BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7310

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774840.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    131   5e-32   Nicotiana sylvestris
ref|XP_009595898.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    129   3e-31   Nicotiana tomentosiformis
ref|XP_009623436.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    125   1e-29   Nicotiana tomentosiformis
ref|XP_009776395.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    122   7e-29   Nicotiana sylvestris
ref|XP_006353499.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    119   2e-27   Solanum tuberosum [potatoes]
ref|XP_004251643.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    119   2e-27   Solanum lycopersicum
ref|XP_009623437.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    112   3e-25   Nicotiana tomentosiformis
ref|XP_011093649.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    112   5e-25   Sesamum indicum [beniseed]
ref|XP_011093648.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    111   6e-25   Sesamum indicum [beniseed]
ref|XP_009595899.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    110   1e-24   
ref|XP_009776396.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    109   3e-24   Nicotiana sylvestris
ref|XP_011093650.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    109   4e-24   Sesamum indicum [beniseed]
ref|XP_010313741.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    108   8e-24   Solanum lycopersicum
ref|XP_006353500.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    108   8e-24   Solanum tuberosum [potatoes]
ref|XP_009774844.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    107   1e-23   Nicotiana sylvestris
ref|XP_011093651.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    106   3e-23   Sesamum indicum [beniseed]
ref|XP_011659958.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    101   3e-21   Cucumis sativus [cucumbers]
ref|XP_011074325.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    100   5e-21   Sesamum indicum [beniseed]
gb|AHB32107.1|  arginyl-tRNA synthetase-like protein                    100   7e-21   Camellia sinensis [black tea]
ref|XP_011083561.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    100   8e-21   Sesamum indicum [beniseed]
ref|XP_011074326.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    100   8e-21   Sesamum indicum [beniseed]
ref|XP_011083560.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...    100   8e-21   Sesamum indicum [beniseed]
ref|XP_008450791.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  99.4    1e-20   Cucumis melo [Oriental melon]
ref|XP_004135677.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  95.1    4e-19   Cucumis sativus [cucumbers]
gb|EYU38804.1|  hypothetical protein MIMGU_mgv1a003377mg              94.7    4e-19   Erythranthe guttata [common monkey flower]
ref|XP_007012999.1|  Arginyl-tRNA synthetase, class Ic isoform 1      94.4    7e-19   
ref|XP_010545317.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  94.4    8e-19   Tarenaya hassleriana [spider flower]
ref|XP_010539378.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  94.0    1e-18   Tarenaya hassleriana [spider flower]
gb|KDP33781.1|  hypothetical protein JCGZ_07352                       93.6    1e-18   Jatropha curcas
gb|KJB54287.1|  hypothetical protein B456_009G028100                  93.6    1e-18   Gossypium raimondii
ref|XP_010539377.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  93.6    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_008450792.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  93.2    2e-18   Cucumis melo [Oriental melon]
ref|XP_012076843.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  93.2    2e-18   Jatropha curcas
ref|XP_007013000.1|  Arginyl-tRNA synthetase, class Ic isoform 2      92.0    4e-18   
ref|XP_010049607.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    92.0    5e-18   Eucalyptus grandis [rose gum]
gb|KCW82309.1|  hypothetical protein EUGRSUZ_C03716                   90.9    1e-17   Eucalyptus grandis [rose gum]
gb|KJB54289.1|  hypothetical protein B456_009G028100                  90.1    1e-17   Gossypium raimondii
gb|KJB54282.1|  hypothetical protein B456_009G028100                  91.3    1e-17   Gossypium raimondii
gb|KJB54283.1|  hypothetical protein B456_009G028100                  91.3    1e-17   Gossypium raimondii
ref|XP_010244286.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  90.9    1e-17   Nelumbo nucifera [Indian lotus]
gb|KJB54285.1|  hypothetical protein B456_009G028100                  90.9    1e-17   Gossypium raimondii
gb|KJB54286.1|  hypothetical protein B456_009G028100                  90.9    1e-17   Gossypium raimondii
gb|KJB54293.1|  hypothetical protein B456_009G028100                  90.9    1e-17   Gossypium raimondii
gb|KJB54284.1|  hypothetical protein B456_009G028100                  90.9    1e-17   Gossypium raimondii
gb|KJB54288.1|  hypothetical protein B456_009G028100                  90.1    2e-17   Gossypium raimondii
ref|XP_010539376.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  90.5    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_010656250.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  90.5    2e-17   Vitis vinifera
gb|KJB54290.1|  hypothetical protein B456_009G028100                  90.1    2e-17   Gossypium raimondii
ref|XP_012076844.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  90.1    2e-17   Jatropha curcas
emb|CBI27986.3|  unnamed protein product                              90.5    2e-17   Vitis vinifera
ref|XP_010539375.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  90.1    2e-17   Tarenaya hassleriana [spider flower]
gb|KJB54291.1|  hypothetical protein B456_009G028100                  89.7    2e-17   Gossypium raimondii
ref|XP_002514206.1|  arginyl-tRNA synthetase, putative                89.7    3e-17   Ricinus communis
ref|XP_010438775.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  89.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010448293.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  89.4    5e-17   Camelina sativa [gold-of-pleasure]
gb|KHG14519.1|  Arginine--tRNA ligase                                 88.6    7e-17   Gossypium arboreum [tree cotton]
gb|KJB27169.1|  hypothetical protein B456_004G282200                  88.2    1e-16   Gossypium raimondii
gb|KHG26458.1|  Arginine--tRNA ligase                                 88.2    1e-16   Gossypium arboreum [tree cotton]
ref|XP_006413208.1|  hypothetical protein EUTSA_v10024637mg           88.2    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_010688348.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  87.8    2e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010656251.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  87.4    2e-16   Vitis vinifera
ref|XP_010244295.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  86.7    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_008242476.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  87.0    3e-16   Prunus mume [ume]
ref|XP_008242477.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  86.7    3e-16   Prunus mume [ume]
ref|XP_007204586.1|  hypothetical protein PRUPE_ppa003237mg           86.7    3e-16   
ref|XP_010545318.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  86.7    3e-16   Tarenaya hassleriana [spider flower]
gb|KDO66604.1|  hypothetical protein CISIN_1g007251mg                 86.3    4e-16   Citrus sinensis [apfelsine]
emb|CDY42746.1|  BnaA03g47930D                                        86.3    5e-16   Brassica napus [oilseed rape]
ref|XP_010110873.1|  Arginine--tRNA ligase                            85.5    7e-16   
ref|NP_194360.1|  Arginyl-tRNA synthetase, class Ic                   85.5    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283292.1|  hypothetical protein CARUB_v10004329mg           85.5    9e-16   Capsella rubella
gb|AHF48762.1|  arginyl-tRNA synthetase                               85.1    1e-15   Canavalia brasiliensis
emb|CAQ34913.1|  arginyl-tRNA synthetase                              85.1    1e-15   Canavalia ensiformis [horse bean]
ref|XP_009137585.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  84.7    2e-15   Brassica rapa
ref|XP_010539382.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  84.7    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_010539379.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  84.7    2e-15   Tarenaya hassleriana [spider flower]
gb|KDO66609.1|  hypothetical protein CISIN_1g007251mg                 83.6    2e-15   Citrus sinensis [apfelsine]
ref|XP_008337668.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  84.7    2e-15   
ref|XP_008789113.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  84.3    2e-15   Phoenix dactylifera
ref|XP_006572930.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  84.7    2e-15   Glycine max [soybeans]
ref|XP_009352570.1|  PREDICTED: probable arginine--tRNA ligase, c...  84.3    2e-15   
ref|XP_010433522.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  84.3    2e-15   Camelina sativa [gold-of-pleasure]
emb|CDY69546.1|  BnaCnng64110D                                        83.2    2e-15   Brassica napus [oilseed rape]
gb|KDO66608.1|  hypothetical protein CISIN_1g007251mg                 84.0    2e-15   Citrus sinensis [apfelsine]
gb|KDO66605.1|  hypothetical protein CISIN_1g007251mg                 84.0    2e-15   Citrus sinensis [apfelsine]
gb|KDO66607.1|  hypothetical protein CISIN_1g007251mg                 83.6    2e-15   Citrus sinensis [apfelsine]
emb|CDP03242.1|  unnamed protein product                              84.3    2e-15   Coffea canephora [robusta coffee]
ref|XP_007152961.1|  hypothetical protein PHAVU_004G174700g           84.0    3e-15   Phaseolus vulgaris [French bean]
ref|XP_009352566.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  84.0    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_009352567.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  83.6    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_001759769.1|  predicted protein                                83.6    4e-15   
ref|XP_010937860.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  83.2    5e-15   Elaeis guineensis
ref|XP_010448294.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  83.2    5e-15   Camelina sativa [gold-of-pleasure]
gb|KHN39952.1|  Arginine--tRNA ligase, cytoplasmic                    83.2    6e-15   Glycine soja [wild soybean]
ref|XP_008789112.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  82.8    6e-15   Phoenix dactylifera
ref|XP_008789026.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  82.8    6e-15   
ref|XP_010438776.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  82.4    8e-15   Camelina sativa [gold-of-pleasure]
gb|EPS67056.1|  hypothetical protein M569_07720                       79.0    8e-15   Genlisea aurea
ref|XP_008789042.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  82.4    9e-15   Phoenix dactylifera
ref|XP_008789059.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  82.4    1e-14   
ref|XP_006451326.1|  hypothetical protein CICLE_v10007707mg           82.0    1e-14   
ref|XP_006475596.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  82.0    1e-14   
emb|CAB11469.1|  arginyl-tRNA synthetase                              82.0    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867571.1|  arginyl-tRNA synthetase                          82.0    1e-14   
ref|XP_006451330.1|  hypothetical protein CICLE_v10007707mg           82.0    1e-14   Citrus clementina [clementine]
ref|XP_010937859.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  81.6    2e-14   Elaeis guineensis
gb|AHF48761.1|  arginyl-tRNA synthetase                               80.9    3e-14   Dioclea megacarpa
ref|XP_006451324.1|  hypothetical protein CICLE_v10007707mg           80.1    4e-14   
ref|XP_006451327.1|  hypothetical protein CICLE_v10007707mg           80.5    4e-14   
ref|XP_006283291.1|  hypothetical protein CARUB_v10004329mg           80.1    6e-14   Capsella rubella
ref|XP_011014624.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  79.3    1e-13   Populus euphratica
ref|XP_010688350.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  79.0    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002888519.1|  hypothetical protein ARALYDRAFT_475759           78.6    1e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_003620789.1|  Arginyl-tRNA synthetase                          75.1    2e-13   
emb|CAB11467.1|  arginyl-tRNA synthetase                              78.2    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176826.1|  arginyl-tRNA synthetase, class Ic                   78.2    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301131.1|  hypothetical protein CARUB_v10021527mg           77.8    3e-13   
ref|XP_002882847.1|  predicted protein                                77.4    4e-13   
ref|XP_002883789.1|  hypothetical protein ARALYDRAFT_480296           77.4    4e-13   
ref|XP_002301499.1|  arginyl-tRNA synthetase family protein           77.0    5e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010465248.1|  PREDICTED: probable arginine--tRNA ligase, c...  77.0    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009142147.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  77.4    5e-13   Brassica rapa
ref|XP_010415196.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  77.0    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010413632.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  77.0    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_003535906.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  76.6    7e-13   Glycine max [soybeans]
ref|XP_004513035.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  76.6    7e-13   Cicer arietinum [garbanzo]
ref|XP_010433523.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  76.3    9e-13   Camelina sativa [gold-of-pleasure]
ref|XP_011014625.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  76.3    1e-12   Populus euphratica
ref|XP_011042210.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  76.3    1e-12   Populus euphratica
ref|XP_010511483.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  75.9    2e-12   Camelina sativa [gold-of-pleasure]
emb|CDX92760.1|  BnaC07g40180D                                        75.9    2e-12   
ref|XP_006293885.1|  hypothetical protein CARUB_v10022872mg           75.5    2e-12   
emb|CDX89348.1|  BnaA01g15450D                                        75.5    2e-12   
ref|XP_009407238.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  75.5    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407237.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  75.5    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY96661.1|  hypothetical protein OsI_18575                        75.5    2e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001054732.1|  Os05g0163000                                     75.5    2e-12   
ref|XP_010678625.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  75.1    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006413206.1|  hypothetical protein EUTSA_v10024637mg           75.1    2e-12   Eutrema salsugineum [saltwater cress]
ref|XP_003529061.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  74.3    4e-12   Glycine max [soybeans]
ref|XP_004513061.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  74.3    4e-12   Cicer arietinum [garbanzo]
emb|CDX94349.1|  BnaC01g18350D                                        74.3    4e-12   
ref|XP_003568860.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  74.3    4e-12   Brachypodium distachyon [annual false brome]
gb|KEH27228.1|  cytoplasmic-like arginine-tRNA ligase                 74.3    5e-12   Medicago truncatula
ref|XP_010231676.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  73.9    5e-12   Brachypodium distachyon [annual false brome]
gb|EMS66157.1|  Arginyl-tRNA synthetase, cytoplasmic                  73.6    7e-12   Triticum urartu
ref|XP_002875125.1|  hypothetical protein ARALYDRAFT_904472           72.8    7e-12   
ref|XP_002886965.1|  hypothetical protein ARALYDRAFT_894178           73.6    8e-12   
emb|CDY50010.1|  BnaC08g12170D                                        73.2    1e-11   Brassica napus [oilseed rape]
emb|CDY14308.1|  BnaA08g14390D                                        72.8    1e-11   Brassica napus [oilseed rape]
ref|XP_006853736.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    72.8    1e-11   Amborella trichopoda
ref|XP_009137586.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  72.4    2e-11   Brassica rapa
ref|NP_001236544.1|  arginyl-tRNA synthetase                          72.4    2e-11   Glycine max [soybeans]
ref|XP_006572789.1|  PREDICTED: arginyl-tRNA synthetase isoform X1    72.4    2e-11   Glycine max [soybeans]
ref|XP_011459396.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  71.6    4e-11   Fragaria vesca subsp. vesca
ref|XP_011399829.1|  Arginine-tRNA ligase                             71.2    4e-11   Auxenochlorella protothecoides
gb|EMT08576.1|  Arginyl-tRNA synthetase                               71.2    6e-11   
gb|KHN40369.1|  Arginine--tRNA ligase, cytoplasmic                    70.5    9e-11   Glycine soja [wild soybean]
ref|XP_009109180.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  70.5    9e-11   Brassica rapa
ref|XP_011459399.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  70.1    1e-10   Fragaria vesca subsp. vesca
gb|KEH44003.1|  cytoplasmic-like arginine-tRNA ligase                 69.7    1e-10   Medicago truncatula
ref|XP_007152963.1|  hypothetical protein PHAVU_004G174900g           69.7    2e-10   Phaseolus vulgaris [French bean]
ref|XP_003608811.1|  Arginyl-tRNA synthetase                          69.3    2e-10   
gb|AES91008.2|  cytoplasmic-like arginine-tRNA ligase                 69.3    2e-10   Medicago truncatula
gb|KIZ07760.1|  hypothetical protein MNEG_0179                        64.3    5e-10   Monoraphidium neglectum
ref|XP_009142154.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  68.2    5e-10   Brassica rapa
ref|XP_012080832.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    67.4    7e-10   Jatropha curcas
gb|KEH36095.1|  cytoplasmic-like arginine-tRNA ligase                 67.4    8e-10   Medicago truncatula
ref|XP_002962266.1|  hypothetical protein SELMODRAFT_76727            67.0    1e-09   Selaginella moellendorffii
ref|XP_005845135.1|  hypothetical protein CHLNCDRAFT_26194            66.6    2e-09   Chlorella variabilis
ref|XP_002961325.1|  hypothetical protein SELMODRAFT_140217           66.6    2e-09   Selaginella moellendorffii
gb|AFW82580.1|  hypothetical protein ZEAMMB73_640075                  66.2    2e-09   
gb|AFW82579.1|  hypothetical protein ZEAMMB73_640075                  65.9    2e-09   
ref|XP_002965180.1|  hypothetical protein SELMODRAFT_83543            66.2    2e-09   Selaginella moellendorffii
gb|AFW82581.1|  hypothetical protein ZEAMMB73_640075                  66.2    2e-09   
ref|NP_001148134.1|  arginyl-tRNA synthetase                          66.2    2e-09   
ref|XP_002958524.1|  hypothetical protein VOLCADRAFT_108162           65.5    4e-09   Volvox carteri f. nagariensis
ref|XP_002530974.1|  arginyl-tRNA synthetase, putative                65.1    5e-09   Ricinus communis
dbj|BAB08191.1|  unnamed protein product                              64.7    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEE53905.1|  hypothetical protein OsJ_00455                        63.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001695651.1|  hypothetical protein CHLREDRAFT_119290           63.5    2e-08   Chlamydomonas reinhardtii
ref|XP_005646217.1|  arginyl-tRNA synthetase                          62.4    4e-08   Coccomyxa subellipsoidea C-169
gb|KFK38730.1|  hypothetical protein AALP_AA3G153100                  59.7    3e-07   Arabis alpina [alpine rockcress]
gb|KFK38731.1|  hypothetical protein AALP_AA3G153100                  59.7    3e-07   Arabis alpina [alpine rockcress]
ref|XP_011161033.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  56.6    2e-06   Solenopsis invicta [imported red fire ant]
ref|XP_006654081.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  57.0    2e-06   Oryza brachyantha
ref|XP_008548167.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    57.0    2e-06   Microplitis demolitor
ref|XP_012063930.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    56.2    4e-06   Atta cephalotes
ref|XP_004977115.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  56.2    4e-06   Setaria italica
ref|XP_008647544.1|  PREDICTED: uncharacterized protein LOC100273...  55.8    5e-06   Zea mays [maize]
ref|XP_011266122.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    55.5    6e-06   Camponotus floridanus
gb|EFN61656.1|  Arginyl-tRNA synthetase, cytoplasmic                  55.5    6e-06   Camponotus floridanus
ref|XP_008647546.1|  PREDICTED: uncharacterized protein LOC100273...  55.5    7e-06   
ref|XP_006632005.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  55.5    7e-06   Lepisosteus oculatus
ref|XP_002051105.1|  GJ14045                                          55.1    8e-06   
ref|XP_003706581.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    55.1    9e-06   Megachile rotundata
gb|ERL94414.1|  hypothetical protein D910_11692                       55.1    9e-06   Dendroctonus ponderosae
ref|XP_011698318.1|  PREDICTED: probable arginine--tRNA ligase, c...  55.1    1e-05   Wasmannia auropunctata
ref|XP_011630540.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    54.7    1e-05   Pogonomyrmex barbatus
gb|ACR35119.1|  unknown                                               54.3    1e-05   Zea mays [maize]
gb|KKA66114.1|  tRNA synthetase                                       54.3    1e-05   
ref|XP_003492480.1|  PREDICTED: arginyl-tRNA synthetase, cytoplas...  54.7    1e-05   Bombus impatiens
emb|CDJ98304.1|  Arginyl tRNA synthetase and Arginyl-tRNA synthet...  54.7    1e-05   Haemonchus contortus [red stomach worm]
ref|XP_003394872.1|  PREDICTED: arginyl-tRNA synthetase, cytoplas...  54.3    1e-05   Bombus terrestris [large earth bumblebee]
ref|XP_011556293.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    54.3    2e-05   Plutella xylostella [cabbage moth]
ref|XP_008647543.1|  PREDICTED: uncharacterized protein LOC100273...  54.3    2e-05   Zea mays [maize]
ref|XP_005708392.1|  arginyl-tRNA synthetase                          53.9    2e-05   Galdieria sulphuraria
ref|NP_001141350.1|  uncharacterized protein LOC100273441             53.9    2e-05   Zea mays [maize]
ref|XP_006610429.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  53.9    2e-05   Apis dorsata [rock honeybee]
ref|XP_623301.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic       53.9    2e-05   
ref|XP_007565550.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    53.5    3e-05   
ref|XP_008426663.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    53.5    3e-05   Poecilia reticulata
ref|XP_005837068.1|  hypothetical protein GUITHDRAFT_200394           53.5    3e-05   Guillardia theta CCMP2712
gb|KDR16424.1|  Arginyl-tRNA synthetase, cytoplasmic                  53.1    3e-05   Zootermopsis nevadensis
ref|XP_008206548.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    53.1    4e-05   
ref|XP_005991871.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  53.1    4e-05   
ref|XP_005991870.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  53.1    4e-05   Latimeria chalumnae
ref|XP_005837067.1|  Arginyl-tRNA synthetase                          53.1    4e-05   Guillardia theta CCMP2712
ref|XP_002611646.1|  hypothetical protein BRAFLDRAFT_117121           52.8    4e-05   Branchiostoma floridae
ref|XP_003690660.1|  PREDICTED: LOW QUALITY PROTEIN: arginine--tR...  52.8    5e-05   Apis florea [dwarf honeybee]
ref|NP_573081.1|  Arginyl-tRNA synthetase                             52.8    6e-05   Drosophila melanogaster
ref|WP_019487092.1|  arginyl-tRNA synthetase                          52.8    6e-05   Kamptonema formosum
ref|XP_006263319.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    52.4    6e-05   Alligator mississippiensis
emb|CAF89939.1|  unnamed protein product                              52.4    7e-05   Tetraodon nigroviridis
emb|CAF97279.1|  unnamed protein product                              52.4    8e-05   Tetraodon nigroviridis
ref|XP_008292304.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    52.0    8e-05   Stegastes partitus
ref|XP_001978023.1|  GG19367                                          52.0    9e-05   Drosophila erecta
ref|XP_005800426.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  52.0    1e-04   
ref|XP_002044201.1|  GM22521                                          52.0    1e-04   Drosophila sechellia
ref|XP_002100732.1|  GE16015                                          52.0    1e-04   Drosophila yakuba
ref|XP_011063314.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    52.0    1e-04   Acromyrmex echinatior
gb|EGI70362.1|  Arginyl-tRNA synthetase, cytoplasmic                  52.0    1e-04   Acromyrmex echinatior
ref|XP_002076727.1|  GD24677                                          51.6    1e-04   Drosophila simulans
ref|XP_003056579.1|  arginyl-tRNA synthetase                          51.6    1e-04   Micromonas pusilla CCMP1545
ref|XP_002425430.1|  Arginyl-tRNA synthetase, putative                51.6    1e-04   Pediculus humanus corporis [human body lice]
gb|EFX66770.1|  hypothetical protein DAPPUDRAFT_302451                51.6    1e-04   Daphnia pulex
ref|XP_003454001.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  51.6    1e-04   Oreochromis niloticus
ref|XP_011151941.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    51.2    1e-04   
gb|EFN76202.1|  Arginyl-tRNA synthetase, cytoplasmic                  51.2    2e-04   Harpegnathos saltator
ref|WP_015176954.1|  arginyl-tRNA synthetase                          51.2    2e-04   Oscillatoria nigro-viridis
ref|WP_006634878.1|  arginyl-tRNA synthetase                          51.2    2e-04   Microcoleus vaginatus
ref|WP_017659013.1|  arginyl-tRNA synthetase                          51.2    2e-04   Geitlerinema sp. PCC 7105
gb|EMT04827.1|  Arginyl-tRNA synthetase                               51.2    2e-04   
ref|XP_005472371.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  51.2    2e-04   Oreochromis niloticus
ref|WP_033374337.1|  arginyl-tRNA synthetase                          50.8    2e-04   
ref|XP_006015766.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    50.8    2e-04   Alligator sinensis
gb|AHF48759.1|  cytoplasmic arginyl-tRNA synthetase                   50.8    2e-04   Caryedes brasiliensis
ref|XP_008331579.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    50.8    2e-04   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_002771232.1|  arginyl-tRNA synthetase, putative                50.8    2e-04   Perkinsus marinus ATCC 50983
ref|XP_002403306.1|  arginyl-tRNA synthetase, putative                50.8    2e-04   Ixodes scapularis [blacklegged tick]
ref|WP_011613340.1|  arginine--tRNA ligase                            50.4    3e-04   Trichodesmium erythraeum
gb|KDD75315.1|  class I (R) tRNA synthetase                           50.1    4e-04   Helicosporidium sp. ATCC 50920
ref|WP_035990551.1|  arginyl-tRNA synthetase                          50.1    4e-04   Leptolyngbya sp. KIOST-1
ref|WP_015115673.1|  arginyl-tRNA synthetase                          50.1    4e-04   Nostoc sp. PCC 7107
ref|XP_002136329.1|  GA24005                                          49.7    4e-04   Drosophila pseudoobscura pseudoobscura
ref|NP_001279103.1|  arginyl-tRNA synthetase                          50.1    4e-04   Callorhinchus milii [Australian ghost shark]
ref|XP_001842295.1|  arginyl-tRNA synthetase                          50.1    4e-04   Culex quinquefasciatus
gb|EHJ75259.1|  putative arginyl-tRNA synthetase                      50.1    4e-04   
ref|WP_015783175.1|  arginyl-tRNA synthetase                          50.1    4e-04   Cyanothece sp. PCC 8802
ref|XP_003970893.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    50.1    4e-04   Takifugu rubripes [tiger puffer]
gb|KFV75360.1|  Arginine--tRNA ligase, cytoplasmic                    50.1    5e-04   Struthio camelus australis
ref|XP_009688558.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  50.1    5e-04   Struthio camelus australis
ref|XP_009688557.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  50.1    5e-04   Struthio camelus australis
ref|XP_009688556.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  50.1    5e-04   Struthio camelus australis
emb|CDS30937.1|  arginyl tRNA synthetase, cytoplasmic                 50.1    5e-04   Hymenolepis microstoma
ref|WP_008186340.1|  arginyl-tRNA synthetase                          49.7    5e-04   Moorea producens
ref|XP_010790048.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    49.7    6e-04   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011877440.1|  PREDICTED: arginine--tRNA ligase, cytoplasmic    49.7    6e-04   Vollenhovia emeryi
ref|XP_011500739.1|  PREDICTED: arginine--tRNA ligase, cytoplasmi...  49.3    8e-04   Ceratosolen solmsi marchali
ref|WP_011320273.1|  arginine--tRNA ligase                            49.3    8e-04   Trichormus variabilis
ref|XP_001658908.1|  AAEL000199-PA                                    49.3    8e-04   
ref|XP_002781131.1|  arginyl-tRNA synthetase, putative                48.9    0.001   Perkinsus marinus ATCC 50983
ref|XP_011500741.1|  PREDICTED: probable arginine--tRNA ligase, c...  48.9    0.001   Ceratosolen solmsi marchali



