical protein F383_15167 [Gossypium arboreum]
Length=561

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
            +P QP  RT+A RF+ +LLSVLLRRQ IFLFAPL+YISGML YMGT S D +P++KHR +
Sbjct  37   SPFQPG-RTIAHRFSCLLLSVLLRRQRIFLFAPLIYISGMLLYMGTASVDVIPVVKHRPS  95

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQ+Y KL+  M++DNSSADAIST+WK+SYKG +WRPC NKS  GLPE
Sbjct  96   PGSVYRSPQVYKKLKIYMNADNSSADAISTVWKNSYKGGQWRPCVNKSYEGLPE  149



>gb|KJB30799.1| hypothetical protein B456_005G161000 [Gossypium raimondii]
Length=561

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F+P QP  RT+A R AW+LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD VP+IKHR 
Sbjct  36   FSPFQPG-RTIAHRLAWLLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPVIKHRP  94

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY KL+ +M++DNSSADAISTIWK+SYKG EWRPC NKS  GLPE
Sbjct  95   APGSVYRSPQLYEKLKIDMNADNSSADAISTIWKNSYKGGEWRPCVNKSFEGLPE  149



>gb|KJB15425.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
Length=539

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
            +P QP  RT+A RF+ +LLSVLLRRQ IFLFAPL+YISGML YMGT S D +P++KHR +
Sbjct  37   SPFQPG-RTIAHRFSCLLLSVLLRRQRIFLFAPLIYISGMLLYMGTASVDIIPVVKHRPS  95

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQ+Y KL+  M++DNSSADAI T+WK+SYKG +WRPC NKS  GLPE
Sbjct  96   PGSVYRSPQVYEKLKIYMNADNSSADAILTVWKNSYKGGQWRPCVNKSYEGLPE  149



>gb|KJB15424.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
 gb|KJB15426.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
Length=561

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
            +P QP  RT+A RF+ +LLSVLLRRQ IFLFAPL+YISGML YMGT S D +P++KHR +
Sbjct  37   SPFQPG-RTIAHRFSCLLLSVLLRRQRIFLFAPLIYISGMLLYMGTASVDIIPVVKHRPS  95

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQ+Y KL+  M++DNSSADAI T+WK+SYKG +WRPC NKS  GLPE
Sbjct  96   PGSVYRSPQVYEKLKIYMNADNSSADAILTVWKNSYKGGQWRPCVNKSYEGLPE  149



>ref|XP_006307153.1| hypothetical protein CARUB_v10008744mg [Capsella rubella]
 gb|EOA40051.1| hypothetical protein CARUB_v10008744mg [Capsella rubella]
Length=555

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
            + GQ   RT   R +WILLSVLLRRQGI LFAPL+Y+S MLF+M   SFDA PII  R  
Sbjct  34   SSGQQQSRTFPHRLSWILLSVLLRRQGILLFAPLIYVSCMLFHMRVASFDAAPIIHRRPA  93

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQ+Y +L+ ++D+DNS+ADAISTIWK SYKG EW+PC NKS+G LPE
Sbjct  94   PGSVYRSPQIYARLRSDIDADNSTADAISTIWKRSYKGVEWKPCVNKSTGVLPE  147



>gb|AES59903.2| O-fucosyltransferase family protein [Medicago truncatula]
Length=549

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
            T  +P+PRT+ QR +++ LS LLRRQGIFLFAPLLYIS +L Y  + SFD VP I HR+ 
Sbjct  35   TAPKPSPRTIPQRLSYLFLSGLLRRQGIFLFAPLLYISCVLLYFSSFSFDVVPFINHRSA  94

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQLY KL+ EMD DNSS DAISTIWK  YKG EW+PC + SS GLPE
Sbjct  95   PGSVYRSPQLYAKLKFEMDEDNSSVDAISTIWKSPYKGREWKPCVHTSSEGLPE  148



>ref|XP_010527785.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=567

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = +2

Query  122  MHAKNRLpssghsspstpssprsrsprvrrggkpggrFTPGQPAPRTLAQRFAWILLSVL  301
            MHAKNRLPSSGH++PS P+SP           K   R T  QP  RTLA R +W+LLSVL
Sbjct  1    MHAKNRLPSSGHNTPSPPASPLRSPRYRHGRSKTTSRLTAVQPG-RTLAHRLSWLLLSVL  59

Query  302  LRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDN  481
            LRRQGIFLFAPL+YIS ML +MGTVSFD VP+I HR  PGS+Y+SPQLY KL+PEMD+DN
Sbjct  60   LRRQGIFLFAPLIYISCMLLFMGTVSFDVVPVITHRPAPGSVYKSPQLYAKLRPEMDADN  119

Query  482  SSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+ADAISTIWKHSYKG EW+PC NKSSG LPE
Sbjct  120  STADAISTIWKHSYKGGEWKPCVNKSSGALPE  151



>ref|XP_002526030.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36370.1| conserved hypothetical protein [Ricinus communis]
Length=570

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 99/124 (80%), Gaps = 9/124 (7%)
 Frame = +2

Query  233  FTPGQPAP---------RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD  385
            FTP   +P         RT+A R AW+LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD
Sbjct  37   FTPASSSPWSHTPGGGGRTIAHRLAWLLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFD  96

Query  386  AVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSG  565
              P+I+H+  PGS+YRSPQLY KL PEMD+DNSSADA+STIWK+SYKG  WR C NKSSG
Sbjct  97   VGPVIQHKPPPGSVYRSPQLYQKLLPEMDADNSSADALSTIWKNSYKGGGWRSCVNKSSG  156

Query  566  GLPE  577
            GLPE
Sbjct  157  GLPE  160



>ref|XP_002892842.1| hypothetical protein ARALYDRAFT_471685 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69101.1| hypothetical protein ARALYDRAFT_471685 [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            Q   RT+A R +WILLSVLLRRQGI LFAPL+Y+S MLF++   SFDA PII  R  PGS
Sbjct  43   QQQSRTVAHRLSWILLSVLLRRQGILLFAPLIYVSCMLFHLHAASFDASPIIHRRPAPGS  102

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            +YRSPQ+Y +L+ E+++DN++ADAISTIWK SYKG EW+PC NKS+G LPE
Sbjct  103  VYRSPQVYARLRGEIEADNTTADAISTIWKRSYKGVEWKPCVNKSTGVLPE  153



>ref|XP_006416955.1| hypothetical protein EUTSA_v10007261mg [Eutrema salsugineum]
 gb|ESQ35308.1| hypothetical protein EUTSA_v10007261mg [Eutrema salsugineum]
Length=557

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            RT A R +WILLSVLLRRQGI LFAPL+YIS MLF+M T SF A PII  R  PGS+YRS
Sbjct  44   RTFAHRISWILLSVLLRRQGILLFAPLIYISCMLFHMRTASFYAGPIIPRRPAPGSVYRS  103

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PQ+Y KL+ EMD+DN++ADAISTIWK SYKG EW+PC  KS+G LPE
Sbjct  104  PQVYAKLRSEMDADNTTADAISTIWKRSYKGVEWKPCVTKSNGVLPE  150



>ref|XP_007045152.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY00984.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=561

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F P QP  RT+A R AW+LLSVLLRRQGIFLFAPL+YISGML YMGTVSFD VPI+KHR 
Sbjct  36   FGPFQPG-RTIAHRLAWLLLSVLLRRQGIFLFAPLIYISGMLLYMGTVSFDVVPIVKHRP  94

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y KL+ +M  DNSSADAISTIW++SYKG EWRPC NKS   LPE
Sbjct  95   APGSVYRSPQVYEKLKIDMCGDNSSADAISTIWRNSYKGGEWRPCVNKSFEDLPE  149



>ref|XP_004498295.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Cicer arietinum]
Length=457

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F+P QP PRT AQR AW+ LSVLLRRQG+FLFAPL+YISGML Y GT SFD  PII+HR 
Sbjct  37   FSPPQPPPRTFAQRLAWVFLSVLLRRQGVFLFAPLIYISGMLLYFGTFSFDVNPIIRHRP  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY KL+P+MD+D+SSADAISTIWK  YK  EW+PC ++SS GLPE
Sbjct  97   APGSVYRSPQLYAKLRPDMDADDSSADAISTIWKSPYKSGEWKPCVHRSSEGLPE  151



>ref|XP_004297377.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=569

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 90/117 (77%), Gaps = 6/117 (5%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF--DAVPIIKHRAT  415
             QP  RTL QR AW LLSVL+RRQG FLFAPLLYISGML YMG+ SF  D +PII     
Sbjct  42   NQPG-RTLIQRIAWHLLSVLIRRQGFFLFAPLLYISGMLLYMGSGSFPDDRLPIIPRHFA  100

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHS---YKGDEWRPCANKSSGGLPE  577
            PGS YRSPQLY KL+ EMD+DNSSADAIST+WKHS   YKG EWRPC N SSG LPE
Sbjct  101  PGSRYRSPQLYEKLRSEMDADNSSADAISTVWKHSFSAYKGGEWRPCVNTSSGVLPE  157



>ref|XP_004498294.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=519

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F+P QP PRT AQR AW+ LSVLLRRQG+FLFAPL+YISGML Y GT SFD  PII+HR 
Sbjct  37   FSPPQPPPRTFAQRLAWVFLSVLLRRQGVFLFAPLIYISGMLLYFGTFSFDVNPIIRHRP  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY KL+P+MD+D+SSADAISTIWK  YK  EW+PC ++SS GLPE
Sbjct  97   APGSVYRSPQLYAKLRPDMDADDSSADAISTIWKSPYKSGEWKPCVHRSSEGLPE  151



>ref|XP_004498293.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=563

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F+P QP PRT AQR AW+ LSVLLRRQG+FLFAPL+YISGML Y GT SFD  PII+HR 
Sbjct  37   FSPPQPPPRTFAQRLAWVFLSVLLRRQGVFLFAPLIYISGMLLYFGTFSFDVNPIIRHRP  96

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQLY KL+P+MD+D+SSADAISTIWK  YK  EW+PC ++SS GLPE
Sbjct  97   APGSVYRSPQLYAKLRPDMDADDSSADAISTIWKSPYKSGEWKPCVHRSSEGLPE  151



>ref|XP_010496695.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=556

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%), Gaps = 1/115 (1%)
 Frame = +2

Query  236  TPGQPAPRT-LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            + GQ   RT    R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R 
Sbjct  34   SSGQHQTRTTFPHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRP  93

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y +L+ ++D+DN++ADAISTIWK SYKG EW+PC NKS+G LPE
Sbjct  94   APGSVYRSPQVYARLRADIDADNTTADAISTIWKRSYKGVEWKPCVNKSTGVLPE  148



>ref|XP_010459015.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=556

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%), Gaps = 1/115 (1%)
 Frame = +2

Query  236  TPGQPAPRT-LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            + GQ   RT    R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R 
Sbjct  34   SSGQHQNRTAFPHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRP  93

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y +L+ ++D+DN++ADAISTIWK SYKG EW+PC NKS+G LPE
Sbjct  94   APGSVYRSPQVYARLRADIDADNTTADAISTIWKRSYKGVEWKPCVNKSTGVLPE  148



>ref|XP_010496702.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=549

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%), Gaps = 1/115 (1%)
 Frame = +2

Query  236  TPGQPAPRT-LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            + GQ   RT    R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R 
Sbjct  34   SSGQHQTRTTFPHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRP  93

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y +L+ ++D+DN++ADAISTIWK SYKG EW+PC NKS+G LPE
Sbjct  94   APGSVYRSPQVYARLRADIDADNTTADAISTIWKRSYKGVEWKPCVNKSTGVLPE  148



>ref|XP_010459016.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=549

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%), Gaps = 1/115 (1%)
 Frame = +2

Query  236  TPGQPAPRT-LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            + GQ   RT    R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R 
Sbjct  34   SSGQHQNRTAFPHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRP  93

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSPQ+Y +L+ ++D+DN++ADAISTIWK SYKG EW+PC NKS+G LPE
Sbjct  94   APGSVYRSPQVYARLRADIDADNTTADAISTIWKRSYKGVEWKPCVNKSTGVLPE  148



>emb|CDX81687.1| BnaC08g39140D [Brassica napus]
Length=558

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            R L  R +WILLS+LLRRQGI LFAPL+YI  MLF+M T SFD  P I  R  PGS+YRS
Sbjct  44   RNLPHRVSWILLSLLLRRQGILLFAPLIYIFCMLFHMRTASFDPGPFINRRPAPGSVYRS  103

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PQ+Y KLQ  MD+DN++ADAISTIWK SYKG EW+PC NKSSG LPE
Sbjct  104  PQVYAKLQAAMDADNATADAISTIWKRSYKGVEWKPCVNKSSGVLPE  150



>ref|XP_010318109.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum lycopersicum]
Length=446

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
             P  PAP+TL Q  A   LS+LLRRQGIFLFAPL+YIS +LFY+ T+ F ++P   H A 
Sbjct  28   APRFPAPKTLPQHLASRFLSLLLRRQGIFLFAPLIYISAVLFYINTLDFHSLPP-PHYAP  86

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQLY  L+P+MDSDNS+ADAISTIW++SYKG EWRPC +KSS GLPE
Sbjct  87   PGSVYRSPQLYANLRPQMDSDNSNADAISTIWRNSYKGGEWRPCIDKSSRGLPE  140



>ref|XP_011070621.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=558

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 90/115 (78%), Gaps = 1/115 (1%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRA  412
            F   +  PRTLAQRF  +L S  L+RQGIFLFAPLLYI+GMLFYMGTVS D VP  ++R 
Sbjct  34   FKSARGPPRTLAQRFDRVL-SFFLKRQGIFLFAPLLYIAGMLFYMGTVSLDVVPFARNRL  92

Query  413  TPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             PGS+YRSP  Y +++ EMDSDNS ++AISTIW++SY+G  WRPC N+SS GLPE
Sbjct  93   GPGSVYRSPDFYARVRHEMDSDNSYSNAISTIWENSYEGGVWRPCTNQSSKGLPE  147



>ref|XP_010931259.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Elaeis guineensis]
Length=497

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = +2

Query  251  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIY  430
            +PR L QR AW+LLS+LLRRQ IFLFAPLLY++GMLFYMGTVS + VP I  R  PGSIY
Sbjct  44   SPRALVQRMAWMLLSLLLRRQAIFLFAPLLYVAGMLFYMGTVSLEGVPRIISRPAPGSIY  103

Query  431  RSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            RSPQLYL+L+ +M++DNSS DA++T+W+H+YKG  WRPC N +   LP+
Sbjct  104  RSPQLYLRLRTDMNADNSS-DALATVWRHAYKGGMWRPCINMTMNELPD  151



>ref|XP_010476573.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=558

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  260  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSP  439
            T   R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R  PGS+YRSP
Sbjct  45   TFLHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRPAPGSVYRSP  104

Query  440  QLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            Q+Y +L+ +MD+DN++ADAISTIWK SYKG EW+PC NKS+G  PE
Sbjct  105  QVYARLRADMDADNTTADAISTIWKRSYKGVEWKPCVNKSTGVSPE  150



>ref|XP_010476572.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=564

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +2

Query  260  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSP  439
            T   R +WILLSVLLRRQGI LFAPL+Y+S M F+M   SFDA PII  R  PGS+YRSP
Sbjct  45   TFLHRISWILLSVLLRRQGILLFAPLIYVSCMFFHMRVASFDAAPIIHRRPAPGSVYRSP  104

