BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7312

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO97628.1|  unnamed protein product                                147   2e-38   Coffea canephora [robusta coffee]
ref|XP_004230442.1|  PREDICTED: regulator of nonsense transcripts...    145   7e-38   
ref|XP_009775100.1|  PREDICTED: regulator of nonsense transcripts...    145   1e-37   Nicotiana sylvestris
ref|XP_009587503.1|  PREDICTED: regulator of nonsense transcripts...    145   1e-37   Nicotiana tomentosiformis
ref|XP_006349314.1|  PREDICTED: regulator of nonsense transcripts...    143   6e-37   Solanum tuberosum [potatoes]
ref|XP_007041200.1|  Smg-4/UPF3 family protein, putative isoform 1      139   1e-35   
ref|XP_007041201.1|  Smg-4/UPF3 family protein, putative isoform 2      138   2e-35   
ref|XP_011092289.1|  PREDICTED: regulator of nonsense transcripts...    139   2e-35   Sesamum indicum [beniseed]
ref|XP_010246764.1|  PREDICTED: regulator of nonsense transcripts...    139   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010246762.1|  PREDICTED: regulator of nonsense transcripts...    139   3e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010246761.1|  PREDICTED: regulator of nonsense transcripts...    139   3e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010246760.1|  PREDICTED: regulator of nonsense transcripts...    139   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_009775092.1|  PREDICTED: regulator of nonsense transcripts...    138   4e-35   Nicotiana sylvestris
ref|XP_009587502.1|  PREDICTED: regulator of nonsense transcripts...    138   4e-35   Nicotiana tomentosiformis
gb|KJB47868.1|  hypothetical protein B456_008G045900                    137   5e-35   Gossypium raimondii
gb|KJB47855.1|  hypothetical protein B456_008G045900                    137   6e-35   Gossypium raimondii
gb|KJB47856.1|  hypothetical protein B456_008G045900                    137   6e-35   Gossypium raimondii
gb|KJB47860.1|  hypothetical protein B456_008G045900                    137   6e-35   Gossypium raimondii
gb|KJB47866.1|  hypothetical protein B456_008G045900                    137   6e-35   Gossypium raimondii
gb|KJB47859.1|  hypothetical protein B456_008G045900                    137   6e-35   Gossypium raimondii
gb|KJB47867.1|  hypothetical protein B456_008G045900                    137   6e-35   Gossypium raimondii
gb|KJB47864.1|  hypothetical protein B456_008G045900                    137   6e-35   Gossypium raimondii
gb|KHF99019.1|  upf3a                                                   137   9e-35   Gossypium arboreum [tree cotton]
ref|XP_010246763.1|  PREDICTED: regulator of nonsense transcripts...    136   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006598794.1|  PREDICTED: regulator of nonsense transcripts...    136   2e-34   Glycine max [soybeans]
ref|XP_009353786.1|  PREDICTED: regulator of nonsense transcripts...    134   7e-34   
ref|XP_002526435.1|  conserved hypothetical protein                     134   1e-33   
ref|XP_008218705.1|  PREDICTED: regulator of nonsense transcripts...    134   1e-33   Prunus mume [ume]
gb|EYU26454.1|  hypothetical protein MIMGU_mgv1a004529mg                134   1e-33   Erythranthe guttata [common monkey flower]
gb|EYU26453.1|  hypothetical protein MIMGU_mgv1a004529mg                134   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_007221816.1|  hypothetical protein PRUPE_ppa004923mg             134   1e-33   Prunus persica
ref|XP_008795266.1|  PREDICTED: regulator of nonsense transcripts...    134   1e-33   Phoenix dactylifera
ref|XP_008795263.1|  PREDICTED: regulator of nonsense transcripts...    134   1e-33   Phoenix dactylifera
ref|XP_007221815.1|  hypothetical protein PRUPE_ppa004923mg             133   2e-33   Prunus persica
ref|XP_009355334.1|  PREDICTED: regulator of nonsense transcripts...    133   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_009355335.1|  PREDICTED: regulator of nonsense transcripts...    133   2e-33   
ref|XP_006592654.1|  PREDICTED: regulator of nonsense transcripts...    132   5e-33   Glycine max [soybeans]
ref|XP_011088114.1|  PREDICTED: regulator of nonsense transcripts...    132   7e-33   
ref|XP_010912655.1|  PREDICTED: regulator of nonsense transcripts...    132   7e-33   Elaeis guineensis
ref|XP_010657967.1|  PREDICTED: regulator of nonsense transcripts...    131   1e-32   Vitis vinifera
ref|XP_010657969.1|  PREDICTED: regulator of nonsense transcripts...    131   1e-32   
ref|XP_010657968.1|  PREDICTED: regulator of nonsense transcripts...    131   1e-32   
ref|XP_007148572.1|  hypothetical protein PHAVU_006G219800g             130   2e-32   Phaseolus vulgaris [French bean]
gb|KDO41302.1|  hypothetical protein CISIN_1g0102241mg                  127   2e-32   Citrus sinensis [apfelsine]
ref|XP_010910233.1|  PREDICTED: regulator of nonsense transcripts...    130   3e-32   
ref|XP_008802925.1|  PREDICTED: regulator of nonsense transcripts...    130   3e-32   Phoenix dactylifera
ref|XP_010910195.1|  PREDICTED: regulator of nonsense transcripts...    130   3e-32   Elaeis guineensis
gb|KJB32866.1|  hypothetical protein B456_005G265700                    129   3e-32   Gossypium raimondii
ref|XP_009404844.1|  PREDICTED: regulator of nonsense transcripts...    129   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009786002.1|  PREDICTED: regulator of nonsense transcripts...    129   4e-32   Nicotiana sylvestris
ref|XP_010930556.1|  PREDICTED: regulator of nonsense transcripts...    130   4e-32   Elaeis guineensis
gb|EPS57826.1|  hypothetical protein M569_16991                         129   5e-32   Genlisea aurea
ref|XP_006858584.1|  PREDICTED: regulator of nonsense transcripts...    130   6e-32   Amborella trichopoda
ref|XP_011628613.1|  PREDICTED: regulator of nonsense transcripts...    130   7e-32   Amborella trichopoda
gb|KJB32869.1|  hypothetical protein B456_005G265700                    128   7e-32   Gossypium raimondii
gb|KJB32861.1|  hypothetical protein B456_005G265700                    129   8e-32   Gossypium raimondii
gb|KJB32868.1|  hypothetical protein B456_005G265700                    129   8e-32   Gossypium raimondii
gb|KJB32858.1|  hypothetical protein B456_005G265700                    129   8e-32   Gossypium raimondii
gb|KJB32864.1|  hypothetical protein B456_005G265700                    129   9e-32   Gossypium raimondii
gb|KJB32865.1|  hypothetical protein B456_005G265700                    129   9e-32   Gossypium raimondii
gb|KJB32862.1|  hypothetical protein B456_005G265700                    129   9e-32   Gossypium raimondii
ref|XP_009587163.1|  PREDICTED: regulator of nonsense transcripts...    127   2e-31   Nicotiana tomentosiformis
ref|XP_006431585.1|  hypothetical protein CICLE_v10000901mg             127   2e-31   Citrus clementina [clementine]
ref|XP_006492554.1|  PREDICTED: regulator of nonsense transcripts...    127   2e-31   Citrus sinensis [apfelsine]
ref|XP_010030190.1|  PREDICTED: regulator of nonsense transcripts...    127   4e-31   Eucalyptus grandis [rose gum]
gb|KCW57140.1|  hypothetical protein EUGRSUZ_I02778                     127   4e-31   Eucalyptus grandis [rose gum]
ref|XP_009401110.1|  PREDICTED: regulator of nonsense transcripts...    127   4e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB32867.1|  hypothetical protein B456_005G265700                    126   5e-31   Gossypium raimondii
ref|XP_008786472.1|  PREDICTED: regulator of nonsense transcripts...    127   6e-31   Phoenix dactylifera
ref|XP_008786471.1|  PREDICTED: regulator of nonsense transcripts...    127   6e-31   
ref|XP_008802926.1|  PREDICTED: regulator of nonsense transcripts...    127   6e-31   Phoenix dactylifera
ref|NP_174660.2|  regulator of nonsense transcripts UPF3                126   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891069.1|  ATUPF3/UPF3                                        126   7e-31   
ref|XP_008802922.1|  PREDICTED: regulator of nonsense transcripts...    127   7e-31   Phoenix dactylifera
ref|XP_009403714.1|  PREDICTED: regulator of nonsense transcripts...    126   7e-31   
ref|XP_006385051.1|  hypothetical protein POPTR_0004s23450g             126   8e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006385052.1|  Smg-4/UPF3 family protein                          126   9e-31   
ref|XP_009362405.1|  PREDICTED: regulator of nonsense transcripts...    125   9e-31   Pyrus x bretschneideri [bai li]
ref|XP_009362399.1|  PREDICTED: regulator of nonsense transcripts...    125   1e-30   Pyrus x bretschneideri [bai li]
gb|AAG12537.1|AC015446_18  Unknown protein                              125   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009362402.1|  PREDICTED: regulator of nonsense transcripts...    125   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_011047887.1|  PREDICTED: regulator of nonsense transcripts...    125   1e-30   Populus euphratica
ref|XP_011047883.1|  PREDICTED: regulator of nonsense transcripts...    125   1e-30   Populus euphratica
ref|XP_011047886.1|  PREDICTED: regulator of nonsense transcripts...    125   1e-30   Populus euphratica
ref|XP_011047885.1|  PREDICTED: regulator of nonsense transcripts...    125   1e-30   Populus euphratica
ref|XP_011028362.1|  PREDICTED: regulator of nonsense transcripts...    125   1e-30   Populus euphratica
ref|XP_011028363.1|  PREDICTED: regulator of nonsense transcripts...    125   2e-30   Populus euphratica
emb|CAN62711.1|  hypothetical protein VITISV_035617                     124   2e-30   Vitis vinifera
ref|XP_012066695.1|  PREDICTED: regulator of nonsense transcripts...    124   2e-30   
ref|XP_012066696.1|  PREDICTED: regulator of nonsense transcripts...    124   2e-30   Jatropha curcas
emb|CAN72659.1|  hypothetical protein VITISV_042717                     124   2e-30   Vitis vinifera
ref|XP_008368136.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...    125   3e-30   
ref|XP_006389505.1|  hypothetical protein POPTR_0022s00460g             124   3e-30   Populus trichocarpa [western balsam poplar]
emb|CBI18298.3|  unnamed protein product                                121   5e-30   Vitis vinifera
ref|XP_008378738.1|  PREDICTED: regulator of nonsense transcripts...    124   6e-30   
ref|XP_008378736.1|  PREDICTED: regulator of nonsense transcripts...    123   6e-30   
ref|XP_008378737.1|  PREDICTED: regulator of nonsense transcripts...    123   6e-30   
ref|XP_010101271.1|  hypothetical protein L484_011635                   123   8e-30   
ref|XP_007226163.1|  hypothetical protein PRUPE_ppa015218mg             122   1e-29   
ref|XP_010683312.1|  PREDICTED: regulator of nonsense transcripts...    122   2e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB68168.1|  hypothetical protein B456_010G229700                    122   2e-29   Gossypium raimondii
ref|XP_008219049.1|  PREDICTED: regulator of nonsense transcripts...    122   2e-29   Prunus mume [ume]
gb|KJB68170.1|  hypothetical protein B456_010G229700                    122   2e-29   Gossypium raimondii
gb|KJB68172.1|  hypothetical protein B456_010G229700                    122   2e-29   Gossypium raimondii
ref|XP_010683306.1|  PREDICTED: regulator of nonsense transcripts...    122   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007024252.1|  Smg-4/UPF3 family protein, putative isoform 5      122   2e-29   
gb|KJB68169.1|  hypothetical protein B456_010G229700                    122   2e-29   Gossypium raimondii
emb|CBI18294.3|  unnamed protein product                                119   2e-29   Vitis vinifera
ref|XP_007024249.1|  Smg-4/UPF3 family protein, putative isoform 2      122   2e-29   
gb|KHG15802.1|  Regulator of nonsense transcripts 3A                    122   2e-29   Gossypium arboreum [tree cotton]
ref|XP_007024253.1|  Smg-4/UPF3 family protein, putative isoform 6      121   2e-29   
ref|XP_007024248.1|  Smg-4/UPF3 family protein, putative isoform 1      122   2e-29   
ref|XP_010327534.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Solanum lycopersicum
ref|XP_006339922.1|  PREDICTED: regulator of nonsense transcripts...    122   3e-29   Solanum tuberosum [potatoes]
ref|XP_010327532.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Solanum lycopersicum
ref|XP_006339925.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Solanum tuberosum [potatoes]
ref|XP_008459660.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Cucumis melo [Oriental melon]
ref|XP_008459659.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Cucumis melo [Oriental melon]
ref|XP_010327533.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Solanum lycopersicum
ref|XP_004248850.2|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Solanum lycopersicum
ref|XP_011656113.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Cucumis sativus [cucumbers]
ref|XP_004141560.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Cucumis sativus [cucumbers]
ref|XP_010327529.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Solanum lycopersicum
ref|XP_010327531.1|  PREDICTED: regulator of nonsense transcripts...    121   3e-29   Solanum lycopersicum
ref|XP_010542926.1|  PREDICTED: regulator of nonsense transcripts...    121   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_010542917.1|  PREDICTED: regulator of nonsense transcripts...    121   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_010542909.1|  PREDICTED: regulator of nonsense transcripts...    121   4e-29   Tarenaya hassleriana [spider flower]
ref|NP_001117406.1|  regulator of nonsense transcripts UPF3             120   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004975685.1|  PREDICTED: regulator of nonsense transcripts...    121   5e-29   
tpg|DAA37690.1|  TPA: hypothetical protein ZEAMMB73_050614              118   5e-29   
ref|XP_004485448.1|  PREDICTED: regulator of nonsense transcripts...    120   6e-29   
ref|XP_009379179.1|  PREDICTED: regulator of nonsense transcripts...    120   7e-29   Pyrus x bretschneideri [bai li]
ref|XP_009379185.1|  PREDICTED: regulator of nonsense transcripts...    120   7e-29   Pyrus x bretschneideri [bai li]
ref|XP_002447880.1|  hypothetical protein SORBIDRAFT_06g017380          120   7e-29   
ref|XP_010499932.1|  PREDICTED: regulator of nonsense transcripts...    120   7e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010478812.1|  PREDICTED: regulator of nonsense transcripts...    120   7e-29   Camelina sativa [gold-of-pleasure]
ref|XP_004485447.1|  PREDICTED: regulator of nonsense transcripts...    120   8e-29   
ref|XP_006303223.1|  hypothetical protein CARUB_v10012004mg             118   8e-29   
gb|EMT22790.1|  Regulator of nonsense transcripts 3A                    120   9e-29   
ref|XP_010463114.1|  PREDICTED: regulator of nonsense transcripts...    120   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009421164.1|  PREDICTED: regulator of nonsense transcripts...    119   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ94892.1|  predicted protein                                      119   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010096436.1|  hypothetical protein L484_013119                   119   2e-28   
ref|XP_011461172.1|  PREDICTED: regulator of nonsense transcripts...    119   3e-28   Fragaria vesca subsp. vesca
ref|XP_011461169.1|  PREDICTED: regulator of nonsense transcripts...    119   3e-28   Fragaria vesca subsp. vesca
ref|XP_009421163.1|  PREDICTED: regulator of nonsense transcripts...    119   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY52194.1|  BnaCnng22070D                                          118   3e-28   Brassica napus [oilseed rape]
tpg|DAA37689.1|  TPA: hypothetical protein ZEAMMB73_050614              118   4e-28   
ref|XP_008669383.1|  PREDICTED: regulator of nonsense transcripts...    118   4e-28   Zea mays [maize]
ref|XP_011031522.1|  PREDICTED: regulator of nonsense transcripts...    117   9e-28   Populus euphratica
ref|XP_008663218.1|  PREDICTED: regulator of nonsense transcripts...    117   1e-27   Zea mays [maize]
ref|XP_008663221.1|  PREDICTED: regulator of nonsense transcripts...    117   1e-27   Zea mays [maize]
ref|XP_008663216.1|  PREDICTED: regulator of nonsense transcripts...    117   1e-27   Zea mays [maize]
ref|XP_008663219.1|  PREDICTED: regulator of nonsense transcripts...    117   1e-27   Zea mays [maize]
ref|XP_008663214.1|  PREDICTED: regulator of nonsense transcripts...    117   1e-27   Zea mays [maize]
ref|XP_010530121.1|  PREDICTED: regulator of nonsense transcripts...    117   1e-27   
ref|XP_008663217.1|  PREDICTED: regulator of nonsense transcripts...    117   1e-27   
ref|XP_010530119.1|  PREDICTED: regulator of nonsense transcripts...    117   2e-27   
ref|XP_010530120.1|  PREDICTED: regulator of nonsense transcripts...    116   2e-27   
emb|CAE03133.3|  OJ000114_01.14                                         116   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052873.1|  Os04g0440100                                       116   2e-27   
emb|CAH66847.1|  H0525C06.10                                            116   2e-27   Oryza sativa [red rice]
ref|XP_010239938.1|  PREDICTED: regulator of nonsense transcripts...    115   8e-27   Brachypodium distachyon [annual false brome]
ref|XP_010239939.1|  PREDICTED: regulator of nonsense transcripts...    114   9e-27   Brachypodium distachyon [annual false brome]
emb|CDY48801.1|  BnaA05g20690D                                          114   1e-26   Brassica napus [oilseed rape]
ref|XP_009145164.1|  PREDICTED: regulator of nonsense transcripts...    114   1e-26   Brassica rapa
ref|XP_009145165.1|  PREDICTED: regulator of nonsense transcripts...    114   1e-26   Brassica rapa
ref|XP_003592906.1|  Regulator of nonsense transcripts 3A               112   4e-26   
ref|XP_002325958.2|  hypothetical protein POPTR_0019s10620g             113   4e-26   Populus trichocarpa [western balsam poplar]
gb|KHN47094.1|  Regulator of nonsense transcripts 3A                    112   8e-26   Glycine soja [wild soybean]
emb|CDY15301.1|  BnaC06g07870D                                          112   8e-26   Brassica napus [oilseed rape]
ref|XP_003592907.1|  Regulator of nonsense transcripts 3A               112   1e-25   
gb|ABE91932.1|  Nonsense-mediated decay UPF3                            111   1e-25   Medicago truncatula
ref|XP_006415052.1|  hypothetical protein EUTSA_v10007455mg             111   1e-25   
ref|XP_006579008.1|  PREDICTED: regulator of nonsense transcripts...    111   1e-25   
gb|AES63156.2|  Smg-4/UPF3 family protein                               111   1e-25   Medicago truncatula
ref|XP_006579007.1|  PREDICTED: regulator of nonsense transcripts...    111   1e-25   
ref|XP_003522607.1|  PREDICTED: regulator of nonsense transcripts...    111   2e-25   
ref|XP_006441553.1|  hypothetical protein CICLE_v10019695mg             111   2e-25   
gb|AES63158.2|  Smg-4/UPF3 family protein                               111   2e-25   Medicago truncatula
ref|XP_006652316.1|  PREDICTED: regulator of nonsense transcripts...    110   3e-25   Oryza brachyantha
ref|XP_003592905.1|  Regulator of nonsense transcripts 3A               111   3e-25   
ref|XP_003527584.1|  PREDICTED: regulator of nonsense transcripts...    110   4e-25   Glycine max [soybeans]
ref|XP_006582443.1|  PREDICTED: regulator of nonsense transcripts...    110   4e-25   Glycine max [soybeans]
ref|XP_006582445.1|  PREDICTED: regulator of nonsense transcripts...    110   4e-25   
ref|XP_009114779.1|  PREDICTED: regulator of nonsense transcripts...    109   4e-25   Brassica rapa
ref|XP_009114778.1|  PREDICTED: regulator of nonsense transcripts...    110   4e-25   Brassica rapa
ref|XP_006582444.1|  PREDICTED: regulator of nonsense transcripts...    110   5e-25   Glycine max [soybeans]
ref|XP_006582442.1|  PREDICTED: regulator of nonsense transcripts...    110   5e-25   Glycine max [soybeans]
emb|CDX93747.1|  BnaA09g23470D                                          109   6e-25   
ref|XP_006478194.1|  PREDICTED: regulator of nonsense transcripts...    108   2e-24   Citrus sinensis [apfelsine]
gb|KDO45829.1|  hypothetical protein CISIN_1g009733mg                   108   2e-24   Citrus sinensis [apfelsine]
gb|AES68284.2|  regulator of nonsense transcripts UPF3 protein          107   5e-24   Medicago truncatula
ref|XP_012073511.1|  PREDICTED: regulator of nonsense transcripts...    106   1e-23   Jatropha curcas
emb|CDY46452.1|  BnaA08g06560D                                          105   2e-23   Brassica napus [oilseed rape]
gb|KDP36702.1|  hypothetical protein JCGZ_07993                         106   2e-23   Jatropha curcas
ref|XP_003598033.1|  B3 domain-containing protein                       107   2e-23   
ref|XP_007148608.1|  hypothetical protein PHAVU_005G000800g             105   2e-23   Phaseolus vulgaris [French bean]
ref|XP_001778894.1|  predicted protein                                  107   2e-23   
ref|XP_007148607.1|  hypothetical protein PHAVU_005G000800g             105   2e-23   Phaseolus vulgaris [French bean]
ref|XP_006441556.1|  hypothetical protein CICLE_v10019695mg             105   2e-23   
ref|XP_009107940.1|  PREDICTED: regulator of nonsense transcripts...    104   3e-23   Brassica rapa
ref|XP_009107941.1|  PREDICTED: regulator of nonsense transcripts...    104   3e-23   Brassica rapa
ref|XP_010910224.1|  PREDICTED: regulator of nonsense transcripts...    103   2e-22   
emb|CDX91795.1|  BnaC08g07140D                                          104   2e-22   
ref|XP_002972412.1|  hypothetical protein SELMODRAFT_97155            97.1    3e-22   
gb|KDO45837.1|  hypothetical protein CISIN_1g009733mg                   102   3e-22   Citrus sinensis [apfelsine]
ref|XP_002984244.1|  hypothetical protein SELMODRAFT_119852           95.9    6e-22   
ref|XP_006441789.1|  hypothetical protein CICLE_v10023375mg           93.2    5e-21   
ref|XP_006478236.1|  PREDICTED: uncharacterized protein LOC102612273  92.4    1e-19   
ref|XP_006441573.1|  hypothetical protein CICLE_v10024086mg           87.0    8e-19   
gb|KIY98106.1|  hypothetical protein MNEG_9858                        87.8    2e-18   Monoraphidium neglectum
ref|XP_001754467.1|  predicted protein                                92.8    2e-18   
ref|XP_004499558.1|  PREDICTED: regulator of nonsense transcripts...  88.2    5e-17   
ref|XP_004499563.1|  PREDICTED: regulator of nonsense transcripts...  88.2    5e-17   Cicer arietinum [garbanzo]
ref|XP_004499561.1|  PREDICTED: regulator of nonsense transcripts...  88.2    5e-17   
ref|XP_004499560.1|  PREDICTED: regulator of nonsense transcripts...  88.2    5e-17   
ref|XP_004499559.1|  PREDICTED: regulator of nonsense transcripts...  88.2    5e-17   
ref|XP_002945932.1|  hypothetical protein VOLCADRAFT_48819            79.3    8e-16   Volvox carteri f. nagariensis
ref|XP_001691099.1|  UPF3 protein                                     80.5    8e-15   Chlamydomonas reinhardtii
ref|XP_002510770.1|  conserved hypothetical protein                   77.8    1e-13   
ref|XP_011395745.1|  Regulator of nonsense transcripts 3A             74.3    2e-12   Auxenochlorella protothecoides
ref|XP_008378998.1|  PREDICTED: regulator of nonsense transcripts...  68.6    3e-12   
emb|CCJ29190.1|  unnamed protein product                              72.8    5e-12   Pneumocystis jirovecii
gb|AFK46637.1|  unknown                                               66.2    2e-11   Lotus japonicus
ref|XP_008352807.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  68.9    1e-10   