>ref|XP_009774840.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Nicotiana sylvestris]
Length=651

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 77/105 (73%), Gaps = 4/105 (4%)
 Frame = +1

Query  271  QIVKASSLENLMSNNGTLRSTSSRFRSVGKVTATPISTMTA----VGSVKEQLAKLFEES  438
            +++  SS  + + N G  R+TS  F SV KV++ PISTM      VGSVKEQLAKLFEES
Sbjct  24   KLIHLSSFSSFLLNTGIPRATSREFFSVVKVSSRPISTMATDKEIVGSVKEQLAKLFEES  83

Query  439  LRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            LRA FPD  DV PM+AICN+ + GDYQCNNAMSLW KIK +GTQF
Sbjct  84   LRAAFPDIEDVHPMIAICNDSRHGDYQCNNAMSLWNKIKGQGTQF  128



>ref|XP_009595898.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Nicotiana tomentosiformis]
Length=651

 Score =   129 bits (324),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 64/100 (64%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +1

Query  286  SSLENLMSNNGTLRSTSSRFRSVGKVTATPISTMTA----VGSVKEQLAKLFEESLRATF  453
            SS  + + N    R+TS    SV KV+  PISTM      VGSVKEQLAKLFEESLRA F
Sbjct  29   SSFSSFLLNTRIPRATSRELFSVVKVSTKPISTMATDKEIVGSVKEQLAKLFEESLRAAF  88

Query  454  PDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            PD   VQPM+AICN+P+ GDYQCNNAMSLW KIK +GTQF
Sbjct  89   PDVEGVQPMIAICNDPRHGDYQCNNAMSLWNKIKGQGTQF  128



>ref|XP_009623436.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Nicotiana tomentosiformis]
Length=649

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 4/92 (4%)
 Frame = +1

Query  310  NNGTLRSTSSRFRSVGKVTATPISTMT----AVGSVKEQLAKLFEESLRATFPDESDVQP  477
            N   LR+TS RF S  +V +  ISTM     ++GS+K+QLAKLFEESLRA FPD SDVQP
Sbjct  35   NTRILRATSRRFFSAVEVHSRTISTMETDKESIGSLKQQLAKLFEESLRAAFPDISDVQP  94

Query  478  MMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            ++AICN+PK GDYQCNNAMSLW KIK KGTQF
Sbjct  95   LVAICNDPKNGDYQCNNAMSLWNKIKGKGTQF  126



>ref|XP_009776395.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Nicotiana sylvestris]
Length=649

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 4/92 (4%)
 Frame = +1

Query  310  NNGTLRSTSSRFRSVGKVTATPISTMT----AVGSVKEQLAKLFEESLRATFPDESDVQP  477
            N   LR+TS RF S  +V++  ISTM     ++GS+K+QLAKLFEESLRA FPD SDV P
Sbjct  35   NTRILRATSRRFFSAVEVSSKTISTMETDKESIGSLKQQLAKLFEESLRAAFPDISDVPP  94

Query  478  MMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            ++AICN+PK GDYQCNNAMSLW KIK KGTQF
Sbjct  95   LVAICNDPKNGDYQCNNAMSLWNKIKGKGTQF  126



>ref|XP_006353499.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Solanum tuberosum]
Length=649

 Score =   119 bits (297),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 58/88 (66%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMT----AVGSVKEQLAKLFEESLRATFPDESDVQPMMAI  489
            LR+TS RF     V+   ISTM      +GS K+Q+AKLFEESLRA FPD  DVQP++AI
Sbjct  39   LRATSRRFFGAVGVSLRTISTMENDKEIIGSQKQQIAKLFEESLRAAFPDIPDVQPLVAI  98