Query  440  QLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            Q+Y +L+ +MD+DN++ADAISTIWK SYKG EW+PC NKS+G  PE
Sbjct  105  QVYARLRADMDADNTTADAISTIWKRSYKGVEWKPCVNKSTGVSPE  150



>ref|XP_004235088.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum lycopersicum]
Length=552

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  239  PGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATP  418
            P  PAP+TL Q  A   LS+LLRRQGIFLFAPL+YIS +LFY+ T+ F ++P   H A P
Sbjct  29   PRFPAPKTLPQHLASRFLSLLLRRQGIFLFAPLIYISAVLFYINTLDFHSLPP-PHYAPP  87

Query  419  GSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            GS+YRSPQLY  L+P+MDSDNS+ADAISTIW++SYKG EWRPC +KSS GLPE
Sbjct  88   GSVYRSPQLYANLRPQMDSDNSNADAISTIWRNSYKGGEWRPCIDKSSRGLPE  140



>ref|XP_006342313.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Solanum tuberosum]
Length=446

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
             P  PAP+TL Q  A   LS+LLRRQGIFLFAPL+YIS +LFY+ T+ F  +P   H A 
Sbjct  28   APRFPAPQTLPQHLASQFLSLLLRRQGIFLFAPLIYISAVLFYINTLDFHNLPP-PHYAP  86

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQLY  L+P+MDSDNS+ADAISTIW++SYKG EWRPC +KSS GLPE
Sbjct  87   PGSVYRSPQLYANLRPQMDSDNSNADAISTIWRNSYKGGEWRPCIDKSSRGLPE  140



>ref|XP_010931258.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Elaeis guineensis]
Length=563

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = +2

Query  251  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIY  430
            +PR L QR AW+LLS+LLRRQ IFLFAPLLY++GMLFYMGTVS + VP I  R  PGSIY
Sbjct  44   SPRALVQRMAWMLLSLLLRRQAIFLFAPLLYVAGMLFYMGTVSLEGVPRIISRPAPGSIY  103

Query  431  RSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            RSPQLYL+L+ +M++DNSS DA++T+W+H+YKG  WRPC N +   LP+
Sbjct  104  RSPQLYLRLRTDMNADNSS-DALATVWRHAYKGGMWRPCINMTMNELPD  151



>emb|CDY33727.1| BnaA09g45330D [Brassica napus]
Length=557

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            RTL  R +WILLS+LLRRQGI LFAPL+YI  MLF+M T SFD  P I  R  PGS+YRS
Sbjct  44   RTLPHRVSWILLSLLLRRQGILLFAPLIYIFCMLFHMRTASFDPGPFINRRPAPGSVYRS  103

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PQ+Y KLQ  M +DN++ADAISTIWK SYKG EW+PC NKSSG LPE
Sbjct  104  PQVYAKLQAAMVADNATADAISTIWKRSYKGVEWKPCVNKSSGVLPE  150



>ref|XP_006342312.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=486

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
             P  PAP+TL Q  A   LS+LLRRQGIFLFAPL+YIS +LFY+ T+ F  +P   H A 
Sbjct  28   APRFPAPQTLPQHLASQFLSLLLRRQGIFLFAPLIYISAVLFYINTLDFHNLPP-PHYAP  86

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PGS+YRSPQLY  L+P+MDSDNS+ADAISTIW++SYKG EWRPC +KSS GLPE
Sbjct  87   PGSVYRSPQLYANLRPQMDSDNSNADAISTIWRNSYKGGEWRPCIDKSSRGLPE  140



>gb|KFK43757.1| hypothetical protein AALP_AA1G168900 [Arabis alpina]
Length=557

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGML-FYMGTVSFDAVPIIKHRATPG  421
            QP+ RTLA R +W LLS  LRRQGI LFAP++YIS ML F+M T SFDA PII  R  PG
Sbjct  39   QPS-RTLAHRLSWFLLSHFLRRQGILLFAPVIYISCMLLFHMRTASFDAGPIIHRRPAPG  97

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+Y+SPQ+Y KL+ E+D+DN++ADAISTIWK SYKG EW+PC NKS+G LPE
Sbjct  98   SVYKSPQVYAKLRAEIDADNTTADAISTIWKRSYKGVEWKPCVNKSNGVLPE  149



>ref|XP_006342311.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=552

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = +2

Query  239  PGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATP  418
            P  PAP+TL Q  A   LS+LLRRQGIFLFAPL+YIS +LFY+ T+ F  +P   H A P
Sbjct  29   PRFPAPQTLPQHLASQFLSLLLRRQGIFLFAPLIYISAVLFYINTLDFHNLPP-PHYAPP  87

Query  419  GSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            GS+YRSPQLY  L+P+MDSDNS+ADAISTIW++SYKG EWRPC +KSS GLPE
Sbjct  88   GSVYRSPQLYANLRPQMDSDNSNADAISTIWRNSYKGGEWRPCIDKSSRGLPE  140



>ref|XP_010553860.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=566

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            RTLA R +W+LLS+LLRRQGIFLFAPL+YIS ML YMGTVSFDAVP I HR  PGS+Y+S
Sbjct  47   RTLAHRLSWLLLSILLRRQGIFLFAPLIYISCMLLYMGTVSFDAVPKITHRPPPGSVYKS  106

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PQ+Y KL+PEMD+DNS+ADAISTIWK SYKG +WRPC NKSSG LPE
Sbjct  107  PQVYAKLRPEMDADNSTADAISTIWKRSYKGGDWRPCVNKSSGVLPE  153



>ref|XP_009420104.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=571

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  254  PRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYR  433
            PRT+AQR AW+LLS LLRRQ IFLFAPLLY++ MLFYMGTV  D+VP I  R+ PGS+YR
Sbjct  53   PRTIAQRMAWMLLSFLLRRQAIFLFAPLLYVAAMLFYMGTVPIDSVPRIISRSAPGSVYR  112

Query  434  SPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            SP+LY +L+P MD+DNSS D ++T+WKHS+KG  WRPC + S+  LP+
Sbjct  113  SPKLYERLRPVMDADNSS-DGLATVWKHSFKGGGWRPCIHTSNDALPD  159



>ref|NP_172950.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AEE29248.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=562

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            R +A R +WI+LSVLLRRQGI LFAP++YIS MLF++   SFDA PII  R  PGS+YRS
Sbjct  48   RNVAHRLSWIILSVLLRRQGILLFAPIIYISCMLFHLHAASFDASPIIHRRPAPGSVYRS  107

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLP  574
            PQ+Y +L+ E+++DN++ADAISTIWK SYKG EW+PC N S+G LP
Sbjct  108  PQVYARLRGEIEADNTTADAISTIWKRSYKGVEWKPCVNMSTGVLP  153



>ref|XP_009117860.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
Length=558

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            RTL  R +W LLS+LLRRQGI L APL+YI  MLF+M T SFD  P I  R  PGS+YRS
Sbjct  44   RTLPHRVSWFLLSLLLRRQGILLVAPLIYIFCMLFHMRTASFDPGPFINRRPAPGSVYRS  103

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            PQ+Y KLQ  M +DN++ADAISTIWK SYKG EW+PC NKSSG LPE
Sbjct  104  PQVYAKLQAAMVADNATADAISTIWKRSYKGVEWKPCVNKSSGVLPE  150



>ref|XP_008776785.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=563

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = +2

Query  251  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIY  430
            APR+L QR AW+LLS+LLRRQ IFLFAPLLY++GMLFYMGTVS + VP I  R   GS+Y
Sbjct  44   APRSLVQRMAWMLLSLLLRRQAIFLFAPLLYVAGMLFYMGTVSLEGVPRIISRPASGSMY  103

Query  431  RSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            RSPQLY +L+P+M++DNSS D ++T+W+H YKG  WRPC N +   LP+
Sbjct  104  RSPQLYQRLRPDMNADNSS-DVLATVWRHPYKGGMWRPCINMTMNELPD  151



>ref|XP_009407491.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=569

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  254  PRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYR  433
            PRTLAQR AW+LLS+LLRRQ IFLFAPLLY++ M+FYMGT+  D+VP I  R  PGS+YR
Sbjct  51   PRTLAQRMAWMLLSLLLRRQAIFLFAPLLYVAAMIFYMGTLPLDSVPRIISRPAPGSVYR  110

Query  434  SPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            SP LY +L+ +M++DNSS D ++T+WKHS+K D WRPC N S+  LP+
Sbjct  111  SPMLYERLRADMEADNSS-DGLATVWKHSFKDDRWRPCINTSADVLPD  157



>ref|XP_010922337.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=563

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = +2

Query  251  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIY  430
            APRTL QR AW+LLS+LLRRQ IFLFAPLLY++GMLFYMGTVS + VP I  R  PGS+Y
Sbjct  44   APRTLLQRLAWMLLSLLLRRQAIFLFAPLLYVAGMLFYMGTVSLEGVPRIISRPAPGSVY  103

Query  431  RSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            RSPQLY +L+P+MDSDNSS DA++T+W+H YKG  WRPC N +   LP+
Sbjct  104  RSPQLYQRLRPDMDSDNSS-DALATVWRHLYKGGTWRPCINMTMNELPD  151



>ref|XP_009416135.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=569

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  254  PRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYR  433
            PR +AQR AW+LLS+ LRRQ IFLF PLLY++ MLFYMGTVS ++VP I  R+ PGS+YR
Sbjct  51   PRAIAQRMAWMLLSLFLRRQAIFLFTPLLYVAAMLFYMGTVSLESVPHIISRSAPGSVYR  110

Query  434  SPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            SP+LY +L+ +MD+DNSS D ++T+WKHS+KG  WRPC + S+  LP+
Sbjct  111  SPKLYERLRNDMDADNSS-DGLATVWKHSFKGGGWRPCLDTSTDVLPD  157



>ref|XP_006826849.1| PREDICTED: uncharacterized protein At1g04910 [Amborella trichopoda]
 gb|ERM94086.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
Length=554

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            R+L QR    LLSV LRRQG+FLFAPL+YISGML YMG+VSFD VP I  R  PGSIY+S
Sbjct  36   RSLVQRVTLALLSVFLRRQGVFLFAPLIYISGMLLYMGSVSFD-VPQISVRPPPGSIYKS  94

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKS-SGGLPE  577
            P+++  L P+M++DNSS+D ++++W+  YKG+EW+PC N++  GGLP+
Sbjct  95   PEVFRNLWPQMNADNSSSDGLASVWRRPYKGEEWKPCINRTLDGGLPD  142



>emb|CDY39592.1| BnaC05g11210D, partial [Brassica napus]
Length=561

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFL-FAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  421
            +P  RT A R +WI+LSV+LRR+   L FAP++YIS MLF+M   SFDA P I  R  PG
Sbjct  52   EPPSRTFAHRISWIVLSVILRRRRRILLFAPVIYISCMLFHMHKASFDAGPTIHRRPAPG  111

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            S+YRSPQ Y KL+ E+D+DN++ADAISTIWK SYKG EW+PC NKS+G LPE
Sbjct  112  SVYRSPQAYAKLRAEIDADNATADAISTIWKRSYKGVEWKPCVNKSNGVLPE  163



>ref|XP_009148881.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 ref|XP_009148882.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 ref|XP_009148883.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=556

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = +2

Query  251  APRTLAQRFAWILLSVLLRRQGIFL-FAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSI  427
            A +T  QR +WI+LSV+LRR+   L FAP++YIS MLF+M T SFDA P I  R  PGS+
Sbjct  40   ANQTFVQRISWIVLSVILRRRRRILLFAPVIYISCMLFHMRTASFDAGPTIHRRPAPGSV  99

Query  428  YRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            YRSPQ+Y KL+  +D+DN++ADAISTIWK SYKG EW+PC NKS+G LPE
Sbjct  100  YRSPQVYAKLRAVIDADNATADAISTIWKRSYKGVEWKPCVNKSNGVLPE  149



>ref|XP_002458744.1| hypothetical protein SORBIDRAFT_03g039450 [Sorghum bicolor]
 gb|EES03864.1| hypothetical protein SORBIDRAFT_03g039450 [Sorghum bicolor]
Length=568

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +2

Query  269  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  448
            +R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++S D+VP I  R  PGS+YRSPQLY
Sbjct  55   RRVARAVLAALLRRQAVFLFAPLLYVAAMLLYMGSISLDSVPRIISRPAPGSVYRSPQLY  114

Query  449  LKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             +L+ +MD+DN++ DA++T+W+H+Y+G  WRPC + ++ GLPE
Sbjct  115  ARLRADMDADNAT-DALATVWRHAYRGGVWRPCISNNTNGLPE  156



>emb|CDY36519.1| BnaA06g09720D [Brassica napus]
Length=556

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +2

Query  248  PAPRTLAQRFAWILLSVLLRRQGIFL-FAPLLYISGMLFYMGTVSFDAVPIIKHRATPGS  424
            PA +T  QR + I+LSV+LRR+   L FAP++YIS MLF+M T SFDA P I  R  PGS
Sbjct  39   PANQTFVQRISCIVLSVILRRRRRILLFAPVIYISCMLFHMRTASFDAGPTIHRRPAPGS  98

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            +YRSPQ+Y KL+  +D+DN++ADAISTIWK SYKG EW+PC NKSSG LPE
Sbjct  99   VYRSPQVYAKLRAVIDADNATADAISTIWKRSYKGVEWKPCVNKSSGVLPE  149



>ref|XP_008656363.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=473

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +2

Query  266  AQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQL  445
            A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQL
Sbjct  72   ARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQL  131

Query  446  YLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            Y +L+ +MD+DNS+  A++T+W+H+YKG  W PC N  + GLPE
Sbjct  132  YARLRADMDADNSTG-ALATVWRHTYKGGTWWPCINNMTNGLPE  174



>ref|XP_008656364.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Zea mays]
Length=433

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +2

Query  266  AQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQL  445
            A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQL
Sbjct  72   ARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQL  131

Query  446  YLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            Y +L+ +MD+DNS+  A++T+W+H+YKG  W PC N  + GLPE
Sbjct  132  YARLRADMDADNSTG-ALATVWRHTYKGGTWWPCINNMTNGLPE  174



>ref|XP_008656362.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=586

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +2

Query  266  AQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQL  445
            A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQL
Sbjct  72   ARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQL  131

Query  446  YLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            Y +L+ +MD+DNS+  A++T+W+H+YKG  W PC N  + GLPE
Sbjct  132  YARLRADMDADNSTG-ALATVWRHTYKGGTWWPCINNMTNGLPE  174



>gb|AFW82218.1| hypothetical protein ZEAMMB73_014086, partial [Zea mays]
Length=582

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +2

Query  266  AQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQL  445
            A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQL
Sbjct  72   ARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQL  131

Query  446  YLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            Y +L+ +MD+DNS+  A++T+W+H+YKG  W PC N  + GLPE
Sbjct  132  YARLRADMDADNSTG-ALATVWRHTYKGGTWWPCINNMTNGLPE  174



>ref|XP_008674838.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
 gb|ACR35648.1| unknown [Zea mays]
 tpg|DAA56900.1| TPA: hypothetical protein ZEAMMB73_118496 [Zea mays]
Length=558

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +2

Query  269  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  448
            +R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++S D+VP I  R  PGS+YRSPQLY
Sbjct  55   RRVARAVLAALLRRQAVFLFAPLLYVAAMLLYMGSISLDSVPRIIPRPAPGSMYRSPQLY  114