ref|XP_005644501.1|  hypothetical protein COCSUDRAFT_44353            66.6    7e-10   Coccomyxa subellipsoidea C-169
ref|XP_005851259.1|  hypothetical protein CHLNCDRAFT_50004            62.4    1e-09   Chlorella variabilis
gb|KHN22614.1|  Regulator of nonsense transcripts 3A                  62.0    4e-09   Glycine soja [wild soybean]
gb|EMS47492.1|  Regulator of nonsense transcripts 3A                  64.3    6e-09   Triticum urartu
ref|XP_010930558.1|  PREDICTED: regulator of nonsense transcripts...  63.5    1e-08   Elaeis guineensis
emb|CAX18772.1|  UPF3 regulator of nonsense transcripts homolog A...  58.9    4e-08   Danio rerio [leopard danio]
ref|XP_010930557.1|  PREDICTED: regulator of nonsense transcripts...  61.2    6e-08   
ref|XP_007872945.1|  hypothetical protein PNEG_01033                  60.8    6e-08   Pneumocystis murina B123
gb|AAH95761.1|  Upf3a protein                                         58.5    7e-08   Danio rerio [leopard danio]
gb|ESA18168.1|  hypothetical protein GLOINDRAFT_144398                59.7    7e-08   
ref|XP_006676092.1|  hypothetical protein BATDEDRAFT_84963            60.8    8e-08   Batrachochytrium dendrobatidis JAM81
gb|EPZ31303.1|  Nucleotide-binding, alpha-beta plait domain-conta...  58.5    1e-07   Rozella allomycis CSF55
emb|CCO28851.1|  putative WD repeat-containing protein C1672,07       60.8    1e-07   Rhizoctonia solani AG-1 IB
gb|KDN51831.1|  hypothetical protein RSAG8_00380                      58.2    4e-07   Rhizoctonia solani AG-8 WAC10335
gb|EJU05580.1|  hypothetical protein DACRYDRAFT_104067                58.5    4e-07   Dacryopinax primogenitus
ref|XP_010738428.1|  PREDICTED: regulator of nonsense transcripts 3A  58.5    4e-07   
ref|XP_010786902.1|  PREDICTED: regulator of nonsense transcripts...  58.2    4e-07   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010903995.1|  PREDICTED: regulator of nonsense transcripts...  58.5    4e-07   Esox lucius
ref|XP_010903997.1|  PREDICTED: regulator of nonsense transcripts...  58.5    4e-07   Esox lucius
ref|XP_006788210.1|  PREDICTED: regulator of nonsense transcripts...  58.5    4e-07   Neolamprologus brichardi [lyretail cichlid]
gb|EUC62084.1|  Smg-4/UPF3 family protein                             58.9    4e-07   Rhizoctonia solani AG-3 Rhs1AP
gb|EXX69496.1|  hypothetical protein RirG_095570                      58.5    4e-07   Rhizophagus irregularis DAOM 197198w
gb|KEP50606.1|  Smg-4/UPF3 family protein                             58.5    5e-07   Rhizoctonia solani 123E
ref|XP_005935879.1|  PREDICTED: regulator of nonsense transcripts...  57.8    6e-07   Haplochromis burtoni
ref|XP_005935876.1|  PREDICTED: regulator of nonsense transcripts...  57.8    7e-07   Haplochromis burtoni
ref|XP_004568013.1|  PREDICTED: regulator of nonsense transcripts...  57.8    7e-07   Maylandia zebra
ref|XP_005475492.1|  PREDICTED: regulator of nonsense transcripts...  57.8    7e-07   Oreochromis niloticus
ref|XP_005935877.1|  PREDICTED: regulator of nonsense transcripts...  57.8    7e-07   Haplochromis burtoni
ref|XP_004568015.1|  PREDICTED: regulator of nonsense transcripts...  57.8    7e-07   
ref|XP_005935878.1|  PREDICTED: regulator of nonsense transcripts...  57.8    7e-07   
ref|XP_004568014.1|  PREDICTED: regulator of nonsense transcripts...  57.8    7e-07   Maylandia zebra
ref|XP_008280517.1|  PREDICTED: regulator of nonsense transcripts...  57.8    7e-07   Stegastes partitus
ref|XP_004568016.1|  PREDICTED: regulator of nonsense transcripts...  57.8    7e-07   
ref|XP_008280526.1|  PREDICTED: regulator of nonsense transcripts...  57.8    8e-07   Stegastes partitus
ref|XP_008280534.1|  PREDICTED: regulator of nonsense transcripts...  57.8    8e-07   Stegastes partitus
ref|XP_003451599.1|  PREDICTED: regulator of nonsense transcripts...  57.8    8e-07   
pdb|1UW4|A  Chain A, The Structural Basis Of The Interaction Betw...  54.3    8e-07   Homo sapiens [man]
dbj|BAG57751.1|  unnamed protein product                              55.1    9e-07   Homo sapiens [man]
ref|XP_849752.2|  PREDICTED: regulator of nonsense transcripts 3A...  57.4    1e-06   Canis lupus familiaris [dogs]
ref|XP_007263451.1|  hypothetical protein FOMMEDRAFT_165771           57.4    1e-06   Fomitiporia mediterranea MF3/22
emb|CEL51964.1|  hypothetical protein RSOLAG1IB_00501                 57.0    1e-06   Rhizoctonia solani AG-1 IB
ref|XP_005167908.1|  PREDICTED: regulator of nonsense transcripts...  57.0    1e-06   Danio rerio [leopard danio]
ref|XP_005167907.1|  PREDICTED: regulator of nonsense transcripts...  57.0    1e-06   Danio rerio [leopard danio]
ref|NP_001189377.1|  regulator of nonsense transcripts 3A             57.0    1e-06   Danio rerio [leopard danio]
ref|XP_003800045.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  57.0    1e-06   
ref|XP_008339206.1|  PREDICTED: zinc transporter ZTP29-like           55.1    1e-06   
ref|XP_011501641.1|  PREDICTED: regulator of nonsense transcripts 3A  57.0    1e-06   Ceratosolen solmsi marchali
gb|KIM41523.1|  hypothetical protein M413DRAFT_445507                 53.9    2e-06   Hebeloma cylindrosporum h7
emb|CDQ69277.1|  unnamed protein product                              57.0    2e-06   Oncorhynchus mykiss
gb|KIJ64775.1|  hypothetical protein HYDPIDRAFT_28135                 56.6    2e-06   Hydnomerulius pinastri MD-312
pdb|2L08|A  Chain A, Solution Nmr Structure Of Nonsense Mrna Redu...  53.1    2e-06   Homo sapiens [man]
ref|XP_007339797.1|  hypothetical protein AURDEDRAFT_181525           56.2    2e-06   
gb|KDQ17942.1|  hypothetical protein BOTBODRAFT_29260                 56.6    2e-06   Botryobasidium botryosum FD-172 SS1
ref|XP_008326453.1|  PREDICTED: regulator of nonsense transcripts...  56.6    2e-06   
ref|XP_008326452.1|  PREDICTED: regulator of nonsense transcripts...  56.2    2e-06   
ref|XP_005733842.1|  PREDICTED: regulator of nonsense transcripts...  56.2    2e-06   
gb|EAX09249.1|  UPF3 regulator of nonsense transcripts homolog A ...  55.1    3e-06   
ref|XP_011533151.1|  PREDICTED: regulator of nonsense transcripts...  55.1    3e-06   
ref|XP_010591894.1|  PREDICTED: regulator of nonsense transcripts...  55.5    3e-06   
ref|XP_007227931.1|  PREDICTED: regulator of nonsense transcripts...  55.8    3e-06   
ref|XP_007227930.1|  PREDICTED: regulator of nonsense transcripts...  55.5    4e-06   
ref|XP_008142232.1|  PREDICTED: regulator of nonsense transcripts 3A  55.5    4e-06   
gb|KIK82630.1|  hypothetical protein PAXRUDRAFT_153590                55.5    4e-06   
emb|CDQ75295.1|  unnamed protein product                              52.0    4e-06   
ref|XP_004621431.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  55.5    5e-06   
ref|XP_006884026.1|  PREDICTED: regulator of nonsense transcripts 3A  55.1    5e-06   
ref|XP_008326455.1|  PREDICTED: regulator of nonsense transcripts...  55.1    5e-06   
ref|XP_005266257.1|  PREDICTED: regulator of nonsense transcripts...  54.7    5e-06   
dbj|BAB32218.1|  unnamed protein product                              52.8    5e-06   
ref|XP_008214123.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  55.5    5e-06   
ref|XP_005659004.1|  PREDICTED: regulator of nonsense transcripts...  55.1    6e-06   
ref|XP_011533148.1|  PREDICTED: regulator of nonsense transcripts...  54.7    6e-06   
gb|ACU18923.1|  unknown                                               51.2    6e-06   
ref|XP_009247103.1|  PREDICTED: regulator of nonsense transcripts...  54.7    7e-06   
gb|AAI21019.1|  UPF3B protein                                         53.5    7e-06   
ref|XP_010591893.1|  PREDICTED: regulator of nonsense transcripts...  54.7    8e-06   
ref|XP_006639007.1|  PREDICTED: regulator of nonsense transcripts...  54.7    8e-06   
ref|XP_006176815.1|  PREDICTED: regulator of nonsense transcripts 3A  54.3    9e-06   
ref|XP_006909398.1|  PREDICTED: regulator of nonsense transcripts...  54.3    9e-06   
gb|ELK26013.1|  Regulator of nonsense transcripts 3A                  54.7    1e-05   
ref|XP_008431428.1|  PREDICTED: regulator of nonsense transcripts...  54.3    1e-05   
dbj|BAC28207.1|  unnamed protein product                              53.1    1e-05   
ref|XP_007547253.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   
ref|XP_009556246.1|  PREDICTED: regulator of nonsense transcripts 3A  53.9    1e-05   
ref|XP_011605288.1|  PREDICTED: regulator of nonsense transcripts 3A  53.9    1e-05   
gb|KIK61351.1|  hypothetical protein GYMLUDRAFT_58885                 53.9    1e-05   
ref|XP_007547251.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   
ref|XP_007547252.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   
ref|XP_008431434.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   
ref|XP_008326454.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   
ref|XP_007547250.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   
emb|CAG07286.1|  unnamed protein product                              53.5    1e-05   
ref|XP_008326457.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   
gb|EAW89843.1|  UPF3 regulator of nonsense transcripts homolog B ...  53.5    1e-05   
ref|XP_007940590.1|  PREDICTED: regulator of nonsense transcripts 3A  53.9    1e-05   
ref|XP_006102113.1|  PREDICTED: regulator of nonsense transcripts 3A  53.9    1e-05   
ref|XP_002824527.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-05   
ref|XP_005877753.1|  PREDICTED: regulator of nonsense transcripts 3A  53.9    1e-05   
ref|XP_004448695.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  53.9    1e-05   
ref|XP_007196795.1|  PREDICTED: regulator of nonsense transcripts...  53.5    1e-05   
ref|XP_003030982.1|  hypothetical protein SCHCODRAFT_109867           53.9    1e-05   
ref|XP_006769378.1|  PREDICTED: regulator of nonsense transcripts 3A  53.5    2e-05   
ref|XP_004710123.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_006749889.1|  PREDICTED: regulator of nonsense transcripts 3A  53.5    2e-05   
ref|XP_004704483.1|  PREDICTED: regulator of nonsense transcripts 3A  53.5    2e-05   
ref|XP_004369447.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  53.5    2e-05   
ref|XP_005810871.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
emb|CEP19677.1|  hypothetical protein                                 53.5    2e-05   
ref|XP_011913563.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_008683241.1|  PREDICTED: regulator of nonsense transcripts 3A  53.5    2e-05   
ref|XP_006218264.1|  PREDICTED: regulator of nonsense transcripts 3A  53.5    2e-05   
ref|XP_010950654.1|  PREDICTED: regulator of nonsense transcripts 3A  53.5    2e-05   
ref|XP_004710124.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
dbj|GAN09940.1|  conserved hypothetical protein                       53.5    2e-05   
ref|XP_004467549.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_011163835.1|  PREDICTED: regulator of nonsense transcripts 3A  53.5    2e-05   
gb|EPQ14845.1|  Regulator of nonsense transcripts 3A                  53.5    2e-05   
ref|XP_004379883.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_005810868.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_005810870.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_006909399.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_005810869.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
dbj|BAB31954.1|  unnamed protein product                              52.8    2e-05   
ref|XP_004577654.1|  PREDICTED: regulator of nonsense transcripts 3A  53.1    2e-05   
ref|XP_007317069.1|  hypothetical protein SERLADRAFT_436716           53.5    2e-05   
dbj|BAB30093.1|  unnamed protein product                              52.8    2e-05   
ref|XP_004379884.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_011581843.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|XP_006872154.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_011377840.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  53.5    2e-05   
gb|KIJ16461.1|  hypothetical protein PAXINDRAFT_10911                 53.5    2e-05   
ref|XP_004614510.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_010985943.1|  PREDICTED: regulator of nonsense transcripts 3A  53.5    2e-05   
ref|XP_004614511.1|  PREDICTED: regulator of nonsense transcripts...  53.5    2e-05   
ref|XP_009190566.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
gb|EPB88698.1|  hypothetical protein HMPREF1544_04457                 53.1    2e-05   
ref|XP_008634145.1|  PREDICTED: regulator of nonsense transcripts 3A  53.1    2e-05   
gb|KIM52552.1|  hypothetical protein SCLCIDRAFT_1223619               53.5    2e-05   
ref|XP_004467550.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|NP_001069879.1|  regulator of nonsense transcripts 3B             52.8    2e-05   
ref|XP_001621914.1|  hypothetical protein NEMVEDRAFT_v1g143243        50.1    2e-05   
ref|XP_006872155.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
gb|EHB07949.1|  Regulator of nonsense transcripts 3B                  52.4    2e-05   
emb|CDS12040.1|  hypothetical protein LRAMOSA04235                    53.1    2e-05   
ref|XP_003414824.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|XP_007196794.1|  PREDICTED: regulator of nonsense transcripts...  52.8    2e-05   
ref|XP_010573973.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|XP_007902641.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|XP_003414825.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|XP_011581842.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
ref|XP_010573972.1|  PREDICTED: regulator of nonsense transcripts...  53.1    2e-05   
gb|EHB12834.1|  Regulator of nonsense transcripts 3B                  53.1    2e-05   
ref|XP_004365162.1|  hypothetical protein CAOG_00291                  53.1    2e-05   
ref|XP_011581841.1|  PREDICTED: regulator of nonsense transcripts...  53.1    3e-05   
gb|AAG60690.1|AF318575_1  UPF3                                        53.1    3e-05   
ref|XP_006851618.1|  PREDICTED: regulator of nonsense transcripts 3A  53.1    3e-05   
ref|XP_009083697.1|  PREDICTED: regulator of nonsense transcripts 3A  52.8    3e-05   
emb|CDH57309.1|  wd repeat-containing protein                         52.8    3e-05   
ref|XP_009233484.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  52.8    3e-05   
gb|KFO73940.1|  Regulator of nonsense transcripts 3A                  52.8    3e-05   
gb|EJT52479.1|  hypothetical protein A1Q1_03995                       52.8    3e-05   
gb|EKD05159.1|  hypothetical protein A1Q2_00545                       52.8    3e-05   
ref|XP_007951522.1|  PREDICTED: regulator of nonsense transcripts...  53.1    3e-05   
ref|XP_005488045.1|  PREDICTED: regulator of nonsense transcripts 3A  52.8    3e-05   
ref|XP_009663817.1|  PREDICTED: regulator of nonsense transcripts 3A  52.8    3e-05   
gb|KFG66380.1|  Smg-4/UPF3 family protein                             53.1    3e-05   
ref|XP_005151571.1|  PREDICTED: regulator of nonsense transcripts 3A  52.8    3e-05   
ref|XP_007075325.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  53.1    3e-05   
gb|EPR58795.1|  Smg-4/UPF3 family protein                             53.1    3e-05   
gb|KFG36731.1|  Smg-4/UPF3 family protein                             53.1    3e-05   
gb|EPT25711.1|  Smg-4/UPF3 family protein                             53.1    3e-05   
ref|XP_007196793.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
ref|XP_008494601.1|  PREDICTED: regulator of nonsense transcripts 3A  52.8    3e-05   
gb|KFG49381.1|  Smg-4/UPF3 family protein                             53.1    3e-05   
ref|XP_007959223.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
gb|KFG56382.1|  Smg-4/UPF3 family protein                             53.1    3e-05   
ref|XP_005420088.1|  PREDICTED: regulator of nonsense transcripts 3A  52.8    3e-05   
ref|XP_007959222.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
gb|KFH02027.1|  Smg-4/UPF3 family protein                             53.1    3e-05   
ref|XP_002364750.1|  smg-4/UPF3 family domain protein                 53.1    3e-05   
ref|XP_011913561.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
ref|XP_011231589.1|  PREDICTED: regulator of nonsense transcripts 3A  52.8    3e-05   
ref|XP_007951523.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
ref|XP_006268616.1|  PREDICTED: regulator of nonsense transcripts 3A  52.8    3e-05   
ref|XP_004872225.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
gb|KFV75952.1|  Regulator of nonsense transcripts 3A                  52.8    3e-05   
ref|XP_010573971.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
ref|XP_005516633.1|  PREDICTED: regulator of nonsense transcripts 3A  52.8    3e-05   
ref|XP_006893846.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
ref|XP_004900219.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  52.8    3e-05   
ref|XP_004872226.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
ref|XP_010726638.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  52.8    3e-05   
ref|NP_075387.1|  regulator of nonsense transcripts 3A isoform hU...  52.8    3e-05   
ref|XP_011581840.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
ref|XP_003914153.1|  PREDICTED: regulator of nonsense transcripts...  52.8    3e-05   
ref|XP_011804102.1|  PREDICTED: regulator of nonsense transcripts 3B  52.4    4e-05   
ref|NP_001272234.1|  uncharacterized protein LOC101866227             52.8    4e-05   
ref|XP_002192806.2|  PREDICTED: regulator of nonsense transcripts 3A  52.8    4e-05   
ref|XP_006893845.1|  PREDICTED: regulator of nonsense transcripts...  52.4    4e-05   
ref|XP_004054834.1|  PREDICTED: regulator of nonsense transcripts...  52.4    4e-05   
ref|XP_009439463.1|  PREDICTED: regulator of nonsense transcripts 3A  52.4    4e-05   
ref|XP_416933.2|  PREDICTED: regulator of nonsense transcripts 3A     52.4    4e-05   
ref|XP_011487599.1|  PREDICTED: regulator of nonsense transcripts...  52.4    4e-05   
ref|XP_011487598.1|  PREDICTED: regulator of nonsense transcripts...  52.4    4e-05   
ref|XP_001629977.1|  predicted protein                                49.7    4e-05   
gb|KFM76145.1|  Regulator of nonsense transcripts 3A                  52.0    4e-05   
gb|ELU44664.1|  smg-4/UPF3 family domain-containing protein           52.4    4e-05   
gb|EHH31036.1|  Nonsense mRNA reducing factor 3B                      52.4    4e-05   
gb|KFH18280.1|  Smg-4/UPF3 family protein                             52.0    5e-05   
ref|XP_005601449.1|  PREDICTED: regulator of nonsense transcripts 3A  52.0    5e-05   
ref|XP_004012426.1|  PREDICTED: regulator of nonsense transcripts...  52.4    5e-05   
ref|XP_006508923.1|  PREDICTED: regulator of nonsense transcripts...  52.0    5e-05   
ref|XP_005415229.1|  PREDICTED: regulator of nonsense transcripts...  50.1    5e-05   
ref|XP_009953366.1|  PREDICTED: regulator of nonsense transcripts...  51.6    5e-05   
ref|XP_004412328.1|  PREDICTED: regulator of nonsense transcripts 3A  52.4    5e-05   
ref|XP_004092554.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  52.0    5e-05   
ref|XP_006927489.2|  PREDICTED: regulator of nonsense transcripts 3A  52.0    5e-05   
gb|KFQ13921.1|  Regulator of nonsense transcripts 3A                  51.6    5e-05   
gb|ERE87581.1|  regulator of nonsense transcripts 3B-like protein     52.0    5e-05   
ref|XP_003832196.1|  PREDICTED: regulator of nonsense transcripts 3A  52.0    6e-05   
ref|XP_005410488.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_005366306.1|  PREDICTED: regulator of nonsense transcripts 3A  51.6    6e-05   
ref|XP_006076664.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_002701034.2|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
gb|ERE87582.1|  regulator of nonsense transcripts 3B-like protein     52.0    6e-05   
ref|XP_011974775.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_005194290.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_005368937.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_004645774.1|  PREDICTED: regulator of nonsense transcripts 3B  52.0    6e-05   
ref|XP_010829734.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_010829733.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_005368938.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_006076665.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_005673918.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_005295966.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_005319423.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
gb|EGV97129.1|  Regulator of nonsense transcripts 3A                  51.6    6e-05   
ref|XP_004587703.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
ref|XP_005963804.1|  PREDICTED: regulator of nonsense transcripts 3A  52.0    6e-05   
ref|XP_011529681.1|  PREDICTED: regulator of nonsense transcripts...  52.0    6e-05   
gb|KDQ32779.1|  hypothetical protein PLEOSDRAFT_1073199               52.0    6e-05   
ref|XP_008827115.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_011962847.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_011529680.1|  PREDICTED: regulator of nonsense transcripts...  52.0    7e-05   
ref|XP_007178659.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_005614596.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  51.6    7e-05   
ref|XP_005410487.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_010611303.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
gb|ACO08927.1|  Regulator of nonsense transcripts 3B                  49.7    7e-05   
ref|XP_005319424.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_004587704.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_005673917.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_002720171.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_006758002.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_005082672.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  51.6    7e-05   
ref|XP_008507162.1|  PREDICTED: regulator of nonsense transcripts 3B  51.6    7e-05   
ref|XP_005859490.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|NP_542199.1|  regulator of nonsense transcripts 3B isoform 1      51.6    7e-05   
ref|XP_008250492.1|  PREDICTED: regulator of nonsense transcripts 3A  51.6    7e-05   
ref|XP_005641799.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_004685811.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_003135389.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
ref|XP_009074647.1|  PREDICTED: regulator of nonsense transcripts 3A  51.6    7e-05   
gb|ERE87580.1|  regulator of nonsense transcripts 3B-like protein     51.6    7e-05   
ref|XP_005410489.1|  PREDICTED: regulator of nonsense transcripts...  51.6    7e-05   
gb|ENN72156.1|  hypothetical protein YQE_11213                        51.6    8e-05   
ref|XP_008588273.1|  PREDICTED: regulator of nonsense transcripts...  51.6    8e-05   
ref|XP_007614170.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  51.6    8e-05   
ref|NP_075386.1|  regulator of nonsense transcripts 3B isoform 2      51.6    8e-05   
ref|XP_003931129.1|  PREDICTED: regulator of nonsense transcripts...  51.6    8e-05   
gb|AAI21018.1|  UPF3 regulator of nonsense transcripts homolog B ...  51.6    8e-05   
ref|XP_005673919.1|  PREDICTED: regulator of nonsense transcripts...  51.6    8e-05   
ref|XP_011630833.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  51.6    8e-05   
ref|XP_010611302.1|  PREDICTED: regulator of nonsense transcripts...  51.6    8e-05   