Query  490  CNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            CN+PK GDYQCNNAMSLW KIK KGTQF
Sbjct  99   CNDPKHGDYQCNNAMSLWNKIKGKGTQF  126



>ref|XP_004251643.1| PREDICTED: arginine--tRNA ligase, cytoplasmic isoform X1 [Solanum 
lycopersicum]
Length=649

 Score =   119 bits (297),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 58/88 (66%), Positives = 66/88 (75%), Gaps = 4/88 (5%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMT----AVGSVKEQLAKLFEESLRATFPDESDVQPMMAI  489
            LR+TS RF     V+   ISTM      +GS K+Q+AKLFEESLRA FPD  DVQP++AI
Sbjct  39   LRATSRRFFGAVGVSLRTISTMENDKEIIGSQKQQIAKLFEESLRAAFPDIPDVQPLVAI  98

Query  490  CNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            CN+PK GDYQCNNAMSLW KIK KGTQF
Sbjct  99   CNDPKHGDYQCNNAMSLWNKIKGKGTQF  126



>ref|XP_009623437.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Nicotiana tomentosiformis]
Length=590

 Score =   112 bits (280),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  391  AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            ++GS+K+QLAKLFEESLRA FPD SDVQP++AICN+PK GDYQCNNAMSLW KIK KGTQ
Sbjct  7    SIGSLKQQLAKLFEESLRAAFPDISDVQPLVAICNDPKNGDYQCNNAMSLWNKIKGKGTQ  66

Query  571  F  573
            F
Sbjct  67   F  67



>ref|XP_011093649.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Sesamum indicum]
Length=628

 Score =   112 bits (279),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 56/101 (55%), Positives = 69/101 (68%), Gaps = 6/101 (6%)
 Frame = +1

Query  283  ASSLENLMSNNGTLRSTSSRFRSVGKVTATPISTMT----AVGSVKEQLAKLFEESLRAT  450
            A S  +  S  G +R+ S R  S  K  +  +STM     + GSVK+Q+AKLFEESLR T
Sbjct  7    ADSHTDTCSYAGIVRAKSRRTVSAAK--SYSLSTMAPDLQSAGSVKQQIAKLFEESLRTT  64

Query  451  FPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             PDE DV+P +A C NPKFGDYQCNNAM LW+++K KGTQF
Sbjct  65   VPDEGDVEPAIAPCQNPKFGDYQCNNAMGLWSRVKGKGTQF  105



>ref|XP_011093648.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Sesamum indicum]
Length=629

 Score =   111 bits (278),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 7/102 (7%)
 Frame = +1

Query  283  ASSLENLMSNNGTLRSTSSRFRSVGKVTATPISTMT-----AVGSVKEQLAKLFEESLRA  447
            A S  +  S  G +R+ S R  S  K  +  +STM      + GSVK+Q+AKLFEESLR 
Sbjct  7    ADSHTDTCSYAGIVRAKSRRTVSAAK--SYSLSTMAPQDLQSAGSVKQQIAKLFEESLRT  64

Query  448  TFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            T PDE DV+P +A C NPKFGDYQCNNAM LW+++K KGTQF
Sbjct  65   TVPDEGDVEPAIAPCQNPKFGDYQCNNAMGLWSRVKGKGTQF  106



>ref|XP_009595899.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Nicotiana tomentosiformis]
Length=590

 Score =   110 bits (275),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VGSVKEQLAKLFEESLRA FPD   VQPM+AICN+P+ GDYQCNNAMSLW KIK +GTQF
Sbjct  8    VGSVKEQLAKLFEESLRAAFPDVEGVQPMIAICNDPRHGDYQCNNAMSLWNKIKGQGTQF  67



>ref|XP_009776396.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Nicotiana sylvestris]
 ref|XP_009776397.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Nicotiana sylvestris]
 ref|XP_009776398.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Nicotiana sylvestris]
Length=590

 Score =   109 bits (273),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  391  AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            ++GS+K+QLAKLFEESLRA FPD SDV P++AICN+PK GDYQCNNAMSLW KIK KGTQ
Sbjct  7    SIGSLKQQLAKLFEESLRAAFPDISDVPPLVAICNDPKNGDYQCNNAMSLWNKIKGKGTQ  66

Query  571  F  573
            F
Sbjct  67   F  67



>ref|XP_011093650.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X3 
[Sesamum indicum]
Length=615

 Score =   109 bits (272),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = +1

Query  325  RSTSSRFRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPK  504
            R T S  +S    T  P   + + GSVK+Q+AKLFEESLR T PDE DV+P +A C NPK
Sbjct  11   RRTVSAAKSYSLSTMAP-QDLQSAGSVKQQIAKLFEESLRTTVPDEGDVEPAIAPCQNPK  69

Query  505  FGDYQCNNAMSLWAKIKVKGTQF  573
            FGDYQCNNAM LW+++K KGTQF
Sbjct  70   FGDYQCNNAMGLWSRVKGKGTQF  92



>ref|XP_010313741.1| PREDICTED: arginine--tRNA ligase, cytoplasmic isoform X2 [Solanum 
lycopersicum]
Length=590

 Score =   108 bits (270),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +GS K+Q+AKLFEESLRA FPD  DVQP++AICN+PK GDYQCNNAMSLW KIK KGTQF
Sbjct  8    IGSQKQQIAKLFEESLRAAFPDIPDVQPLVAICNDPKHGDYQCNNAMSLWNKIKGKGTQF  67



>ref|XP_006353500.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Solanum tuberosum]
Length=590

 Score =   108 bits (270),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +GS K+Q+AKLFEESLRA FPD  DVQP++AICN+PK GDYQCNNAMSLW KIK KGTQF
Sbjct  8    IGSQKQQIAKLFEESLRAAFPDIPDVQPLVAICNDPKHGDYQCNNAMSLWNKIKGKGTQF  67



>ref|XP_009774844.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Nicotiana sylvestris]
Length=590

 Score =   107 bits (268),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/60 (80%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VGSVKEQLAKLFEESLRA FPD  DV PM+AICN+ + GDYQCNNAMSLW KIK +GTQF
Sbjct  8    VGSVKEQLAKLFEESLRAAFPDIEDVHPMIAICNDSRHGDYQCNNAMSLWNKIKGQGTQF  67



>ref|XP_011093651.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X4 
[Sesamum indicum]
Length=589

 Score =   106 bits (265),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  385  MTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKG  564
            + + GSVK+Q+AKLFEESLR T PDE DV+P +A C NPKFGDYQCNNAM LW+++K KG
Sbjct  4    LQSAGSVKQQIAKLFEESLRTTVPDEGDVEPAIAPCQNPKFGDYQCNNAMGLWSRVKGKG  63

Query  565  TQF  573
            TQF
Sbjct  64   TQF  66



>ref|XP_011659958.1| PREDICTED: arginine--tRNA ligase, cytoplasmic isoform X1 [Cucumis 
sativus]
Length=645

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAI  489
            LR+ S R  S    T   +STM      VG++K QLAK+F+ SLRAT PDE+DV+P++A 
Sbjct  35   LRAASRRLISASTKTPQSVSTMATEEDNVGNIKRQLAKIFDVSLRATVPDETDVEPLVAA  94

Query  490  CNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  95   CAG-KFGDYQCNNAMGLWSKIKGKGTQF  121



>ref|XP_011074325.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Sesamum indicum]
Length=646

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 61/91 (67%), Gaps = 1/91 (1%)
 Frame = +1

Query  304  MSNNGTLRSTSSRF-RSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPM  480
             S N  LR++   F R+    + T  +     GS+K+QLAKLFEESLR T P+E DV P 
Sbjct  33   FSTNCILRTSRRLFLRAKASSSKTMANDEVTGGSLKQQLAKLFEESLRITVPEELDVDPA  92

Query  481  MAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +A C NPKFGDYQCNNAM LW+K+K K TQF
Sbjct  93   IAPCQNPKFGDYQCNNAMGLWSKVKGKSTQF  123



>gb|AHB32107.1| arginyl-tRNA synthetase-like protein [Camellia sinensis]
Length=589

 Score =   100 bits (248),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VGS+K+QLAKLFE SLR T PDE DV+P++A C NP+FGDYQCNNAMSLW KIK KG++F
Sbjct  8    VGSLKQQLAKLFEASLRTTVPDELDVEPLIAAC-NPRFGDYQCNNAMSLWTKIKGKGSEF  66



>ref|XP_011083561.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Sesamum indicum]
Length=590

 Score =   100 bits (248),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            GS+K+QLAKLFEESLR T P+E DV P +A C NPKFGDYQCNNAM LW+K+K K TQF
Sbjct  9    GSLKQQLAKLFEESLRITVPEELDVDPAIAPCQNPKFGDYQCNNAMGLWSKVKGKSTQF  67



>ref|XP_011074326.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Sesamum indicum]
Length=590

 Score =   100 bits (248),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            GS+K+QLAKLFEESLR T P+E DV P +A C NPKFGDYQCNNAM LW+K+K K TQF
Sbjct  9    GSLKQQLAKLFEESLRITVPEELDVDPAIAPCQNPKFGDYQCNNAMGLWSKVKGKSTQF  67



>ref|XP_011083560.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Sesamum indicum]
Length=646

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 5/93 (5%)
 Frame = +1

Query  304  MSNNGTLRSTSSRFRSVGKVTATPISTM---TAVGSVKEQLAKLFEESLRATFPDESDVQ  474
             S N  L+++   FR      ++PI+        GS+K+QLAKLFEESLR T P+E DV 
Sbjct  33   FSTNCILKTSRRSFRRAK--ASSPITMANDEVTGGSLKQQLAKLFEESLRITVPEELDVD  90

Query  475  PMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            P +A C NPKFGDYQCNNAM LW+K+K K TQF
Sbjct  91   PAIAPCQNPKFGDYQCNNAMGLWSKVKGKSTQF  123



>ref|XP_008450791.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Cucumis melo]
Length=645

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAI  489
            LR+ S R  S    T   +STM      VG++K QLAK+F+ SLR T PDE+DV+P++A 
Sbjct  35   LRAASRRLVSATTKTPQSVSTMATEEDNVGNIKRQLAKIFDVSLRTTVPDETDVEPLVAA  94

Query  490  CNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  95   CAG-KFGDYQCNNAMGLWSKIKGKGTQF  121



>ref|XP_004135677.1| PREDICTED: arginine--tRNA ligase, cytoplasmic isoform X2 [Cucumis 
sativus]
 ref|XP_011659959.1| PREDICTED: arginine--tRNA ligase, cytoplasmic isoform X2 [Cucumis 
sativus]
 gb|KGN66189.1| hypothetical protein Csa_1G575050 [Cucumis sativus]
Length=590

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VG++K QLAK+F+ SLRAT PDE+DV+P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  8    VGNIKRQLAKIFDVSLRATVPDETDVEPLVAACAG-KFGDYQCNNAMGLWSKIKGKGTQF  66



>gb|EYU38804.1| hypothetical protein MIMGU_mgv1a003377mg [Erythranthe guttata]
Length=589

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            GS+K+Q+A+LFEESLR T P+E DV P +A C N  FGDYQCNNAM LW+K+K KGTQF
Sbjct  10   GSLKQQIARLFEESLRVTVPEELDVAPAIAPCQNANFGDYQCNNAMGLWSKLKGKGTQF  68



>ref|XP_007012999.1| Arginyl-tRNA synthetase, class Ic isoform 1 [Theobroma cacao]
 gb|EOY30618.1| Arginyl-tRNA synthetase, class Ic isoform 1 [Theobroma cacao]
Length=648

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 60/89 (67%), Gaps = 8/89 (9%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTA-----VGSVKEQLAKLFEESLRATFPDESDVQPMMA  486
            LR TS R     K  +  I+TM       VG+VK QLAKLFE SL+ T P+E DV+P++A
Sbjct  38   LRVTSRRLAWAAKTQS--ITTMATGEDECVGNVKVQLAKLFEASLKVTVPNEPDVEPLVA  95

Query  487  ICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  96   ACTG-KFGDYQCNNAMGLWSKIKGKGTQF  123



>ref|XP_010545317.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Tarenaya hassleriana]
Length=653

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 48/89 (54%), Positives = 60/89 (67%), Gaps = 8/89 (9%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTAV-----GSVKEQLAKLFEESLRATFPDESDVQPMMA  486
            L++TS R     K+   P++TM A      G++K QLAKLFE SL+ T PDE DV+P++A
Sbjct  45   LKATSKRLTLATKIQ--PVATMAAADEENAGNLKRQLAKLFEASLKNTVPDEPDVEPLVA  102

Query  487  ICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             C   KFGDYQCNNAM LW+KIK K T F
Sbjct  103  AC-TAKFGDYQCNNAMGLWSKIKGKATPF  130



>ref|XP_010539378.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X4 
[Tarenaya hassleriana]
Length=620

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 7/94 (7%)
 Frame = +1

Query  304  MSNNGTLRSTSSRFRSVGKVTATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDV  471
            +S    LR+TS R   V      P++TM A     G+VK QLAKLFE SL+ T PDE +V
Sbjct  7    LSKTVLLRATSKRL--VLATKTQPVATMAADEENAGNVKRQLAKLFEASLKLTVPDEPNV  64

Query  472  QPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +P++A C   KFGDYQCNNAM LW+KIK K + F
Sbjct  65   EPLVAAC-TAKFGDYQCNNAMGLWSKIKGKASPF  97



>gb|KDP33781.1| hypothetical protein JCGZ_07352 [Jatropha curcas]
Length=644

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = +1

Query  325  RSTSSRFRSVGKVTATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAIC  492
            R TS R     K  A  ISTMT     VG++K+QLAKLFE SLR T P E D++P++A C
Sbjct  38   RVTSRRLAFATKTQA--ISTMTNTEENVGNLKKQLAKLFEVSLRETVPTEPDIEPLVAAC  95

Query  493  NNPKFGDYQCNNAMSLWAKIKVKGTQF  573
               KFGDYQCNNAMSLWAKIK K T+F
Sbjct  96   T-AKFGDYQCNNAMSLWAKIKGKNTEF  121



>gb|KJB54287.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=652

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 60/89 (67%), Gaps = 8/89 (9%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTAV-----GSVKEQLAKLFEESLRATFPDESDVQPMMA  486
            LR  S R     K  +  I+TM AV     G+VK QLAKLFE SL+ T P+E+DV P++A
Sbjct  43   LRVVSRRLVLATKTQS--ITTMAAVKEECKGNVKAQLAKLFEVSLKVTVPNEADVDPLIA  100

Query  487  ICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  101  ACTG-KFGDYQCNNAMGLWSKIKGKGTQF  128



>ref|XP_010539377.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X3 
[Tarenaya hassleriana]
Length=621

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/95 (52%), Positives = 61/95 (64%), Gaps = 8/95 (8%)
 Frame = +1