Query  449  LKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             +L+ +MD+DN++ DA++ +W+H+Y+G  WRPC + ++ GLPE
Sbjct  115  ARLRADMDADNAT-DALAAVWRHAYRGGVWRPCISNNTNGLPE  156



>ref|XP_008674839.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=502

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +2

Query  269  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  448
            +R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++S D+VP I  R  PGS+YRSPQLY
Sbjct  55   RRVARAVLAALLRRQAVFLFAPLLYVAAMLLYMGSISLDSVPRIIPRPAPGSMYRSPQLY  114

Query  449  LKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
             +L+ +MD+DN++ DA++ +W+H+Y+G  WRPC + ++ GLPE
Sbjct  115  ARLRADMDADNAT-DALAAVWRHAYRGGVWRPCISNNTNGLPE  156



>ref|XP_008649713.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Zea mays]
Length=472

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQ  442
            +A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R   GS+YRSPQ
Sbjct  70   VARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPLGSVYRSPQ  129

Query  443  LYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            LY +L+ +MD+DNS+  A++T+W+H+Y G  WRPC N  + GLPE
Sbjct  130  LYRRLRADMDADNSTG-ALATVWRHTYIGGTWRPCINNMTNGLPE  173



>gb|AFW78262.1| hypothetical protein ZEAMMB73_416738, partial [Zea mays]
Length=556

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQ  442
            +A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R   GS+YRSPQ
Sbjct  51   VARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPLGSVYRSPQ  110

Query  443  LYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            LY +L+ +MD+DNS+  A++T+W+H+Y G  WRPC N  + GLPE
Sbjct  111  LYRRLRADMDADNSTG-ALATVWRHTYIGGTWRPCINNMTNGLPE  154



>ref|XP_008649712.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=585

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQ  442
            +A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R   GS+YRSPQ
Sbjct  70   VARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPLGSVYRSPQ  129

Query  443  LYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            LY +L+ +MD+DNS+  A++T+W+H+Y G  WRPC N  + GLPE
Sbjct  130  LYRRLRADMDADNSTG-ALATVWRHTYIGGTWRPCINNMTNGLPE  173



>ref|XP_008649711.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=588

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQ  442
            +A+R A  +L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R   GS+YRSPQ
Sbjct  70   VARRVARAVLATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPLGSVYRSPQ  129

Query  443  LYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            LY +L+ +MD+DNS+  A++T+W+H+Y G  WRPC N  + GLPE
Sbjct  130  LYRRLRADMDADNSTG-ALATVWRHTYIGGTWRPCINNMTNGLPE  173



>dbj|BAJ88036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  311  QGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSA  490
            Q +FLFAPLLY++ ML YMG+VS D VP I  R  PGS+YRSPQLY +L+PEMD+DN++ 
Sbjct  54   QAVFLFAPLLYVAAMLLYMGSVSLDGVPRIISRPAPGSLYRSPQLYARLRPEMDADNAT-  112

Query  491  DAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            DA++T+W+H+YKG  W+PC + ++ GLPE
Sbjct  113  DALATVWRHAYKGGVWQPCISNNTYGLPE  141



>ref|XP_003589652.1| hypothetical protein MTR_1g031590 [Medicago truncatula]
Length=614

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  236  TPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT  415
            T  +P+PRT+ QR +++ LS LLRRQGIFLFAPLLYIS +L Y  + SFD VP I HR+ 
Sbjct  35   TAPKPSPRTIPQRLSYLFLSGLLRRQGIFLFAPLLYISCVLLYFSSFSFDVVPFINHRSA  94

Query  416  PGSIYRSPQLYLKLQPEMDSDNSSADAIST  505
            PGS+YRSPQLY KL+ EMD DNSS DA+ T
Sbjct  95   PGSVYRSPQLYAKLKFEMDEDNSSVDALLT  124



>ref|XP_004963730.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=576

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +2

Query  311  QGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSA  490
            Q +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQLY +L+ +MD+DNS+ 
Sbjct  77   QAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQLYARLRADMDADNST-  135

Query  491  DAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            DA++T+W+H+YKG  W+PC N  +  LPE
Sbjct  136  DALATVWRHTYKGGTWQPCINNGTNSLPE  164



>gb|AAF31019.1|AC012189_1 Contains similarity to atypical PKC specific binding protein 
from Rattus norvegicus gb|AB005549. This gene is cut off, partial 
[Arabidopsis thaliana]
Length=133

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            R +A R +WI+LSVLLRRQGI LFAP++YIS MLF++   SFDA PII  R  PGS+YRS
Sbjct  48   RNVAHRLSWIILSVLLRRQGILLFAPIIYISCMLFHLHAASFDASPIIHRRPAPGSVYRS  107

Query  437  PQLYLKLQPEMDSDNSSADAI  499
            PQ+Y +L+ E+++DN++ADA+
Sbjct  108  PQVYARLRGEIEADNTTADAV  128



>ref|XP_004970534.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=564

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +2

Query  317  IFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADA  496
            +FLFAPLLY++ ML YMG++S D+VP I  R  PGS+YRSPQLY +L+ +MD+DN++ DA
Sbjct  67   VFLFAPLLYVAAMLLYMGSISLDSVPRIISRPAPGSMYRSPQLYARLRADMDADNAT-DA  125

Query  497  ISTIWKHSYKGDEWRPCANKSSGGLPE  577
            ++T+W+H+Y+G  WRPC + ++ GLPE
Sbjct  126  LATVWRHAYRGGIWRPCISNNTDGLPE  152



>ref|XP_003564587.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=573

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  311  QGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSA  490
            Q +FLFAPLLY++ ML YMG++S D+VP I  R  PGS+YRSPQLY +L+ +MD+DN++ 
Sbjct  74   QAVFLFAPLLYVAAMLLYMGSISLDSVPRIISRPAPGSLYRSPQLYARLRADMDADNAT-  132

Query  491  DAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            DA++T+W+H+YKG  WRPC   ++  LPE
Sbjct  133  DALATVWRHAYKGGVWRPCIRNNTYDLPE  161



>ref|XP_003568305.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=570

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +2

Query  317  IFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADA  496
            +FLFAPLLY++ ML YMG++  D VP I  R+ PGS+YRSPQLY +L+ EMD+DN + DA
Sbjct  73   VFLFAPLLYVAAMLLYMGSLPLDVVPRIIARSAPGSVYRSPQLYARLRAEMDADNYT-DA  131

Query  497  ISTIWKHSYKGDEWRPCANKSSGGLPE  577
            ++T+W+ +YKG  WRPC +  S  LPE
Sbjct  132  LATVWRQTYKGGVWRPCIHNMSKSLPE  158



>gb|AAF79229.1|AC006917_14 F10B6.36 [Arabidopsis thaliana]
Length=483

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  353  MLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGD  532
            MLF++   SFDA PII  R  PGS+YRSPQ+Y +L+ E+++DN++ADAISTIWK SYKG 
Sbjct  1    MLFHLHAASFDASPIIHRRPAPGSVYRSPQVYARLRGEIEADNTTADAISTIWKRSYKGV  60

Query  533  EWRPCANKSSGGLP  574
            EW+PC N S+G LP
Sbjct  61   EWKPCVNMSTGVLP  74



>ref|XP_004499554.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=508

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 73/101 (72%), Gaps = 7/101 (7%)
 Frame = +2

Query  272  RFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT---PGSIYRSPQ  442
            +F ++++S +LRR+G+ LFAPLLYISGML YMG++SFD V + KHR     PGS+Y SPQ
Sbjct  31   KFVFVVMSAILRRRGLLLFAPLLYISGMLLYMGSLSFDVVLVHKHRHRPPPPGSLYTSPQ  90

Query  443  LYLKLQPEMDSDNSSA-DAISTIWKHSYKGD-EWRPCANKS  559
            L+  L P M++DNS++ + +   W  + K D  W+PCANK+
Sbjct  91   LFHNLWPFMETDNSTSLNVLMKAW--NVKEDRHWKPCANKT  129



>ref|XP_009379526.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009379534.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=458

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 78/121 (64%), Gaps = 9/121 (7%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIK  403
            G+   +++ ++   +L+SV+ +R+G+ LFAPLLYISGML YMG+V+FD      AV ++ 
Sbjct  33   GRGPKQSIVEKVVVLLISVVFKRRGVLLFAPLLYISGMLLYMGSVNFDVVSLKNAVVVVS  92

Query  404  HRATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCANKSS--GGLP  574
             R+ PGS+YRSPQ++ KL P M +D N + + +  +W    +   W+PC +  +   GLP
Sbjct  93   KRSPPGSVYRSPQVFHKLWPHMQADSNHTHNLLMAVWNSKVRRQVWKPCISNDTPEEGLP  152

Query  575  E  577
            +
Sbjct  153  K  153



>ref|XP_004499553.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Cicer arietinum]
Length=553

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 73/101 (72%), Gaps = 7/101 (7%)
 Frame = +2

Query  272  RFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT---PGSIYRSPQ  442
            +F ++++S +LRR+G+ LFAPLLYISGML YMG++SFD V + KHR     PGS+Y SPQ
Sbjct  31   KFVFVVMSAILRRRGLLLFAPLLYISGMLLYMGSLSFDVVLVHKHRHRPPPPGSLYTSPQ  90

Query  443  LYLKLQPEMDSDNSSA-DAISTIWKHSYKGD-EWRPCANKS  559
            L+  L P M++DNS++ + +   W  + K D  W+PCANK+
Sbjct  91   LFHNLWPFMETDNSTSLNVLMKAW--NVKEDRHWKPCANKT  129



>ref|XP_006582446.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=500

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 11/110 (10%)
 Frame = +2

Query  269  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  430
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG++SFD V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSFDVVSIKNGVVLVHKRAPPGSVY  99

Query  431  RSPQLYLKLQPEMDSDN-SSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            RSPQL+  L P M++DN ++ + +   W  + +  EW+PCAN S   LPE
Sbjct  100  RSPQLFQNLWPLMEADNGTTLNVLMKAWTKN-ELREWKPCANAS---LPE  145



>ref|XP_003526401.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN20543.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 11/110 (10%)
 Frame = +2

Query  269  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  430
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG++SFD V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSFDVVSIKNGVVLVHKRAPPGSVY  99

Query  431  RSPQLYLKLQPEMDSDN-SSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            RSPQL+  L P M++DN ++ + +   W  + +  EW+PCAN S   LPE
Sbjct  100  RSPQLFQNLWPLMEADNGTTLNVLMKAWTKN-ELREWKPCANAS---LPE  145



>ref|XP_011622189.1| PREDICTED: uncharacterized protein At1g04910 [Amborella trichopoda]
Length=568

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            + +  R  ++L SV+ RR G+ LF PL+YI GMLFYMG++ F+  P++ +R  PGS YRS
Sbjct  48   QNVIHRLVYLLFSVVYRRHGVLLFVPLVYICGMLFYMGSLPFEG-PVVANRPPPGSTYRS  106

Query  437  PQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCAN  553
            P+++ KL P M +D+++++A+ST W +   G  WRPCA+
Sbjct  107  PEVFKKLWPSMQADDNASNALSTAW-YPRVGQGWRPCAS  144



>ref|XP_009379518.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=571

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 78/121 (64%), Gaps = 9/121 (7%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIK  403
            G+   +++ ++   +L+SV+ +R+G+ LFAPLLYISGML YMG+V+FD      AV ++ 
Sbjct  33   GRGPKQSIVEKVVVLLISVVFKRRGVLLFAPLLYISGMLLYMGSVNFDVVSLKNAVVVVS  92

Query  404  HRATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCANKSS--GGLP  574
             R+ PGS+YRSPQ++ KL P M +D N + + +  +W    +   W+PC +  +   GLP
Sbjct  93   KRSPPGSVYRSPQVFHKLWPHMQADSNHTHNLLMAVWNSKVRRQVWKPCISNDTPEEGLP  152

Query  575  E  577
            +
Sbjct  153  K  153



>ref|XP_007148603.1| hypothetical protein PHAVU_005G000400g [Phaseolus vulgaris]
 gb|ESW20597.1| hypothetical protein PHAVU_005G000400g [Phaseolus vulgaris]
Length=565

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 71/108 (66%), Gaps = 12/108 (11%)
 Frame = +2

Query  269  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  430
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG+ SFD V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSFSFDVVSIKNGVVLVHKRAPPGSVY  99

Query  431  RSPQLYLKLQPEMDSD-----NSSADAISTIWKHSYKGDEWRPCANKS  559
            RSPQ++ KL P M+++     N + + +   W  S +  EWRPCAN+S
Sbjct  100  RSPQVFEKLWPFMEAEAGNANNGTCNVLMKAWS-SIELREWRPCANRS  146



>ref|XP_012075789.1| PREDICTED: uncharacterized protein At1g04910 [Jatropha curcas]
 gb|KDP34835.1| hypothetical protein JCGZ_11197 [Jatropha curcas]
Length=594

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 72/107 (67%), Gaps = 9/107 (8%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-------AVPIIKHRAT  415
            + L +R  +IL+SV+ RR+G+ LFAPL+YISGML YMG+++FD          +++ R  
Sbjct  57   QNLVERLIFILVSVVFRRRGVLLFAPLMYISGMLLYMGSLNFDVDLNLKSGGVVVRKRPP  116

Query  416  PGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCAN  553
            PGS+YRSPQ++ KL P M+++ N S +A+ T W    + + W+PC N
Sbjct  117  PGSVYRSPQVFEKLWPYMETESNGSNNALMTAWDPKLR-NGWKPCGN  162



>ref|XP_011096470.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=586

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 72/113 (64%), Gaps = 7/113 (6%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT----PGS  424
            + + +RF + L+S + RR+G+ LFAPLLYISGML YMG   FDAV  I + A     PGS
Sbjct  58   KNVVERFGYFLISAMYRRRGVLLFAPLLYISGMLMYMGIFGFDAVNNISNGARDVVGPGS  117

Query  425  IYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKS--SGGLPE  577
            +YRSPQ++ KL P M+++N S++ +  +W    +   W+PC  ++    GL E
Sbjct  118  VYRSPQVFEKLWPFMEAENRSSNTLMNVWNPKLR-QGWKPCIKQTVIQSGLSE  169



>ref|XP_006579000.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=500

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 8/104 (8%)
 Frame = +2

Query  269  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  430
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG++S D V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSIDVVSIKNGVVLVHKRAPPGSVY  99

Query  431  RSPQLYLKLQPEMDSDN-SSADAISTIWKHSYKGDEWRPCANKS  559
            RSPQL+  L P M++DN ++ + +   W    +  EW+PCAN+S
Sbjct  100  RSPQLFQNLWPFMEADNGTTLNVLMRAWTKK-ELREWKPCANRS  142



>gb|KHN47089.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 8/104 (8%)
 Frame = +2

Query  269  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  430
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG++S D V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSIDVVSIKNGVVLVHKRAPPGSVY  99

Query  431  RSPQLYLKLQPEMDSDN-SSADAISTIWKHSYKGDEWRPCANKS  559
            RSPQL+  L P M++DN ++ + +   W    +  EW+PCAN+S
Sbjct  100  RSPQLFQNLWPFMEADNGTTLNVLMRAWTKK-ELREWKPCANRS  142



>ref|XP_006578999.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=566

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 8/104 (8%)
 Frame = +2

Query  269  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATPGSIY  430
            ++  +IL+S + RR+G+ LFAPLLYISGML YMG++S D V I      +  RA PGS+Y
Sbjct  40   EKLVFILMSAVFRRRGLLLFAPLLYISGMLLYMGSLSIDVVSIKNGVVLVHKRAPPGSVY  99