>emb|CDO97628.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVVLRHLPP++ Q++L+++V++RFSGRYNWVSF PGK SQK+Q+YSRAY++F
Sbjct  1    MKGPLDRTKVVLRHLPPSISQSSLMDQVETRFSGRYNWVSFRPGKTSQKRQSYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKG  83



>ref|XP_004230442.1| PREDICTED: regulator of nonsense transcripts UPF3 [Solanum lycopersicum]
Length=485

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR+KVVLRHLPPT+ Q+ L+++VDSRF+GRYNW  F PGK SQK QTYSRAY+EF
Sbjct  1    MKGPLDRSKVVLRHLPPTISQSMLLDQVDSRFAGRYNWFCFLPGKSSQKHQTYSRAYIEF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKG  83



>ref|XP_009775100.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Nicotiana sylvestris]
Length=508

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVVLRHLPPT+ Q+ L+E+V SRF+GRYNW SF PGK SQK QTYSRAYV+F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVVSRFTGRYNWFSFRPGKSSQKHQTYSRAYVDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKG  83



>ref|XP_009587503.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=508

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVVLRHLPPT+ Q+ L+E+V SRF+GRYNW SF PGK SQK QTYSRAYV+F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVLSRFTGRYNWFSFRPGKSSQKHQTYSRAYVDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKG  83



>ref|XP_006349314.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Solanum 
tuberosum]
Length=483

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR+KVVLRHLPPT+ Q+ L+++VDSRF+GRYNW  F PGK SQK QTYSRAY+EF
Sbjct  1    MKGPLDRSKVVLRHLPPTISQSMLLDQVDSRFAGRYNWFCFLPGKSSQKHQTYSRAYIEF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KMPEDVIEFAEFFDGHVFVNEKG  83



>ref|XP_007041200.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOX97031.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
Length=514

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP + +A L+E+VD+ FSGRYNW+SF PGK SQK Q+YSRAY++F
Sbjct  1    MKGALDRTKVILRHLPPAITEAMLVEQVDTAFSGRYNWLSFRPGKSSQKHQSYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KR EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KRSEDVLEFAEFFNGHVFVNEKG  83



>ref|XP_007041201.1| Smg-4/UPF3 family protein, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOX97032.1| Smg-4/UPF3 family protein, putative isoform 2, partial [Theobroma 
cacao]
Length=440

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP + +A L+E+VD+ FSGRYNW+SF PGK SQK Q+YSRAY++F
Sbjct  1    MKGALDRTKVILRHLPPAITEAMLVEQVDTAFSGRYNWLSFRPGKSSQKHQSYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KR EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KRSEDVLEFAEFFNGHVFVNEKG  83



>ref|XP_011092289.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
 ref|XP_011092290.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
 ref|XP_011092291.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
Length=518

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVVLRHLPPT+ Q+ L + VDSRFSGRY W +F PGK SQK  TYSRAY++F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSNLFDHVDSRFSGRYRWSAFRPGKSSQKHLTYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             RPEDV+EFAEFFNGH+FVNEKG
Sbjct  61   NRPEDVLEFAEFFNGHVFVNEKG  83



>ref|XP_010246764.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X5 
[Nelumbo nucifera]
Length=575

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR KVVLRHLPPTL Q+ L E++D RF+GRY W+ F  GK SQK Q YSRAY++F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHIFVNEKG  83



>ref|XP_010246762.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Nelumbo nucifera]
Length=585

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR KVVLRHLPPTL Q+ L E++D RF+GRY W+ F  GK SQK Q YSRAY++F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHIFVNEKG  83



>ref|XP_010246761.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Nelumbo nucifera]
Length=602

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR KVVLRHLPPTL Q+ L E++D RF+GRY W+ F  GK SQK Q YSRAY++F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHIFVNEKG  83



>ref|XP_010246760.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Nelumbo nucifera]
Length=612

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR KVVLRHLPPTL Q+ L E++D RF+GRY W+ F  GK SQK Q YSRAY++F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHIFVNEKG  83



>ref|XP_009775092.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Nicotiana sylvestris]
Length=517

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 74/92 (80%), Gaps = 9/92 (10%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK---------ISQKQQ  407
            MK PLDR KVVLRHLPPT+ Q+ L+E+V SRF+GRYNW SF PGK          SQK Q
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVVSRFTGRYNWFSFRPGKSRPSPQIFSCSQKHQ  60

Query  408  TYSRAYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            TYSRAYV+FKRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   TYSRAYVDFKRPEDVIEFAEFFDGHVFVNEKG  92



>ref|XP_009587502.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=517

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 74/92 (80%), Gaps = 9/92 (10%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK---------ISQKQQ  407
            MK PLDR KVVLRHLPPT+ Q+ L+E+V SRF+GRYNW SF PGK          SQK Q
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSMLVEQVLSRFTGRYNWFSFRPGKSRPSPQIFSCSQKHQ  60

Query  408  TYSRAYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            TYSRAYV+FKRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   TYSRAYVDFKRPEDVIEFAEFFDGHVFVNEKG  92



>gb|KJB47868.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47870.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=468

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFFNGH+FV+EKG
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKG  90



>gb|KJB47855.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47857.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=508

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  1    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFFNGH+FV+EKG
Sbjct  61   KRPEDVLEFAEFFNGHVFVSEKG  83



>gb|KJB47856.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47858.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=509

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  1    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFFNGH+FV+EKG
Sbjct  61   KRPEDVLEFAEFFNGHVFVSEKG  83



>gb|KJB47860.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47862.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47865.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=515

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFFNGH+FV+EKG
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKG  90



>gb|KJB47866.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=509

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFFNGH+FV+EKG
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKG  90



>gb|KJB47859.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47861.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
 gb|KJB47869.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=516

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFFNGH+FV+EKG
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKG  90



>gb|KJB47867.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=511

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFFNGH+FV+EKG
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKG  90



>gb|KJB47864.1| hypothetical protein B456_008G045900 [Gossypium raimondii]
Length=485

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESMLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFFNGH+FV+EKG
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKG  90



>gb|KHF99019.1| upf3a [Gossypium arboreum]
Length=577

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KV+LRHLPP++ ++ L+E+VDS FSGRYNW+SF PGK SQK  +YSRAYV+F
Sbjct  8    MKGTLDRTKVILRHLPPSITESVLLEQVDSAFSGRYNWLSFRPGKSSQKNLSYSRAYVDF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFFNGH+FV+EKG
Sbjct  68   KRPEDVLEFAEFFNGHVFVSEKG  90



>ref|XP_010246763.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X4 
[Nelumbo nucifera]
Length=580

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR KVVLRHLPPTL Q+ L E++D RF+GRY W+ F  GK SQK Q YSRAY++F
Sbjct  1    MKDPFDRTKVVLRHLPPTLSQSALTEQIDGRFAGRYKWICFRSGKNSQKHQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEK  500
            KRPEDVIEFAEFF+GH+FVNEK
Sbjct  61   KRPEDVIEFAEFFDGHIFVNEK  82



>ref|XP_006598794.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006598795.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 gb|KHN39677.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=512

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A L+ ++D+ F+GRYNW+SF PGKISQK  +YSRAY++F
Sbjct  1    MKGALDRTKVVLRHLPPSISEAALLAQIDAAFAGRYNWLSFRPGKISQKHISYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVI FAEFFNGH+FVNEKG
Sbjct  61   KRPEDVILFAEFFNGHVFVNEKG  83



>ref|XP_009353786.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009353787.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009353789.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ QA L+E++D  F+GRY+WV+F PGK SQK Q+YSRAY++ 
Sbjct  2    MKGQLDRTKVVLRHLPPSISQAALVEQIDGFFAGRYSWVAFRPGKKSQKNQSYSRAYIDL  61

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GHLFVNEKG
Sbjct  62   KRPEDVFEFAEFFDGHLFVNEKG  84



>ref|XP_002526435.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35930.1| conserved hypothetical protein [Ricinus communis]
Length=472

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            ++ KVV+RHLPPT+ Q + +E++D  FSGRYNWVSF PGK SQK Q+YSRAY++FKRPED
Sbjct  7    EKTKVVVRHLPPTISQGSFLEQIDVVFSGRYNWVSFRPGKSSQKHQSYSRAYIDFKRPED  66

Query  450  VIEFAEFFNGHLFVNEKG  503
            VIEFAEFFNGHLFVNEKG
Sbjct  67   VIEFAEFFNGHLFVNEKG  84



>ref|XP_008218705.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Prunus 
mume]
Length=492

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            +K  LDR KVVLRHLPP++ Q +L+E++D  FSGRYNWV+F PGK SQK  +YSRAY++ 
Sbjct  2    LKDQLDRTKVVLRHLPPSISQTSLVEQIDVFFSGRYNWVAFRPGKRSQKNPSYSRAYIDL  61

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GHLFVNEKG
Sbjct  62   KRPEDVIEFAEFFDGHLFVNEKG  84



>gb|EYU26454.1| hypothetical protein MIMGU_mgv1a004529mg [Erythranthe guttata]
Length=521

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  +DR KVVLRHLPPT+ Q+ L+E VDSRFSGRY W++F PGK S +Q  YSRAY++F
Sbjct  1    MKGSIDRTKVVLRHLPPTISQSNLVEHVDSRFSGRYGWLAFRPGKSSPRQPIYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
              PEDVIEFAEFFNGH+FVNEKG
Sbjct  61   NTPEDVIEFAEFFNGHIFVNEKG  83



>gb|EYU26453.1| hypothetical protein MIMGU_mgv1a004529mg [Erythranthe guttata]
Length=522