Query  304  MSNNGTLRSTSSRFRSVGKVTATPISTMTA-----VGSVKEQLAKLFEESLRATFPDESD  468
            +S    LR+TS R   V      P++TM A      G+VK QLAKLFE SL+ T PDE +
Sbjct  7    LSKTVLLRATSKRL--VLATKTQPVATMAAQDEENAGNVKRQLAKLFEASLKLTVPDEPN  64

Query  469  VQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            V+P++A C   KFGDYQCNNAM LW+KIK K + F
Sbjct  65   VEPLVAAC-TAKFGDYQCNNAMGLWSKIKGKASPF  98



>ref|XP_008450792.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Cucumis melo]
 ref|XP_008450793.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Cucumis melo]
Length=590

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VG++K QLAK+F+ SLR T PDE+DV+P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  8    VGNIKRQLAKIFDVSLRTTVPDETDVEPLVAACAG-KFGDYQCNNAMGLWSKIKGKGTQF  66



>ref|XP_012076843.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Jatropha curcas]
Length=645

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 60/88 (68%), Gaps = 8/88 (9%)
 Frame = +1

Query  325  RSTSSRFRSVGKVTATPISTMTA-----VGSVKEQLAKLFEESLRATFPDESDVQPMMAI  489
            R TS R     K  A  ISTMT      VG++K+QLAKLFE SLR T P E D++P++A 
Sbjct  38   RVTSRRLAFATKTQA--ISTMTNKTEENVGNLKKQLAKLFEVSLRETVPTEPDIEPLVAA  95

Query  490  CNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            C   KFGDYQCNNAMSLWAKIK K T+F
Sbjct  96   CT-AKFGDYQCNNAMSLWAKIKGKNTEF  122



>ref|XP_007013000.1| Arginyl-tRNA synthetase, class Ic isoform 2 [Theobroma cacao]
 gb|EOY30619.1| Arginyl-tRNA synthetase, class Ic isoform 2 [Theobroma cacao]
Length=592

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VG+VK QLAKLFE SL+ T P+E DV+P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  9    VGNVKVQLAKLFEASLKVTVPNEPDVEPLVAACTG-KFGDYQCNNAMGLWSKIKGKGTQF  67



>ref|XP_010049607.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Eucalyptus grandis]
 gb|KCW82308.1| hypothetical protein EUGRSUZ_C03716 [Eucalyptus grandis]
Length=640

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 5/80 (6%)
 Frame = +1

Query  346  RSVGKVTATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGD  513
            RSV  +     +TM +    +G+V++QLAKLFE SLR T P+ESDV+P++A C   KFGD
Sbjct  39   RSVWSIRTQAATTMASDQENIGNVRKQLAKLFETSLRTTVPEESDVEPLVAAC-TAKFGD  97

Query  514  YQCNNAMSLWAKIKVKGTQF  573
            YQCNNAMSLW +IK K T+F
Sbjct  98   YQCNNAMSLWPRIKGKKTEF  117



>gb|KCW82309.1| hypothetical protein EUGRSUZ_C03716 [Eucalyptus grandis]
Length=589

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  379  STMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKV  558
            S    +G+V++QLAKLFE SLR T P+ESDV+P++A C   KFGDYQCNNAMSLW +IK 
Sbjct  3    SDQENIGNVRKQLAKLFETSLRTTVPEESDVEPLVAAC-TAKFGDYQCNNAMSLWPRIKG  61

Query  559  KGTQF  573
            K T+F
Sbjct  62   KKTEF  66



>gb|KJB54289.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=444

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QLAKLFE SL+ T P+E+DV P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  10   GNVKAQLAKLFEVSLKVTVPNEADVDPLIAACTG-KFGDYQCNNAMGLWSKIKGKGTQF  67



>gb|KJB54282.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=675

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTAV-----GSVKEQLAKLFEESLRATFPDESDVQPMMA  486
            LR  S R     K  +  I+TM A      G+VK QLAKLFE SL+ T P+E+DV P++A
Sbjct  66   LRVVSRRLVLATKTQS--ITTMAAQEEECKGNVKAQLAKLFEVSLKVTVPNEADVDPLIA  123

Query  487  ICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  124  ACTG-KFGDYQCNNAMGLWSKIKGKGTQF  151



>gb|KJB54283.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=652

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTAV-----GSVKEQLAKLFEESLRATFPDESDVQPMMA  486
            LR  S R     K  +  I+TM A      G+VK QLAKLFE SL+ T P+E+DV P++A
Sbjct  43   LRVVSRRLVLATKTQS--ITTMAAQEEECKGNVKAQLAKLFEVSLKVTVPNEADVDPLIA  100

Query  487  ICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  101  ACTG-KFGDYQCNNAMGLWSKIKGKGTQF  128



>ref|XP_010244286.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Nelumbo nucifera]
Length=645

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 8/107 (7%)
 Frame = +1

Query  274  IVKASSLENLMSNNGTLRSTSSRFRSVGKVTAT-----PISTMTA--VGSVKEQLAKLFE  432
            +V  + L +L S+   L++  SR R    V+ T      +STM    VG VK+QL+KLFE
Sbjct  17   LVSFNRLSHLHSHPVLLKTDFSRLRPRRLVSTTITASVSVSTMDQEIVGHVKQQLSKLFE  76

Query  433  ESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             SLR T PDE DV+P++  C   KFGDYQCNNAMSL+++IK K TQF
Sbjct  77   ASLRTTVPDELDVEPLVVPCTG-KFGDYQCNNAMSLYSRIKGKTTQF  122



>gb|KJB54285.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=588

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QLAKLFE SL+ T P+E+DV P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  10   GNVKAQLAKLFEVSLKVTVPNEADVDPLIAACTG-KFGDYQCNNAMGLWSKIKGKGTQF  67



>gb|KJB54286.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=590

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QLAKLFE SL+ T P+E+DV P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  10   GNVKAQLAKLFEVSLKVTVPNEADVDPLIAACTG-KFGDYQCNNAMGLWSKIKGKGTQF  67



>gb|KJB54293.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=591

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QLAKLFE SL+ T P+E+DV P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  10   GNVKAQLAKLFEVSLKVTVPNEADVDPLIAACTG-KFGDYQCNNAMGLWSKIKGKGTQF  67



>gb|KJB54284.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=591

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QLAKLFE SL+ T P+E+DV P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  10   GNVKAQLAKLFEVSLKVTVPNEADVDPLIAACTG-KFGDYQCNNAMGLWSKIKGKGTQF  67



>gb|KJB54288.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=505

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QLAKLFE SL+ T P+E+DV P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  10   GNVKAQLAKLFEVSLKVTVPNEADVDPLIAACTG-KFGDYQCNNAMGLWSKIKGKGTQF  67



>ref|XP_010539376.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Tarenaya hassleriana]
Length=646

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 7/88 (8%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAI  489
            LR+TS R   V      P++TM A     G+VK QLAKLFE SL+ T PDE +V+P++A 
Sbjct  39   LRATSKRL--VLATKTQPVATMAADEENAGNVKRQLAKLFEASLKLTVPDEPNVEPLVAA  96

Query  490  CNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            C   KFGDYQCNNAM LW+KIK K + F
Sbjct  97   C-TAKFGDYQCNNAMGLWSKIKGKASPF  123



>ref|XP_010656250.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Vitis vinifera]
Length=646

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 5/71 (7%)
 Frame = +1

Query  361  VTATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNN  528
            ++ T ISTMT      G+VK+QL+KLFE+SLR T P ESDV+P++A C  PKFGDYQCNN
Sbjct  49   ISKTSISTMTNDEENAGTVKKQLSKLFEQSLRITVPSESDVEPLIAAC-APKFGDYQCNN  107

Query  529  AMSLWAKIKVK  561
            AM LW++IK K
Sbjct  108  AMGLWSRIKNK  118



>gb|KJB54290.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
 gb|KJB54292.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=523

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QLAKLFE SL+ T P+E+DV P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  10   GNVKAQLAKLFEVSLKVTVPNEADVDPLIAACTG-KFGDYQCNNAMGLWSKIKGKGTQF  67



>ref|XP_012076844.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Jatropha curcas]
Length=590

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +1

Query  382  TMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVK  561
            T   VG++K+QLAKLFE SLR T P E D++P++A C   KFGDYQCNNAMSLWAKIK K
Sbjct  5    TEENVGNLKKQLAKLFEVSLRETVPTEPDIEPLVAACT-AKFGDYQCNNAMSLWAKIKGK  63

Query  562  GTQF  573
             T+F
Sbjct  64   NTEF  67



>emb|CBI27986.3| unnamed protein product [Vitis vinifera]
Length=691

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 5/71 (7%)
 Frame = +1

Query  361  VTATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNN  528
            ++ T ISTMT      G+VK+QL+KLFE+SLR T P ESDV+P++A C  PKFGDYQCNN
Sbjct  49   ISKTSISTMTNDEENAGTVKKQLSKLFEQSLRITVPSESDVEPLIAAC-APKFGDYQCNN  107

Query  529  AMSLWAKIKVK  561
            AM LW++IK K
Sbjct  108  AMGLWSRIKNK  118



>ref|XP_010539375.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Tarenaya hassleriana]
Length=647

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTA-----VGSVKEQLAKLFEESLRATFPDESDVQPMMA  486
            LR+TS R   V      P++TM A      G+VK QLAKLFE SL+ T PDE +V+P++A
Sbjct  39   LRATSKRL--VLATKTQPVATMAAQDEENAGNVKRQLAKLFEASLKLTVPDEPNVEPLVA  96

Query  487  ICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             C   KFGDYQCNNAM LW+KIK K + F
Sbjct  97   AC-TAKFGDYQCNNAMGLWSKIKGKASPF  124



>gb|KJB54291.1| hypothetical protein B456_009G028100 [Gossypium raimondii]
Length=556

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QLAKLFE SL+ T P+E+DV P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  10   GNVKAQLAKLFEVSLKVTVPNEADVDPLIAACTG-KFGDYQCNNAMGLWSKIKGKGTQF  67



>ref|XP_002514206.1| arginyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF48160.1| arginyl-tRNA synthetase, putative [Ricinus communis]
Length=592

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +1

Query  367  ATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWA  546
            AT       VG++K+Q+AKLFE SLR T P E DV+P++A C   KFGDYQCNNAMSLW+
Sbjct  2    ATNAENEDNVGNLKKQIAKLFEASLRETVPSEPDVEPLVAACT-AKFGDYQCNNAMSLWS  60

Query  547  KIKVKGTQF  573
            KIK K T+F
Sbjct  61   KIKGKNTEF  69



>ref|XP_010438775.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Camelina sativa]
Length=650

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = +1

Query  316  GTLRSTSSRFRSVGKVTATPISTMTAV-----GSVKEQLAKLFEESLRATFPDESDVQPM  480
            G LR T+ RF    +  A  ++TM AV     G++K QLAKLF+ SL+ T PDE  V+P+
Sbjct  39   GKLRVTAWRFAFATR--AKSLATMAAVNEECTGNLKRQLAKLFDVSLKLTVPDEPSVEPL  96

Query  481  MAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +A     KFGDYQCNNAM LW+ IK KGTQF
Sbjct  97   VAASAPGKFGDYQCNNAMGLWSIIKGKGTQF  127



>ref|XP_010448293.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Camelina sativa]
Length=654

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 7/89 (8%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTAV-----GSVKEQLAKLFEESLRATFPDESDVQPMMA  486
            LR+T+ RF    +  A  ++TM AV     G++K QLAKLF+ SL+ T PDE  V+P++A
Sbjct  45   LRATAWRFAFATR--AKSLATMAAVNEECTGNLKRQLAKLFDVSLKVTVPDEPSVEPLVA  102

Query  487  ICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
                 KFGDYQCNNAM LW+ IK KGTQF
Sbjct  103  ASAPGKFGDYQCNNAMGLWSIIKGKGTQF  131



>gb|KHG14519.1| Arginine--tRNA ligase [Gossypium arboreum]
Length=647

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K QLAKLFE SL+ T P+E+DV P++A C   KFGDYQCNNAM LW+KIK KGTQF
Sbjct  66   GNLKAQLAKLFEVSLKVTVPNEADVDPLIAACTG-KFGDYQCNNAMGLWSKIKGKGTQF  123



>gb|KJB27169.1| hypothetical protein B456_004G282200 [Gossypium raimondii]
 gb|KJB27170.1| hypothetical protein B456_004G282200 [Gossypium raimondii]
 gb|KJB27171.1| hypothetical protein B456_004G282200 [Gossypium raimondii]
Length=592

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +GS+K QLAKLFE SL+ T P+E DV+P++A CN  KFGDYQCNNAM LW+KIK KG  F
Sbjct  9    MGSLKAQLAKLFEVSLKVTVPNELDVEPLVAACNG-KFGDYQCNNAMGLWSKIKGKGAPF  67



>gb|KHG26458.1| Arginine--tRNA ligase [Gossypium arboreum]
Length=592

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +GS+K QLAKLFE SL+ T P+E DV+P++A CN  KFGDYQCNNAM LW+KIK KG  F
Sbjct  9    MGSLKAQLAKLFEVSLKVTVPNELDVEPLVAACNG-KFGDYQCNNAMGLWSKIKGKGAPF  67



>ref|XP_006413208.1| hypothetical protein EUTSA_v10024637mg [Eutrema salsugineum]
 gb|ESQ54661.1| hypothetical protein EUTSA_v10024637mg [Eutrema salsugineum]
Length=652

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 9/107 (8%)
 Frame = +1

Query  265  HHQIVKASSLENLMSNNGTLRSTSSRFRSVGKVTATPISTMTA----VGSVKEQLAKLFE  432
            +HQ    SS     S  G LR+TS RF     + +  ++TM A     G+ K QL KLF+
Sbjct  28   YHQFAYLSSYS---SQTGILRATSRRFAFA--IKSKSVATMAANEEFTGNPKRQLEKLFD  82

Query  433  ESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             SL+ T P+E  V P++A     KFGDYQCNNAM LW+ IK KGTQF
Sbjct  83   VSLKLTVPNEPGVAPLVAASQPGKFGDYQCNNAMGLWSIIKGKGTQF  129



>ref|XP_010688348.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=648

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 62/89 (70%), Gaps = 8/89 (9%)
 Frame = +1

Query  316  GTLRSTSSRFRSVGKVTATPISTMT---AVGSVKEQLAKLFEESLRATFPDESDVQPMMA  486
            G LRST  R   VG V A  +STM      G++K+QLAK+FE SLRAT P E+DV+P++A
Sbjct  42   GFLRSTYKRLNIVGGVRA--LSTMADEGGGGNLKQQLAKVFEISLRATVPSEADVEPLIA  99

Query  487  ICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
                 KFGDYQCNNAMSL++KIK K  +F
Sbjct  100  ---PGKFGDYQCNNAMSLFSKIKGKNAEF  125



>ref|XP_010656251.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Vitis vinifera]
Length=590

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVK  561
            G+VK+QL+KLFE+SLR T P ESDV+P++A C  PKFGDYQCNNAM LW++IK K
Sbjct  9    GTVKKQLSKLFEQSLRITVPSESDVEPLIAAC-APKFGDYQCNNAMGLWSRIKNK  62