Query  431  RSPQLYLKLQPEMDSDN-SSADAISTIWKHSYKGDEWRPCANKS  559
            RSPQL+  L P M++DN ++ + +   W    +  EW+PCAN+S
Sbjct  100  RSPQLFQNLWPFMEADNGTTLNVLMRAWTKK-ELREWKPCANRS  142



>ref|XP_010104480.1| hypothetical protein L484_025449 [Morus notabilis]
 gb|EXC01081.1| hypothetical protein L484_025449 [Morus notabilis]
Length=290

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 74/116 (64%), Gaps = 10/116 (9%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPI------IKHRATP  418
            +++ +R   +L+S + RR+G+ L APLLYISGML YMG+VSFD V I      +  R  P
Sbjct  40   QSVMERIVLLLISAMFRRRGVLLLAPLLYISGMLLYMGSVSFDVVGIKNGVVVVHKRHPP  99

Query  419  GSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCANKS--SGGLPE  577
            GS+YRSPQ++ KL P M ++ N S +A+ ++W  S     W+PC ++     GLP+
Sbjct  100  GSVYRSPQVFEKLWPFMQAESNGSENAMMSVWN-STVHQVWKPCLHRDIPKAGLPK  154



>gb|KJB28878.1| hypothetical protein B456_005G074200 [Gossypium raimondii]
Length=461

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 73/107 (68%), Gaps = 10/107 (9%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATP  418
            ++ A +  ++L+S + RR+G+ LFAPLLYISGML YMG + FD      AV ++  R+ P
Sbjct  46   QSAANKIVFVLISTVFRRKGVLLFAPLLYISGMLLYMGLLGFDVVSLKNAVVVVHRRSPP  105

Query  419  GSIYRSPQLYLKLQPEMDSD-NSSADAISTIWK-HSYKGDEWRPCAN  553
            GS+YRSPQL+ KL P M+++ N++ +A+ T W    ++G  W+PC N
Sbjct  106  GSVYRSPQLFQKLWPYMEAESNATHNALMTAWNLKMHQG--WKPCVN  150



>ref|XP_007222464.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
 gb|EMJ23663.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
Length=569

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 78/114 (68%), Gaps = 8/114 (7%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIK  403
            G+   +++ ++   +L+SV+ +R+G+ LFAPLLYISGML YMG+VSFD      AV +++
Sbjct  32   GRGPKQSIVEKVVVLLISVVFKRRGVLLFAPLLYISGMLLYMGSVSFDVVSLKNAVVVVR  91

Query  404  HRATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCANKSS  562
             R+ PGS+YRSPQ++ KL P M ++ N + + + T+W +S     W+PC +K +
Sbjct  92   KRSPPGSLYRSPQVFQKLWPYMQAESNHTHNFLMTVW-NSKVHQVWKPCISKDT  144



>ref|XP_007020035.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY17260.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=588

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 75/107 (70%), Gaps = 10/107 (9%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATP  418
            ++ A +  ++L+S + RR+G+ LFAPL+YISGML +MGT+ FD      AV ++  R+ P
Sbjct  48   QSAADKIVFVLISAVFRRKGVLLFAPLVYISGMLLFMGTLGFDVVSLKNAVVVVHRRSPP  107

Query  419  GSIYRSPQLYLKLQPEMDSD-NSSADAISTIWK-HSYKGDEWRPCAN  553
            GS+YRSPQ++ KL P M+++ N+S +A+ T W    ++G  W+PCA+
Sbjct  108  GSVYRSPQVFQKLWPFMEAESNASYNALMTAWNLKMHQG--WKPCAS  152



>gb|KJB28877.1| hypothetical protein B456_005G074200 [Gossypium raimondii]
Length=575

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 73/107 (68%), Gaps = 10/107 (9%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATP  418
            ++ A +  ++L+S + RR+G+ LFAPLLYISGML YMG + FD      AV ++  R+ P
Sbjct  46   QSAANKIVFVLISTVFRRKGVLLFAPLLYISGMLLYMGLLGFDVVSLKNAVVVVHRRSPP  105

Query  419  GSIYRSPQLYLKLQPEMDSD-NSSADAISTIWK-HSYKGDEWRPCAN  553
            GS+YRSPQL+ KL P M+++ N++ +A+ T W    ++G  W+PC N
Sbjct  106  GSVYRSPQLFQKLWPYMEAESNATHNALMTAWNLKMHQG--WKPCVN  150



>ref|XP_002439920.1| hypothetical protein SORBIDRAFT_09g022540 [Sorghum bicolor]
 gb|EES18350.1| hypothetical protein SORBIDRAFT_09g022540 [Sorghum bicolor]
Length=175

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +2

Query  290  LSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEM  469
            L+ LLRRQ +FLFAPLLY++ ML YMG++  DAVP I  R  PGS+YRSPQLY +L+ +M
Sbjct  90   LATLLRRQAVFLFAPLLYVAAMLLYMGSLPLDAVPRIIARQPPGSVYRSPQLYARLRADM  149

Query  470  DSDNSSADAIST  505
            D+DNS+  A + 
Sbjct  150  DADNSTGAACNV  161



>ref|XP_009362462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=582

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 79/122 (65%), Gaps = 11/122 (9%)
 Frame = +2

Query  242  GQPAPR-TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPII  400
            G+  P+ ++ ++   +L+SV+ +R+ + LFAPLLY+SGML YMGTV+FD      AV ++
Sbjct  53   GRRGPKQSILEKVVVLLISVVFKRRAVLLFAPLLYLSGMLLYMGTVNFDVVSLKHAVVVV  112

Query  401  KHRATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCA--NKSSGGL  571
              R+ PGS+YRSPQ++ KL P M ++ N + + +  +W    +   W+PC   N S+ GL
Sbjct  113  SKRSPPGSVYRSPQVFHKLWPHMQAESNHTHNLLMAVWNSKVR-QVWKPCISNNISNEGL  171

Query  572  PE  577
            P+
Sbjct  172  PK  173



>gb|EMT14891.1| hypothetical protein F775_28466 [Aegilops tauschii]
Length=426

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = +2

Query  365  MGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRP  544
            MG++S D VP I  R  PGS+YRSPQLY +L+PEMD+DN++ DA++T+W+H+YKG  W+P
Sbjct  1    MGSISLDGVPRIISRPAPGSLYRSPQLYARLRPEMDADNAT-DALATVWRHAYKGGVWQP  59

Query  545  CANKSSGGLPE  577
            C + ++ GLPE
Sbjct  60   CISNNTYGLPE  70



>ref|XP_007020036.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY17261.1| O-fucosyltransferase family protein isoform 2 [Theobroma cacao]
Length=525

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 75/107 (70%), Gaps = 10/107 (9%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATP  418
            ++ A +  ++L+S + RR+G+ LFAPL+YISGML +MGT+ FD      AV ++  R+ P
Sbjct  48   QSAADKIVFVLISAVFRRKGVLLFAPLVYISGMLLFMGTLGFDVVSLKNAVVVVHRRSPP  107

Query  419  GSIYRSPQLYLKLQPEMDSD-NSSADAISTIWK-HSYKGDEWRPCAN  553
            GS+YRSPQ++ KL P M+++ N+S +A+ T W    ++G  W+PCA+
Sbjct  108  GSVYRSPQVFQKLWPFMEAESNASYNALMTAWNLKMHQG--WKPCAS  152



>ref|XP_008459666.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
 ref|XP_008459667.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=556

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 73/111 (66%), Gaps = 11/111 (10%)
 Frame = +2

Query  260  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDA--------VPIIKHRAT  415
            ++ ++  +++LS + RR+G+ LFAPLLYIS ML YMG+++FD         V  +  RA 
Sbjct  34   SIMEKLVFLILSAVFRRKGLLLFAPLLYISMMLLYMGSLNFDVSISNLKTRVVSVSKRAP  93

Query  416  PGSIYRSPQLYLKLQP--EMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            PGS+YRSPQ++ KL P  E +S NS+  A+ST W +S   + W+PC N S+
Sbjct  94   PGSLYRSPQVFEKLWPFMEAESRNSTTHALSTAW-NSRVHNVWKPCINSST  143



>ref|XP_008352830.1| PREDICTED: uncharacterized protein YGR130C-like [Malus domestica]
Length=611

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/122 (39%), Positives = 77/122 (63%), Gaps = 11/122 (9%)
 Frame = +2

Query  242  GQPAPR-TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPII  400
            G+  P+ ++ ++   +  SV  +R+ + LFAPLLY+SGML YMGTV+FD      AV ++
Sbjct  53   GRRGPKQSILEKVVVLXXSVXFKRRAVLLFAPLLYLSGMLLYMGTVNFDVVSLKNAVVVV  112

Query  401  KHRATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCA--NKSSGGL  571
              R+ PGS+YRSPQ++ KL P M ++ N + + + ++W    +   W+PC   + S+ GL
Sbjct  113  SKRSPPGSVYRSPQVFHKLWPHMQAESNHTHNLLMSVWNSKVR-QVWKPCISNDXSNEGL  171

Query  572  PE  577
            P+
Sbjct  172  PK  173



>ref|XP_004299893.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=564

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 72/108 (67%), Gaps = 7/108 (6%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVP-----IIKH  406
            G    +++ +R  + ++SV+ RR+G+ LFAPLLYISGML YMG+VSFD V      II  
Sbjct  33   GTKQQQSIVERAVFFIISVVFRRRGMLLFAPLLYISGMLLYMGSVSFDVVSLKNVVIIGK  92

Query  407  RATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPC  547
             + PGS+YRSPQ++ KL P M ++ N + + +ST+W +S     W+PC
Sbjct  93   PSPPGSVYRSPQVFQKLWPFMQAESNHTPNLLSTVW-NSKVHKVWKPC  139



>gb|EMS48050.1| hypothetical protein TRIUR3_23455 [Triticum urartu]
Length=381

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +2

Query  365  MGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRP  544
            MG++S D VP I  R  PGS+Y SPQLY +L+PEMD+DN++ DA++T+W+H+YKG  W+P
Sbjct  1    MGSISLDGVPRIISRPAPGSLYHSPQLYARLRPEMDADNAT-DALATVWRHAYKGGVWQP  59

Query  545  CANKSSGGLPE  577
            C + ++ GLPE
Sbjct  60   CISNNTYGLPE  70



>ref|XP_008339228.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=392

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 79/122 (65%), Gaps = 11/122 (9%)
 Frame = +2

Query  242  GQPAPR-TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPII  400
            G+  P+ ++ ++   +L+SV+ +R+ + LFAPLLY+SGML YMGTV+FD      AV ++
Sbjct  32   GRRGPKQSILEKVVVLLISVVFKRRAVLLFAPLLYLSGMLLYMGTVNFDVVSLKNAVVVV  91

Query  401  KHRATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPC--ANKSSGGL  571
              R+ PGS+Y SPQ++ KL P M ++ N + + + ++W    +   W+PC   + S+ GL
Sbjct  92   SKRSPPGSVYXSPQVFHKLWPHMQAESNHTHNLLMSVWNSKVR-QVWKPCISNDXSNEGL  150

Query  572  PE  577
            P+
Sbjct  151  PK  152



>gb|EYU22809.1| hypothetical protein MIMGU_mgv1a003510mg [Erythranthe guttata]
Length=580

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 72/110 (65%), Gaps = 5/110 (5%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPII--KHRAT  415
            G+   + +A+RF + L+S L R++G+ LFAPLLYI+GML YMGT+ F+A+  +       
Sbjct  50   GRVEMKNVAERFRYFLISALYRKRGVLLFAPLLYIAGMLMYMGTMGFNAMSSVGGGDAVG  109

Query  416  PGSIYRSPQLYLKLQP--EMDSDNSSADAISTIWKHSYKGDEWRPCANKS  559
            PGS+YRSP+++ KL P  E +S N +++ +S +W    K   W+PC  ++
Sbjct  110  PGSVYRSPEVFEKLWPFMEAESGNRTSNLLSNVWNPKMK-QGWKPCIKQT  158



>ref|XP_008368398.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Malus domestica]
Length=511

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 79/122 (65%), Gaps = 11/122 (9%)
 Frame = +2

Query  242  GQPAPR-TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPII  400
            G+  P+ ++ ++   +L+SV+ +R+ + LFAPLLY+SGML YMGTV+FD      AV ++
Sbjct  32   GRRGPKQSILEKVVVLLISVVFKRRAVLLFAPLLYLSGMLLYMGTVNFDVVSLKNAVVVV  91

Query  401  KHRATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPC--ANKSSGGL  571
              R+ PGS+Y SPQ++ KL P M ++ N + + + ++W    +   W+PC   + S+ GL
Sbjct  92   SKRSPPGSVYXSPQVFHKLWPHMQAESNHTHNLLMSVWNSKVR-QVWKPCISNDXSNEGL  150

Query  572  PE  577
            P+
Sbjct  151  PK  152



>gb|ERN02976.1| hypothetical protein AMTR_s00134p00089540 [Amborella trichopoda]
Length=127

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            + +  R  ++L SV+ RR G+ LF PL+YI GMLFYMG++ F+  P++ +R  PGS YRS
Sbjct  48   QNVIHRLVYLLFSVVYRRHGVLLFVPLVYICGMLFYMGSLPFEG-PVVANRPPPGSTYRS  106

Query  437  PQLYLKLQPEMDSDNSSADAI  499
            P+++ KL P M +D+++++A+
Sbjct  107  PEVFKKLWPSMQADDNASNAV  127



>ref|XP_004141562.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis sativus]
 ref|XP_011656115.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis sativus]
 gb|KGN52707.1| hypothetical protein Csa_5G651650 [Cucumis sativus]
Length=573

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 72/111 (65%), Gaps = 11/111 (10%)
 Frame = +2

Query  260  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDA--------VPIIKHRAT  415
            ++ ++  +++LS + RR+G+ LFAPLLYIS ML YMG+++FD         V  +  RA 
Sbjct  51   SIMEKLVFLILSAVFRRKGLLLFAPLLYISMMLLYMGSLNFDVSISNLKTRVVSVSKRAP  110

Query  416  PGSIYRSPQLYLKLQP--EMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            PG++YRSPQ++ KL P  E +S NS+  A+ST W +S     W+PC + S+
Sbjct  111  PGTVYRSPQVFEKLWPFMEAESRNSTTHALSTAW-NSKVHHVWKPCISSST  160



>ref|XP_002325978.2| hypothetical protein POPTR_0019s11020g [Populus trichocarpa]
 gb|EEF00360.2| hypothetical protein POPTR_0019s11020g [Populus trichocarpa]
Length=584

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 76/113 (67%), Gaps = 9/113 (8%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPGSI  427
            + +R  +++++V+LRR+G+ LFAPLLY++GM+ YMG+++FD        +++ RA PG++
Sbjct  63   VVERLMFMVVTVVLRRRGLLLFAPLLYVAGMVLYMGSLNFDVNLKNGGVVVRKRAPPGTV  122

Query  428  YRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPC--ANKSSGGLPE  577
            YRSP+++ KL P M+++ N S +A+ T W    +   W+P   +N S   LPE
Sbjct  123  YRSPKVFDKLWPYMEAESNGSHNALMTAWDPKLR-QAWKPSGISNYSDAELPE  174



>ref|XP_010246042.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nelumbo 
nucifera]
Length=510