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  +DR KVVLRHLPPT+ Q+ L+E VDSRFSGRY W++F PGK S +Q  YSRAY++F
Sbjct  1    MKGSIDRTKVVLRHLPPTISQSNLVEHVDSRFSGRYGWLAFRPGKSSPRQPIYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
              PEDVIEFAEFFNGH+FVNEKG
Sbjct  61   NTPEDVIEFAEFFNGHIFVNEKG  83



>ref|XP_007221816.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
 gb|EMJ23015.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
Length=485

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            +K  LDR KVVLRHLPP++ Q +L+E++D  FSGRYNWV+F PGK SQK  +YSRAY++ 
Sbjct  2    LKDQLDRTKVVLRHLPPSISQTSLVEQIDVFFSGRYNWVAFRPGKRSQKNPSYSRAYIDL  61

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GHLFVNEKG
Sbjct  62   KRPEDVIEFAEFFDGHLFVNEKG  84



>ref|XP_008795266.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Phoenix dactylifera]
Length=562

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR K+VLRHLPP++ Q+ LIE++D RFSGRY+W+ F PGK S K Q YSRAY+ F
Sbjct  1    MKDPFDRTKIVLRHLPPSISQSALIEQIDERFSGRYDWLCFRPGKASHKNQRYSRAYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPE V+EFAEFF+GH+FVNEKG
Sbjct  61   KRPEVVVEFAEFFDGHIFVNEKG  83



>ref|XP_008795263.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008795264.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
Length=565

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR K+VLRHLPP++ Q+ LIE++D RFSGRY+W+ F PGK S K Q YSRAY+ F
Sbjct  1    MKDPFDRTKIVLRHLPPSISQSALIEQIDERFSGRYDWLCFRPGKASHKNQRYSRAYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPE V+EFAEFF+GH+FVNEKG
Sbjct  61   KRPEVVVEFAEFFDGHIFVNEKG  83



>ref|XP_007221815.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
 gb|EMJ23014.1| hypothetical protein PRUPE_ppa004923mg [Prunus persica]
Length=482

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            +K  LDR KVVLRHLPP++ Q +L+E++D  FSGRYNWV+F PGK SQK  +YSRAY++ 
Sbjct  2    LKDQLDRTKVVLRHLPPSISQTSLVEQIDVFFSGRYNWVAFRPGKRSQKNPSYSRAYIDL  61

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GHLFVNEKG
Sbjct  62   KRPEDVIEFAEFFDGHLFVNEKG  84



>ref|XP_009355334.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=495

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ QA L+E++D  F+GRYNWV+F PGK SQK Q+YSRAY++ 
Sbjct  2    MKGQLDRTKVVLRHLPPSISQAALVEQIDVFFAGRYNWVAFRPGKRSQKNQSYSRAYIDL  61

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRP+DV +FAEFF+GHLFVNEKG
Sbjct  62   KRPDDVFDFAEFFDGHLFVNEKG  84



>ref|XP_009355335.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=485

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ QA L+E++D  F+GRYNWV+F PGK SQK Q+YSRAY++ 
Sbjct  2    MKGQLDRTKVVLRHLPPSISQAALVEQIDVFFAGRYNWVAFRPGKRSQKNQSYSRAYIDL  61

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRP+DV +FAEFF+GHLFVNEKG
Sbjct  62   KRPDDVFDFAEFFDGHLFVNEKG  84



>ref|XP_006592654.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006592655.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 gb|KHN31598.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=514

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A L+ ++D+ F+GRYNW+SF PGKISQK  ++SRAY++F
Sbjct  1    MKGALDRTKVVLRHLPPSISEAALLSQIDAAFAGRYNWLSFRPGKISQKHMSFSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVI FAEFFNGH+FVN KG
Sbjct  61   KRPEDVILFAEFFNGHVFVNVKG  83



>ref|XP_011088114.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
Length=515

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVVLRHLPPT+ Q+ L+E VDSRF GRY W+ F PGK S K   YSRAY++F
Sbjct  1    MKGPLDRTKVVLRHLPPTISQSNLVEHVDSRFVGRYLWLVFRPGKSSLKHPKYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             +PEDVIEFAEFFNGH+FVNEKG
Sbjct  61   NKPEDVIEFAEFFNGHVFVNEKG  83



>ref|XP_010912655.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Elaeis 
guineensis]
Length=562

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR K+VLRHLPP++ Q+ L+E++  RF+GRY+WV F PGK S K Q YSR+Y+ F
Sbjct  1    MKGPFDRTKIVLRHLPPSISQSALMEQIGERFAGRYDWVCFRPGKASPKNQRYSRSYLSF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVVEFAEFFDGHIFVNEKG  83



>ref|XP_010657967.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Vitis vinifera]
 emb|CBI29694.3| unnamed protein product [Vitis vinifera]
Length=519

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVV+RHLPPT+ +A  +E++D+ F GRY  V F PGK SQK+Q+YSRAY++F
Sbjct  1    MKGPLDRTKVVVRHLPPTISEAAFLEQIDTVFKGRYTLVKFRPGKNSQKRQSYSRAYLDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKG  83



>ref|XP_010657969.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Vitis vinifera]
Length=514

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVV+RHLPPT+ +A  +E++D+ F GRY  V F PGK SQK+Q+YSRAY++F
Sbjct  1    MKGPLDRTKVVVRHLPPTISEAAFLEQIDTVFKGRYTLVKFRPGKNSQKRQSYSRAYLDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKG  83



>ref|XP_010657968.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Vitis vinifera]
Length=515

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVV+RHLPPT+ +A  +E++D+ F GRY  V F PGK SQK+Q+YSRAY++F
Sbjct  1    MKGPLDRTKVVVRHLPPTISEAAFLEQIDTVFKGRYTLVKFRPGKNSQKRQSYSRAYLDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKG  83



>ref|XP_007148572.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 ref|XP_007148573.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 gb|ESW20566.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 gb|ESW20567.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
Length=513

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP+L +A L+ ++DS F+ RYNW+SF P K+SQK  +YSRAY++F
Sbjct  1    MKGSLDRTKVVLRHLPPSLSEAALLAQIDSAFADRYNWLSFRPAKVSQKHISYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRP+DVI FAEFFNGH+FVNEKG
Sbjct  61   KRPDDVILFAEFFNGHVFVNEKG  83



>gb|KDO41302.1| hypothetical protein CISIN_1g0102241mg, partial [Citrus sinensis]
 gb|KDO41303.1| hypothetical protein CISIN_1g0102241mg, partial [Citrus sinensis]
Length=260

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVV+R+LPP + Q    E++D  F GRYNWVSF  GK SQK Q+ +RAY++F
Sbjct  1    MKGPLDRTKVVVRNLPPAITQPAFTEQIDGAFGGRYNWVSFRQGKTSQKHQSCARAYLDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K+PEDV+EFAEFFNGH+FVNEKG
Sbjct  61   KKPEDVLEFAEFFNGHVFVNEKG  83



>ref|XP_010910233.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Elaeis guineensis]
Length=531

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVVLR LPP +PQATL+E++D RF+GRY W  F PGK ++K Q +SRAY++F
Sbjct  1    MKDPLDRTKVVLRRLPPAIPQATLMEEIDGRFAGRYKWFCFRPGKNNRKNQHHSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             R EDV+EFAEFF+GH+FVNEKG
Sbjct  61   NRSEDVVEFAEFFDGHIFVNEKG  83



>ref|XP_008802925.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Phoenix dactylifera]
Length=568

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  246  VWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  425
            +  MK PLDR KVVLR LPP + QATL+E++D RF+GRY W  F PGK SQK   +SRAY
Sbjct  7    IAHMKDPLDRTKVVLRRLPPAISQATLMEEIDGRFAGRYKWFCFRPGKNSQKNPHHSRAY  66

Query  426  VEFKRPEDVIEFAEFFNGHLFVNEKG  503
            ++FKRPEDV+EFAEFF+GH+FVN+KG
Sbjct  67   IDFKRPEDVVEFAEFFDGHVFVNKKG  92



>ref|XP_010910195.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010910210.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010910217.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
Length=566

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVVLR LPP +PQATL+E++D RF+GRY W  F PGK ++K Q +SRAY++F
Sbjct  1    MKDPLDRTKVVLRRLPPAIPQATLMEEIDGRFAGRYKWFCFRPGKNNRKNQHHSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             R EDV+EFAEFF+GH+FVNEKG
Sbjct  61   NRSEDVVEFAEFFDGHIFVNEKG  83



>gb|KJB32866.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=443

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKG  83



>ref|XP_009404844.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
Length=467

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR KVV+RHLPP + Q+ L+E++D RF+GRY+WV F PGK SQK Q +SRAY+ F
Sbjct  1    MKDPPDRTKVVMRHLPPAISQSVLMEQIDGRFAGRYDWVCFRPGKNSQKDQIHSRAYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
              PEDV+EFAEFF+GH+FVNEKG
Sbjct  61   NNPEDVVEFAEFFDGHIFVNEKG  83



>ref|XP_009786002.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Nicotiana 
sylvestris]
Length=469

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVV+RHLPPTL Q+TL+E+VDSRF+GRYNW +F PGK S K Q+YSRAY++F+  EDV
Sbjct  5    RTKVVVRHLPPTLSQSTLLEQVDSRFAGRYNWFTFRPGKTSLKHQSYSRAYIDFRNTEDV  64

Query  453  IEFAEFFNGHLFVNEKG  503
            IEFAEFF+GH+FVNEKG
Sbjct  65   IEFAEFFDGHVFVNEKG  81



>ref|XP_010930556.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Elaeis guineensis]
Length=575

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR KVVLRHLPP++ Q+ L+E++D RF+GRY+W  F PGK S K Q YSRAY+ F
Sbjct  1    MKDPFDRTKVVLRHLPPSISQSALMEQIDGRFAGRYDWACFRPGKASHKNQRYSRAYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KR EDV+EFAE F+GH+FVNEKG
Sbjct  61   KRLEDVVEFAELFDGHIFVNEKG  83



>gb|EPS57826.1| hypothetical protein M569_16991, partial [Genlisea aurea]
Length=484

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVVLRHLPP++ ++ L+E +DSRFSGRY+W +F PGK SQK+  YSRAY+ F
Sbjct  1    MKGPLDRTKVVLRHLPPSISESNLVELIDSRFSGRYHWFAFCPGKSSQKRLKYSRAYIGF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             +PEDVIEFA FFNGH FVNEKG
Sbjct  61   YKPEDVIEFAAFFNGHAFVNEKG  83



>ref|XP_006858584.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Amborella trichopoda]
 gb|ERN20051.1| hypothetical protein AMTR_s00071p00188270 [Amborella trichopoda]
Length=599

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVV+R LPP L Q  L+EK+DSRFSGRY W +F PGK S K Q +SR Y++F
Sbjct  1    MKDPLDRTKVVVRRLPPALTQQALMEKIDSRFSGRYEWAAFRPGKNSLKNQRHSRIYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFF GH+FVNEKG
Sbjct  61   KRPEDVLEFAEFFVGHVFVNEKG  83



>ref|XP_011628613.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Amborella trichopoda]
Length=600

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVV+R LPP L Q  L+EK+DSRFSGRY W +F PGK S K Q +SR Y++F
Sbjct  1    MKDPLDRTKVVVRRLPPALTQQALMEKIDSRFSGRYEWAAFRPGKNSLKNQRHSRIYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFF GH+FVNEKG
Sbjct  61   KRPEDVLEFAEFFVGHVFVNEKG  83



>gb|KJB32869.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=442

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKG  83



>gb|KJB32861.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=507

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKG  83



>gb|KJB32868.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=499

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKG  83



>gb|KJB32858.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=508

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKG  83



>gb|KJB32864.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=504

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKG  83



>gb|KJB32865.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=515

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKG  83



>gb|KJB32862.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=514

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEKG  83



>ref|XP_009587163.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Nicotiana 
tomentosiformis]
Length=469

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVV+RHLPPTL Q+TL+E+VDSRF+GRYNW +F PGK S K Q+YSR Y++F+  EDV
Sbjct  5    RTKVVVRHLPPTLSQSTLLEQVDSRFAGRYNWFTFRPGKTSLKHQSYSRVYIDFRNTEDV  64

Query  453  IEFAEFFNGHLFVNEKG  503
            IEFAEFF+GH+FVNEKG
Sbjct  65   IEFAEFFDGHVFVNEKG  81



>ref|XP_006431585.1| hypothetical protein CICLE_v10000901mg [Citrus clementina]
 gb|ESR44825.1| hypothetical protein CICLE_v10000901mg [Citrus clementina]
Length=514

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVV+R+LPP + Q    E++D  F GRYNWVSF  GK SQK Q+ +RAY++F
Sbjct  1    MKGPLDRTKVVVRNLPPAITQPAFTEQIDGAFGGRYNWVSFRQGKTSQKHQSCARAYLDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K+PEDV+EFAEFFNGH+FVNEKG
Sbjct  61   KKPEDVLEFAEFFNGHVFVNEKG  83



>ref|XP_006492554.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Citrus 
sinensis]
Length=514

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVV+R+LPP + Q    E++D  F GRYNWVSF  GK SQK Q+ +RAY++F
Sbjct  1    MKGPLDRTKVVVRNLPPAITQPAFTEQIDGAFGGRYNWVSFRQGKTSQKHQSCARAYLDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K+PEDV+EFAEFFNGH+FVNEKG
Sbjct  61   KKPEDVLEFAEFFNGHVFVNEKG  83



>ref|XP_010030190.1| PREDICTED: regulator of nonsense transcripts UPF3 [Eucalyptus 
grandis]
 gb|KCW57141.1| hypothetical protein EUGRSUZ_I02778 [Eucalyptus grandis]
Length=486

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK   DR KVVLRHLPP++ +  L +++D+ F+GRYNW SF PGK S K Q YSRAY+ F
Sbjct  1    MKGHPDRTKVVLRHLPPSITEGMLADQIDTAFAGRYNWFSFRPGKTSLKHQVYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFEGHVFVNEKG  83



>gb|KCW57140.1| hypothetical protein EUGRSUZ_I02778 [Eucalyptus grandis]
Length=479

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK   DR KVVLRHLPP++ +  L +++D+ F+GRYNW SF PGK S K Q YSRAY+ F
Sbjct  1    MKGHPDRTKVVLRHLPPSITEGMLADQIDTAFAGRYNWFSFRPGKTSLKHQVYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFEGHVFVNEKG  83



>ref|XP_009401110.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401111.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
Length=565

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            M+ P DR KVV+R LPP++ Q+ L+E++D RF+GRY+WV F PGK SQK Q +SRAY+ F
Sbjct  1    MRGPSDRTKVVVRRLPPSISQSVLMEQIDGRFAGRYDWVCFRPGKNSQKNQRHSRAYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAEFF+ H+FVNEKG
Sbjct  61   KRPEDVVEFAEFFDQHIFVNEKG  83



>gb|KJB32867.1| hypothetical protein B456_005G265700 [Gossypium raimondii]
Length=476

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  LDR KVVLRHLPP++ +A LIE+VDS F+GRYNW SF PGK  QK Q+ SR Y++F
Sbjct  1    MKRTLDRTKVVLRHLPPSITEAMLIEQVDSAFAGRYNWFSFRPGKNRQKHQSCSRLYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEK  500
            K  EDV+EFAEFFNGH+FVNEK
Sbjct  61   KSLEDVLEFAEFFNGHVFVNEK  82



>ref|XP_008786472.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Phoenix dactylifera]
Length=574

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK   DR KVVLRHLPP++ Q+ L+E++D RF+GRY+W  F PGK S K Q YSRAY+ F
Sbjct  1    MKDSFDRTKVVLRHLPPSISQSALMEQIDGRFAGRYDWACFRPGKASHKNQRYSRAYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KR EDV+EFAE F+GH+FVNEKG
Sbjct  61   KRLEDVVEFAELFDGHIFVNEKG  83



>ref|XP_008786471.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
Length=581

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK   DR KVVLRHLPP++ Q+ L+E++D RF+GRY+W  F PGK S K Q YSRAY+ F
Sbjct  1    MKDSFDRTKVVLRHLPPSISQSALMEQIDGRFAGRYDWACFRPGKASHKNQRYSRAYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KR EDV+EFAE F+GH+FVNEKG
Sbjct  61   KRLEDVVEFAELFDGHIFVNEKG  83



>ref|XP_008802926.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Phoenix dactylifera]
Length=567

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +3

Query  246  VWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK--ISQKQQTYSR  419
            +  MK PLDR KVVLR LPP + QATL+E++D RF+GRY W  F PGK   SQK   +SR
Sbjct  7    IAHMKDPLDRTKVVLRRLPPAISQATLMEEIDGRFAGRYKWFCFRPGKNSCSQKNPHHSR  66

Query  420  AYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            AY++FKRPEDV+EFAEFF+GH+FVN+KG
Sbjct  67   AYIDFKRPEDVVEFAEFFDGHVFVNKKG  94



>ref|NP_174660.2| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
 sp|Q9FVW4.1|RENT3_ARATH RecName: Full=Regulator of nonsense transcripts UPF3; AltName: 
Full=Nonsense mRNA reducing factor UPF3; AltName: Full=Up-frameshift 
suppressor 3 homolog; Short=AtUpf3 [Arabidopsis thaliana]
 gb|AAG12847.1|AC079286_4 unknown protein; 6107-8789 [Arabidopsis thaliana]
 gb|AAM91586.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15431.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31653.1| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
Length=482

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF+ RYNWVSF PGK S K Q YSRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSSYKNQKYSRAYVSF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKG  83



>ref|XP_002891069.1| ATUPF3/UPF3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67328.1| ATUPF3/UPF3 [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF+ RYNWVSF PGK S K Q YSRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSSYKNQKYSRAYVSF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKG  83



>ref|XP_008802922.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802923.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802924.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Phoenix dactylifera]
Length=570

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +3

Query  246  VWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK--ISQKQQTYSR  419
            +  MK PLDR KVVLR LPP + QATL+E++D RF+GRY W  F PGK   SQK   +SR
Sbjct  7    IAHMKDPLDRTKVVLRRLPPAISQATLMEEIDGRFAGRYKWFCFRPGKNSCSQKNPHHSR  66

Query  420  AYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            AY++FKRPEDV+EFAEFF+GH+FVN+KG
Sbjct  67   AYIDFKRPEDVVEFAEFFDGHVFVNKKG  94



>ref|XP_009403714.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Musa 
acuminata subsp. malaccensis]
Length=563

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P DR KVV+R LPP++ Q  L+E++D RF+GRY+WV F PGK SQK Q Y+RAY+ F
Sbjct  1    MKDPSDRTKVVVRRLPPSMSQPVLMEQIDGRFAGRYDWVCFRPGKNSQKNQRYTRAYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K P+DV+EFAEFF+GH+FVNEKG
Sbjct  61   KIPDDVVEFAEFFDGHIFVNEKG  83



>ref|XP_006385051.1| hypothetical protein POPTR_0004s23450g [Populus trichocarpa]
 gb|ERP62848.1| hypothetical protein POPTR_0004s23450g [Populus trichocarpa]
Length=520