>ref|XP_010244295.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010244302.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010244311.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Nelumbo nucifera]
Length=587

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VG VK+QL+KLFE SLR T PDE DV+P++  C   KFGDYQCNNAMSL+++IK K TQF
Sbjct  6    VGHVKQQLSKLFEASLRTTVPDELDVEPLVVPCTG-KFGDYQCNNAMSLYSRIKGKTTQF  64



>ref|XP_008242476.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Prunus mume]
Length=649

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 5/70 (7%)
 Frame = +1

Query  376  ISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLW  543
            +STM      VG+VK QLAKLFE SLR   PDE +V+P++  C   KFGDYQCNNAM LW
Sbjct  57   VSTMATEEENVGNVKRQLAKLFEVSLRTIVPDEPEVEPVVVACAG-KFGDYQCNNAMGLW  115

Query  544  AKIKVKGTQF  573
            +KIK KGT F
Sbjct  116  SKIKGKGTDF  125



>ref|XP_008242477.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Prunus mume]
Length=590

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VG+VK QLAKLFE SLR   PDE +V+P++  C   KFGDYQCNNAM LW+KIK KGT F
Sbjct  8    VGNVKRQLAKLFEVSLRTIVPDEPEVEPVVVACAG-KFGDYQCNNAMGLWSKIKGKGTDF  66



>ref|XP_007204586.1| hypothetical protein PRUPE_ppa003237mg [Prunus persica]
 gb|EMJ05785.1| hypothetical protein PRUPE_ppa003237mg [Prunus persica]
Length=590

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VG+VK QLAKLFE SLR   PDE +V+P++  C   KFGDYQCNNAM LW+KIK KGT F
Sbjct  8    VGNVKRQLAKLFEVSLRTIVPDEPEVEPVVVACAG-KFGDYQCNNAMGLWSKIKGKGTDF  66



>ref|XP_010545318.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Tarenaya hassleriana]
Length=590

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K QLAKLFE SL+ T PDE DV+P++A C   KFGDYQCNNAM LW+KIK K T F
Sbjct  10   GNLKRQLAKLFEASLKNTVPDEPDVEPLVAAC-TAKFGDYQCNNAMGLWSKIKGKATPF  67



>gb|KDO66604.1| hypothetical protein CISIN_1g007251mg [Citrus sinensis]
Length=611

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 4/87 (5%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTA---VGSVKEQLAKLFEESLRATFPDESDVQPMMAIC  492
            LR+T+ R       T +  S  T     G+VK +L K+F+ +L+AT P+E+DV+P++A C
Sbjct  37   LRATTRRLALAATKTRSITSMATEEENTGNVKRELEKVFDLALKATVPNETDVRPLIAAC  96

Query  493  NNPKFGDYQCNNAMSLWAKIKVKGTQF  573
               KFGDYQCNNAM LW+KIK KGT+F
Sbjct  97   T-AKFGDYQCNNAMGLWSKIKGKGTEF  122



>emb|CDY42746.1| BnaA03g47930D [Brassica napus]
Length=648

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 10/107 (9%)
 Frame = +1

Query  265  HHQIVKASSLENLMSNNGTLRSTSSRFRSVGKVTATPISTMTAV----GSVKEQLAKLFE  432
            HH     +SL +  S +G LR+T+ RF  V K  +  ++TM AV    G++K Q+ KLF+
Sbjct  25   HH----LASLSSPYSPSGVLRATAKRFTFVTK--SKSVTTMAAVQDCPGNLKRQVEKLFD  78

Query  433  ESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             SLR+T PDE+ VQ  +      K GDYQCNNAM LW+ IK KGTQF
Sbjct  79   ASLRSTVPDETGVQTEVTASLPGKPGDYQCNNAMGLWSIIKGKGTQF  125



>ref|XP_010110873.1| Arginine--tRNA ligase [Morus notabilis]
 gb|EXC28692.1| Arginine--tRNA ligase [Morus notabilis]
Length=564

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QL KLFE SLR T PDE DV+P++A C   KFGDYQCNNAM LW+K++ K T+F
Sbjct  10   GNVKRQLGKLFETSLRTTVPDEPDVEPLIAAC-TAKFGDYQCNNAMGLWSKMRGKSTKF  67



>ref|NP_194360.1| Arginyl-tRNA synthetase, class Ic [Arabidopsis thaliana]
 emb|CAB11468.1| arginyl-tRNA synthetase [Arabidopsis thaliana]
 emb|CAB38959.1| arginyl-tRNA synthetase [Arabidopsis thaliana]
 emb|CAB79485.1| arginyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AEE85182.1| Arginyl-tRNA synthetase, class Ic [Arabidopsis thaliana]
Length=642

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = +1

Query  322  LRSTSSRF--RSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICN  495
            LR+T+ RF   S  K      +     G++K QLAKLF+ SL+ T PDE  V+P++A   
Sbjct  34   LRATAWRFAFSSRAKSVVAMAANEEFTGNLKRQLAKLFDVSLKLTVPDEPSVEPLVAASA  93

Query  496  NPKFGDYQCNNAMSLWAKIKVKGTQF  573
              KFGDYQCNNAM LW+ IK KGTQF
Sbjct  94   LGKFGDYQCNNAMGLWSIIKGKGTQF  119



>ref|XP_006283292.1| hypothetical protein CARUB_v10004329mg [Capsella rubella]
 gb|EOA16190.1| hypothetical protein CARUB_v10004329mg [Capsella rubella]
Length=652

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%), Gaps = 6/88 (7%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAI  489
            LR+T+ RF    +  A  ++TM A     G++K QLAKLF+ +L+ T PDE  V+P++A 
Sbjct  44   LRATAWRFAFATR--AKSVATMAANEECTGNLKRQLAKLFDVALKLTVPDEPSVEPLVAA  101

Query  490  CNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             +  KFGDYQCNNAM LW+ IK KGT F
Sbjct  102  SDAGKFGDYQCNNAMGLWSIIKGKGTPF  129



>gb|AHF48762.1| arginyl-tRNA synthetase [Canavalia brasiliensis]
Length=595

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAIC---NNPKFGDYQCNNAMSLWAKIKVKGT  567
             SVK+QLAKLFE SLRAT PDE DV P++  C   +  KF DYQCNNAMSLWAKIK K T
Sbjct  9    ASVKKQLAKLFEVSLRATVPDEPDVAPLVDACAAKSGVKFADYQCNNAMSLWAKIKGKQT  68

Query  568  QF  573
             F
Sbjct  69   GF  70



>emb|CAQ34913.1| arginyl-tRNA synthetase [Canavalia ensiformis]
Length=595

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAIC---NNPKFGDYQCNNAMSLWAKIKVKGT  567
             SVK+QLAKLFE SLRAT PDE DV P++  C   +  KF DYQCNNAMSLWAKIK K T
Sbjct  9    ASVKKQLAKLFEVSLRATVPDEPDVAPLVDACAAKSGVKFADYQCNNAMSLWAKIKGKQT  68

Query  568  QF  573
             F
Sbjct  69   GF  70



>ref|XP_009137585.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Brassica rapa]
Length=648

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 10/107 (9%)
 Frame = +1

Query  265  HHQIVKASSLENLMSNNGTLRSTSSRFRSVGKVTATPISTMTAV----GSVKEQLAKLFE  432
            HH     +SL +  S +G LR+T+ RF  V K  +  ++TM A     G++K Q+ KLF+
Sbjct  25   HH----LASLSSPYSPSGVLRATAKRFTFVTK--SKSVTTMAAAQEYPGNLKRQVEKLFD  78

Query  433  ESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             SLR+T PDE+ VQ  +      K GDYQCNNAM LW+ IK KGTQF
Sbjct  79   ASLRSTVPDETGVQTEVTASLPGKPGDYQCNNAMGLWSIIKGKGTQF  125



>ref|XP_010539382.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X6 
[Tarenaya hassleriana]
 ref|XP_010539383.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X6 
[Tarenaya hassleriana]
Length=589

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QLAKLFE SL+ T PDE +V+P++A C   KFGDYQCNNAM LW+KIK K + F
Sbjct  9    GNVKRQLAKLFEASLKLTVPDEPNVEPLVAAC-TAKFGDYQCNNAMGLWSKIKGKASPF  66



>ref|XP_010539379.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X5 
[Tarenaya hassleriana]
 ref|XP_010539381.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X5 
[Tarenaya hassleriana]
Length=590

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK QLAKLFE SL+ T PDE +V+P++A C   KFGDYQCNNAM LW+KIK K + F
Sbjct  10   GNVKRQLAKLFEASLKLTVPDEPNVEPLVAAC-TAKFGDYQCNNAMGLWSKIKGKASPF  67



>gb|KDO66609.1| hypothetical protein CISIN_1g007251mg [Citrus sinensis]
Length=426

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK +L K+F+ +L+AT P+E+DV+P++A C   KFGDYQCNNAM LW+KIK KGT+F
Sbjct  9    GNVKRELEKVFDLALKATVPNETDVRPLIAACT-AKFGDYQCNNAMGLWSKIKGKGTEF  66



>ref|XP_008337668.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Malus domestica]
Length=628

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VG+ K+QLAKLFE SLR   PDE DV P++A  +  KFGDYQCNNAM LW+KIK KG++F
Sbjct  8    VGNAKQQLAKLFEVSLRRIVPDEQDVAPVIA-ASTGKFGDYQCNNAMGLWSKIKGKGSEF  66



>ref|XP_008789113.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Phoenix dactylifera]
Length=586

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            GSVK+QL++LF+ SL AT PDE +++P++ +C   KFGDYQCNNAM LW++IK K T+F
Sbjct  24   GSVKQQLSRLFKASLSATVPDEPNIEPLVEVCT-AKFGDYQCNNAMGLWSRIKGKSTEF  81



>ref|XP_006572930.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Glycine max]
Length=651

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 60/98 (61%), Gaps = 14/98 (14%)
 Frame = +1

Query  322  LRSTSSRFR-SVGKVTATPI----STMTAV------GSVKEQLAKLFEESLRATFPDESD  468
            L+  S RF  SV K   +P+    ST TA+       SVK QLA+LF+ SLRAT PDE D
Sbjct  29   LKVASRRFALSVTKTQQSPVTKPQSTSTAIIEIDNPASVKRQLAQLFDLSLRATVPDEPD  88

Query  469  VQPMMAIC---NNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            V P++  C      KFGDYQCNNAM +W+K+K K T F
Sbjct  89   VVPLIDACAVKGGVKFGDYQCNNAMGIWSKMKGKQTGF  126



>ref|XP_009352570.1| PREDICTED: probable arginine--tRNA ligase, cytoplasmic isoform 
X3 [Pyrus x bretschneideri]
Length=557

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 5/70 (7%)
 Frame = +1

Query  376  ISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLW  543
            +STM      VG+ ++QLAKLFE SLR   PDE DV P++A  +  KFGDYQCNNAM LW
Sbjct  50   VSTMATEEENVGNARQQLAKLFEVSLRRIVPDEQDVAPVIA-ASTGKFGDYQCNNAMGLW  108

Query  544  AKIKVKGTQF  573
            +KIK KG++F
Sbjct  109  SKIKGKGSEF  118



>ref|XP_010433522.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Camelina sativa]
Length=654

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 7/91 (8%)
 Frame = +1

Query  316  GTLRSTSSRFRSVGKVTATPISTMTAV-----GSVKEQLAKLFEESLRATFPDESDVQPM  480
            G LR+T+ RF    +  A  ++TM AV     G++K QLAKLF+ SL+ T P E  V+P+
Sbjct  43   GKLRATAWRFAFATR--AKSLATMAAVNEECTGNLKRQLAKLFDVSLKLTVPGEPSVEPL  100

Query  481  MAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +A     KF DYQCNNAM LW+ IK KGTQF
Sbjct  101  VAASAPGKFEDYQCNNAMGLWSIIKGKGTQF  131



>emb|CDY69546.1| BnaCnng64110D, partial [Brassica napus]
Length=398

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 6/93 (6%)
 Frame = +1

Query  307  SNNGTLRSTSSRFRSVGKVTATPISTMTAV----GSVKEQLAKLFEESLRATFPDESDVQ  474
            S +G LR+T+ RF  V K  +  ++TM AV    G++K Q+ KLF+ SLR+T PDE+ V+
Sbjct  32   SPSGVLRATAKRFTFVTK--SKSVTTMAAVQEYPGNLKRQVEKLFDASLRSTVPDETGVE  89

Query  475  PMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
              +      K GDYQCNNAM LW+ IK KGTQF
Sbjct  90   TEVTASLPGKPGDYQCNNAMGLWSIIKGKGTQF  122



>gb|KDO66608.1| hypothetical protein CISIN_1g007251mg [Citrus sinensis]
Length=519

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK +L K+F+ +L+AT P+E+DV+P++A C   KFGDYQCNNAM LW+KIK KGT+F
Sbjct  9    GNVKRELEKVFDLALKATVPNETDVRPLIAACT-AKFGDYQCNNAMGLWSKIKGKGTEF  66



>gb|KDO66605.1| hypothetical protein CISIN_1g007251mg [Citrus sinensis]
 gb|KDO66606.1| hypothetical protein CISIN_1g007251mg [Citrus sinensis]
Length=555

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK +L K+F+ +L+AT P+E+DV+P++A C   KFGDYQCNNAM LW+KIK KGT+F
Sbjct  9    GNVKRELEKVFDLALKATVPNETDVRPLIAACT-AKFGDYQCNNAMGLWSKIKGKGTEF  66



>gb|KDO66607.1| hypothetical protein CISIN_1g007251mg [Citrus sinensis]
Length=499

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK +L K+F+ +L+AT P+E+DV+P++A C   KFGDYQCNNAM LW+KIK KGT+F
Sbjct  9    GNVKRELEKVFDLALKATVPNETDVRPLIAACT-AKFGDYQCNNAMGLWSKIKGKGTEF  66



>emb|CDP03242.1| unnamed protein product [Coffea canephora]
Length=648

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 48/107 (45%), Positives = 66/107 (62%), Gaps = 12/107 (11%)
 Frame = +1

Query  286  SSLENLMSN---------NGTLRSTSSRFRSVGKV--TATPISTMTAVGSVKEQLAKLFE  432
            SSL+N + +          G LR T+SR  SV K+   ++    M  VGSVK+QL +LF 
Sbjct  20   SSLQNSLKSLLISPTFQPTGILR-TASRPFSVAKLQSVSSMAEVMERVGSVKQQLQRLFG  78

Query  433  ESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            E+ R  FPDE D+ P++  C + + GDYQCNNAMSL+AKIK +  +F
Sbjct  79   EAFRDKFPDELDIVPIITPCKDLRHGDYQCNNAMSLFAKIKGRVPEF  125



>ref|XP_007152961.1| hypothetical protein PHAVU_004G174700g [Phaseolus vulgaris]
 gb|ESW24955.1| hypothetical protein PHAVU_004G174700g [Phaseolus vulgaris]
Length=653