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 4/112 (4%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD--AVPIIKH  406
            F    P   T A+R  +I+LS + R++G+ LFAPL+YISGML YMG++S +  A  ++  
Sbjct  41   FGSRSPKLHTFAERLVYIVLSAVYRKRGVLLFAPLVYISGMLLYMGSLSLEVVAPVVVVK  100

Query  407  RATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCANKS  559
             A PGS YRSPQ++ KL+P M  D N S++A+ T W H      W+ C N+S
Sbjct  101  PAPPGSTYRSPQVFEKLRPFMQDDGNHSSNALMTAW-HVKSHQSWKHCVNQS  151



>emb|CDY03127.1| BnaC06g08460D [Brassica napus]
Length=560

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 69/110 (63%), Gaps = 9/110 (8%)
 Frame = +2

Query  242  GQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIK  403
            G+ + + + +R  ++L SV+ RR+G+ L APLLYI+GML +MG+  F        V I+ 
Sbjct  31   GKTSNQGIGERLVFLLFSVVFRRKGVLLLAPLLYIAGMLLFMGSFGFTILDLGHGVDIVY  90

Query  404  HRATPGSIYRSPQLYLKLQP--EMDSDNSSADAISTIWKHSYKGDEWRPC  547
             RA PGS+YRSP+++ +L P  E D++  S +A+   WK   KG  W+PC
Sbjct  91   RRAPPGSVYRSPKVFKRLWPMMEADANRRSPNALMEAWKPRVKG-MWKPC  139



>emb|CDY66921.1| BnaAnng23210D [Brassica napus]
Length=564

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 66/103 (64%), Gaps = 9/103 (9%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  424
            + +R  ++L SV+ RR+G+ L APLLYI+GML +MG+  F        V I+  RA PGS
Sbjct  40   IGERLVFLLFSVVFRRKGVLLLAPLLYIAGMLLFMGSFGFTILDLGHGVDIVYRRAPPGS  99

Query  425  IYRSPQLYLKLQP--EMDSDNSSADAISTIWKHSYKGDEWRPC  547
            +YRSP+++ +L P  E D++ SS +A+   WK   KG  W+PC
Sbjct  100  VYRSPKVFKRLWPVMEADANRSSHNALMEAWKPRVKG-MWKPC  141



>ref|XP_010246041.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
Length=532

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 4/112 (4%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD--AVPIIKH  406
            F    P   T A+R  +I+LS + R++G+ LFAPL+YISGML YMG++S +  A  ++  
Sbjct  41   FGSRSPKLHTFAERLVYIVLSAVYRKRGVLLFAPLVYISGMLLYMGSLSLEVVAPVVVVK  100

Query  407  RATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCANKS  559
             A PGS YRSPQ++ KL+P M  D N S++A+ T W H      W+ C N+S
Sbjct  101  PAPPGSTYRSPQVFEKLRPFMQDDGNHSSNALMTAW-HVKSHQSWKHCVNQS  151



>ref|XP_010246040.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nelumbo 
nucifera]
Length=576

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 4/112 (4%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD--AVPIIKH  406
            F    P   T A+R  +I+LS + R++G+ LFAPL+YISGML YMG++S +  A  ++  
Sbjct  41   FGSRSPKLHTFAERLVYIVLSAVYRKRGVLLFAPLVYISGMLLYMGSLSLEVVAPVVVVK  100

Query  407  RATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCANKS  559
             A PGS YRSPQ++ KL+P M  D N S++A+ T W H      W+ C N+S
Sbjct  101  PAPPGSTYRSPQVFEKLRPFMQDDGNHSSNALMTAW-HVKSHQSWKHCVNQS  151



>ref|XP_009781764.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana sylvestris]
Length=565

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 67/103 (65%), Gaps = 3/103 (3%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVS-FDAVPIIKHRATPGSIYRSP  439
            L ++  ++++S + RR+G+ LFAPLLYISGML YMGT+  FDA       + PGS+YRSP
Sbjct  43   LQEKLGFMIVSAVYRRRGVLLFAPLLYISGMLLYMGTLGFFDASAATTEVSPPGSLYRSP  102

Query  440  QLYLKLQPEMDS-DNSSADAISTIWKHSYKGDEWRPCANKSSG  565
            Q++ KL P MDS +N S++ ++ +W        W+PC+    G
Sbjct  103  QVFDKLWPFMDSYNNGSSNLLTNVWNPKLH-QVWKPCSVSQEG  144



>ref|XP_010538926.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=571

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 69/107 (64%), Gaps = 9/107 (8%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATPGS  424
            LA+R  ++L+S + RR+G+ L APLLYI+GML +MG+  F        V I+  RA PGS
Sbjct  52   LAERLVFMLVSSIFRRKGVLLLAPLLYITGMLLFMGSFGFSVLDLGHGVEIVYKRAPPGS  111

Query  425  IYRSPQLYLKLQP--EMDSDNSSADAISTIWKHSYKGDEWRPCANKS  559
            +YRSP+++ +L P  E D++ SS +A+ T W    K + W+PC N +
Sbjct  112  VYRSPKVFKRLWPFMEADTNASSHNALMTAWYPRAK-NVWKPCINTN  157



>ref|XP_009114709.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=562

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 66/103 (64%), Gaps = 9/103 (9%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  424
            + +R  ++L SV+ RR+G+ L APLLYI+GML +MG+  F        V I+  RA PGS
Sbjct  40   IGERLVFLLFSVVFRRKGVLLLAPLLYIAGMLLFMGSFGFTILDLGHRVDIVYRRAPPGS  99

Query  425  IYRSPQLYLKLQP--EMDSDNSSADAISTIWKHSYKGDEWRPC  547
            +YRSP+++ +L P  E D++ SS +A+   WK   KG  W+PC
Sbjct  100  VYRSPKVFKRLWPVMEADANRSSHNALMEAWKPRVKG-MWKPC  141



>ref|XP_009594772.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana tomentosiformis]
Length=564

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVS-FDAVPIIKHRATPGSIYRSP  439
            L ++  ++++S + RR+G+ LFAPLLYISGML YMGT+  FDA       + PGS+YRSP
Sbjct  42   LQEKLGFMIVSAVYRRRGVLLFAPLLYISGMLLYMGTLGFFDASAATTEVSPPGSLYRSP  101

Query  440  QLYLKLQPEMDS-DNSSADAISTIWKHSYKGDEWRPCANKSSG  565
            Q++ KL P MDS +N S++ ++ +W        W+PC     G
Sbjct  102  QVFDKLWPFMDSHNNGSSNLLTNVWNPKLH-QVWKPCTVSQEG  143



>ref|XP_002984324.1| hypothetical protein SELMODRAFT_268854 [Selaginella moellendorffii]
 gb|EFJ14834.1| hypothetical protein SELMODRAFT_268854 [Selaginella moellendorffii]
Length=570

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 69/108 (64%), Gaps = 4/108 (4%)
 Frame = +2

Query  239  PGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATP  418
            PG P   TL QR + ++LS+LLR+  + L AP++YISGML YM T++ D +P ++    P
Sbjct  33   PGSPG-STLMQRLSCLVLSILLRQHKLLLIAPIIYISGMLLYMSTMTLD-LPRVRKPDPP  90

Query  419  GSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            GS YRSP+++  L P M + N++   I  +W+   +G+ W PC ++ S
Sbjct  91   GSRYRSPEVFANLWPAMRASNNT--GIKAVWQFPKEGEGWVPCLDRHS  136



>ref|XP_002533585.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28803.1| conserved hypothetical protein [Ricinus communis]
Length=587

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 45/119 (38%), Positives = 76/119 (64%), Gaps = 11/119 (9%)
 Frame = +2

Query  251  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-------AVPIIKHR  409
            + + + ++  ++L+SV+L+R+G+ LFAPLLYISGML YMG+++FD          +++ R
Sbjct  53   SKQNVVEKLMFVLVSVVLKRRGVLLFAPLLYISGMLLYMGSLNFDVDLNLKNGGVVVRKR  112

Query  410  ATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCANK--SSGGLPE  577
               GS+YRSPQ++ KL P M+++ N S +A++  W      + W+PC +   S   LP+
Sbjct  113  PPVGSVYRSPQVFKKLWPYMEAESNGSYNALAKAWDVKLL-EGWKPCGSNTISEAELPK  170



>ref|XP_011003993.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=590

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 43/113 (38%), Positives = 75/113 (66%), Gaps = 9/113 (8%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPGSI  427
            + +R  +++++V+LRR+G+ LFAPLLY++GM+ YMG+++FD        +++ RA PG++
Sbjct  69   VVERLMFMVVTVVLRRRGLLLFAPLLYVAGMVLYMGSLNFDVNLKNGGVVVRKRAPPGTV  128

Query  428  YRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPC--ANKSSGGLPE  577
            YRSP+++ KL P M+++ N + +A+ T W        W+P   +N S   LPE
Sbjct  129  YRSPKVFDKLWPYMEAESNGTHNALMTAWDPKLH-QAWKPSGISNYSDAELPE  180



>gb|EEC79353.1| hypothetical protein OsI_20224 [Oryza sativa Indica Group]
Length=549

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +2

Query  305  RRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNS  484
            RRQ +FLFAPLLY++ ML YMG++  D VP I  R  PGS+YRSPQLY +L+ +MD+DNS
Sbjct  79   RRQAVFLFAPLLYVAAMLLYMGSIPLDVVPRIVARPAPGSVYRSPQLYARLRADMDADNS  138

Query  485  SADAIS  502
            + DA+S
Sbjct  139  T-DAVS  143



>ref|NP_001055751.1| Os05g0459600 [Oryza sativa Japonica Group]
 gb|AAT39163.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAF17665.1| Os05g0459600 [Oryza sativa Japonica Group]
Length=519

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +2

Query  305  RRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNS  484
            RRQ +FLFAPLLY++ ML YMG++  D VP I  R  PGS+YRSPQLY +L+ +MD+DNS
Sbjct  79   RRQAVFLFAPLLYVAAMLLYMGSIPLDVVPRIVARPAPGSVYRSPQLYARLRADMDADNS  138

Query  485  SADAIST  505
            + DAI  
Sbjct  139  T-DAICN  144



>gb|KFK27807.1| hypothetical protein AALP_AA8G431600 [Arabis alpina]
Length=569

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 67/112 (60%), Gaps = 11/112 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDA------VPIIKHRATPGS  424
            L +R  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R  PGS
Sbjct  47   LGERLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHRVEIVYRRGPPGS  106

Query  425  IYRSPQLYLKLQPEMDSD--NSSADAISTIWKHSYKGDEWRPC--ANKSSGG  568
            +YRSP+++ +L P M++D   SS +A+   W    K   W+PC   N S+ G
Sbjct  107  VYRSPKVFKRLWPNMEADANGSSHNALMKTWNPRVK-STWKPCISTNVSAAG  157



>gb|AAK93632.1| putative growth regulator protein [Arabidopsis thaliana]
Length=568

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 68/112 (61%), Gaps = 11/112 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  424
            L +R  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R +PGS
Sbjct  46   LGERLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGSPGS  105

Query  425  IYRSPQLYLKLQPEMDSD--NSSADAISTIWKHSYKGDEWRPC--ANKSSGG  568
            +YRSP+++ +L P M++D   SS + +   WK   K   W+PC   N S+ G
Sbjct  106  VYRSPKVFKRLWPVMEADVNGSSHNVLMEAWKPRVK-SVWKPCISTNVSAAG  156



>ref|NP_564461.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAN12984.1| putative growth regulator [Arabidopsis thaliana]
 gb|AEE31802.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=568

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 68/112 (61%), Gaps = 11/112 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  424
            L +R  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R +PGS
Sbjct  46   LGERLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGSPGS  105

Query  425  IYRSPQLYLKLQPEMDSD--NSSADAISTIWKHSYKGDEWRPC--ANKSSGG  568
            +YRSP+++ +L P M++D   SS + +   WK   K   W+PC   N S+ G
Sbjct  106  VYRSPKVFKRLWPVMEADVNGSSHNVLMEAWKPRVK-SVWKPCISTNVSAAG  156



>ref|XP_008347877.1| PREDICTED: DDB1- and CUL4-associated factor 13-like [Malus domestica]
Length=296

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 66/95 (69%), Gaps = 7/95 (7%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHRATP  418
            +++ ++   +L+SV+ +R+G+ LFAPLLYISGML YMG+V+FD      AV ++  R+ P
Sbjct  38   QSIVEKVVVLLISVVFKRRGVLLFAPLLYISGMLLYMGSVNFDVVSLKNAVVVVSKRSPP  97

Query  419  GSIYRSPQLYLKLQPEMDSD-NSSADAISTIWKHS  520
            GS+YRSPQ++ +L P M ++ N + + +S   + S
Sbjct  98   GSVYRSPQVFHRLWPYMQAEGNHTHNLVSEFLQTS  132



>gb|AAF79365.1|AC007887_24 F15O4.45 [Arabidopsis thaliana]
Length=668

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 68/112 (61%), Gaps = 11/112 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  424
            L +R  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R +PGS
Sbjct  66   LGERLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGSPGS  125

Query  425  IYRSPQLYLKLQPEMDSD--NSSADAISTIWKHSYKGDEWRPC--ANKSSGG  568
            +YRSP+++ +L P M++D   SS + +   WK   K   W+PC   N S+ G
Sbjct  126  VYRSPKVFKRLWPVMEADVNGSSHNVLMEAWKPRVK-SVWKPCISTNVSAAG  176



>ref|XP_006397450.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
 gb|ESQ38903.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
Length=571

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 69/112 (62%), Gaps = 11/112 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  424
            + ++  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R  PGS
Sbjct  49   IGEKLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGPPGS  108

Query  425  IYRSPQLYLKLQP--EMDSDNSSADAISTIWKHSYKGDEWRPC--ANKSSGG  568
            +YRSP+++ +L P  E D++ SS +A+   WK   K + W+PC   N S+ G
Sbjct  109  VYRSPKVFKRLWPVMEADANRSSHNALMAAWKPKVK-NMWKPCITTNVSASG  159



>ref|XP_002272758.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=582

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 69/114 (61%), Gaps = 9/114 (8%)
 Frame = +2

Query  260  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT-----PGS  424
            +  +R  ++ +S + RR+G+ LFAP+LYISGML YMG++SFD               PGS
Sbjct  56   SFVERVMFVFVSAVFRRRGLLLFAPVLYISGMLLYMGSLSFDGGGGGGGGGGAEAQPPGS  115

Query  425  IYRSPQLYLKLQPEMDSD-NSSADAISTIWKHSYKGDEWRPCANK--SSGGLPE  577
            +YRSP+++ KL   M+ + N S +A+ T+W H      W+PC N+  S+  LP+
Sbjct  116  VYRSPEVFEKLWAFMEGESNRSHNALMTVW-HPKPHQSWKPCVNQRISAAELPK  168



>ref|XP_003598018.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES68269.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=577

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 70/101 (69%), Gaps = 6/101 (6%)
 Frame = +2

Query  275  FAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT----PGSIYRSPQ  442
            F ++ +S + RR+G+ LFAPLLYI+GML YMG++SFD V + KH       PGS+Y SPQ
Sbjct  38   FVYLFMSAIFRRRGLLLFAPLLYIAGMLLYMGSLSFDIVLVSKHHRLPPPPPGSLYTSPQ  97