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+S+ PG  SQK Q+YSRAY++FKRPED
Sbjct  8    DKTKVVVRHLPPGISQPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYIDFKRPED  67

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FAEFFNGH+FVNEKG
Sbjct  68   VIDFAEFFNGHIFVNEKG  85



>ref|XP_006385052.1| Smg-4/UPF3 family protein [Populus trichocarpa]
 gb|ERP62849.1| Smg-4/UPF3 family protein [Populus trichocarpa]
Length=527

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+S+ PG  SQK Q+YSRAY++FKRPED
Sbjct  8    DKTKVVVRHLPPGISQPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYIDFKRPED  67

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FAEFFNGH+FVNEKG
Sbjct  68   VIDFAEFFNGHIFVNEKG  85



>ref|XP_009362405.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Pyrus x bretschneideri]
Length=491

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L Q+ L+ ++D + + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLLHQIDHQLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHMFVNEKG  83



>ref|XP_009362399.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009362400.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009362401.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=523

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L Q+ L+ ++D + + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLLHQIDHQLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHMFVNEKG  83



>gb|AAG12537.1|AC015446_18 Unknown protein [Arabidopsis thaliana]
Length=525

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF+ RYNWVSF PGK S K Q YSRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSSYKNQKYSRAYVSF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKG  83



>ref|XP_009362402.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009362403.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009362404.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=522

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L Q+ L+ ++D + + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLLHQIDHQLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHMFVNEKG  83



>ref|XP_011047887.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Populus euphratica]
Length=510

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+SF PGK SQK Q+ SRAY++FKRP+D
Sbjct  7    DKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKRPDD  66

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FAEFFNGHLFVNEKG
Sbjct  67   VIDFAEFFNGHLFVNEKG  84



>ref|XP_011047883.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
 ref|XP_011047884.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
Length=518

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+SF PGK SQK Q+ SRAY++FKRP+D
Sbjct  7    DKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKRPDD  66

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FAEFFNGHLFVNEKG
Sbjct  67   VIDFAEFFNGHLFVNEKG  84



>ref|XP_011047886.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Populus euphratica]
Length=511

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+SF PGK SQK Q+ SRAY++FKRP+D
Sbjct  7    DKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKRPDD  66

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FAEFFNGHLFVNEKG
Sbjct  67   VIDFAEFFNGHLFVNEKG  84



>ref|XP_011047885.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Populus euphratica]
Length=517

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+SF PGK SQK Q+ SRAY++FKRP+D
Sbjct  7    DKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSFRPGKSSQKHQSCSRAYIDFKRPDD  66

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FAEFFNGHLFVNEKG
Sbjct  67   VIDFAEFFNGHLFVNEKG  84



>ref|XP_011028362.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
Length=521

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            D+ KVV+RHLPP + +   +E++D  FSGRYNW+S+ PG  SQK Q+YSRAY++FKRPED
Sbjct  8    DKTKVVVRHLPPGISKPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYIDFKRPED  67

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FAEFFNGHLFVNEKG
Sbjct  68   VIDFAEFFNGHLFVNEKG  85



>ref|XP_011028363.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Populus euphratica]
Length=520

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            D+ KVV+RHLPP + +   +E++D  FSGRYNW+S+ PG  SQK Q+YSRAY++FKRPED
Sbjct  8    DKTKVVVRHLPPGISKPMFVEQIDVAFSGRYNWLSYRPGNNSQKHQSYSRAYIDFKRPED  67

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FAEFFNGHLFVNEKG
Sbjct  68   VIDFAEFFNGHLFVNEKG  85



>emb|CAN62711.1| hypothetical protein VITISV_035617 [Vitis vinifera]
Length=355

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KV++RHLPP + +A  +E++++ F GRY  V F PGK SQ++Q+YSRAY++F
Sbjct  1    MKGPLDRTKVMVRHLPPMILEAAFLEQINTVFKGRYTLVKFRPGKNSQQRQSYSRAYLDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDVIEFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEKG  83



>ref|XP_012066695.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Jatropha curcas]
 gb|KDP42459.1| hypothetical protein JCGZ_00256 [Jatropha curcas]
Length=510

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK   ++ KVV+RHLPPT+ Q   +E+++  F+GRYNWVSF PGK SQ+ Q+ SRAY++F
Sbjct  1    MKGQSEKTKVVVRHLPPTISQDMFLEQINVAFAGRYNWVSFRPGKNSQRHQSNSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            + PEDVIEFAEFFNGHLFVNEKG
Sbjct  61   RSPEDVIEFAEFFNGHLFVNEKG  83



>ref|XP_012066696.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Jatropha curcas]
Length=509

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK   ++ KVV+RHLPPT+ Q   +E+++  F+GRYNWVSF PGK SQ+ Q+ SRAY++F
Sbjct  1    MKGQSEKTKVVVRHLPPTISQDMFLEQINVAFAGRYNWVSFRPGKNSQRHQSNSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            + PEDVIEFAEFFNGHLFVNEKG
Sbjct  61   RSPEDVIEFAEFFNGHLFVNEKG  83



>emb|CAN72659.1| hypothetical protein VITISV_042717 [Vitis vinifera]
Length=437

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  234  FELPVWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTY  413
             +L +  MK PLDR KV++RHLPP + +A  +E++D+ F  RY  V F PGK SQ++Q+Y
Sbjct  69   LKLGISHMKGPLDRTKVMVRHLPPMISEAAFLEQIDTVFKERYTLVKFCPGKNSQQRQSY  128

Query  414  SRAYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            SRAY++FKRPEDVIEFAEFF+GH+FVNEKG
Sbjct  129  SRAYLDFKRPEDVIEFAEFFDGHVFVNEKG  158



>ref|XP_008368136.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
UPF3-like [Malus domestica]
Length=575

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MKVPL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKVPLVRTKVLIRHLPPSLSQSDLFHQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_006389505.1| hypothetical protein POPTR_0022s00460g [Populus trichocarpa]
 gb|ERP48419.1| hypothetical protein POPTR_0022s00460g [Populus trichocarpa]
Length=511

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            D+ KVV+RHLPP + Q   +E++D  FSGRYNW+S+ PGK SQK Q+ SRAY++FKRP+D
Sbjct  7    DKTKVVVRHLPPGVSQPMFVEQIDLAFSGRYNWLSYRPGKSSQKHQSCSRAYIDFKRPDD  66

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FAEFFNGHLFVNEKG
Sbjct  67   VIDFAEFFNGHLFVNEKG  84



>emb|CBI18298.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KV++RHLPP + +A  +E++++ F GRY  V F PGK SQ++Q+YSRAY++F
Sbjct  1    MKGPLDRTKVMVRHLPPMILEAAFLEQINTVFKGRYTLVKFRPGKNSQQRQSYSRAYLDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEK  500
            KRPEDVIEFAEFF+GH+FVNEK
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEK  82



>ref|XP_008378738.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Malus domestica]
Length=517

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAYV+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYVDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHIFVNEKG  83



>ref|XP_008378736.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Malus domestica]
Length=524

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAYV+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYVDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHIFVNEKG  83



>ref|XP_008378737.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Malus domestica]
Length=523

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAYV+F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYVDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHIFVNEKG  83



>ref|XP_010101271.1| hypothetical protein L484_011635 [Morus notabilis]
 gb|EXB88206.1| hypothetical protein L484_011635 [Morus notabilis]
Length=533

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R K V+R LPP+L Q+ L +++D RFSGRY+W  F PGK SQK Q YSRAY++F
Sbjct  1    MKDPLSRTKAVVRRLPPSLSQSDLFQQIDDRFSGRYHWFCFRPGKNSQKHQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             R EDV+EFAEFF+GH+FVNEKG
Sbjct  61   NRAEDVLEFAEFFDGHVFVNEKG  83



>ref|XP_007226163.1| hypothetical protein PRUPE_ppa015218mg [Prunus persica]
 gb|EMJ27362.1| hypothetical protein PRUPE_ppa015218mg [Prunus persica]
Length=467

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L  + L++++D + + RYNW  F PGK SQK Q YSRAY++F
Sbjct  1    MKDPLVRTKVLVRHLPPSLSHSDLLQQIDHQLADRYNWFCFRPGKNSQKNQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_010683312.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=495

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL+R KVV+RHLPP+L  ++  E++D RFS RYNW SF PG  S   Q Y RAYV F
Sbjct  1    MKEPLNRTKVVVRHLPPSLSHSSFFEQIDGRFSSRYNWSSFRPGNSSHTNQRYGRAYVNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
              P+DV EFAEFFNGH+FVNEKG
Sbjct  61   NSPDDVFEFAEFFNGHVFVNEKG  83



>gb|KJB68168.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=452

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP++ +  +I ++D RFS RYNW SF  GK S KQQ+YSRAY+ F
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             RPEDV EFAEFF+GH+FVNEKG
Sbjct  61   NRPEDVFEFAEFFDGHIFVNEKG  83



>ref|XP_008219049.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
 ref|XP_008219050.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
 ref|XP_008219051.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
Length=528

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L  + L++++D + + RYNW  F PGK SQK Q YSRAY++F
Sbjct  1    MKDPLVRTKVLVRHLPPSLSHSDLLQQIDHQLADRYNWFCFRPGKNSQKNQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKG  83



>gb|KJB68170.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=459

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP++ +  +I ++D RFS RYNW SF  GK S KQQ+YSRAY+ F
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             RPEDV EFAEFF+GH+FVNEKG
Sbjct  61   NRPEDVFEFAEFFDGHIFVNEKG  83



>gb|KJB68172.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=464

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP++ +  +I ++D RFS RYNW SF  GK S KQQ+YSRAY+ F
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             RPEDV EFAEFF+GH+FVNEKG
Sbjct  61   NRPEDVFEFAEFFDGHIFVNEKG  83



>ref|XP_010683306.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=503

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL+R KVV+RHLPP+L  ++  E++D RFS RYNW SF PG  S   Q Y RAYV F
Sbjct  1    MKEPLNRTKVVVRHLPPSLSHSSFFEQIDGRFSSRYNWSSFRPGNSSHTNQRYGRAYVNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
              P+DV EFAEFFNGH+FVNEKG
Sbjct  61   NSPDDVFEFAEFFNGHVFVNEKG  83



>ref|XP_007024252.1| Smg-4/UPF3 family protein, putative isoform 5 [Theobroma cacao]
 gb|EOY26874.1| Smg-4/UPF3 family protein, putative isoform 5 [Theobroma cacao]
Length=492

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KVV+RHLPP++ Q+ L  ++D RFS RYNW SF  GK S K Q YSRAY+ F
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKG  83



>gb|KJB68169.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
 gb|KJB68171.1| hypothetical protein B456_010G229700 [Gossypium raimondii]
Length=487

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP++ +  +I ++D RFS RYNW SF  GK S KQQ+YSRAY+ F
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKSSHKQQSYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             RPEDV EFAEFF+GH+FVNEKG
Sbjct  61   NRPEDVFEFAEFFDGHIFVNEKG  83



>emb|CBI18294.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KV++RHLPP + +A  +E++D+ F  RY  V F PGK SQ++Q+YSRAY++F
Sbjct  1    MKGPLDRTKVMVRHLPPMISEAAFLEQIDTVFKERYTLVKFCPGKNSQQRQSYSRAYLDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEK  500
            KRPEDVIEFAEFF+GH+FVNEK
Sbjct  61   KRPEDVIEFAEFFDGHVFVNEK  82



>ref|XP_007024249.1| Smg-4/UPF3 family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY26871.1| Smg-4/UPF3 family protein, putative isoform 2 [Theobroma cacao]
Length=487

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KVV+RHLPP++ Q+ L  ++D RFS RYNW SF  GK S K Q YSRAY+ F
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKG  83



>gb|KHG15802.1| Regulator of nonsense transcripts 3A [Gossypium arboreum]
Length=540

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP++ +  +I ++D RFS RYNW SF  GK S KQQ+YSRAY+ F
Sbjct  1    MKEPLRKTKVVIRHLPPSVTEPFIISQIDDRFSDRYNWFSFRLGKCSHKQQSYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             RPEDV EFAEFF+GH+FVNEKG
Sbjct  61   NRPEDVFEFAEFFDGHIFVNEKG  83



>ref|XP_007024253.1| Smg-4/UPF3 family protein, putative isoform 6 [Theobroma cacao]
 gb|EOY26875.1| Smg-4/UPF3 family protein, putative isoform 6 [Theobroma cacao]
Length=450

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KVV+RHLPP++ Q+ L  ++D RFS RYNW SF  GK S K Q YSRAY+ F
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_007024248.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007024250.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007024251.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY26870.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY26872.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY26873.1| Smg-4/UPF3 family protein, putative isoform 1 [Theobroma cacao]
Length=523

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KVV+RHLPP++ Q+ L  ++D RFS RYNW SF  GK S K Q YSRAY+ F
Sbjct  1    MKEPLRRTKVVIRHLPPSVTQSFLFSQIDDRFSDRYNWFSFRLGKSSHKHQRYSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_010327534.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Solanum lycopersicum]
Length=476

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  453  IEFAEFFNGHLFVNEKG  503
             EFAEFF+GH+FVNEKG
Sbjct  65   TEFAEFFDGHMFVNEKG  81



>ref|XP_006339922.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006339923.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006339924.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Solanum tuberosum]
Length=508

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFTFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  453  IEFAEFFNGHLFVNEKG  503
             EFAEFF+GH+FVNEKG
Sbjct  65   TEFAEFFDGHMFVNEKG  81



>ref|XP_010327532.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Solanum lycopersicum]
Length=495

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  453  IEFAEFFNGHLFVNEKG  503
             EFAEFF+GH+FVNEKG
Sbjct  65   TEFAEFFDGHMFVNEKG  81



>ref|XP_006339925.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Solanum tuberosum]
Length=482

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFTFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  453  IEFAEFFNGHLFVNEKG  503
             EFAEFF+GH+FVNEKG
Sbjct  65   TEFAEFFDGHMFVNEKG  81



>ref|XP_008459660.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Cucumis melo]
Length=506

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL+R KVV+RHLPP+L  + L   +  RF+GR+NW  + PGK SQK Q Y+RAY++F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             RPEDV EFAEFF+GH+FVNEKG
Sbjct  61   TRPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_008459659.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Cucumis melo]
Length=513

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL+R KVV+RHLPP+L  + L   +  RF+GR+NW  + PGK SQK Q Y+RAY++F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             RPEDV EFAEFF+GH+FVNEKG
Sbjct  61   TRPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_010327533.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Solanum lycopersicum]
Length=489

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  453  IEFAEFFNGHLFVNEKG  503
             EFAEFF+GH+FVNEKG
Sbjct  65   TEFAEFFDGHMFVNEKG  81



>ref|XP_004248850.2| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Solanum lycopersicum]
Length=496

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  453  IEFAEFFNGHLFVNEKG  503
             EFAEFF+GH+FVNEKG
Sbjct  65   TEFAEFFDGHMFVNEKG  81



>ref|XP_011656113.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Cucumis sativus]
 gb|KGN52703.1| hypothetical protein Csa_5G650630 [Cucumis sativus]
Length=513

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL+R KVV+RHLPP+L  + L   +  RF+GR+NW  + PGK SQK Q Y+RAY++F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             RPEDV EFAEFF+GH+FVNEKG
Sbjct  61   TRPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_004141560.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Cucumis sativus]
Length=506

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL+R KVV+RHLPP+L  + L   +  RF+GR+NW  + PGK SQK Q Y+RAY++F
Sbjct  1    MKDPLERTKVVIRHLPPSLSHSDLFHHIHDRFAGRFNWSYYRPGKTSQKDQRYARAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             RPEDV EFAEFF+GH+FVNEKG
Sbjct  61   TRPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_010327529.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010327530.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum lycopersicum]
Length=508

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  453  IEFAEFFNGHLFVNEKG  503
             EFAEFF+GH+FVNEKG
Sbjct  65   TEFAEFFDGHMFVNEKG  81



>ref|XP_010327531.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Solanum lycopersicum]
Length=507

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVVLRHLPPTL Q+ L+E VDSRF+GRYNW +F P K S K Q+YS+AY++F+  EDV
Sbjct  5    RTKVVLRHLPPTLSQSMLLEHVDSRFAGRYNWFNFRPAKTSLKHQSYSKAYIDFRNMEDV  64

Query  453  IEFAEFFNGHLFVNEKG  503
             EFAEFF+GH+FVNEKG
Sbjct  65   TEFAEFFDGHMFVNEKG  81



>ref|XP_010542926.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Tarenaya hassleriana]
Length=490

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KV++RHLPP++ Q+ L+  + +RF+ RYNW++FHPGK S K Q YSRAY+EF
Sbjct  1    MKDPLQKRKVIVRHLPPSITQSGLLSHIHARFADRYNWLAFHPGKSSHKNQKYSRAYIEF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV EFA FFNGH+FVNEKG
Sbjct  61   KTQEDVYEFATFFNGHVFVNEKG  83



>ref|XP_010542917.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Tarenaya hassleriana]
Length=491

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KV++RHLPP++ Q+ L+  + +RF+ RYNW++FHPGK S K Q YSRAY+EF
Sbjct  1    MKDPLQKRKVIVRHLPPSITQSGLLSHIHARFADRYNWLAFHPGKSSHKNQKYSRAYIEF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV EFA FFNGH+FVNEKG
Sbjct  61   KTQEDVYEFATFFNGHVFVNEKG  83



>ref|XP_010542909.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Tarenaya hassleriana]
Length=495

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KV++RHLPP++ Q+ L+  + +RF+ RYNW++FHPGK S K Q YSRAY+EF
Sbjct  1    MKDPLQKRKVIVRHLPPSITQSGLLSHIHARFADRYNWLAFHPGKSSHKNQKYSRAYIEF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV EFA FFNGH+FVNEKG
Sbjct  61   KTQEDVYEFATFFNGHVFVNEKG  83



>ref|NP_001117406.1| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
 gb|AEE31654.1| regulator of nonsense transcripts UPF3 [Arabidopsis thaliana]
Length=484

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK--ISQKQQTYSRAYV  428
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF+ RYNWVSF PGK  +  K Q YSRAYV
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFADRYNWVSFRPGKSRLGYKNQKYSRAYV  60

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
             FK PEDV EFA FFNGH+FVNEKG
Sbjct  61   SFKAPEDVYEFAAFFNGHVFVNEKG  85



>ref|XP_004975685.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Setaria italica]
 ref|XP_004975686.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Setaria italica]
Length=504

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAE FNGH+FVNEKG
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKG  83



>tpg|DAA37690.1| TPA: hypothetical protein ZEAMMB73_050614 [Zea mays]
Length=270

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV+EFAE FNGH+FVNEKG
Sbjct  61   KHPEDVVEFAEVFNGHIFVNEKG  83



>ref|XP_004485448.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Cicer arietinum]
 ref|XP_004485449.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Cicer arietinum]
 ref|XP_004485450.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Cicer arietinum]
Length=510