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 62/103 (60%), Gaps = 14/103 (14%)
 Frame = +1

Query  307  SNNGTLRSTSSRFR-SVGKVTATPI----STMTAV------GSVKEQLAKLFEESLRATF  453
            S +  L+  S RF  SV K   +P+    ST TAV       SVK QLA+LFE SLRAT 
Sbjct  26   SRSDLLKIASRRFALSVTKTQQSPVTKPQSTSTAVTEIDNPASVKRQLAQLFELSLRATV  85

Query  454  PDESDVQPMMAIC---NNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            PDE DV P++  C      KFGDYQCNNAM +W+K+K K T F
Sbjct  86   PDEPDVVPLVDACAVKGGVKFGDYQCNNAMGVWSKVKGKQTGF  128



>ref|XP_009352566.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Pyrus x bretschneideri]
Length=638

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 5/70 (7%)
 Frame = +1

Query  376  ISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLW  543
            +STM      VG+ ++QLAKLFE SLR   PDE DV P++A  +  KFGDYQCNNAM LW
Sbjct  50   VSTMATEEENVGNARQQLAKLFEVSLRRIVPDEQDVAPVIA-ASTGKFGDYQCNNAMGLW  108

Query  544  AKIKVKGTQF  573
            +KIK KG++F
Sbjct  109  SKIKGKGSEF  118



>ref|XP_009352567.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009352568.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Pyrus x bretschneideri]
Length=586

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            VG+ ++QLAKLFE SLR   PDE DV P++A  +  KFGDYQCNNAM LW+KIK KG++F
Sbjct  8    VGNARQQLAKLFEVSLRRIVPDEQDVAPVIA-ASTGKFGDYQCNNAMGLWSKIKGKGSEF  66



>ref|XP_001759769.1| predicted protein [Physcomitrella patens]
 gb|EDQ75273.1| predicted protein [Physcomitrella patens]
Length=606

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  391  AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
             +GSV++Q+  L  E+L  T PD  D++P +A+C NPK GDYQCNNAM +W+KIK K T 
Sbjct  25   GIGSVRQQVVNLVREALATTVPDVEDIEPQVAVCGNPKNGDYQCNNAMGIWSKIKGKNTS  84

Query  571  F  573
            F
Sbjct  85   F  85



>ref|XP_010937860.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Elaeis guineensis]
Length=609

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            GSVK+QL+KLF+ SL AT PDE +++P++ +C   KFGDYQCNNAM LW++IK K  +F
Sbjct  24   GSVKQQLSKLFKASLSATVPDEPNIEPLVEVC-TAKFGDYQCNNAMGLWSRIKGKSKEF  81



>ref|XP_010448294.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Camelina sativa]
Length=591

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K QLAKLF+ SL+ T PDE  V+P++A     KFGDYQCNNAM LW+ IK KGTQF
Sbjct  10   GNLKRQLAKLFDVSLKVTVPDEPSVEPLVAASAPGKFGDYQCNNAMGLWSIIKGKGTQF  68



>gb|KHN39952.1| Arginine--tRNA ligase, cytoplasmic [Glycine soja]
Length=655

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 49/102 (48%), Positives = 60/102 (59%), Gaps = 18/102 (18%)
 Frame = +1

Query  322  LRSTSSRFR-SVGKVTATPI----STMTAV----------GSVKEQLAKLFEESLRATFP  456
            L+  S RF  SV K   +P+    ST TA+           SVK QLA+LF+ SLRAT P
Sbjct  29   LKVASRRFALSVTKTQQSPVTKPQSTSTAIIATANEIDNPASVKRQLAQLFDLSLRATVP  88

Query  457  DESDVQPMMAIC---NNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            DE DV P++  C      KFGDYQCNNAM +W+K+K K T F
Sbjct  89   DEPDVVPLIDACAVKGGVKFGDYQCNNAMGIWSKMKGKQTGF  130



>ref|XP_008789112.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Phoenix dactylifera]
Length=635

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (59%), Gaps = 18/107 (17%)
 Frame = +1

Query  304  MSNNGTLRSTSSRFRSVGKVT-----------ATPISTMTA------VGSVKEQLAKLFE  432
            ++ +G  R+ S RF +  K             + P+    A       GSVK+QL++LF+
Sbjct  25   LAPSGYYRAASRRFLATKKTELPSAMSGDASGSAPLQGQAAEDGGDRAGSVKQQLSRLFK  84

Query  433  ESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             SL AT PDE +++P++ +C   KFGDYQCNNAM LW++IK K T+F
Sbjct  85   ASLSATVPDEPNIEPLVEVCT-AKFGDYQCNNAMGLWSRIKGKSTEF  130



>ref|XP_008789026.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008789032.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Phoenix dactylifera]
Length=618

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 62/107 (58%), Gaps = 18/107 (17%)
 Frame = +1

Query  304  MSNNGTLRSTSSRFRSVGKV-----------TATPISTMTA------VGSVKEQLAKLFE  432
             +  G  R+ S RF +  K            ++ P+    A       GSVK+QL++LF+
Sbjct  8    FAKTGYYRAPSRRFLATKKTELPLAMSGDASSSAPLQGQAAKDGGDRAGSVKQQLSRLFK  67

Query  433  ESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
             SL AT PDE +++P++ +C   KFGDYQCNNAM LW++IK K T+F
Sbjct  68   ASLSATVPDEPNIEPLVEVCT-AKFGDYQCNNAMGLWSRIKGKSTEF  113



>ref|XP_010438776.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Camelina sativa]
Length=591

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K QLAKLF+ SL+ T PDE  V+P++A     KFGDYQCNNAM LW+ IK KGTQF
Sbjct  10   GNLKRQLAKLFDVSLKLTVPDEPSVEPLVAASAPGKFGDYQCNNAMGLWSIIKGKGTQF  68



>gb|EPS67056.1| hypothetical protein M569_07720, partial [Genlisea aurea]
Length=180

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +1

Query  391  AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            AV S+K+Q+AKLFEESL+ T P+ES V P++  C N +FGDYQCNNAM LW+KIK
Sbjct  7    AVRSLKKQIAKLFEESLKVTVPEES-VDPVVEPCQNTRFGDYQCNNAMGLWSKIK  60



>ref|XP_008789042.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Phoenix dactylifera]
 ref|XP_008789050.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Phoenix dactylifera]
Length=586

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            GSVK+QL++LF+ SL AT PDE +++P++ +C   KFGDYQCNNAM LW++IK K T+F
Sbjct  24   GSVKQQLSRLFKASLSATVPDEPNIEPLVEVCT-AKFGDYQCNNAMGLWSRIKGKSTEF  81



>ref|XP_008789059.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X3 
[Phoenix dactylifera]
 ref|XP_008789067.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X3 
[Phoenix dactylifera]
Length=578

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            GSVK+QL++LF+ SL AT PDE +++P++ +C   KFGDYQCNNAM LW++IK K T+F
Sbjct  16   GSVKQQLSRLFKASLSATVPDEPNIEPLVEVCT-AKFGDYQCNNAMGLWSRIKGKSTEF  73



>ref|XP_006451326.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
 gb|ESR64566.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
Length=575

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 62/91 (68%), Gaps = 12/91 (13%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTAV-------GSVKEQLAKLFEESLRATFPDESDVQPM  480
            LR+T+ R      + AT   ++T++       G+VK +L K+F+ +L+AT  +E+DV+P+
Sbjct  37   LRATTRRL----ALAATKTRSITSMANEEENTGNVKRELEKVFDLALKATVRNETDVRPL  92

Query  481  MAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +A C   KFGDYQCNNAM LW+KIK KGT+F
Sbjct  93   IAACT-AKFGDYQCNNAMGLWSKIKGKGTEF  122



>ref|XP_006475596.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X4 
[Citrus sinensis]
Length=555

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 62/91 (68%), Gaps = 12/91 (13%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTAV-------GSVKEQLAKLFEESLRATFPDESDVQPM  480
            LR+T+ R      + AT   ++T++       G+VK +L K+F+ +L+AT  +E+DV+P+
Sbjct  37   LRATTRRL----ALAATKTRSITSMANEEENTGNVKRELEKVFDLALKATVRNETDVRPL  92

Query  481  MAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +A C   KFGDYQCNNAM LW+KIK KGT+F
Sbjct  93   IAACT-AKFGDYQCNNAMGLWSKIKGKGTEF  122



>emb|CAB11469.1| arginyl-tRNA synthetase [Arabidopsis thaliana]
Length=590

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K QLAKLF+ SL+ T PDE  V+P++A     KFGDYQCNNAM LW+ IK KGTQF
Sbjct  9    GNLKRQLAKLFDVSLKLTVPDEPSVEPLVAASALGKFGDYQCNNAMGLWSIIKGKGTQF  67



>ref|XP_002867571.1| arginyl-tRNA synthetase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43830.1| arginyl-tRNA synthetase [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K QLAKLF+ SL+ T PDE  V+P++A     KFGDYQCNNAM LW+ IK KGTQF
Sbjct  9    GNLKRQLAKLFDVSLKLTVPDEPSVEPLVAASALGKFGDYQCNNAMGLWSIIKGKGTQF  67



>ref|XP_006451330.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
 ref|XP_006475593.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Citrus sinensis]
 gb|ESR64570.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
Length=645

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 62/91 (68%), Gaps = 12/91 (13%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTAV-------GSVKEQLAKLFEESLRATFPDESDVQPM  480
            LR+T+ R      + AT   ++T++       G+VK +L K+F+ +L+AT  +E+DV+P+
Sbjct  37   LRATTRRL----ALAATKTRSITSMANEEENTGNVKRELEKVFDLALKATVRNETDVRPL  92

Query  481  MAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +A C   KFGDYQCNNAM LW+KIK KGT+F
Sbjct  93   IAACT-AKFGDYQCNNAMGLWSKIKGKGTEF  122



>ref|XP_010937859.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Elaeis guineensis]
Length=658

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            GSVK+QL+KLF+ SL AT PDE +++P++ +C   KFGDYQCNNAM LW++IK K  +F
Sbjct  73   GSVKQQLSKLFKASLSATVPDEPNIEPLVEVC-TAKFGDYQCNNAMGLWSRIKGKSKEF  130



>gb|AHF48761.1| arginyl-tRNA synthetase [Dioclea megacarpa]
Length=595

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAIC---NNPKFGDYQCNNAMSLWAKIKVKGT  567
             SVK+ LAKLFE SLRAT PDE DV P++  C   +  KF DYQCNNAMSLW+KIK K T
Sbjct  9    ASVKKLLAKLFEVSLRATVPDEPDVAPLVDACAAKSGVKFADYQCNNAMSLWSKIKGKQT  68

Query  568  QF  573
             F
Sbjct  69   GF  70



>ref|XP_006451324.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
 ref|XP_006451325.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
 gb|ESR64564.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
 gb|ESR64565.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
Length=519

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK +L K+F+ +L+AT  +E+DV+P++A C   KFGDYQCNNAM LW+KIK KGT+F
Sbjct  9    GNVKRELEKVFDLALKATVRNETDVRPLIAACT-AKFGDYQCNNAMGLWSKIKGKGTEF  66



>ref|XP_006451327.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
 ref|XP_006451328.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
 ref|XP_006451329.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
 ref|XP_006475594.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Citrus sinensis]
 ref|XP_006475595.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X3 
[Citrus sinensis]
 gb|ESR64567.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
 gb|ESR64568.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
 gb|ESR64569.1| hypothetical protein CICLE_v10007707mg [Citrus clementina]
Length=589

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK +L K+F+ +L+AT  +E+DV+P++A C   KFGDYQCNNAM LW+KIK KGT+F
Sbjct  9    GNVKRELEKVFDLALKATVRNETDVRPLIAACT-AKFGDYQCNNAMGLWSKIKGKGTEF  66



>ref|XP_006283291.1| hypothetical protein CARUB_v10004329mg [Capsella rubella]
 gb|EOA16189.1| hypothetical protein CARUB_v10004329mg [Capsella rubella]
Length=590

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K QLAKLF+ +L+ T PDE  V+P++A  +  KFGDYQCNNAM LW+ IK KGT F
Sbjct  9    GNLKRQLAKLFDVALKLTVPDEPSVEPLVAASDAGKFGDYQCNNAMGLWSIIKGKGTPF  67



>ref|XP_011014624.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Populus euphratica]
Length=644

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = +1

Query  328  STSSRFRSVGKVTATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAICN  495
            +  SR        A  ISTM A     G++K +LAKLF+ SL AT P E D++P++A C 
Sbjct  36   AAKSRRLPFAATKAPSISTMAAEQENTGNLKRKLAKLFQLSLEATVPGEPDIEPLVAAC-  94

Query  496  NPKFGDYQCNNAMSLWAKIKVK-GTQF  573
              KFGDYQCNNAM LW+KIK + G +F
Sbjct  95   TAKFGDYQCNNAMGLWSKIKGRPGIEF  121



>ref|XP_010688350.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=586

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 3/59 (5%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K+QLAK+FE SLRAT P E+DV+P++A     KFGDYQCNNAMSL++KIK K  +F
Sbjct  8    GNLKQQLAKVFEISLRATVPSEADVEPLIA---PGKFGDYQCNNAMSLFSKIKGKNAEF  63



>ref|XP_002888519.1| hypothetical protein ARALYDRAFT_475759 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64778.1| hypothetical protein ARALYDRAFT_475759 [Arabidopsis lyrata subsp. 
lyrata]
Length=590

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +1

Query  367  ATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWA  546
            AT ++     G+ + QLAKLFE SL+ T PDE +V+P++      KFGDYQCNNAM LW+
Sbjct  2    ATIVANKEFTGNPRRQLAKLFEVSLKLTVPDEPNVEPLI---EPGKFGDYQCNNAMGLWS  58

Query  547  KIKVKGTQF  573
             IK KGTQF
Sbjct  59   FIKGKGTQF  67



>ref|XP_003620789.1| Arginyl-tRNA synthetase [Medicago truncatula]
Length=183

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAIC----NNPKFGDYQCNNAMSLWAKIKVKG  564
             SVK QLA+LF+ SL+   PDE DV P++ +C     + KFGDYQCNNAM +W+K+K K 
Sbjct  72   ASVKRQLAQLFDVSLKTIVPDEEDVVPLVDVCTAKTGSVKFGDYQCNNAMGIWSKLKGKE  131

Query  565  TQF  573
            T F
Sbjct  132  TGF  134



>emb|CAB11467.1| arginyl-tRNA synthetase [Arabidopsis thaliana]
Length=589

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +1

Query  367  ATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWA  546
            AT +++    G+ + QLAKLF+ SL+ T PDE +V+P++      KFGDYQCNNAM LW+
Sbjct  2    ATIVASKEFTGNPRRQLAKLFDVSLKLTVPDEPNVEPLI---EPGKFGDYQCNNAMGLWS  58