Query  443  LYLKLQPEMDSDNSSADAISTIWKH-SYKGD-EWRPCANKS  559
            L+  L P M + ++++ +++ + K  + K D +W+PCANK+
Sbjct  98   LFHNLWPFMLNSSNNSTSLNVLMKAWTVKEDRQWKPCANKT  138



>ref|XP_002891187.1| hypothetical protein ARALYDRAFT_473680 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67446.1| hypothetical protein ARALYDRAFT_473680 [Arabidopsis lyrata subsp. 
lyrata]
Length=569

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 68/112 (61%), Gaps = 11/112 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  424
            L +R  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R  PGS
Sbjct  47   LGERLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYSRGPPGS  106

Query  425  IYRSPQLYLKLQPEMDSD--NSSADAISTIWKHSYKGDEWRPC--ANKSSGG  568
            +YRSP+++ +L P M++D   +S + +  +WK   K   W+PC   N S+ G
Sbjct  107  VYRSPKVFKRLWPLMEADVNGTSHNVLMEVWKPRVK-SIWKPCISTNVSAAG  157



>ref|XP_010061980.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Eucalyptus 
grandis]
Length=454

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 71/111 (64%), Gaps = 6/111 (5%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR-  409
            F  G+   ++L +R    ++S + RR+G+ LFAP+LYI+GM+ YMG+  FD V + ++  
Sbjct  34   FGGGRWPKKSLVERLVLAIVSAVFRRRGVLLFAPVLYITGMVLYMGSFGFD-VGLRRNAD  92

Query  410  --ATPGSIYRSPQLYLKLQPEMDS-DNSSADAISTIWKHSYKGDEWRPCAN  553
              A PGS+YRSPQ++ KL P M++  NSS +A++  W  +     W+PC +
Sbjct  93   GPAPPGSVYRSPQVFEKLWPLMETASNSSFNALTMAWSPTLH-QSWKPCGS  142



>ref|XP_006473172.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=450

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 6/107 (6%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  421
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  43   QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRERAPPG  102

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            S+YRSPQ++ KL P M ++  + + + T W +S     W+PCA++S+
Sbjct  103  SVYRSPQVFQKLWPFMQAEAIANNTLMTAW-NSKVHQPWKPCADRSN  148



>gb|EPS61677.1| hypothetical protein M569_13117, partial [Genlisea aurea]
Length=421

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 70/112 (63%), Gaps = 10/112 (9%)
 Frame = +2

Query  251  APRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAV------PIIKHRA  412
            A + +A  FA++L+S L RR+G+ LFAPL+YISG++ YMG + F++V       +     
Sbjct  10   ASKNMAAGFAYLLISALYRRKGMLLFAPLIYISGLVVYMGWIGFESVNSQRINTVGSDAV  69

Query  413  TPGSIYRSPQLYLKLQPEMDSD---NSSADAISTIWKHSYKGDEWRPCANKS  559
             PG++YRSP+L+ KL P M+S+   N S++ +  +W       EW+P  ++S
Sbjct  70   GPGTLYRSPELFEKLWPFMESETSSNKSSNTLINVWSPKLH-KEWKPSIDQS  120



>gb|KDO83868.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=455

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 6/107 (6%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  421
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  43   QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRERAPPG  102

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            S+YRSPQ++ KL P M ++  + + + T W +S     W+PCA++S+
Sbjct  103  SVYRSPQVFQKLWPFMQAEAIANNTLMTAW-NSKVHQPWKPCADRSN  148



>ref|XP_010543593.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Tarenaya 
hassleriana]
Length=577

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 69/112 (62%), Gaps = 11/112 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  424
            L +R  ++L+S + RR+G+ L APLLYI+GML +MG+  F        V II  R  PGS
Sbjct  56   LVERLVFVLVSAVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIIYKRGPPGS  115

Query  425  IYRSPQLYLKLQPEMDSDNSSA--DAISTIWKHSYKGDEWRPC--ANKSSGG  568
            +YRSP+++ +L P M++D ++   +A+ T W  + +   W+PC   N S+ G
Sbjct  116  VYRSPKVFKRLWPMMEADINATHHNALMTAWNPNVQSI-WKPCISTNVSTSG  166



>ref|XP_010543575.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543584.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Tarenaya 
hassleriana]
Length=587

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 69/112 (62%), Gaps = 11/112 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRATPGS  424
            L +R  ++L+S + RR+G+ L APLLYI+GML +MG+  F        V II  R  PGS
Sbjct  56   LVERLVFVLVSAVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIIYKRGPPGS  115

Query  425  IYRSPQLYLKLQPEMDSDNSSA--DAISTIWKHSYKGDEWRPC--ANKSSGG  568
            +YRSP+++ +L P M++D ++   +A+ T W  + +   W+PC   N S+ G
Sbjct  116  VYRSPKVFKRLWPMMEADINATHHNALMTAWNPNVQSI-WKPCISTNVSTSG  166



>gb|KCW69027.1| hypothetical protein EUGRSUZ_F02582 [Eucalyptus grandis]
Length=524

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 71/111 (64%), Gaps = 6/111 (5%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR-  409
            F  G+   ++L +R    ++S + RR+G+ LFAP+LYI+GM+ YMG+  FD V + ++  
Sbjct  34   FGGGRWPKKSLVERLVLAIVSAVFRRRGVLLFAPVLYITGMVLYMGSFGFD-VGLRRNAD  92

Query  410  --ATPGSIYRSPQLYLKLQPEMDS-DNSSADAISTIWKHSYKGDEWRPCAN  553
              A PGS+YRSPQ++ KL P M++  NSS +A++  W  +     W+PC +
Sbjct  93   GPAPPGSVYRSPQVFEKLWPLMETASNSSFNALTMAWSPTLH-QSWKPCGS  142



>ref|XP_010061979.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69026.1| hypothetical protein EUGRSUZ_F02582 [Eucalyptus grandis]
Length=562

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 71/111 (64%), Gaps = 6/111 (5%)
 Frame = +2

Query  233  FTPGQPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHR-  409
            F  G+   ++L +R    ++S + RR+G+ LFAP+LYI+GM+ YMG+  FD V + ++  
Sbjct  34   FGGGRWPKKSLVERLVLAIVSAVFRRRGVLLFAPVLYITGMVLYMGSFGFD-VGLRRNAD  92

Query  410  --ATPGSIYRSPQLYLKLQPEMDS-DNSSADAISTIWKHSYKGDEWRPCAN  553
              A PGS+YRSPQ++ KL P M++  NSS +A++  W  +     W+PC +
Sbjct  93   GPAPPGSVYRSPQVFEKLWPLMETASNSSFNALTMAWSPTLH-QSWKPCGS  142



>gb|KDO83867.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=523

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 6/107 (6%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  421
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  43   QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRERAPPG  102

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            S+YRSPQ++ KL P M ++  + + + T W +S     W+PCA++S+
Sbjct  103  SVYRSPQVFQKLWPFMQAEAIANNTLMTAW-NSKVHQPWKPCADRSN  148



>ref|XP_006473171.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 gb|KDO83865.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
 gb|KDO83866.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=570

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 6/107 (6%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  421
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  43   QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRERAPPG  102

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            S+YRSPQ++ KL P M ++  + + + T W +S     W+PCA++S+
Sbjct  103  SVYRSPQVFQKLWPFMQAEAIANNTLMTAW-NSKVHQPWKPCADRSN  148



>ref|XP_002972493.1| hypothetical protein SELMODRAFT_441812 [Selaginella moellendorffii]
 gb|EFJ26579.1| hypothetical protein SELMODRAFT_441812 [Selaginella moellendorffii]
Length=870

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 64/100 (64%), Gaps = 3/100 (3%)
 Frame = +2

Query  269  QRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLY  448
            QR + ++LS+LLR+  + L AP++YISGML YM T++ D +P ++    PGS YRSP+++
Sbjct  2    QRLSCLVLSILLRQHKLLLIAPIIYISGMLLYMSTMTLD-LPRVRKPDPPGSRYRSPEVF  60

Query  449  LKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSSGG  568
              L P M + N++   I  +W+   +G+ W PC ++ S  
Sbjct  61   ANLWPAMRASNNT--GIKAVWQFPKEGEGWVPCLDRHSSN  98



>ref|XP_006434583.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 ref|XP_006434584.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47823.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47824.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=570

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 6/107 (6%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  421
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  43   QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRKRAPPG  102

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            S+YRSPQ++ KL P M ++  + + + T W +S     W+PCA++S+
Sbjct  103  SVYRSPQVFQKLWPFMQAEAITNNTLMTAW-NSKVHQPWKPCADRSN  148



>ref|XP_004237568.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=571

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 67/112 (60%), Gaps = 19/112 (17%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAV----------P  394
            Q   +  A++  ++++S + RR+G+ LFAPLLYISGML YMG + FDA           P
Sbjct  39   QVKLQNFAEKLGFMIVSAVYRRRGVLLFAPLLYISGMLLYMGALGFDASRTSGGGTGLDP  98

Query  395  IIKHRATPGSIYRSPQLYLKLQPEMDSDNS-SADAISTIWKHSYKGDEWRPC  547
            I       GS+YRSPQ++ KL P MD++N+ S++ ++ +W        W+PC
Sbjct  99   I-------GSVYRSPQVFEKLWPLMDAENNGSSNLLTNVWNLKLH-QVWKPC  142



>ref|XP_006387763.1| hypothetical protein POPTR_0603s002101g, partial [Populus trichocarpa]
 gb|ERP46677.1| hypothetical protein POPTR_0603s002101g, partial [Populus trichocarpa]
Length=145

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 62/82 (76%), Gaps = 5/82 (6%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAV-----PIIKHRATPGSI  427
            + +R  +++++V+LRR+G+ LFAPLLY++GM+ YMG+++FD        +++ RA PG++
Sbjct  63   VVERLMFMVVTVVLRRRGLLLFAPLLYVAGMVLYMGSLNFDVNLKNGGVVVRKRAPPGTV  122

Query  428  YRSPQLYLKLQPEMDSDNSSAD  493
            YRSP+++ KL P M+++++ + 
Sbjct  123  YRSPKVFDKLWPYMEAESNGSH  144



>ref|XP_010319880.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=568

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 67/112 (60%), Gaps = 19/112 (17%)
 Frame = +2

Query  245  QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAV----------P  394
            Q   +  A++  ++++S + RR+G+ LFAPLLYISGML YMG + FDA           P
Sbjct  39   QVKLQNFAEKLGFMIVSAVYRRRGVLLFAPLLYISGMLLYMGALGFDASRTSGGGTGLDP  98

Query  395  IIKHRATPGSIYRSPQLYLKLQPEMDSDNS-SADAISTIWKHSYKGDEWRPC  547
            I       GS+YRSPQ++ KL P MD++N+ S++ ++ +W        W+PC
Sbjct  99   I-------GSVYRSPQVFEKLWPLMDAENNGSSNLLTNVWNLKLH-QVWKPC  142



>ref|XP_006434581.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47821.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=656

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 69/107 (64%), Gaps = 6/107 (6%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD-----AVPIIKHRATPG  421
            + L ++   +L+S + +R+G+ L APLLYIS ML YM +  FD     +V +++ RA PG
Sbjct  129  QNLVEKLVVVLISAVFKRKGVLLVAPLLYISVMLLYMSSFGFDVVDLKSVVVVRKRAPPG  188

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            S+YRSPQ++ KL P M ++  + + + T W +S     W+PCA++S+
Sbjct  189  SVYRSPQVFQKLWPFMQAEAITNNTLMTAW-NSKVHQPWKPCADRSN  234



>ref|XP_010680244.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=598

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 69/124 (56%), Gaps = 24/124 (19%)
 Frame = +2

Query  260  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVP---------------  394
               +R  +I+++ + RR+G+ LFAPLLYI+GML YMG++S D+                 
Sbjct  54   NFVERVVYIVIATVFRRKGVLLFAPLLYITGMLAYMGSLSLDSKVNGGERIGLEKLKGNI  113

Query  395  -------IIKHRATPGSIYRSPQLYLKLQPEM-DSDNSSADAISTIWKHSYKGDEWRPCA  550
                   ++     PGS+YRSP+++ +L P + D  N S +A++T+W   Y+   W+PC 
Sbjct  114  VEFSGGFVLNEPRLPGSLYRSPEVFERLWPFLQDEANHSTNALTTVWPTRYQ-RGWKPCI  172

Query  551  NKSS  562
            N S+
Sbjct  173  NNSA  176



>ref|XP_010680324.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=596

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 69/124 (56%), Gaps = 24/124 (19%)
 Frame = +2

Query  260  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVP---------------  394
               +R  +I+++ + RR+G+ LFAPLLYI+GML YMG++S D+                 
Sbjct  54   NFVERVVYIVIATVFRRKGVLLFAPLLYITGMLAYMGSLSLDSKVNGGERIGLEKLKGNI  113

Query  395  -------IIKHRATPGSIYRSPQLYLKLQPEM-DSDNSSADAISTIWKHSYKGDEWRPCA  550
                   ++     PGS+YRSP+++ +L P + D  N S +A++T+W   Y+   W+PC 
Sbjct  114  VEFSGGFVLNEPRLPGSLYRSPEVFERLWPFLQDEANHSTNALTTVWPTRYQ-RGWKPCI  172

Query  551  NKSS  562
            N S+
Sbjct  173  NNSA  176



>ref|XP_006349651.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=571

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 70/118 (59%), Gaps = 21/118 (18%)
 Frame = +2

Query  233  FTPG--QPAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAV-----  391
            FT G  Q   +  A++  ++++S + RR+G+ LFAPLLYISGML YMG + FDA      
Sbjct  33   FTSGNCQVNLQNFAEKLGFMIVSAVYRRRGVLLFAPLLYISGMLLYMGALGFDASRTSGG  92

Query  392  -----PIIKHRATPGSIYRSPQLYLKLQPEMDSDNS-SADAISTIWKHSYKGDEWRPC  547
                 PI       GS+YRSPQ++ KL P M+++N+ S++ ++ +W        W+PC
Sbjct  93   GTGLDPI-------GSVYRSPQVFEKLWPLMEAENNGSSNLLTNVWNPKLH-QVWKPC  142



>ref|XP_010500036.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHR-ATPG  421
            L ++  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R   PG
Sbjct  54   LGEKLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGGPPG  113

Query  422  SIYRSPQLYLKLQPEMDSD--NSSADAISTIWKHSYKGDEWRPC  547
            S+YRSP+++ +L P M++D   +S +A+   WK   K   W+PC
Sbjct  114  SVYRSPKVFKRLWPVMEADVNGTSHNALMAAWKPRVK-SVWKPC  156



>ref|XP_010461317.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFD------AVPIIKHR-ATPG  421
            L ++  ++L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R   PG
Sbjct  54   LGEKLVFLLFSIVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGGPPG  113

Query  422  SIYRSPQLYLKLQPEMDSD--NSSADAISTIWKHSYKGDEWRPC  547
            S+YRSP+++ +L P M++D   +S +A+   WK   K   W+PC
Sbjct  114  SVYRSPKVFKRLWPVMEADVNGTSHNALMAAWKPRVK-SVWKPC  156



>ref|XP_008781543.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Phoenix dactylifera]
Length=423

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = +2

Query  302  LRRQGIFLFAPLLYISGMLFYMGTVSFDAVP------IIKHRATPGSIYRSPQLYLKLQP  463
             RR+GI L APLLY+S ML +MG+ + DAVP      ++  R  PG++YRS Q++  L P
Sbjct  48   FRRRGILLVAPLLYVSAMLVFMGSWNLDAVPVRVGVAVLHRRPPPGAVYRSHQVFESLWP  107