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            DR KVV+RHLPPT+ + +L   +D  FSGRYNW+SF P KIS K  ++SRAY++F +PED
Sbjct  3    DRTKVVVRHLPPTISEDSLSSLIDGSFSGRYNWLSFRPAKISPKHTSFSRAYIDFNKPED  62

Query  450  VIEFAEFFNGHLFVNEKG  503
            VIEFAEFFNGH+FVNEKG
Sbjct  63   VIEFAEFFNGHVFVNEKG  80



>ref|XP_009379179.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Pyrus x bretschneideri]
Length=524

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K+PEDV EFAEFF+GH+FVNEKG
Sbjct  61   KQPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_009379185.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=523

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L Q+ L  ++D   + RYNW+ F PGK SQK Q YSRAY++F
Sbjct  1    MKEPLVRTKVLIRHLPPSLSQSDLFSQIDHLLADRYNWLCFRPGKNSQKNQRYSRAYIDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K+PEDV EFAEFF+GH+FVNEKG
Sbjct  61   KQPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_002447880.1| hypothetical protein SORBIDRAFT_06g017380 [Sorghum bicolor]
 gb|EES12208.1| hypothetical protein SORBIDRAFT_06g017380 [Sorghum bicolor]
Length=504

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAE FNGH+FVNEKG
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKG  83



>ref|XP_010499932.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Camelina sativa]
 ref|XP_010499933.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Camelina sativa]
Length=485

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF  RYNWVSF PGK S + Q  SRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSFRNQKCSRAYVAF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKG  83



>ref|XP_010478812.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Camelina 
sativa]
Length=484

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF  RYNWVSF PGK S + Q  SRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSFRNQKCSRAYVAF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKG  83



>ref|XP_004485447.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Cicer arietinum]
Length=517

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            DR KVV+RHLPPT+ + +L   +D  FSGRYNW+SF P KIS K  ++SRAY++F +PED
Sbjct  3    DRTKVVVRHLPPTISEDSLSSLIDGSFSGRYNWLSFRPAKISPKHTSFSRAYIDFNKPED  62

Query  450  VIEFAEFFNGHLFVNEKG  503
            VIEFAEFFNGH+FVNEKG
Sbjct  63   VIEFAEFFNGHVFVNEKG  80



>ref|XP_006303223.1| hypothetical protein CARUB_v10012004mg [Capsella rubella]
 gb|EOA36121.1| hypothetical protein CARUB_v10012004mg [Capsella rubella]
Length=311

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P+ + KVV+RHLPP+L Q+ L+ ++D RF  RYNWVSF PGK S + Q  SRAYV F
Sbjct  1    MKEPVQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSYRNQKCSRAYVAF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            + PEDV EFA FFNGH+FVNEKG
Sbjct  61   EEPEDVYEFAAFFNGHVFVNEKG  83



>gb|EMT22790.1| Regulator of nonsense transcripts 3A [Aegilops tauschii]
Length=484

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSPEDVVEFAEFFNGHVFVNEKG  83



>ref|XP_010463114.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Camelina 
sativa]
Length=499

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP+L Q+ L+ ++D RF  RYNWVSF PGK S + Q  SRAYV F
Sbjct  1    MKEPLQKKKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSFRNQKCSRAYVAF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKG  83



>ref|XP_009421164.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=531

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK   DR KVV+R LPP++ Q+ L+E++D RF+GRY+WV F PGK S+K Q +SRAY+ F
Sbjct  1    MKDSSDRTKVVVRRLPPSISQSVLMEQIDGRFAGRYDWVFFRPGKNSRKNQRHSRAYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            +R +DV+EFAEFF+GH+FVNEKG
Sbjct  61   ERSDDVVEFAEFFDGHIFVNEKG  83



>dbj|BAJ94892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  30   MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWARFRPGNASQKNHRYSRLYLNF  89

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV+EFAEFFNGH+FVNEKG
Sbjct  90   KSPEDVVEFAEFFNGHVFVNEKG  112



>ref|XP_010096436.1| hypothetical protein L484_013119 [Morus notabilis]
 gb|EXB64107.1| hypothetical protein L484_013119 [Morus notabilis]
Length=534

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 67/78 (86%), Gaps = 1/78 (1%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            DR KVVLRHLPPT+ +A L+E++DS F+GRY+W+SF PGK  QK  ++SRAY++FK+PED
Sbjct  8    DRTKVVLRHLPPTISKAALLERIDSVFAGRYSWLSFRPGKNRQK-HSFSRAYLDFKKPED  66

Query  450  VIEFAEFFNGHLFVNEKG  503
            V+EFAE F GH+FVNEKG
Sbjct  67   VVEFAELFGGHVFVNEKG  84



>ref|XP_011461172.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Fragaria vesca subsp. vesca]
Length=498

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L Q+   +++D  F  R+NW  F PGK S K Q YSRAY+EF
Sbjct  1    MKDPLVRTKVLVRHLPPSLSQSDFFQQIDHLFGDRHNWFCFRPGKNSHKHQRYSRAYIEF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_011461169.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011461170.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011461171.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Fragaria vesca subsp. vesca]
Length=508

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KV++RHLPP+L Q+   +++D  F  R+NW  F PGK S K Q YSRAY+EF
Sbjct  1    MKDPLVRTKVLVRHLPPSLSQSDFFQQIDHLFGDRHNWFCFRPGKNSHKHQRYSRAYIEF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV EFAEFF+GH+FVNEKG
Sbjct  61   KRPEDVFEFAEFFDGHVFVNEKG  83



>ref|XP_009421163.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=564

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK   DR KVV+R LPP++ Q+ L+E++D RF+GRY+WV F PGK S+K Q +SRAY+ F
Sbjct  1    MKDSSDRTKVVVRRLPPSISQSVLMEQIDGRFAGRYDWVFFRPGKNSRKNQRHSRAYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            +R +DV+EFAEFF+GH+FVNEKG
Sbjct  61   ERSDDVVEFAEFFDGHIFVNEKG  83



>emb|CDY52194.1| BnaCnng22070D [Brassica napus]
Length=484

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  + KVV+RHLPP+L Q+ L+ ++D RF  RYNWVSF PGK S K Q YSRAY  F
Sbjct  1    MKDPSAKRKVVVRHLPPSLSQSDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFSF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FFNGH+FVNEKG
Sbjct  61   KAPEDVYDFAAFFNGHVFVNEKG  83



>tpg|DAA37689.1| TPA: hypothetical protein ZEAMMB73_050614 [Zea mays]
Length=500

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV+EFAE FNGH+FVNEKG
Sbjct  61   KHPEDVVEFAEVFNGHIFVNEKG  83



>ref|XP_008669383.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Zea mays]
Length=499

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV+EFAE FNGH+FVNEKG
Sbjct  61   KHPEDVVEFAEVFNGHIFVNEKG  83



>ref|XP_011031522.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
 ref|XP_011031524.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
 ref|XP_011031525.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
 ref|XP_011031526.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Populus 
euphratica]
Length=524

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +3

Query  252  RMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVE  431
            + K PL R KVV+RHLPP+L Q+ L  + D RF  RYNW  F PG  S K Q YSRAY++
Sbjct  3    KKKEPLGRTKVVIRHLPPSLSQSNLFSQFDHRFCHRYNWFRFRPGNSSHKSQRYSRAYID  62

Query  432  FKRPEDVIEFAEFFNGHLFVNEKG  503
            FK PEDV+EFA+FF+GH+FVNEKG
Sbjct  63   FKNPEDVLEFADFFHGHVFVNEKG  86



>ref|XP_008663218.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Zea mays]
Length=502

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAE FNGH+FVNEKG
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKG  83



>ref|XP_008663221.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Zea mays]
Length=488

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAE FNGH+FVNEKG
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKG  83



>ref|XP_008663216.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Zea mays]
Length=504

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAE FNGH+FVNEKG
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKG  83



>ref|XP_008663219.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Zea mays]
Length=496

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAE FNGH+FVNEKG
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKG  83



>ref|XP_008663214.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Zea mays]
 ref|XP_008663215.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Zea mays]
Length=514

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAE FNGH+FVNEKG
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKG  83



>ref|XP_010530121.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Tarenaya hassleriana]
Length=494

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  L + KVV+RHLPP++ Q+ L+  +D+RF+ RYNW +F  GK S K Q YSRAY+EF
Sbjct  1    MKDLLQKRKVVVRHLPPSISQSDLLSHIDARFADRYNWFAFRSGKSSHKNQKYSRAYIEF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FFNGH+FVNEKG
Sbjct  61   KTPEDVCDFASFFNGHVFVNEKG  83



>ref|XP_008663217.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Zea mays]
 gb|AFW58318.1| hypothetical protein ZEAMMB73_385077 [Zea mays]
Length=503

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD RF+GRY+W  F PG  SQK   +SR Y+ F
Sbjct  1    MKDPAHRTKVVLRRLPPAIAQQAVVDQVDLRFAGRYDWACFRPGNASQKNHRHSRLYLNF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            KRPEDV+EFAE FNGH+FVNEKG
Sbjct  61   KRPEDVVEFAEVFNGHVFVNEKG  83



>ref|XP_010530119.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Tarenaya hassleriana]
Length=499

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  L + KVV+RHLPP++ Q+ L+  +D+RF+ RYNW +F  GK S K Q YSRAY+EF
Sbjct  1    MKDLLQKRKVVVRHLPPSISQSDLLSHIDARFADRYNWFAFRSGKSSHKNQKYSRAYIEF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FFNGH+FVNEKG
Sbjct  61   KTPEDVCDFASFFNGHVFVNEKG  83



>ref|XP_010530120.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Tarenaya hassleriana]
Length=498

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK  L + KVV+RHLPP++ Q+ L+  +D+RF+ RYNW +F  GK S K Q YSRAY+EF
Sbjct  1    MKDLLQKRKVVVRHLPPSISQSDLLSHIDARFADRYNWFAFRSGKSSHKNQKYSRAYIEF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FFNGH+FVNEKG
Sbjct  61   KTPEDVCDFASFFNGHVFVNEKG  83



>emb|CAE03133.3| OJ000114_01.14 [Oryza sativa Japonica Group]
Length=455

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            +K P  R KVVLR LPP + Q  ++E+VD+RF GRY+W  F PG  SQK   YSR Y+ F
Sbjct  8    VKDPAHRTKVVLRRLPPAIAQQAVVEQVDARFGGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV+EFAE FNGH+FVNEKG
Sbjct  68   KGPEDVVEFAEVFNGHVFVNEKG  90



>ref|NP_001052873.1| Os04g0440100 [Oryza sativa Japonica Group]
 dbj|BAF14787.1| Os04g0440100 [Oryza sativa Japonica Group]
Length=507

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            +K P  R KVVLR LPP + Q  ++E+VD+RF GRY+W  F PG  SQK   YSR Y+ F
Sbjct  8    VKDPAHRTKVVLRRLPPAIAQQAVVEQVDARFGGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV+EFAE FNGH+FVNEKG
Sbjct  68   KGPEDVVEFAEVFNGHVFVNEKG  90



>emb|CAH66847.1| H0525C06.10 [Oryza sativa Indica Group]
 gb|EEC77332.1| hypothetical protein OsI_16007 [Oryza sativa Indica Group]
 gb|EEE61056.1| hypothetical protein OsJ_14914 [Oryza sativa Japonica Group]
Length=507

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            +K P  R KVVLR LPP + Q  ++E+VD+RF GRY+W  F PG  SQK   YSR Y+ F
Sbjct  8    VKDPAHRTKVVLRRLPPAIAQQAVVEQVDARFGGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV+EFAE FNGH+FVNEKG
Sbjct  68   KGPEDVVEFAEVFNGHVFVNEKG  90



>ref|XP_010239938.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Brachypodium distachyon]
Length=506

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+  
Sbjct  1    MKDPPPRTKVVLRRLPPAIGQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNL  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSSEDVVEFAEFFNGHIFVNEKG  83



>ref|XP_010239939.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Brachypodium distachyon]
Length=505

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  R KVVLR LPP + Q  ++++VD+RF+GRY+W  F PG  SQK   YSR Y+  
Sbjct  1    MKDPPPRTKVVLRRLPPAIGQQAVVDQVDARFAGRYDWACFRPGNASQKNHRYSRLYLNL  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  EDV+EFAEFFNGH+FVNEKG
Sbjct  61   KSSEDVVEFAEFFNGHIFVNEKG  83



>emb|CDY48801.1| BnaA05g20690D [Brassica napus]
Length=476

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  + KVV+RHLPP+L ++ L+ ++D RF  RYNWVSF PGK S K Q YSRAY  F
Sbjct  1    MKEPSAKRKVVVRHLPPSLSESDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFGF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FF+GH+FVNEKG
Sbjct  61   KAPEDVYDFAAFFSGHVFVNEKG  83



>ref|XP_009145164.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Brassica rapa]
Length=485

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  + KVV+RHLPP+L ++ L+ ++D RF  RYNWVSF PGK S K Q YSRAY  F
Sbjct  1    MKEPSAKRKVVVRHLPPSLSESDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFGF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FF+GH+FVNEKG
Sbjct  61   KAPEDVYDFAAFFSGHVFVNEKG  83



>ref|XP_009145165.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Brassica rapa]
Length=480

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  + KVV+RHLPP+L ++ L+ ++D RF  RYNWVSF PGK S K Q YSRAY  F
Sbjct  1    MKEPSAKRKVVVRHLPPSLSESDLLSQIDPRFGDRYNWVSFRPGKSSYKAQKYSRAYFGF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FF+GH+FVNEKG
Sbjct  61   KAPEDVYDFAAFFSGHVFVNEKG  83



>ref|XP_003592906.1| Regulator of nonsense transcripts 3A [Medicago truncatula]
Length=385

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FA FFNGHLF+N+KG
Sbjct  62   VIDFAHFFNGHLFLNQKG  79



>ref|XP_002325958.2| hypothetical protein POPTR_0019s10620g [Populus trichocarpa]
 gb|EEF00340.2| hypothetical protein POPTR_0019s10620g [Populus trichocarpa]
Length=527

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +3

Query  252  RMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVE  431
            + K PL R KVV+RHLPP+L Q+ L  + D  F  RYNW  F PG  S K Q YSRAY++
Sbjct  3    KKKEPLGRTKVVIRHLPPSLSQSNLFSQFDHLFCHRYNWFRFRPGNSSHKSQRYSRAYID  62

Query  432  FKRPEDVIEFAEFFNGHLFVNEKG  503
            FK PEDV+EFA FF+GH+FVNEKG
Sbjct  63   FKNPEDVLEFAGFFHGHVFVNEKG  86



>gb|KHN47094.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=530

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  255  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  428
            MKV  +R K  VV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S K+Q +SRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
            +FK P+DV EFAEFF+GH+FVNE+G
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVNERG  85



>emb|CDY15301.1| BnaC06g07870D [Brassica napus]
Length=473

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP+L ++ L+ ++DSRF  RY W SF PGK + K Q +SRAY  F
Sbjct  2    MKDPLAKRKVVVRHLPPSLSESDLLSQIDSRFGDRYYWFSFRPGKSNYKTQKHSRAYFGF  61

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FFNGH+FVNEKG
Sbjct  62   KAPEDVYDFAAFFNGHVFVNEKG  84



>ref|XP_003592907.1| Regulator of nonsense transcripts 3A [Medicago truncatula]
Length=498

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FA FFNGHLF+N+KG
Sbjct  62   VIDFAHFFNGHLFLNQKG  79



>gb|ABE91932.1| Nonsense-mediated decay UPF3 [Medicago truncatula]
Length=500

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FA FFNGHLF+N+KG
Sbjct  62   VIDFAHFFNGHLFLNQKG  79



>ref|XP_006415052.1| hypothetical protein EUTSA_v10007455mg [Eutrema salsugineum]
 gb|ESQ33405.1| hypothetical protein EUTSA_v10007455mg [Eutrema salsugineum]
Length=496

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  + KVV+RHLPP+L Q+ L+ +++ RF  RY W SF PGK S K Q +SRAYV F
Sbjct  1    MKDPSPKRKVVVRHLPPSLSQSDLLSQIEPRFGDRYYWFSFRPGKSSYKNQKFSRAYVGF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  61   KAPEDVYEFAAFFNGHVFVNEKG  83



>ref|XP_006579008.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Glycine max]
Length=493

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  255  MKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  428
            MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S K+Q +SRAY+
Sbjct  1    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
            +FK P+DV EFAEFF+GH+FVNE+G
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVNERG  85



>gb|AES63156.2| Smg-4/UPF3 family protein [Medicago truncatula]
Length=510

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FA FFNGHLF+N+KG
Sbjct  62   VIDFAHFFNGHLFLNQKG  79



>ref|XP_006579007.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Glycine max]
Length=525

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  255  MKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  428
            MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S K+Q +SRAY+
Sbjct  1    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
            +FK P+DV EFAEFF+GH+FVNE+G
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVNERG  85



>ref|XP_003522607.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006579004.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 ref|XP_006579005.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Glycine max]
 ref|XP_006579006.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Glycine max]
Length=535

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  255  MKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  428
            MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S K+Q +SRAY+
Sbjct  1    MKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFASRYNWFSFRPGNNSHKRQRHSRAYI  60

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
            +FK P+DV EFAEFF+GH+FVNE+G
Sbjct  61   DFKCPDDVFEFAEFFDGHVFVNERG  85



>ref|XP_006441553.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 ref|XP_006441554.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 ref|XP_006441555.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54793.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54794.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54795.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
Length=523

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KVV+RHLPP+L Q  L+      F+ RYNW  F PGK S K Q YSRAYVE 
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSYKHQRYSRAYVEL  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K+P DV EFAE  NGH+FVNEKG
Sbjct  61   KKPADVFEFAELLNGHVFVNEKG  83



>gb|AES63158.2| Smg-4/UPF3 family protein [Medicago truncatula]
Length=540

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FA FFNGHLF+N+KG
Sbjct  62   VIDFAHFFNGHLFLNQKG  79



>ref|XP_006652316.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Oryza 
brachyantha]
Length=512

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            +K P  R KVVLR LPP +    ++++VD+RF+GRY+W  F PG  SQK   YSR Y+ F
Sbjct  8    VKDPAHRTKVVLRRLPPAIAPQAVVDQVDARFAGRYDWSCFRPGNASQKNHRYSRLYLNF  67

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV+EFAE F+GH+FVNEKG
Sbjct  68   KSPEDVVEFAEVFSGHVFVNEKG  90



>ref|XP_003592905.1| Regulator of nonsense transcripts 3A [Medicago truncatula]
Length=565

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            DR KVV+RHLPPT+ Q +L+  +DS F+GRYNW SFHP KI+    T SRAY++F  P+D
Sbjct  3    DRTKVVIRHLPPTITQDSLLPLIDSSFAGRYNWFSFHPPKITSHNHT-SRAYIDFNTPDD  61

Query  450  VIEFAEFFNGHLFVNEKG  503
            VI+FA FFNGHLF+N+KG
Sbjct  62   VIDFAHFFNGHLFLNQKG  79



>ref|XP_003527584.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 gb|KHN20546.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=529

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +3

Query  252  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  425
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S  +Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAY  65