Query  547  KIKVKGTQF  573
             IK KGTQF
Sbjct  59   LIKGKGTQF  67



>ref|NP_176826.1| arginyl-tRNA synthetase, class Ic [Arabidopsis thaliana]
 gb|AAG51163.1|AC074025_13 arginyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AAK53017.1|AF375433_1 At1g66530/F28G11_14 [Arabidopsis thaliana]
 gb|AAM16217.1| At1g66530/F28G11_14 [Arabidopsis thaliana]
 gb|AEE34521.1| arginyl-tRNA synthetase, class Ic [Arabidopsis thaliana]
Length=590

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +1

Query  367  ATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWA  546
            AT +++    G+ + QLAKLF+ SL+ T PDE +V+P++      KFGDYQCNNAM LW+
Sbjct  2    ATIVASKEFTGNPRRQLAKLFDVSLKLTVPDEPNVEPLI---EPGKFGDYQCNNAMGLWS  58

Query  547  KIKVKGTQF  573
             IK KGTQF
Sbjct  59   LIKGKGTQF  67



>ref|XP_006301131.1| hypothetical protein CARUB_v10021527mg [Capsella rubella]
 gb|EOA34029.1| hypothetical protein CARUB_v10021527mg [Capsella rubella]
Length=579

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +1

Query  367  ATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWA  546
            AT +++    G+ + QLAKLF  SL+ T PDE DV+P++      KFGDYQCNNAM LW+
Sbjct  2    ATVVASEAFTGNPRRQLAKLFSVSLKLTVPDEPDVEPLV---EPGKFGDYQCNNAMGLWS  58

Query  547  KIKVKGTQF  573
             IK KGT+F
Sbjct  59   IIKGKGTEF  67



>ref|XP_002882847.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59106.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=579

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 3/59 (5%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K+QL KLF+ SL+ T PDE  V+P++ +    KF DYQCNNAM LW+K+K KGTQF
Sbjct  10   GNLKQQLVKLFDASLKLTVPDEPSVKPLVVV---GKFEDYQCNNAMGLWSKVKGKGTQF  65



>ref|XP_002883789.1| hypothetical protein ARALYDRAFT_480296 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60048.1| hypothetical protein ARALYDRAFT_480296 [Arabidopsis lyrata subsp. 
lyrata]
Length=590

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +1

Query  367  ATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWA  546
            AT ++     G+ + QLAKLF+ SL+ T PDE +V+P++      KFGDYQCNNAM LW+
Sbjct  2    ATIVANKEFTGNPRRQLAKLFDVSLKLTVPDEPNVEPLI---EPGKFGDYQCNNAMGLWS  58

Query  547  KIKVKGTQF  573
             IK KGTQF
Sbjct  59   IIKGKGTQF  67



>ref|XP_002301499.1| arginyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE80772.1| arginyl-tRNA synthetase family protein [Populus trichocarpa]
Length=590

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVK-GTQF  573
            G++K++LAKLF+ SL AT P E D++P++A C   KFGDYQCNNAM LW+KIK + G +F
Sbjct  9    GNLKQKLAKLFQLSLEATVPGEPDIEPLVAAC-TAKFGDYQCNNAMGLWSKIKGRPGIEF  67



>ref|XP_010465248.1| PREDICTED: probable arginine--tRNA ligase, cytoplasmic [Camelina 
sativa]
Length=588

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +G++K+QL KLF+ SL+ T PDE  V+P++ +    KF DYQCNNAM LW+K+K KGTQF
Sbjct  11   MGNLKQQLIKLFDASLKLTVPDEPSVKPLVEV---GKFEDYQCNNAMGLWSKVKGKGTQF  67



>ref|XP_009142147.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Brassica rapa]
Length=642

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +1

Query  307  SNNGTLRSTSSR--FRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPM  480
            S +G LR+TS R  F +  K  AT  ++    G++K ++ KLF+ SLR T PD + V+  
Sbjct  29   SLSGVLRATSRRLAFATRSKSVATMAASQEFTGNLKREVEKLFDASLRITVPDGTSVETE  88

Query  481  MAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +A     K GDYQCNNAM LW+ IK KGTQF
Sbjct  89   VAASLPGKPGDYQCNNAMGLWSVIKGKGTQF  119



>ref|XP_010415196.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=590

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +1

Query  367  ATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWA  546
            AT ++     G+ + QLAKLF  SL+ T PDE  V+P++      KFGDYQCNNAM LW+
Sbjct  2    ATMVANEAFTGNPRRQLAKLFSVSLKLTVPDEPGVEPLV---EPGKFGDYQCNNAMGLWS  58

Query  547  KIKVKGTQF  573
             IKVKGTQF
Sbjct  59   IIKVKGTQF  67



>ref|XP_010413632.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
 ref|XP_010413639.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
 ref|XP_010413646.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=590

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +1

Query  367  ATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWA  546
            AT I+     G+++ QLAKLF  SL+ T PDE  V+P++      KFGDYQCNNAM LW+
Sbjct  2    ATMIANEAFSGNLRRQLAKLFSVSLKLTVPDEPGVEPLI---EPGKFGDYQCNNAMGLWS  58

Query  547  KIKVKGTQF  573
             IK KGTQF
Sbjct  59   IIKGKGTQF  67



>ref|XP_003535906.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Glycine max]
Length=651

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 60/101 (59%), Gaps = 5/101 (5%)
 Frame = +1

Query  286  SSLENLMSNNGTLRSTSSRFRSVGK--VTATPISTMTAVGSVKEQLAKLFEESLRATFPD  459
            S L  + S+   L +T ++  SV K   T+T I  +    SVK QLA+LF+ SLR T PD
Sbjct  26   SDLLKVASHRFALSATKTQQSSVTKPQSTSTAIIEIDNPASVKRQLAQLFDLSLRETVPD  85

Query  460  ESDVQPMMAIC---NNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            E  V P++  C      KFGDYQCNNAM +W+++K K T F
Sbjct  86   EPHVVPLVDACAVKGGAKFGDYQCNNAMGIWSRMKGKQTGF  126



>ref|XP_004513035.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Cicer arietinum]
Length=595

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAIC---NNPKFGDYQCNNAMSLWAKIKVKGT  567
             SV++QLAKLF ESL+A  P E DV P++  C   +  K  DYQCNNAMSLWAKIK K T
Sbjct  9    ASVRKQLAKLFAESLKAIVPSEPDVVPLIDACVAKSGVKHADYQCNNAMSLWAKIKGKQT  68

Query  568  QF  573
            +F
Sbjct  69   EF  70



>ref|XP_010433523.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Camelina sativa]
Length=591

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K QLAKLF+ SL+ T P E  V+P++A     KF DYQCNNAM LW+ IK KGTQF
Sbjct  10   GNLKRQLAKLFDVSLKLTVPGEPSVEPLVAASAPGKFEDYQCNNAMGLWSIIKGKGTQF  68



>ref|XP_011014625.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Populus euphratica]
Length=590

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVK-GTQF  573
            G++K +LAKLF+ SL AT P E D++P++A C   KFGDYQCNNAM LW+KIK + G +F
Sbjct  9    GNLKRKLAKLFQLSLEATVPGEPDIEPLVAAC-TAKFGDYQCNNAMGLWSKIKGRPGIEF  67



>ref|XP_011042210.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Populus euphratica]
 ref|XP_011042211.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Populus euphratica]
Length=599

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVK-GTQF  573
            G++K +LAKLF+ SL AT P E D++P++A C   KFGDYQCNNAM LW+KIK + G +F
Sbjct  9    GNLKRKLAKLFQLSLEATVPGEPDIEPLVAAC-TAKFGDYQCNNAMGLWSKIKGRPGIEF  67



>ref|XP_010511483.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=590

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +1

Query  367  ATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWA  546
            AT ++     G+ + QLAKLF  SL+ T PDE  V+P++      KFGDYQCNNAM LW+
Sbjct  2    ATMVANEAFTGNPRRQLAKLFSVSLKLTVPDEPGVEPLV---EPGKFGDYQCNNAMGLWS  58

Query  547  KIKVKGTQF  573
             IK KGTQF
Sbjct  59   IIKGKGTQF  67



>emb|CDX92760.1| BnaC07g40180D [Brassica napus]
Length=664

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +1

Query  316  GTLRSTSSR--FRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAI  489
            G LR T+ R  F +  K  AT  ++    G++K ++ KLF+ SLR T PD + V+  +A 
Sbjct  54   GVLRGTTRRLAFATRSKSVATMAASQEFTGNLKREVEKLFDASLRITVPDGTSVETEVAA  113

Query  490  CNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
                K GDYQCNNAM LW+ IK KGTQF
Sbjct  114  SLPGKPGDYQCNNAMGLWSVIKGKGTQF  141



>ref|XP_006293885.1| hypothetical protein CARUB_v10022872mg [Capsella rubella]
 gb|EOA26783.1| hypothetical protein CARUB_v10022872mg [Capsella rubella]
Length=590

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 3/69 (4%)
 Frame = +1

Query  367  ATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWA  546
            AT ++  T  G+ + QL KLF  SL+ T PDE +V+P++      KFGDYQCNNAM LW+
Sbjct  2    ATMVANETFTGNPRRQLTKLFSVSLKLTVPDEPNVEPLV---EPGKFGDYQCNNAMGLWS  58

Query  547  KIKVKGTQF  573
             IK KGT+F
Sbjct  59   IIKGKGTEF  67



>emb|CDX89348.1| BnaA01g15450D [Brassica napus]
Length=652

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +1

Query  316  GTLRSTSSR--FRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAI  489
            G LR T+ R  F +  K  AT  ++    G++K ++ KLF+ SLR T PD + V+  +A 
Sbjct  42   GVLRGTTRRLAFATRSKSVATMAASQEFTGNLKREVEKLFDASLRITVPDGTSVETEVAA  101

Query  490  CNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
                K GDYQCNNAM LW+ IK KGTQF
Sbjct  102  SLPGKPGDYQCNNAMGLWSVIKGKGTQF  129



>ref|XP_009407238.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=609

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +GSVK+QL++L +ESL+A FP E  ++P++A C   KFGDYQCNNAM LW+++K K T+F
Sbjct  25   IGSVKQQLSRLLKESLQALFPYE--IEPLVAACQ-AKFGDYQCNNAMGLWSQLKGKPTEF  81



>ref|XP_009407237.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=661

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +GSVK+QL++L +ESL+A FP E  ++P++A C   KFGDYQCNNAM LW+++K K T+F
Sbjct  77   IGSVKQQLSRLLKESLQALFPYE--IEPLVAACQ-AKFGDYQCNNAMGLWSQLKGKPTEF  133



>gb|EAY96661.1| hypothetical protein OsI_18575 [Oryza sativa Indica Group]
Length=606

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 8/80 (10%)
 Frame = +1

Query  352  VGKVTATPISTMT------AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGD  513
            +G  T+T ++T +        GSVK+QL+KL   SLR T P E +V PM+ +C   KFGD
Sbjct  1    MGDETSTSVATQSQEPAAVGAGSVKQQLSKLVIASLRTTVP-EVEVDPMVEVCT-AKFGD  58

Query  514  YQCNNAMSLWAKIKVKGTQF  573
            YQCNNAM LW++IK  GT F
Sbjct  59   YQCNNAMGLWSRIKGSGTSF  78



>ref|NP_001054732.1| Os05g0163000 [Oryza sativa Japonica Group]
 gb|AAT07655.1| putative Arginyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAF16646.1| Os05g0163000 [Oryza sativa Japonica Group]
 gb|EEE62435.1| hypothetical protein OsJ_17227 [Oryza sativa Japonica Group]
Length=606

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 52/80 (65%), Gaps = 8/80 (10%)
 Frame = +1

Query  352  VGKVTATPISTMT------AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGD  513
            +G  T+T ++T +        GSVK+QL+KL   SLR T P E +V PM+ +C   KFGD
Sbjct  1    MGDETSTSVATQSQEPAAVGAGSVKQQLSKLVIASLRTTVP-EVEVDPMVEVCT-AKFGD  58

Query  514  YQCNNAMSLWAKIKVKGTQF  573
            YQCNNAM LW++IK  GT F
Sbjct  59   YQCNNAMGLWSRIKGSGTSF  78



>ref|XP_010678625.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678626.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678627.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+VK+ LA++F++SL AT P+E+D+ P++AICN   FGDYQCNNAMSL+ KI+    +F
Sbjct  9    GNVKQLLAQVFKKSLEATVPNEADLHPLIAICNE-NFGDYQCNNAMSLFGKIRGTMPEF  66



>ref|XP_006413206.1| hypothetical protein EUTSA_v10024637mg [Eutrema salsugineum]
 ref|XP_006413207.1| hypothetical protein EUTSA_v10024637mg [Eutrema salsugineum]
 gb|ESQ54659.1| hypothetical protein EUTSA_v10024637mg [Eutrema salsugineum]
 gb|ESQ54660.1| hypothetical protein EUTSA_v10024637mg [Eutrema salsugineum]
Length=590

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G+ K QL KLF+ SL+ T P+E  V P++A     KFGDYQCNNAM LW+ IK KGTQF
Sbjct  9    GNPKRQLEKLFDVSLKLTVPNEPGVAPLVAASQPGKFGDYQCNNAMGLWSIIKGKGTQF  67



>ref|XP_003529061.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Glycine max]
 gb|KHN14253.1| Arginine--tRNA ligase, cytoplasmic [Glycine soja]
Length=597

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAIC----NNPKFGDYQCNNAMSLWAKIKVKG  564
             SVK+QLAK+FEESLR T PDE DV P +  C       KF DYQCNNAM L+AK+K K 
Sbjct  10   ASVKKQLAKVFEESLRTTVPDEPDVVPSIDPCAANKAGVKFADYQCNNAMGLFAKMKGKQ  69

Query  565  TQF  573
            T F
Sbjct  70   TGF  72



>ref|XP_004513061.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Cicer arietinum]
Length=650

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 4/62 (6%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAIC----NNPKFGDYQCNNAMSLWAKIKVKGT  567
            SVK QLA+LF+ SL+AT P+E +V P++ +C       KFGDYQCNNAM +W+KIK K T
Sbjct  65   SVKRQLAQLFDVSLKATVPNEENVVPLVDVCTAKTGGVKFGDYQCNNAMGIWSKIKGKET  124

Query  568  QF  573
             F
Sbjct  125  GF  126



>emb|CDX94349.1| BnaC01g18350D [Brassica napus]
Length=657

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +1

Query  316  GTLRSTSSR--FRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAI  489
            G  R+T+ R  F +  K  AT  ++    G++K ++ KLF+ SLR T PD + V+  +A 
Sbjct  47   GVFRATTRRLVFATRSKSVATMAASQEFTGNLKREVEKLFDASLRLTVPDGTSVETEVAA  106

Query  490  CNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
                K GDYQCNNAM LW+ IK KGTQF
Sbjct  107  SLPGKPGDYQCNNAMGLWSVIKGKGTQF  134



>ref|XP_003568860.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Brachypodium distachyon]
Length=661

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 8/81 (10%)
 Frame = +1

Query  349  SVGKVTATPISTM------TAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFG  510
            ++G  T+T +S           GSVK+Q++ L   SLRAT P E DV+PM+ +C   KFG
Sbjct  55   TMGDETSTSVSAQPQEPAALGAGSVKQQISNLVVLSLRATVP-EVDVEPMVEVCT-AKFG  112