Query  464  EMDSDNSSADAISTIWKHSYKGDEWRPCANK  556
             M +D + ++A+ T W H      W+PC NK
Sbjct  108  FMQADVNHSNALMTAW-HQKASQRWKPCLNK  137



>emb|CDP10650.1| unnamed protein product [Coffea canephora]
Length=573

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (64%), Gaps = 10/107 (9%)
 Frame = +2

Query  266  AQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT------PGSI  427
             +R  + ++S + RR+G+ L APLLYIS ML YMGTV FD+V + ++         PGS+
Sbjct  48   VERLGFAVISTVYRRRGVLLLAPLLYISVMLLYMGTVGFDSV-VSRNGGNGDDLTRPGSL  106

Query  428  YRSPQLYLKLQP--EMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            YRSPQ++ KL P  E +S+ SS++ I  +W    +   W+PC ++++
Sbjct  107  YRSPQVFEKLWPFMEAESNGSSSNLIMNVWTLKPR-QSWKPCIHQTA  152



>ref|XP_008781542.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Phoenix dactylifera]
Length=461

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = +2

Query  302  LRRQGIFLFAPLLYISGMLFYMGTVSFDAVP------IIKHRATPGSIYRSPQLYLKLQP  463
             RR+GI L APLLY+S ML +MG+ + DAVP      ++  R  PG++YRS Q++  L P
Sbjct  48   FRRRGILLVAPLLYVSAMLVFMGSWNLDAVPVRVGVAVLHRRPPPGAVYRSHQVFESLWP  107

Query  464  EMDSDNSSADAISTIWKHSYKGDEWRPCANK  556
             M +D + ++A+ T W H      W+PC NK
Sbjct  108  FMQADVNHSNALMTAW-HQKASQRWKPCLNK  137



>ref|XP_001760728.1| predicted protein [Physcomitrella patens]
 gb|EDQ74467.1| predicted protein [Physcomitrella patens]
Length=558

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 2/108 (2%)
 Frame = +2

Query  260  TLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSP  439
            T +Q+    LLS   RR  + LF P +Y++GML YMG       P    R  PGS+YRS 
Sbjct  22   TWSQKLTHFLLSFFRRRNRVLLFIPFIYVTGMLLYMGGDISMEFPPFPGRYRPGSVYRSD  81

Query  440  QLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCAN--KSSGGLPE  577
            Q++ KL PEM+  +SS+  + + W++  KG  + PC +      GLPE
Sbjct  82   QVFEKLWPEMERADSSSYGVLSAWEYPKKGGGFTPCLSSINQKAGLPE  129



>ref|XP_010478945.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=571

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 10/104 (10%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHRAT-PG  421
            L ++  ++L S++ RR+   L APLLYI+GML +MG+  F        V I+  R   PG
Sbjct  52   LGEKLVFLLFSIVFRRKSFLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGGPPG  111

Query  422  SIYRSPQLYLKLQPEMDSD--NSSADAISTIWKHSYKGDEWRPC  547
            S+YRSP+++ +L P M++D   +S +A+   WK   K   W+PC
Sbjct  112  SVYRSPKVFKRLWPVMEADVNGTSHNALMAAWKPRVK-SVWKPC  154



>ref|XP_006304663.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
 gb|EOA37561.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
Length=580

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 66/120 (55%), Gaps = 19/120 (16%)
 Frame = +2

Query  263  LAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF------DAVPIIKHR-----  409
            L ++  + L S++ RR+G+ L APLLYI+GML +MG+  F        V I+  R     
Sbjct  48   LGEKLVFSLFSLVFRRKGVLLLAPLLYIAGMLLFMGSFGFTVLDLGHGVEIVYRRGGGGG  107

Query  410  ---ATPGSIYRSPQLYLKLQPEMDSD--NSSADAISTIWKHSYKGDEWRPC--ANKSSGG  568
                 PGS+YRSP+++ +L   M+SD   SS +A+   WK   K   W+PC   N S+ G
Sbjct  108  GGGGAPGSVYRSPKVFKRLWNVMESDVNGSSHNALMAAWKPRVK-SLWKPCISTNVSAAG  166



>ref|XP_010930789.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910-like 
[Elaeis guineensis]
Length=553

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = +2

Query  320  FLFAPLLYISGMLFYMGTVSFDAVP------IIKHRATPGSIYRSPQLYLKLQPEMDSDN  481
             L AP+LY+S ML +MG+ + DAVP      +++ R  PG++YRSPQ++ +L P M +D 
Sbjct  58   LLLAPVLYVSAMLVFMGSWNLDAVPVRVGVAVLRRRPLPGAVYRSPQVFERLWPFMQADV  117

Query  482  SSADAISTIWKHSYKGDEWRPCANK  556
            + ++A++  W H      W+PC NK
Sbjct  118  NHSNALTRAW-HQKASQRWKPCVNK  141



>ref|XP_010930931.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=545

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 49/84 (58%), Gaps = 4/84 (5%)
 Frame = +2

Query  308  RQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSS  487
            R  +F    +LY+ G L   G+VS    P     A PGS+YRSP+L+ KL PEM  DNSS
Sbjct  41   RMPVFFVVVMLYVVGFLLCAGSVSMLMHP----PAAPGSVYRSPELFKKLWPEMQLDNSS  96

Query  488  ADAISTIWKHSYKGDEWRPCANKS  559
               ++ +WK+  +  +W+PC N S
Sbjct  97   GVDLNAVWKYGKRLKQWKPCTNSS  120



>emb|CAN77312.1| hypothetical protein VITISV_026198 [Vitis vinifera]
Length=312

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 55/95 (58%), Gaps = 5/95 (5%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRAT-----PG  421
             +  +R  ++ +S + RR+G+ LFAP+LYISGML YMG++SFD               PG
Sbjct  55   HSFVERVMFVFVSAVFRRRGLLLFAPVLYISGMLLYMGSLSFDGGGGGGGGGGAEAQPPG  114

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYK  526
            S+YRSP+++ KL   M+ +++ +     I +   +
Sbjct  115  SVYRSPEVFEKLWAFMEGESNRSHNARVIVEEEXR  149



>ref|XP_010912508.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=550

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 66/109 (61%), Gaps = 7/109 (6%)
 Frame = +2

Query  248  PAPRTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVP------IIKHR  409
            P P++  +R  + +L+ LLRR+G  L APLLY+S M  ++G  + D+VP      ++  R
Sbjct  31   PRPKSGVERLLYAVLATLLRRRGFLLLAPLLYVSAMPVFLGRWNLDSVPVRVRVAVLHRR  90

Query  410  ATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANK  556
              PG++YRSP+++ +L P M +D + + A+ T W H      W+PC NK
Sbjct  91   PPPGAVYRSPRVFERLWPFMQADVNHSIALMTAW-HQKASQRWKPCVNK  138



>ref|XP_006847061.1| PREDICTED: uncharacterized protein At1g04910 [Amborella trichopoda]
 gb|ERN08642.1| hypothetical protein AMTR_s00017p00201590 [Amborella trichopoda]
Length=539

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 57/107 (53%), Gaps = 9/107 (8%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQG-----IFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPG  421
            ++   + A+I+      R+G     + LF PLLY+S ML   G   F   P +     PG
Sbjct  16   KSFLVKVAYIVFFSFFTRRGRGRFSLLLFGPLLYVSAMLICAGPFPFSTTPSL----PPG  71

Query  422  SIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            S+YRS + + KL P M SDN S+  ++ +WK+      W+ CAN++S
Sbjct  72   SLYRSSEAFWKLWPAMQSDNGSSIELTAVWKYHKSPAGWKLCANQTS  118



>ref|XP_008784225.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=552

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 52/82 (63%), Gaps = 7/82 (9%)
 Frame = +2

Query  329  APLLYISGMLFYMGTVSFDA------VPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSA  490
            APLLY+S ML ++G  + D+      +P+++ R  PG+ YRSPQ++ +L P M +D + +
Sbjct  60   APLLYVSAMLVFIGRWNLDSTPVRVGMPVLRRRPPPGAAYRSPQVFERLWPFMQADVNHS  119

Query  491  DAISTIWKHSYKGDEWRPCANK  556
            +A+ T W H  +   W+PC NK
Sbjct  120  NALMTAW-HQKERQRWKPCINK  140



>gb|KHN08072.1| DUF246 domain-containing protein [Glycine soja]
Length=449

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  467  MDSDNSSADAISTIWKHSYKGDEWRPCANKSSGGLPE  577
            MDSDNSSADAISTIWK+ Y+G EW+PC N+SS GLPE
Sbjct  1    MDSDNSSADAISTIWKYPYRGGEWKPCVNRSSEGLPE  37



>ref|XP_004513833.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=580

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  320  FLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAI  499
            F   P++YISG+L  +G   F    +I H   PGS YRS +++ KL  ++DSDNSS   +
Sbjct  62   FFLLPVVYISGLLMCVGPFPFKFSALIGHAPLPGSRYRSHEVFHKLWHDIDSDNSSFIEL  121

Query  500  STIWKHSYKGDEWRPCAN  553
            S++WK+  K  E +PC N
Sbjct  122  SSVWKYKRKLREQKPCPN  139



>ref|XP_010664246.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Vitis 
vinifera]
Length=588

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 55/86 (64%), Gaps = 6/86 (7%)
 Frame = +2

Query  308  RQGI--FLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDN  481
            R+G+  FL  PL YISG+L  +G  S     ++     PGS+YRS +++ KL  E++SDN
Sbjct  62   RRGLRYFLLLPLFYISGLLMCVGPFS----GLVWQAPLPGSVYRSHEIFEKLWHEIESDN  117

Query  482  SSADAISTIWKHSYKGDEWRPCANKS  559
            SSA  +S++W+++ +  E +PC N S
Sbjct  118  SSAIELSSVWRYNRRLKEQKPCPNTS  143



>ref|XP_002284399.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Vitis 
vinifera]
Length=585

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 57/89 (64%), Gaps = 6/89 (7%)
 Frame = +2

Query  299  LLRRQGI--FLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMD  472
            ++ R+G+  FL  PL YISG+L  +G  S     ++     PGS+YRS +++ KL  E++
Sbjct  59   IIIRRGLRYFLLLPLFYISGLLMCVGPFS----GLVWQAPLPGSVYRSHEIFEKLWHEIE  114

Query  473  SDNSSADAISTIWKHSYKGDEWRPCANKS  559
            SDNSSA  +S++W+++ +  E +PC N S
Sbjct  115  SDNSSAIELSSVWRYNRRLKEQKPCPNTS  143



>emb|CBI19065.3| unnamed protein product [Vitis vinifera]
Length=585

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 55/86 (64%), Gaps = 6/86 (7%)
 Frame = +2

Query  308  RQGI--FLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDN  481
            R+G+  FL  PL YISG+L  +G  S     ++     PGS+YRS +++ KL  E++SDN
Sbjct  62   RRGLRYFLLLPLFYISGLLMCVGPFS----GLVWQAPLPGSVYRSHEIFEKLWHEIESDN  117

Query  482  SSADAISTIWKHSYKGDEWRPCANKS  559
            SSA  +S++W+++ +  E +PC N S
Sbjct  118  SSAIELSSVWRYNRRLKEQKPCPNTS  143



>gb|EMS66777.1| hypothetical protein TRIUR3_19446 [Triticum urartu]
Length=399

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +2

Query  353  MLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAIST  505
            ML YMG++  D VP I  R+ PGS+YRSPQLY +L+P+MD+DNS+ DAI  
Sbjct  1    MLLYMGSLPLDVVPRIITRSAPGSVYRSPQLYARLRPDMDADNST-DAICN  50



>ref|XP_003614789.1| Growth regulator-related protein [Medicago truncatula]
 gb|AES97747.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=589

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +2

Query  320  FLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAI  499
            F   P++Y+SG+L  +G   F     I H   PGS YRS +++  L PE+DSDNSS   +
Sbjct  68   FFLLPVVYLSGLLMCVGPFPFTF--FIGHTPLPGSRYRSHEVFDHLWPEIDSDNSSFIEL  125

Query  500  STIWKHSYKGDEWRPCAN  553
            S++WK+  K  E +PC+N
Sbjct  126  SSVWKYKRKLREKKPCSN  143



>gb|EEC71770.1| hypothetical protein OsI_04380 [Oryza sativa Indica Group]
Length=440

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +2

Query  353  MLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAIST  505
            ML YMG++S D+VP I  R  PGS+YRSPQLY +L+ +MD+DN++ DAI  
Sbjct  1    MLLYMGSISLDSVPRIISRPAPGSLYRSPQLYARLRADMDADNAT-DAICN  50



>ref|XP_006596302.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=584

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 5/91 (5%)
 Frame = +2

Query  284  ILLSVLLRRQGIFLFA-PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQ  460
            ++  ++ RR   F F  PL+YISG+L  +G  S     +I H   PGS YRS +++  L 
Sbjct  58   LVAGIMARRSLRFFFLLPLVYISGLLMCVGPFS----ALIGHTLLPGSRYRSHEIFHNLW  113

Query  461  PEMDSDNSSADAISTIWKHSYKGDEWRPCAN  553
             +++ DNSSA  ++++WK+  K  E +PC N
Sbjct  114  HDIEGDNSSATELASVWKYKRKLREQKPCPN  144



>gb|KJB28879.1| hypothetical protein B456_005G074200 [Gossypium raimondii]
Length=547

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 57/101 (56%), Gaps = 26/101 (26%)
 Frame = +2

Query  257  RTLAQRFAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRS  436
            ++ A +  ++L+S + RR+G+ LFAPLL                      R+ PGS+YRS
Sbjct  46   QSAANKIVFVLISTVFRRKGVLLFAPLL----------------------RSPPGSVYRS  83

Query  437  PQLYLKLQPEMDSD-NSSADAISTIWK-HSYKGDEWRPCAN  553
            PQL+ KL P M+++ N++ +A+ T W    ++G  W+PC N
Sbjct  84   PQLFQKLWPYMEAESNATHNALMTAWNLKMHQG--WKPCVN  122



>ref|XP_007141089.1| hypothetical protein PHAVU_008G166600g [Phaseolus vulgaris]
 gb|ESW13083.1| hypothetical protein PHAVU_008G166600g [Phaseolus vulgaris]
Length=582

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 55/91 (60%), Gaps = 6/91 (7%)
 Frame = +2

Query  287  LLSVLLRRQGI--FLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQ  460
            L++V++ R+ +  F   P++YISG+L  +G  S     +I H   PGS YRS +++  L 
Sbjct  56   LVAVIMARRSLRYFFLLPVVYISGLLMCVGPFS----ALIGHTPLPGSRYRSHEIFHNLL  111

Query  461  PEMDSDNSSADAISTIWKHSYKGDEWRPCAN  553
              +++DNSS   ++++WK+  K  E +PC N
Sbjct  112  HHIETDNSSVIELASVWKYKRKLREQKPCPN  142



>gb|EEE55649.1| hypothetical protein OsJ_04031 [Oryza sativa Japonica Group]
Length=422

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +2

Query  353  MLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSS  487
            ML YMG++S D+VP I  R  PGS+YRSPQLY +L+ +MD+DN++
Sbjct  1    MLLYMGSISLDSVPRIISRPAPGSLYRSPQLYARLRADMDADNAT  45



>ref|XP_010091349.1| hypothetical protein L484_020151 [Morus notabilis]
 gb|EXB44339.1| hypothetical protein L484_020151 [Morus notabilis]
Length=1270