Query  426  VEFKRPEDVIEFAEFFNGHLFVNEKG  503
            ++FK P+DV EFAEFF+GH+FVNE+G
Sbjct  66   IDFKCPDDVFEFAEFFDGHVFVNERG  91



>ref|XP_006582443.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Glycine max]
Length=539

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +3

Query  252  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  425
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S  +Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAY  65

Query  426  VEFKRPEDVIEFAEFFNGHLFVNEKG  503
            ++FK P+DV EFAEFF+GH+FVNE+G
Sbjct  66   IDFKCPDDVFEFAEFFDGHVFVNERG  91



>ref|XP_006582445.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Glycine max]
Length=537

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +3

Query  252  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  425
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S  +Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAY  65

Query  426  VEFKRPEDVIEFAEFFNGHLFVNEKG  503
            ++FK P+DV EFAEFF+GH+FVNE+G
Sbjct  66   IDFKCPDDVFEFAEFFDGHVFVNERG  91



>ref|XP_009114779.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Brassica rapa]
Length=462

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP+L ++ L+ ++DSRF  RY W SF PGK + + Q +SRAY  F
Sbjct  3    MKDPLAKRKVVVRHLPPSLAESDLLSQIDSRFGDRYYWFSFRPGKSNYRTQKHSRAYFGF  62

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FFNGH+FVN+KG
Sbjct  63   KAPEDVYDFASFFNGHVFVNDKG  85



>ref|XP_009114778.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Brassica rapa]
Length=479

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP+L ++ L+ ++DSRF  RY W SF PGK + + Q +SRAY  F
Sbjct  3    MKDPLAKRKVVVRHLPPSLAESDLLSQIDSRFGDRYYWFSFRPGKSNYRTQKHSRAYFGF  62

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FFNGH+FVN+KG
Sbjct  63   KAPEDVYDFASFFNGHVFVNDKG  85



>ref|XP_006582444.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Glycine max]
Length=537

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +3

Query  252  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  425
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S  +Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAY  65

Query  426  VEFKRPEDVIEFAEFFNGHLFVNEKG  503
            ++FK P+DV EFAEFF+GH+FVNE+G
Sbjct  66   IDFKCPDDVFEFAEFFDGHVFVNERG  91



>ref|XP_006582442.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
Length=547

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 2/86 (2%)
 Frame = +3

Query  252  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  425
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F+ RYNW SF PG  S  +Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLSQSDLSQHIDSHFASRYNWFSFRPGNNSHTRQRHSRAY  65

Query  426  VEFKRPEDVIEFAEFFNGHLFVNEKG  503
            ++FK P+DV EFAEFF+GH+FVNE+G
Sbjct  66   IDFKCPDDVFEFAEFFDGHVFVNERG  91



>emb|CDX93747.1| BnaA09g23470D [Brassica napus]
Length=475

 Score =   109 bits (272),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL + KVV+RHLPP+L ++ L+ ++DSRF  RY W SF PGK + + Q +SRAY  F
Sbjct  2    MKDPLAKRKVVVRHLPPSLAESDLLSQIDSRFGDRYYWFSFRPGKSNYRAQKHSRAYFGF  61

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV +FA FFNGH+FVN+KG
Sbjct  62   KAPEDVYDFAAFFNGHVFVNDKG  84



>ref|XP_006478194.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Citrus sinensis]
 ref|XP_006478195.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Citrus sinensis]
Length=523

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KVV+RHLPP+L Q  L+      F+ RYNW  F PGK S K Q YSRAYVE 
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSYKHQRYSRAYVEL  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K+P  V EFAE  NGH+FVNEKG
Sbjct  61   KKPAGVFEFAELLNGHVFVNEKG  83



>gb|KDO45829.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45830.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45831.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45832.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45833.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45834.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45835.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
 gb|KDO45836.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
Length=523

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KVV+RHLPP+L Q  L+      F+ RYNW  F PGK S K Q YSRAYVE 
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSYKHQRYSRAYVEL  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K+P  V EFAE  NGH+FVNEKG
Sbjct  61   KKPAGVFEFAELLNGHVFVNEKG  83



>gb|AES68284.2| regulator of nonsense transcripts UPF3 protein [Medicago truncatula]
Length=540

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVV+RHLPP+L ++ LI+ +D+RFS RY+W  F  G  S + Q Y+RAY++F  P+DV
Sbjct  9    RTKVVIRHLPPSLTESDLIQHIDNRFSSRYHWFVFRSGNTSYRNQKYARAYLDFNSPDDV  68

Query  453  IEFAEFFNGHLFVNEKG  503
             EFAEFFNGH+FVNEKG
Sbjct  69   FEFAEFFNGHVFVNEKG  85



>ref|XP_012073511.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Jatropha 
curcas]
 ref|XP_012073512.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Jatropha 
curcas]
 ref|XP_012073513.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Jatropha 
curcas]
Length=503

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +3

Query  246  VWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  425
            + + K P +R +VV+RHLPP+L Q  L  + D  FS RYNW  F P K SQK Q YSRAY
Sbjct  2    IMKKKEPSERTRVVIRHLPPSLSQFHLFSQFDHLFSQRYNWFCFRPAKFSQKHQRYSRAY  61

Query  426  VEFKRPEDVIEFAEFFNGHLFVNEKG  503
            ++FK P DV+EFA+ F+GH+F NE+G
Sbjct  62   IDFKNPGDVLEFADIFHGHIFYNERG  87



>emb|CDY46452.1| BnaA08g06560D [Brassica napus]
Length=491

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK    + KVV+RHLPP+L Q  L+ ++DSRF   Y+W SF PGK + K Q +SRAY  F
Sbjct  1    MKDRSAKRKVVVRHLPPSLSQPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  61   KSPEDVYEFAAFFNGHVFVNEKG  83



>gb|KDP36702.1| hypothetical protein JCGZ_07993 [Jatropha curcas]
Length=536

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +3

Query  246  VWRMKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  425
            + + K P +R +VV+RHLPP+L Q  L  + D  FS RYNW  F P K SQK Q YSRAY
Sbjct  2    IMKKKEPSERTRVVIRHLPPSLSQFHLFSQFDHLFSQRYNWFCFRPAKFSQKHQRYSRAY  61

Query  426  VEFKRPEDVIEFAEFFNGHLFVNEKG  503
            ++FK P DV+EFA+ F+GH+F NE+G
Sbjct  62   IDFKNPGDVLEFADIFHGHIFYNERG  87



>ref|XP_003598033.1| B3 domain-containing protein [Medicago truncatula]
Length=1203

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVV+RHLPP+L ++ LI+ +D+RFS RY+W  F  G  S + Q Y+RAY++F  P+DV
Sbjct  9    RTKVVIRHLPPSLTESDLIQHIDNRFSSRYHWFVFRSGNTSYRNQKYARAYLDFNSPDDV  68

Query  453  IEFAEFFNGHLFVNEKG  503
             EFAEFFNGH+FVNEKG
Sbjct  69   FEFAEFFNGHVFVNEKG  85



>ref|XP_007148608.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
 gb|ESW20602.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
Length=529

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +3

Query  252  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  425
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F  RYNW SF PG  S K+Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFDSRYNWFSFRPGNTSLKRQRHSRAY  65

Query  426  VEFKRPEDVIEFAEFFNGHLFVNEKG  503
            ++F  P DV +FA FF+GH+FVNE+G
Sbjct  66   IDFNSPHDVFDFAHFFHGHVFVNERG  91



>ref|XP_001778894.1| predicted protein [Physcomitrella patens]
 gb|EDQ56344.1| predicted protein [Physcomitrella patens]
Length=1124

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK    R KV +RHLPP+L  A   +++  +++G Y W S+HPGK S K+Q YSRAY+ F
Sbjct  26   MKEQQARTKVSVRHLPPSLAWAVFQDQIAVKYAGTYTWWSYHPGKSSHKRQVYSRAYINF  85

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K+PEDVI+F E FNGH+FVNE+G
Sbjct  86   KKPEDVIDFYEDFNGHVFVNERG  108



>ref|XP_007148607.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
 gb|ESW20601.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
Length=539

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +3

Query  252  RMKVPLDR--AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAY  425
            +MKV  +R   KVV+RHLPP+L Q+ L + +DS F  RYNW SF PG  S K+Q +SRAY
Sbjct  6    KMKVRSEREKTKVVIRHLPPSLTQSDLFQHIDSHFDSRYNWFSFRPGNTSLKRQRHSRAY  65

Query  426  VEFKRPEDVIEFAEFFNGHLFVNEKG  503
            ++F  P DV +FA FF+GH+FVNE+G
Sbjct  66   IDFNSPHDVFDFAHFFHGHVFVNERG  91



>ref|XP_006441556.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
 gb|ESR54796.1| hypothetical protein CICLE_v10019695mg [Citrus clementina]
Length=527

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKIS----QKQQTYSRA  422
            MK PL R KVV+RHLPP+L Q  L+      F+ RYNW  F PGK S     K Q YSRA
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSFFYSYKHQRYSRA  60

Query  423  YVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            YVE K+P DV EFAE  NGH+FVNEKG
Sbjct  61   YVELKKPADVFEFAELLNGHVFVNEKG  87



>ref|XP_009107940.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Brassica rapa]
Length=466

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK    + KVV+RHLPP+L +  L+ ++DSRF   Y+W SF PGK + K Q +SRAY  F
Sbjct  1    MKDRSAKRKVVVRHLPPSLSEPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  61   KSPEDVYEFAAFFNGHVFVNEKG  83



>ref|XP_009107941.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Brassica rapa]
Length=461

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK    + KVV+RHLPP+L +  L+ ++DSRF   Y+W SF PGK + K Q +SRAY  F
Sbjct  1    MKDRSAKRKVVVRHLPPSLSEPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  61   KSPEDVYEFAAFFNGHVFVNEKG  83



>ref|XP_010910224.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Elaeis guineensis]
Length=551

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 15/83 (18%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PLDR KVVLR LPP +PQATL+E++D RF+GRY W  F PGK               
Sbjct  1    MKDPLDRTKVVLRRLPPAIPQATLMEEIDGRFAGRYKWFCFRPGK---------------  45

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
             + EDV+EFAEFF+GH+FVNEKG
Sbjct  46   NKSEDVVEFAEFFDGHIFVNEKG  68



>emb|CDX91795.1| BnaC08g07140D [Brassica napus]
Length=730

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK    + KVV+RHLPP+L +  L+ ++DSRF   Y+W SF PGK + K Q +SRAY  F
Sbjct  240  MKDRSAKRKVVVRHLPPSLSEPDLLSQIDSRFGDSYSWFSFRPGKSNYKTQKHSRAYFGF  299

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K PEDV EFA FFNGH+FVNEKG
Sbjct  300  KSPEDVYEFAAFFNGHVFVNEKG  322



>ref|XP_002972412.1| hypothetical protein SELMODRAFT_97155 [Selaginella moellendorffii]
 gb|EFJ26498.1| hypothetical protein SELMODRAFT_97155 [Selaginella moellendorffii]
Length=118

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KVV+R LPPTL +  L+ ++ +RF+  Y W+ F PGK +   Q +SRAY+EF
Sbjct  1    MKDPLSRTKVVVRRLPPTLSEDALVSRIQTRFARPYLWMLFRPGKSTN--QIHSRAYIEF  58

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            +RPEDV+ F E F+GH+FVNEKG
Sbjct  59   ERPEDVLAFHEDFHGHVFVNEKG  81



>gb|KDO45837.1| hypothetical protein CISIN_1g009733mg [Citrus sinensis]
Length=527

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKIS----QKQQTYSRA  422
            MK PL R KVV+RHLPP+L Q  L+      F+ RYNW  F PGK S     K Q YSRA
Sbjct  1    MKEPLQRTKVVIRHLPPSLSQNDLLALFRDHFNDRYNWFCFRPGKSSFFYSYKHQRYSRA  60

Query  423  YVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            YVE K+P  V EFAE  NGH+FVNEKG
Sbjct  61   YVELKKPAGVFEFAELLNGHVFVNEKG  87



>ref|XP_002984244.1| hypothetical protein SELMODRAFT_119852 [Selaginella moellendorffii]
 gb|EFJ14754.1| hypothetical protein SELMODRAFT_119852 [Selaginella moellendorffii]
Length=118

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            M+ PL R KVV+R LPPTL +  L+ ++ +RF+  Y W+ F PGK +   Q +SRAY+EF
Sbjct  1    MRDPLSRTKVVVRRLPPTLSEDALVSRIQTRFARPYLWMLFRPGKSTN--QIHSRAYIEF  58

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            +RPEDV+ F E F+GH+FVNEKG
Sbjct  59   ERPEDVLAFHEDFHGHVFVNEKG  81



>ref|XP_006441789.1| hypothetical protein CICLE_v10023375mg [Citrus clementina]
 gb|ESR55029.1| hypothetical protein CICLE_v10023375mg [Citrus clementina]
Length=103

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 55/88 (63%), Gaps = 5/88 (6%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKI-----SQKQQTYSR  419
            MK PL R KVV+RHLP +L Q  L+      F+  YNW +F P  +     S K QTYSR
Sbjct  1    MKKPLQRTKVVIRHLPLSLSQNDLLALFHDHFNDHYNWSTFGPENLGIFFNSYKHQTYSR  60

Query  420  AYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            A  E K+P DV EFAE  NGH+FVNEKG
Sbjct  61   ACEELKKPTDVFEFAELLNGHVFVNEKG  88



>ref|XP_006478236.1| PREDICTED: uncharacterized protein LOC102612273 [Citrus sinensis]
Length=233

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +3

Query  279  KVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVIE  458
            ++V+RHLPP+L Q  L+      F+ RYNW  F PG+ S K Q YSRAY E K P  V E
Sbjct  36   QLVIRHLPPSLSQNDLLALFHDHFNDRYNWFCFRPGRSSSKHQRYSRAYEELKNPAVVFE  95

Query  459  FAEFFNGHLFVNEKG  503
            FAE  NGH+FVNEKG
Sbjct  96   FAELLNGHVFVNEKG  110



>ref|XP_006441573.1| hypothetical protein CICLE_v10024086mg [Citrus clementina]
 gb|ESR54813.1| hypothetical protein CICLE_v10024086mg [Citrus clementina]
Length=90

 Score = 87.0 bits (214),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 51/83 (61%), Gaps = 9/83 (11%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK PL R KVV+RHLPP+L Q  L+      F+ RYN           K +TYSR Y E 
Sbjct  1    MKKPLQRTKVVIRHLPPSLSQNDLLALFHDHFNDRYNCF---------KHETYSRTYEEL  51

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K+P DV EFAE  NGH+FVNEKG
Sbjct  52   KKPTDVFEFAELLNGHVFVNEKG  74



>gb|KIY98106.1| hypothetical protein MNEG_9858, partial [Monoraphidium neglectum]
Length=149

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            M  P +R KVV+R+LPP L +  L   VD    GRY W +++PGK+S ++  +SRAY +F
Sbjct  1    MTKPQERTKVVVRNLPPALTEEALRAVVDKIVGGRYGWSAYYPGKVSLRRTLHSRAYFDF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
              P+DVIEF   F+GH+FV+ KG
Sbjct  61   LTPDDVIEFKTRFDGHVFVSTKG  83



>ref|XP_001754467.1| predicted protein [Physcomitrella patens]
 gb|EDQ80917.1| predicted protein [Physcomitrella patens]
Length=987

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/108 (42%), Positives = 61/108 (56%), Gaps = 26/108 (24%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGK---------------  389
            MK    R KV +RHLPP+L +A   +++  +++G Y W S+HPGK               
Sbjct  26   MKEQQARTKVAVRHLPPSLSEAVFQDQIAGKYAGAYTWWSYHPGKNRSSRKRRQYVAHNP  85

Query  390  -----------ISQKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVNEK  500
                        S K+Q YSRAY+ FK+PEDVI+F E FNGH+FVNE+
Sbjct  86   RNQFDAVGAIACSHKRQVYSRAYINFKKPEDVIDFYEDFNGHVFVNER  133



>ref|XP_004499558.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Cicer arietinum]
Length=572

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  255  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  428
            MKV  +R K  VV+RHLPP+L ++ LI+++ +RFS  YN+ SFH G  S K Q YSRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
             F  P+DV +FA+FFNGH+FVNEKG
Sbjct  61   NFNSPDDVFDFADFFNGHVFVNEKG  85



>ref|XP_004499563.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X6 [Cicer arietinum]
 ref|XP_004499564.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X7 [Cicer arietinum]
 ref|XP_004499565.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X8 [Cicer arietinum]
Length=535

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  255  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  428
            MKV  +R K  VV+RHLPP+L ++ LI+++ +RFS  YN+ SFH G  S K Q YSRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
             F  P+DV +FA+FFNGH+FVNEKG
Sbjct  61   NFNSPDDVFDFADFFNGHVFVNEKG  85



>ref|XP_004499561.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Cicer arietinum]
 ref|XP_004499562.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X5 [Cicer arietinum]
Length=567

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  255  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  428
            MKV  +R K  VV+RHLPP+L ++ LI+++ +RFS  YN+ SFH G  S K Q YSRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
             F  P+DV +FA+FFNGH+FVNEKG
Sbjct  61   NFNSPDDVFDFADFFNGHVFVNEKG  85



>ref|XP_004499560.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Cicer arietinum]
Length=568

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  255  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  428
            MKV  +R K  VV+RHLPP+L ++ LI+++ +RFS  YN+ SFH G  S K Q YSRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
             F  P+DV +FA+FFNGH+FVNEKG
Sbjct  61   NFNSPDDVFDFADFFNGHVFVNEKG  85



>ref|XP_004499559.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Cicer arietinum]
Length=570

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  255  MKVPLDRAK--VVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYV  428
            MKV  +R K  VV+RHLPP+L ++ LI+++ +RFS  YN+ SFH G  S K Q YSRAY+
Sbjct  1    MKVRSERGKTKVVIRHLPPSLTESDLIQQIHNRFSSTYNYFSFHLGNTSLKNQRYSRAYI  60

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
             F  P+DV +FA+FFNGH+FVNEKG
Sbjct  61   NFNSPDDVFDFADFFNGHVFVNEKG  85



>ref|XP_002945932.1| hypothetical protein VOLCADRAFT_48819 [Volvox carteri f. nagariensis]
 gb|EFJ52927.1| hypothetical protein VOLCADRAFT_48819, partial [Volvox carteri 
f. nagariensis]
Length=90

 Score = 79.3 bits (194),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  276  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  455
             KVV+R+LPP +   T    ++S   GRY W+S+ PGK+S K+  +SRAYV F   EDV 
Sbjct  1    TKVVIRNLPPGMTDDTFKTVLESLAGGRYTWLSYFPGKVSLKRVVFSRAYVNFLTAEDVY  60

Query  456  EFAEFFNGHLFVNEKG  503
            +F + F+GH+F+ +KG
Sbjct  61   DFKQRFDGHVFIGQKG  76



>ref|XP_001691099.1| UPF3 protein [Chlamydomonas reinhardtii]
 gb|EDP05545.1| UPF3 protein [Chlamydomonas reinhardtii]
Length=371

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  255  MKVPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEF  434
            MK P  + KV++R LPP + + T    +DS  +GRYNW+S++ GK+S K+   SRAY+ F
Sbjct  1    MKPPRQKTKVLVRKLPPAMSEDTFKSVLDSVAAGRYNWLSYYAGKVSLKRVASSRAYINF  60

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
               EDV  F + F+GH+F++ +G
Sbjct  61   VSEEDVYNFKQRFDGHVFISRQG  83



>ref|XP_002510770.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52957.1| conserved hypothetical protein [Ricinus communis]
Length=423

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +3

Query  279  KVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVIE  458
            KVV+RHLPP+L Q+ L  +        +NW  F P   S K   YSRAY+EFK P D  +
Sbjct  14   KVVIRHLPPSLSQSHLFSQFHHLLLLSFNWFCFRPPNSSHKNHRYSRAYIEFKSPADAGQ  73

Query  459  FAEFFNGHLFVNEKG  503
            FA  F+GHLFV++ G
Sbjct  74   FAHLFHGHLFVDDNG  88



>ref|XP_011395745.1| Regulator of nonsense transcripts 3A [Auxenochlorella protothecoides]
 gb|KFM22879.1| Regulator of nonsense transcripts 3A [Auxenochlorella protothecoides]
Length=475

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPED  449
            +R KVV+RHLPP+L +      V      R NW +++ GK+S K+  +SRAY+ FK P D
Sbjct  6    ERTKVVVRHLPPSLSEDAFKSAVQEWLD-RSNWSAYYQGKVSAKEHVHSRAYLNFKDPAD  64

Query  450  VIEFAEFFNGHLFVNEKG  503
             + F+  FNG+LFV+++G
Sbjct  65   ALRFSAAFNGNLFVSDRG  82



>ref|XP_008378998.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Malus 
domestica]
Length=607

 Score = 68.6 bits (166),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  393  SQKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            SQK Q+YSRAY++ KRPEDV +FAEFF+GHLFVNEKG
Sbjct  84   SQKNQSYSRAYIDLKRPEDVFDFAEFFDGHLFVNEKG  120


 Score = 29.3 bits (64),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 0/51 (0%)
 Frame = +2

Query  257  EGSFGSSQSGVAALAAHTSAGYAHRES*FSLLRSLQLGLFPPWKNQPETTN  409
            EG  GS+Q G + LAA   A  A   +   L   LQLG F  W+ +    N
Sbjct  37   EGPVGSNQGGASTLAAFDFASCACGANRRFLCWPLQLGCFSSWQEERSQKN  87



>emb|CCJ29190.1| unnamed protein product [Pneumocystis jirovecii]
Length=395

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 4/84 (5%)
 Frame = +3

Query  264  PLDRAKVVLRHLPPTLPQATLIEKVDSRFSG-RYNWVSFHPGKIS---QKQQTYSRAYVE  431
            P  R KVV+R+LPP L + T  E V       R  W SF+PGK+S    K   Y+RAY++
Sbjct  19   PATRLKVVIRYLPPDLSEQTFKELVKEWIDEERVEWSSFYPGKVSSNRNKNDKYARAYIK  78

Query  432  FKRPEDVIEFAEFFNGHLFVNEKG  503
            FK PE +I F + F  HLF +EKG
Sbjct  79   FKSPEALIAFHKGFGAHLFTDEKG  102



>gb|AFK46637.1| unknown [Lotus japonicus]
Length=57

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  267  LDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHP-GKI  392
            LDR KVVLRHLPPTL QA+L+ ++D+ F GRYNW+SF P GK+
Sbjct  2    LDRTKVVLRHLPPTLSQASLVAQIDAAFLGRYNWLSFCPAGKV  44



>ref|XP_008352807.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
UPF3-like, partial [Malus domestica]
Length=532

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  390  ISQKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
             SQK Q YSRAY++FKRPEDV EFAEFF+GH+FVNEKG
Sbjct  2    CSQKNQRYSRAYIDFKRPEDVFEFAEFFDGHVFVNEKG  39



>ref|XP_005644501.1| hypothetical protein COCSUDRAFT_44353 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19957.1| hypothetical protein COCSUDRAFT_44353 [Coccomyxa subellipsoidea 
C-169]
Length=382

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +3

Query  267  LDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPE  446
            ++R KVV+R LPP++  A + E VDS  + +YNW SF  GK S ++  +SR YV F+ P 
Sbjct  1    MERTKVVIRKLPPSIADADVRELVDS-TNVKYNWFSFVQGKTSVRKVVHSRCYVNFEDPS  59

Query  447  DVIEFAEFFNGHLFVNEKG  503
            D+  F      H FV ++G
Sbjct  60   DIPAFKAAVEAHAFVTDRG  78



>ref|XP_005851259.1| hypothetical protein CHLNCDRAFT_50004 [Chlorella variabilis]
 gb|EFN59157.1| hypothetical protein CHLNCDRAFT_50004 [Chlorella variabilis]
Length=119

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            R KVV+R LPP+L +      V   +  R +W S+  GK S K   +SRAY+ FK   DV
Sbjct  6    RCKVVVRRLPPSLQEEAFRGAV-REWIERADWFSYVQGKASSKDLLHSRAYLRFKDAADV  64

Query  453  IEFAEFFNGHLFVNEKG  503
              F + ++GH FVNE+G
Sbjct  65   PRFQQAWDGHAFVNERG  81



>gb|KHN22614.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=148

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 30/106 (28%)
 Frame = +3

Query  270  DRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNW-VSFHPGK-------------------  389
            ++ KVV+RHL P+L  +        RFS R++  +   P +                   
Sbjct  8    EKTKVVIRHLSPSLTLSDFFPT--HRFSLRFSLQLVLLPSRQQQVITIQTLPVCSLCNPN  65

Query  390  --------ISQKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
                     S K+Q +SRAY++FK P+DV EF EFF+GH+FVNE+G
Sbjct  66   KSLIIIIICSHKRQMHSRAYIDFKCPDDVFEFTEFFDGHVFVNERG  111



>gb|EMS47492.1| Regulator of nonsense transcripts 3A [Triticum urartu]
Length=509

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  384  GKISQKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            G  SQK   YSR Y+ FK PEDV+EFAEFFNGH+FVNEKG
Sbjct  46   GVKSQKNHRYSRLYLNFKSPEDVVEFAEFFNGHVFVNEKG  85



>ref|XP_010930558.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Elaeis guineensis]
Length=543

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 4/49 (8%)
 Frame = +3

Query  369  VSFHPGKIS----QKQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            V  H G+ S     K Q YSRAY+ FKR EDV+EFAE F+GH+FVNEKG
Sbjct  3    VGCHEGRTSPVWCHKNQRYSRAYLNFKRLEDVVEFAELFDGHIFVNEKG  51



>emb|CAX18772.1| UPF3 regulator of nonsense transcripts homolog A (yeast) [Danio 
rerio]
Length=155

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +3

Query  276  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  455
            +KVV+R LPP+L +  L E +    S  +++  F P   S     +SRAY+ FK PED+I
Sbjct  43   SKVVIRRLPPSLSKDQLQEHLSPLPS--FDYFEFFPADQSLYPHLFSRAYINFKNPEDII  100

Query  456  EFAEFFNGHLFVNEKG  503
             F + F+G++F++ KG
Sbjct  101  IFRDRFDGYVFIDNKG  116



>ref|XP_010930557.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Elaeis guineensis]
Length=558

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  399  KQQTYSRAYVEFKRPEDVIEFAEFFNGHLFVNEKG  503
            K Q YSRAY+ FKR EDV+EFAE F+GH+FVNEKG
Sbjct  32   KNQRYSRAYLNFKRLEDVVEFAELFDGHIFVNEKG  66



>ref|XP_007872945.1| hypothetical protein PNEG_01033 [Pneumocystis murina B123]
 gb|EMR10886.1| hypothetical protein PNEG_01033 [Pneumocystis murina B123]
Length=410

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 43/80 (54%), Gaps = 3/80 (4%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKIS---QKQQTYSRAYVEFKRP  443
            R KVV+R+LP  L +      V    S    W SF PGKIS    K   + RAY++FK P
Sbjct  22   RLKVVVRYLPCNLSEQEFKNSVKEWISEEIEWFSFFPGKISTNRSKNDRHGRAYIKFKSP  81

Query  444  EDVIEFAEFFNGHLFVNEKG  503
            E +I F +  N HLF +EK 
Sbjct  82   EALITFYKGINKHLFTDEKN  101



>gb|AAH95761.1| Upf3a protein [Danio rerio]
Length=201

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +3

Query  276  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  455
            +KVV+R LPP+L +  L E +    S  +++  F P   S     +SRAY+ FK PED+I
Sbjct  43   SKVVIRRLPPSLSKDQLQEHLSPLPS--FDYFEFFPADQSLYPHLFSRAYINFKNPEDII  100

Query  456  EFAEFFNGHLFVNEKG  503
             F + F+G++F++ KG
Sbjct  101  IFRDRFDGYVFIDNKG  116



>gb|ESA18168.1| hypothetical protein GLOINDRAFT_144398, partial [Rhizophagus 
irregularis DAOM 181602]
Length=270

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = +3

Query  267  LDRAKVVLRHLPPTLPQATLIEKVDSRFSGR-YNWVSFHPGKISQ---KQQTYSRAYVEF  434
            + + KVV+R LPP +P++   E V    +     W  FH G+IS+   K+  +SRAY  F
Sbjct  25   VTKTKVVVRRLPPLIPESLFFESVKQWVNEETCTWSRFHQGRISKSKNKESIFSRAYFHF  84

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  E V+EF   ++ HLF++++G
Sbjct  85   KTVEQVLEFHRGYDNHLFIDKQG  107



>ref|XP_006676092.1| hypothetical protein BATDEDRAFT_84963 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83414.1| hypothetical protein BATDEDRAFT_84963 [Batrachochytrium dendrobatidis 
JAM81]
Length=510

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (60%), Gaps = 4/84 (5%)
 Frame = +3

Query  261  VPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQK---QQTYSRAYVE  431
             P  R K+V+R LPPTLP+      + S++    +W  +  GK+++K   Q  +SRAY+ 
Sbjct  55   TPKLRTKIVVRRLPPTLPRDAFFNTI-SKWLDYIDWSEYVSGKLAKKLAKQNVFSRAYLN  113

Query  432  FKRPEDVIEFAEFFNGHLFVNEKG  503
            F   + V++F +  NGHLFV+ KG
Sbjct  114  FIDCDSVLDFFKSCNGHLFVDSKG  137



>gb|EPZ31303.1| Nucleotide-binding, alpha-beta plait domain-containing protein 
[Rozella allomycis CSF55]
Length=217

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDV  452
            ++K+V+R+LPP+L + T ++ + +       W ++    +S K + +S AY+ FK  E V
Sbjct  9    KSKIVVRYLPPSLTEETFLKTISAHLPN-VTWKTYLKDNLSVKGKKFSIAYLNFKTEESV  67

Query  453  IEFAEFFNGHLFVNEKG  503
            + FA+ F+GH+FV+  G
Sbjct  68   LNFAKEFDGHVFVDSSG  84



>emb|CCO28851.1| putative WD repeat-containing protein C1672,07 [Rhizoctonia solani 
AG-1 IB]
Length=759

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRY-NWVSFHPGKISQK---QQTYSRAYVEFKR  440
            + KVV+R LPP LP+    + V    +    NW  + PGK+  K   + T SRAYVEF  
Sbjct  645  KLKVVIRRLPPNLPENIFWQSVAQWVTDETSNWKLYVPGKLRTKLNRENTPSRAYVEFVT  704

Query  441  PEDVIEFAEFFNGHLFVNEKG  503
            PE VI F   +NGH+F +++G
Sbjct  705  PEAVITFNRDYNGHVFRDKQG  725



>gb|KDN51831.1| hypothetical protein RSAG8_00380, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=333

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYN-WVSFHPGKISQK---QQTYSRAYVEFKR  440
            R KVV+R LPP LP+    + V    +   + W  + PGK+  K   + T SRAYVEF  
Sbjct  30   RLKVVIRRLPPNLPENIFWQSVAQWVTDESSSWKLYVPGKLRTKLNRENTPSRAYVEFTT  89

Query  441  PEDVIEFAEFFNGHLFVNEKG  503
            PE ++ F   +NGH+F +++G
Sbjct  90   PEAIVVFNRGYNGHVFRDKQG  110



>gb|EJU05580.1| hypothetical protein DACRYDRAFT_104067 [Dacryopinax sp. DJM-731 
SS1]
Length=469

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = +3

Query  261  VPLDRAKVVLRHLPPTLPQATLIEKVDSRFSGR-YNWVSFHPGKISQK---QQTYSRAYV  428
            V   R KV++R LPP LP+A   + V+   +     W  F+ GKI  K   +   SRAY+
Sbjct  36   VSATRLKVIVRRLPPNLPEAVFWKSVEPWVNEENTTWRIFYSGKIKPKLENENVPSRAYI  95

Query  429  EFKRPEDVIEFAEFFNGHLFVNEKG  503
             FK PE V +F+  +NGH F +++G
Sbjct  96   MFKTPEQVAQFSSAYNGHAFRDKQG  120



>ref|XP_010738428.1| PREDICTED: regulator of nonsense transcripts 3A [Larimichthys 
crocea]
Length=468

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = +3

Query  276  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  455
             KVVLR LPP L +  L E++    S  Y++  F P   S     +SRAY+ FK PED++
Sbjct  46   TKVVLRRLPPNLSKEQLEEQLSPLPS--YDYFEFFPADQSLYPHLFSRAYINFKSPEDIL  103

Query  456  EFAEFFNGHLFVNEKG  503
             F + F+G++F++ KG
Sbjct  104  LFRDRFDGYVFIDNKG  119



>ref|XP_010786902.1| PREDICTED: regulator of nonsense transcripts 3A-like [Notothenia 
coriiceps]
Length=312

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = +3

Query  276  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  455
             KVV+R LPP L +  L E++    S  Y++  F P   S     +SRAY+ FK PED++
Sbjct  46   TKVVIRRLPPNLSKDQLEEQLSPLPS--YDYFEFFPADQSLYPHLFSRAYINFKIPEDIL  103

Query  456  EFAEFFNGHLFVNEKG  503
             F + F+G++F++ KG
Sbjct  104  LFRDRFDGYVFIDNKG  119



>ref|XP_010903995.1| PREDICTED: regulator of nonsense transcripts 3A isoform X1 [Esox 
lucius]
Length=490

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +3

Query  276  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  455
             KVV+R LPP L +  L E++    S  Y++  F P   S     +SRAY+ FK PED++
Sbjct  46   TKVVIRRLPPNLSKDQLEEQLSPLPS--YDYFEFFPADQSLYPHLFSRAYINFKNPEDIL  103

Query  456  EFAEFFNGHLFVNEKG  503
             F++ F+G++F++ KG
Sbjct  104  LFSDRFDGYVFIDNKG  119



>ref|XP_010903997.1| PREDICTED: regulator of nonsense transcripts 3A isoform X2 [Esox 
lucius]
Length=486

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +3

Query  276  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  455
             KVV+R LPP L +  L E++    S  Y++  F P   S     +SRAY+ FK PED++
Sbjct  46   TKVVIRRLPPNLSKDQLEEQLSPLPS--YDYFEFFPADQSLYPHLFSRAYINFKNPEDIL  103

Query  456  EFAEFFNGHLFVNEKG  503
             F++ F+G++F++ KG
Sbjct  104  LFSDRFDGYVFIDNKG  119



>ref|XP_006788210.1| PREDICTED: regulator of nonsense transcripts 3A-like [Neolamprologus 
brichardi]
Length=463

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = +3

Query  276  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  455
             KVV+R LPP L +  L E++    S  Y++  F P   S     +SRAY+ FK PED++
Sbjct  46   TKVVIRRLPPNLSKEQLEEQLSPLPS--YDYFEFSPADQSLYPHLFSRAYINFKNPEDIL  103

Query  456  EFAEFFNGHLFVNEKG  503
             F + F+G++F++ KG
Sbjct  104  LFRDRFDGYVFIDNKG  119



>gb|EUC62084.1| Smg-4/UPF3 family protein [Rhizoctonia solani AG-3 Rhs1AP]
Length=821

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYN-WVSFHPGKISQK---QQTYSRAYVEFKR  440
            R KVV+R LPP LP+    + V    +   + W  + PGK+  K   + T SRAYVEF  
Sbjct  384  RLKVVVRRLPPNLPETIFWQSVAQWVTDESSSWKLYVPGKLRTKLNRENTPSRAYVEFTT  443

Query  441  PEDVIEFAEFFNGHLFVNEKG  503
            PE V+ F   +NGH+F +++G
Sbjct  444  PEAVVVFNRDYNGHVFRDKQG  464



>gb|EXX69496.1| hypothetical protein RirG_095570 [Rhizophagus irregularis DAOM 
197198w]
Length=548

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = +3

Query  267  LDRAKVVLRHLPPTLPQATLIEKVDSRFSGRY-NWVSFHPGKISQ---KQQTYSRAYVEF  434
            + + KVV+R LPP +P++   E V    +     W  FH G+IS+   K+  +SRAY  F
Sbjct  25   VTKTKVVVRRLPPLIPESLFFESVKQWVNEETCTWSRFHQGRISKSKNKESIFSRAYFHF  84

Query  435  KRPEDVIEFAEFFNGHLFVNEKG  503
            K  E V+EF   ++ HLF++++G
Sbjct  85   KTVEQVLEFHRGYDNHLFIDKQG  107



>gb|KEP50606.1| Smg-4/UPF3 family protein [Rhizoctonia solani 123E]
Length=821

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = +3

Query  273  RAKVVLRHLPPTLPQATLIEKVDSRFSGRYN-WVSFHPGKISQK---QQTYSRAYVEFKR  440
            R KVV+R LPP LP+    + V    +   + W  + PGK+  K   + T SRAYVEF  
Sbjct  384  RLKVVVRRLPPNLPETIFWQSVAQWVTDESSSWKLYVPGKLRTKLNRENTPSRAYVEFTT  443

Query  441  PEDVIEFAEFFNGHLFVNEKG  503
            PE V+ F   +NGH+F +++G
Sbjct  444  PEAVVVFNRDYNGHVFRDKQG  464



>ref|XP_005935879.1| PREDICTED: regulator of nonsense transcripts 3A-like isoform 
X4 [Haplochromis burtoni]
Length=415

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = +3

Query  276  AKVVLRHLPPTLPQATLIEKVDSRFSGRYNWVSFHPGKISQKQQTYSRAYVEFKRPEDVI  455
             KVV+R LPP L +  L E++    S  Y++  F P   S     +SRAY+ FK PED++
Sbjct  46   TKVVIRRLPPNLSKEQLEEQLSPLPS--YDYFEFFPADQSLYPHLFSRAYINFKNPEDIL  103

Query  456  EFAEFFNGHLFVNEKG  503
             F + F+G++F++ KG
Sbjct  104  LFRDRFDGYVFIDNKG  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 583917745398