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = +2

Query  305  RRQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATP-GSIYRSPQLYLKLQPEMDSDN  481
            R+    L  P+LY+SG++  +G  S     ++ H   P GS+YRS Q++ KL  ++ SDN
Sbjct  53   RKLRYLLVLPMLYVSGLIMCVGPFS----ALVGHSPPPPGSVYRSHQMFQKLWDDIHSDN  108

Query  482  SSADAISTIWKHSYKGDEWRPCANKSSGGL  571
            SSA  +S++W +  +  E +PC N ++G L
Sbjct  109  SSAIQLSSVWSYRRRLKEQKPCPNSTAGQL  138



>ref|XP_009379852.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=536

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 7/91 (8%)
 Frame = +2

Query  302  LRRQGIFLFAPLLYISGMLFYMGTVSFDAVP------IIKHRATPGSIYRSPQLYLKLQP  463
            LR +   L  PL+Y++ ML  +G  + +A+P      I+K    PGS+YRSPQ++ KL P
Sbjct  36   LRWRVALLLVPLVYVALMLVLVGWWNLEAMPARVGVAILKRAPPPGSVYRSPQVFRKLWP  95

Query  464  EMDSDNSSADAISTIWKHSYKGDEWRPCANK  556
             M SD + ++A+   W H      W+PC  K
Sbjct  96   FMQSDFNHSNALMMAW-HQKTTQRWKPCLRK  125



>ref|XP_002513766.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48349.1| conserved hypothetical protein [Ricinus communis]
Length=591

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = +2

Query  320  FLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAI  499
             L  PLLYISG++  +G  S    P     + PG++YRS  L+LKL P + +DNS++  +
Sbjct  77   LLVLPLLYISGLIMCVGPFSALLQP-----SLPGAVYRSHDLFLKLWPHISADNSTSIEL  131

Query  500  STIWKHSYKGDEWRPCANKSS  562
            S++WK   +    RPC N ++
Sbjct  132  SSVWKFKRRSKLQRPCPNSTA  152



>gb|EEE63981.1| hypothetical protein OsJ_18808 [Oryza sativa Japonica Group]
Length=876

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  353  MLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAIS  502
            ML YMG++  D VP I  R  PGS+YRSPQLY +L+ +MD+D S+ DA+S
Sbjct  1    MLLYMGSIPLDVVPRIVARPAPGSVYRSPQLYARLRADMDADKST-DAVS  49



>ref|XP_008219032.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=503

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 8/77 (10%)
 Frame = +2

Query  353  MLFYMGTVSFD------AVPIIKHRATPGSIYRSPQLYLKLQPEMDSD-NSSADAISTIW  511
            ML YMG+VSFD      AV ++  R+ PGS+YRSPQ++ KL P M ++ N + + + T+W
Sbjct  1    MLLYMGSVSFDVVSLKNAVVVVSKRSPPGSLYRSPQVFQKLWPYMQAESNHTHNFLMTVW  60

Query  512  KHSYKGDEWRPCANKSS  562
             +S     W+PC  K +
Sbjct  61   -NSKVHQVWKPCITKDT  76



>ref|XP_010272863.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=587

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 11/103 (11%)
 Frame = +2

Query  275  FAWILLSVLLRRQGIFLFAPLLYISGMLFYMGTVSF--------DAVPIIKHRATPGSIY  430
            FA +L     R   IF+  P+ YISGM+ ++GT S          +   +     PGS+Y
Sbjct  59   FACVLSQRNFR---IFILVPVFYISGMIIFLGTFSVVMRPRSCSPSPSPLLPPPQPGSVY  115

Query  431  RSPQLYLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKS  559
            RS +++  L P++ SDN+S   +S++W++S K  E +PC N +
Sbjct  116  RSHEIFQNLWPDIQSDNASGIELSSVWRYSKKLKEQKPCTNAT  158



>ref|XP_004142690.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis sativus]
 gb|KGN54587.1| hypothetical protein Csa_4G372090 [Cucumis sativus]
Length=587

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 8/89 (9%)
 Frame = +2

Query  308  RQGIFLFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSS  487
            RQ + L  PLLYISG++  +G  S      +     PGS+YRS Q+Y +LQ  + SDNSS
Sbjct  72   RQMVLL--PLLYISGLIMCVGPFS----SFVGQPPPPGSLYRSHQMYHRLQRHIQSDNSS  125

Query  488  AD-AISTIWKHSYKGDEWRPCANKSSGGL  571
            A   +S++WK+  +  E +PC+N ++  L
Sbjct  126  AAIQLSSVWKYK-RLKERKPCSNSTTSRL  153



>ref|XP_006396012.1| hypothetical protein EUTSA_v10003892mg [Eutrema salsugineum]
 gb|ESQ33298.1| hypothetical protein EUTSA_v10003892mg [Eutrema salsugineum]
Length=464

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 48/77 (62%), Gaps = 4/77 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A   S++W
Sbjct  65   PMIYASGLLMCVGPFS----ALVGWVYIPGSVYRSPEIYRKLRDDILSDNSTAVEFSSVW  120

Query  512  KHSYKGDEWRPCANKSS  562
            K+  +    +PC N ++
Sbjct  121  KYKRRPKMPKPCLNSTA  137



>ref|XP_006396013.1| hypothetical protein EUTSA_v10003892mg [Eutrema salsugineum]
 gb|ESQ33299.1| hypothetical protein EUTSA_v10003892mg [Eutrema salsugineum]
Length=585

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 48/77 (62%), Gaps = 4/77 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A   S++W
Sbjct  65   PMIYASGLLMCVGPFS----ALVGWVYIPGSVYRSPEIYRKLRDDILSDNSTAVEFSSVW  120

Query  512  KHSYKGDEWRPCANKSS  562
            K+  +    +PC N ++
Sbjct  121  KYKRRPKMPKPCLNSTA  137



>ref|XP_010461373.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Camelina sativa]
Length=589

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A  +S++W
Sbjct  68   PMIYASGLLMCVGPFS----GLVGWVYVPGSVYRSPEIYRKLKDDILSDNSTALELSSVW  123

Query  512  KHSYKGDEWRPCANKS  559
            K+  +    +PC N +
Sbjct  124  KYKRRPKMPKPCPNST  139



>ref|XP_012078175.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Jatropha curcas]
 gb|KDP32763.1| hypothetical protein JCGZ_12055 [Jatropha curcas]
Length=594

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 48/77 (62%), Gaps = 4/77 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            PLLYISG++  +G  S      +   + PG++YRS +L+ KL P++  DNS+A  +S++W
Sbjct  85   PLLYISGLIMCVGPFS----AFLLQPSLPGAVYRSSELFAKLWPDIAVDNSTAIELSSVW  140

Query  512  KHSYKGDEWRPCANKSS  562
            K + +    RPC + ++
Sbjct  141  KFTRRLKVQRPCPDSTA  157



>ref|XP_012078174.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Jatropha curcas]
Length=595

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 48/77 (62%), Gaps = 4/77 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            PLLYISG++  +G  S      +   + PG++YRS +L+ KL P++  DNS+A  +S++W
Sbjct  85   PLLYISGLIMCVGPFS----AFLLQPSLPGAVYRSSELFAKLWPDIAVDNSTAIELSSVW  140

Query  512  KHSYKGDEWRPCANKSS  562
            K + +    RPC + ++
Sbjct  141  KFTRRLKVQRPCPDSTA  157



>ref|XP_010478971.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=589

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A  +S++W
Sbjct  68   PMIYASGLLMCVGPFS----GLVGWVYVPGSVYRSPEIYRKLKDDILSDNSTALELSSVW  123

Query  512  KHSYKGDEWRPCANKS  559
            K+  +    +PC N +
Sbjct  124  KYKRRPKMPKPCPNST  139



>ref|XP_008444126.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=586

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = +2

Query  323  LFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAIS  502
            +  PLLYISG++  +G  S      +     PGS+YRS  +Y +L   + SDNSSA  +S
Sbjct  75   VLLPLLYISGLIMCVGPFS----SFVGQPPPPGSLYRSHLMYHRLHRHIQSDNSSAIQLS  130

Query  503  TIWKHSYKGDEWRPCANKSSGGL  571
            ++WK+  +  E +PC+N ++  L
Sbjct  131  SVWKYK-RLKERKPCSNSTTSRL  152



>ref|XP_010461371.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=589

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A  +S +W
Sbjct  68   PMIYASGLLMCVGPFS----GLVGGVYVPGSVYRSPEIYRKLKDDILSDNSTALELSYVW  123

Query  512  KHSYKGDEWRPCANKS  559
            K+  +    +PC N +
Sbjct  124  KYKRRPKMPKPCPNST  139



>ref|XP_011097784.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=553

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (52%), Gaps = 15/99 (15%)
 Frame = +2

Query  305  RRQGIF-------------LFAPLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQL  445
            RR+G+F             +F  +LYI G++   G +     P       PGS YRS +L
Sbjct  33   RRRGVFCFFFTGIFHERYLIFLTVLYIMGLVTCAGPLLTILHPPPP--PLPGSFYRSQEL  90

Query  446  YLKLQPEMDSDNSSADAISTIWKHSYKGDEWRPCANKSS  562
            +LKL PE+ SDN+S   +  +W++  K  E RPC N S+
Sbjct  91   FLKLWPEIQSDNASTVELDNLWRYRRKLKEQRPCLNASA  129



>ref|NP_683362.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAO00754.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE31900.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=589

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A  +S++W
Sbjct  67   PMIYASGLLMCVGPFS----GLVGWVYVPGSVYRSPEIYRKLKDDIFSDNSTALELSSVW  122

Query  512  KHSYKGDEWRPCANKS  559
            K   +    +PC N +
Sbjct  123  KFKRRPKMPKPCPNST  138



>ref|XP_010478972.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Camelina sativa]
Length=589

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A  +S +W
Sbjct  68   PMIYASGLLMCVGPFS----GLVGWVYVPGSVYRSPEIYRKLKDDILSDNSTALELSYVW  123

Query  512  KHSYKGDEWRPCANKS  559
            K+  +    +PC N +
Sbjct  124  KYKRRPKMPKPCPNST  139



>ref|XP_001753325.1| predicted protein [Physcomitrella patens]
 gb|EDQ81954.1| predicted protein [Physcomitrella patens]
Length=510

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 4/78 (5%)
 Frame = +2

Query  353  MLFYMG-TVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYKG  529
            ML YMG  +S D  P    R  PGS+YRS Q++  L PEM+  +SS   + ++W++   G
Sbjct  1    MLLYMGGDISVD-FPPFPGRHRPGSVYRSDQVFENLWPEMERADSSFYGVLSVWEYPKDG  59

Query  530  DEWRPCAN--KSSGGLPE  577
              + PC N  K+  GLPE
Sbjct  60   GGFTPCLNSIKNDAGLPE  77



>ref|XP_002893927.1| hypothetical protein ARALYDRAFT_473732 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70186.1| hypothetical protein ARALYDRAFT_473732 [Arabidopsis lyrata subsp. 
lyrata]
Length=589

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 46/76 (61%), Gaps = 4/76 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP+ Y KL+ ++ SDNS+A  +S++W
Sbjct  67   PMIYASGLLMCVGPFS----GLVGWVYVPGSVYRSPEFYRKLKDDILSDNSTALELSSVW  122

Query  512  KHSYKGDEWRPCANKS  559
            K   +    +PC N +
Sbjct  123  KFKRRPKMPKPCPNST  138



>ref|XP_009145111.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 emb|CDY47995.1| BnaA05g36320D [Brassica napus]
Length=586

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ +DNS+   +S++W
Sbjct  65   PMIYASGLLMCVGPFS----GLVGWVYVPGSVYRSPEIYRKLRDDIFADNSTDVELSSVW  120

Query  512  KHSYKGDEWRPCANKS  559
            K+  +    +PC N +
Sbjct  121  KYKRRPKMQKPCPNST  136



>ref|XP_010500091.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=521

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +2

Query  335  LLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWK  514
            ++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A  +S++WK
Sbjct  1    MIYASGLLMCVGPFS----GLVGWVYVPGSVYRSPEIYRKLKDDILSDNSTALELSSVWK  56

Query  515  HSYKGDEWRPCANKS  559
            +  +    +PC N +
Sbjct  57   YKRRPKMPKPCPNST  71



>ref|XP_010461370.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=590

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSA-DAISTI  508
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A + +S++
Sbjct  68   PMIYASGLLMCVGPFS----GLVGWVYVPGSVYRSPEIYRKLKDDILSDNSTALEQLSSV  123

Query  509  WKHSYKGDEWRPCANKS  559
            WK+  +    +PC N +
Sbjct  124  WKYKRRPKMPKPCPNST  140



>ref|XP_006306299.1| hypothetical protein CARUB_v10012165mg [Capsella rubella]
 gb|EOA39197.1| hypothetical protein CARUB_v10012165mg [Capsella rubella]
Length=588

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++  DNS+A  +S++W
Sbjct  67   PMIYASGLLMCVGPFS----GLVGWVYVPGSVYRSPEIYRKLKDDILFDNSTALELSSVW  122

Query  512  KHSYKGDEWRPCANKS  559
            K+  +    +PC N +
Sbjct  123  KYKRRPKMPKPCPNST  138



>emb|CDP12443.1| unnamed protein product [Coffea canephora]
Length=576

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +2

Query  356  LFYMGTVSFDAVP---IIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIWKHSYK  526
            L++ G ++F   P   I++    PGS+YRS +++ KL P++ SDNSS+  +S+IW++  K
Sbjct  77   LYFSGVITFTVGPLLAILRPAPPPGSVYRSHEVFEKLWPDIHSDNSSSIGLSSIWRYRRK  136

Query  527  GDEWRPCANKSS  562
              E + C N ++
Sbjct  137  LKEQKSCPNGTA  148



>ref|XP_010478969.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
 ref|XP_010478970.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=590

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSA-DAISTI  508
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A + +S++
Sbjct  68   PMIYASGLLMCVGPFS----GLVGWVYVPGSVYRSPEIYRKLKDDILSDNSTALEQLSSV  123

Query  509  WKHSYKGDEWRPCANKS  559
            WK+  +    +PC N +
Sbjct  124  WKYKRRPKMPKPCPNST  140



>ref|XP_010530190.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=559

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 48/77 (62%), Gaps = 4/77 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP ++ KL+ ++ +DNS+A  +S++W
Sbjct  53   PMMYASGLLMCVGPFS----GLVGWAPVPGSVYRSPIIFQKLRDDIFADNSTAIELSSVW  108

Query  512  KHSYKGDEWRPCANKSS  562
            K+  +    +PC N ++
Sbjct  109  KYKRRPKMPKPCPNSTA  125



>gb|KFK32890.1| hypothetical protein AALP_AA6G300900 [Arabis alpina]
Length=594

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = +2

Query  332  PLLYISGMLFYMGTVSFDAVPIIKHRATPGSIYRSPQLYLKLQPEMDSDNSSADAISTIW  511
            P++Y SG+L  +G  S     ++     PGS+YRSP++Y KL+ ++ SDNS+A  +  +W
Sbjct  66   PMIYASGLLMCVGPFS----GLVGWVYIPGSVYRSPEIYQKLRDDILSDNSTALELEAVW  121

Query  512  KHSYKGDEWRPCANKSS  562
            K   +    +PC N ++
Sbjct  122  KFKRRPKMPKPCPNATA  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723620794530