Query  511  DYQCNNAMSLWAKIKVKGTQF  573
            DYQCNNAM LW+++K  GT F
Sbjct  113  DYQCNNAMGLWSRVKGSGTSF  133



>gb|KEH27228.1| cytoplasmic-like arginine-tRNA ligase [Medicago truncatula]
Length=659

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAIC----NNPKFGDYQCNNAMSLWAKIKVKG  564
             SVK QLA+LF+ SL+   PDE DV P++ +C     + KFGDYQCNNAM +W+K+K K 
Sbjct  72   ASVKRQLAQLFDVSLKTIVPDEEDVVPLVDVCTAKTGSVKFGDYQCNNAMGIWSKLKGKE  131

Query  565  TQF  573
            T F
Sbjct  132  TGF  134



>ref|XP_010231676.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Brachypodium distachyon]
Length=606

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 8/80 (10%)
 Frame = +1

Query  352  VGKVTATPISTM------TAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGD  513
            +G  T+T +S           GSVK+Q++ L   SLRAT P E DV+PM+ +C   KFGD
Sbjct  1    MGDETSTSVSAQPQEPAALGAGSVKQQISNLVVLSLRATVP-EVDVEPMVEVCT-AKFGD  58

Query  514  YQCNNAMSLWAKIKVKGTQF  573
            YQCNNAM LW+++K  GT F
Sbjct  59   YQCNNAMGLWSRVKGSGTSF  78



>gb|EMS66157.1| Arginyl-tRNA synthetase, cytoplasmic [Triticum urartu]
Length=544

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +1

Query  391  AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
              GSVK+Q++ L   SLRAT P E DV+P++ +C   KFGDYQCNNAM LW+K+K  GT 
Sbjct  20   GAGSVKQQISNLAALSLRATVP-EVDVEPIVEVCTG-KFGDYQCNNAMGLWSKVKGSGTS  77

Query  571  F  573
            F
Sbjct  78   F  78



>ref|XP_002875125.1| hypothetical protein ARALYDRAFT_904472 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51384.1| hypothetical protein ARALYDRAFT_904472 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K QLAKL    L+ T PDE   +P++A     KFGDYQCNNAM LW+ IK KGTQF
Sbjct  33   GNLKRQLAKLLVVCLKLTVPDEPSFEPLVAASAAGKFGDYQCNNAMGLWSIIKGKGTQF  91



>ref|XP_002886965.1| hypothetical protein ARALYDRAFT_894178 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63224.1| hypothetical protein ARALYDRAFT_894178 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 3/54 (6%)
 Frame = +1

Query  412  QLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +LAKLFE SL+ T PDE +V+P++      KFGDYQCNNAM LW+ IK KGTQF
Sbjct  53   ELAKLFEVSLKLTVPDEPNVEPLI---EPAKFGDYQCNNAMGLWSIIKGKGTQF  103



>emb|CDY50010.1| BnaC08g12170D [Brassica napus]
Length=736

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = +1

Query  325  RSTSSRFRSVG---KVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICN  495
            R+TS RF + G   K  AT  +     G++K QL KLF+ SLR+T PD+  V+P++    
Sbjct  122  RATSRRF-AFGIESKSAATMAANQECSGNLKRQLEKLFDASLRSTVPDKPRVKPVVTTSP  180

Query  496  NPKFGDYQCNNAMSLWAKIKVKGTQF  573
              + GDYQCNNAM LW+ IK K +QF
Sbjct  181  LDRSGDYQCNNAMGLWSMIKGKDSQF  206



>emb|CDY14308.1| BnaA08g14390D [Brassica napus]
Length=620

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = +1

Query  325  RSTSSRFRSV--GKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNN  498
            R+TS RF S    K  AT        G++K QL KLF+ SLR+T PD + V+P++     
Sbjct  11   RATSRRFASQIESKSAATMEVNQECPGNLKRQLEKLFDASLRSTVPDNTRVKPVVTTSPL  70

Query  499  PKFGDYQCNNAMSLWAKIKVKGTQF  573
             + GDYQCNNAM LW+ IK K +QF
Sbjct  71   DRSGDYQCNNAMGLWSMIKGKDSQF  95



>ref|XP_006853736.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Amborella trichopoda]
 gb|ERN15203.1| hypothetical protein AMTR_s00056p00173860 [Amborella trichopoda]
Length=645

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            G+V++ LAKL + SLRATFPD+ +++P++AIC   KFGDYQ NNAM +W+KIK
Sbjct  66   GTVRQLLAKLCKASLRATFPDDLELEPLVAICTG-KFGDYQFNNAMGIWSKIK  117



>ref|XP_009137586.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Brassica rapa]
Length=590

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K Q+ KLF+ SLR+T PDE+ VQ  +      K GDYQCNNAM LW+ IK KGTQF
Sbjct  9    GNLKRQVEKLFDASLRSTVPDETGVQTEVTASLPGKPGDYQCNNAMGLWSIIKGKGTQF  67



>ref|NP_001236544.1| arginyl-tRNA synthetase [Glycine max]
 emb|CAR64264.1| arginyl-tRNA synthetase [Glycine max]
Length=597

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAIC----NNPKFGDYQCNNAMSLWAKIKVKG  564
             SVK+QLAK FEESLR T PDE DV P +  C       KF DYQCNNAM L+AK+K K 
Sbjct  10   ASVKKQLAKEFEESLRITVPDEPDVVPSIDPCAANKAGIKFADYQCNNAMGLFAKMKGKQ  69

Query  565  TQF  573
            T F
Sbjct  70   TGF  72



>ref|XP_006572789.1| PREDICTED: arginyl-tRNA synthetase isoform X1 [Glycine max]
Length=597

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAIC----NNPKFGDYQCNNAMSLWAKIKVKG  564
             SVK+QLAK FEESLR T PDE DV P +  C       KF DYQCNNAM L+AK+K K 
Sbjct  10   ASVKKQLAKEFEESLRITVPDEPDVVPSIDPCAANKAGIKFADYQCNNAMGLFAKMKGKQ  69

Query  565  TQF  573
            T F
Sbjct  70   TGF  72



>ref|XP_011459396.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=646

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 8/76 (11%)
 Frame = +1

Query  367  ATPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAIC---NNPKFGDYQCN  525
            A  +STM A    V SVK QL KLFE S+R   PD  +V+P +      +  KFGDYQCN
Sbjct  49   ARSVSTMAAGGESVASVKRQLGKLFEVSIRTAVPD-VNVEPAVVPSIEKSGKKFGDYQCN  107

Query  526  NAMSLWAKIKVKGTQF  573
            NAM +W+KIK KGT F
Sbjct  108  NAMDIWSKIKGKGTAF  123



>ref|XP_011399829.1| Arginine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM26881.1| Arginine-tRNA ligase [Auxenochlorella protothecoides]
Length=588

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVK  561
            GS++++L  LF  S+ +TFPD + VQP +A  N+PKFGDYQCNNAM+L+AK K K
Sbjct  10   GSIRQELTSLFGASISSTFPD-AGVQPSVAQTNDPKFGDYQCNNAMALFAKCKGK  63



>gb|EMT08576.1| Arginyl-tRNA synthetase [Aegilops tauschii]
Length=762

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +1

Query  385  MTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKG  564
            +   GSVK+Q++ L   SLRAT P E DV+P++ +C   KFGDYQCNNAM LW+K K  G
Sbjct  145  VQGAGSVKQQISNLVALSLRATVP-EVDVEPIVEVCTG-KFGDYQCNNAMGLWSKGKGSG  202

Query  565  TQF  573
            T F
Sbjct  203  TSF  205



>gb|KHN40369.1| Arginine--tRNA ligase, cytoplasmic [Glycine soja]
Length=778

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAIC----NNPKFGDYQCNNAMSLWAKIKVKGT  567
            SVK+QLAK FEESLR T PDE DV P +  C       KF DYQCNNAM L+AK+K K T
Sbjct  11   SVKKQLAKEFEESLRITVPDEPDVVPSIDPCAANKAGIKFADYQCNNAMGLFAKMKGKQT  70

Query  568  QF  573
             F
Sbjct  71   GF  72



>ref|XP_009109180.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Brassica 
rapa]
 ref|XP_009109181.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Brassica 
rapa]
Length=592

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K QL KLF+ SLR+T PD+  V+P++      + GDYQCNNAM LW+ IK K +QF
Sbjct  9    GNLKRQLEKLFDASLRSTVPDKPRVKPVITTSPLDRSGDYQCNNAMGLWSMIKGKDSQF  67



>ref|XP_011459399.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Fragaria vesca subsp. vesca]
 ref|XP_011459402.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=592

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 43/64 (67%), Gaps = 4/64 (6%)
 Frame = +1

Query  391  AVGSVKEQLAKLFEESLRATFPDESDVQPMMAIC---NNPKFGDYQCNNAMSLWAKIKVK  561
            +V SVK QL KLFE S+R   PD  +V+P +      +  KFGDYQCNNAM +W+KIK K
Sbjct  7    SVASVKRQLGKLFEVSIRTAVPD-VNVEPAVVPSIEKSGKKFGDYQCNNAMDIWSKIKGK  65

Query  562  GTQF  573
            GT F
Sbjct  66   GTAF  69



>gb|KEH44003.1| cytoplasmic-like arginine-tRNA ligase [Medicago truncatula]
Length=596

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 3/66 (5%)
 Frame = +1

Query  385  MTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAIC---NNPKFGDYQCNNAMSLWAKIK  555
            + A  SV++QLA LF E+L AT P E DV P++  C   N  K  DYQCNNAMSL+AKIK
Sbjct  5    LDAPASVRKQLATLFREALIATVPTEPDVVPLIDACVPKNGVKHADYQCNNAMSLFAKIK  64

Query  556  VKGTQF  573
             K  +F
Sbjct  65   GKRPEF  70



>ref|XP_007152963.1| hypothetical protein PHAVU_004G174900g [Phaseolus vulgaris]
 gb|ESW24957.1| hypothetical protein PHAVU_004G174900g [Phaseolus vulgaris]
Length=596

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAIC---NNPKFGDYQCNNAMSLWAKIKVKGT  567
             SVK+QLAK+FE SL+ T PDE +V P +  C   +  KF DYQCNNAM ++AKIK K +
Sbjct  10   ASVKKQLAKVFEVSLKTTVPDEPEVSPSVDACAAKSGVKFADYQCNNAMGIFAKIKGKQS  69

Query  568  QF  573
             F
Sbjct  70   GF  71



>ref|XP_003608811.1| Arginyl-tRNA synthetase [Medicago truncatula]
Length=589

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAIC----NNPKFGDYQCNNAMSLWAKIKVKGT  567
            SVK+QLA+LF ESL+AT P E DV P++  C    N  K  DYQCNNAMSL+  IK K  
Sbjct  10   SVKKQLAELFRESLKATVPSEPDVVPLVEACVANKNGVKHADYQCNNAMSLFPIIKEKQP  69

Query  568  QF  573
            +F
Sbjct  70   EF  71



>gb|AES91008.2| cytoplasmic-like arginine-tRNA ligase [Medicago truncatula]
Length=597

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAIC----NNPKFGDYQCNNAMSLWAKIKVKGT  567
            SVK+QLA+LF ESL+AT P E DV P++  C    N  K  DYQCNNAMSL+  IK K  
Sbjct  10   SVKKQLAELFRESLKATVPSEPDVVPLVEACVANKNGVKHADYQCNNAMSLFPIIKEKQP  69

Query  568  QF  573
            +F
Sbjct  70   EF  71



>gb|KIZ07760.1| hypothetical protein MNEG_0179, partial [Monoraphidium neglectum]
Length=125

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +1

Query  388  TAVG-SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            TA G SV+  L  LF E++ A FP+  D  P++A CNN   GDYQCNNAM L+ K+K
Sbjct  3    TATGTSVRTDLEALFGEAIAAAFPNSPDKAPLIAACNNAANGDYQCNNAMPLFGKMK  59



>ref|XP_009142154.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Brassica rapa]
 ref|XP_009142161.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Brassica rapa]
Length=590

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            G++K ++ KLF+ SLR T PD + V+  +A     K GDYQCNNAM LW+ IK KGTQF
Sbjct  9    GNLKREVEKLFDASLRITVPDGTSVETEVAASLPGKPGDYQCNNAMGLWSVIKGKGTQF  67



>ref|XP_012080832.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Jatropha curcas]
 gb|KDP30635.1| hypothetical protein JCGZ_16200 [Jatropha curcas]
Length=602

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 5/66 (8%)
 Frame = +1

Query  370  TPISTMTA----VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMS  537
            +P+S+  A    +G+VK+QL+KLF  SLR   P + + +P++A C  PKFGDYQCNNAMS
Sbjct  9    SPLSSALAEEENMGNVKKQLSKLFAVSLREMLPPQLNAEPLVASCV-PKFGDYQCNNAMS  67

Query  538  LWAKIK  555
            L++K+K
Sbjct  68   LFSKLK  73



>gb|KEH36095.1| cytoplasmic-like arginine-tRNA ligase [Medicago truncatula]
Length=596

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +1

Query  385  MTAVGSVKEQLAKLFEESLRATFPDESD-VQPMMAIC---NNPKFGDYQCNNAMSLWAKI  552
            + A  SV++QLAKLF E+L AT P +SD + P++  C   N  K  DYQCNNAMSL+AKI
Sbjct  5    LDAPASVRKQLAKLFVEALNATLPTQSDAIVPLIDACVAKNGIKPADYQCNNAMSLFAKI  64

Query  553  KVKGTQF  573
            K K  +F
Sbjct  65   KGKQQEF  71



>ref|XP_002962266.1| hypothetical protein SELMODRAFT_76727 [Selaginella moellendorffii]
 gb|EFJ37526.1| hypothetical protein SELMODRAFT_76727 [Selaginella moellendorffii]
Length=578

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  385  MTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            M    SV+ +++++F+ + R+T  +   V+P++  CNNPKFGDYQ NNAM +W++IK
Sbjct  1    MARCPSVRSEISQIFQAAFRSTVGEWVSVEPIVTACNNPKFGDYQINNAMGIWSRIK  57



>ref|XP_005845135.1| hypothetical protein CHLNCDRAFT_26194 [Chlorella variabilis]
 gb|EFN53033.1| hypothetical protein CHLNCDRAFT_26194 [Chlorella variabilis]
Length=601

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            +GS++++LA  F++SL A FP  +    ++  CNNPKFGDYQCNNAM L  K+K
Sbjct  34   LGSLRQRLAAAFQQSLDAAFPSMAGEPAIVNPCNNPKFGDYQCNNAMGLHGKLK  87



>ref|XP_002961325.1| hypothetical protein SELMODRAFT_140217 [Selaginella moellendorffii]
 gb|EFJ38864.1| hypothetical protein SELMODRAFT_140217 [Selaginella moellendorffii]
Length=595

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            +++++L+K+  ES + T  +  +V+P +A C NP FGDYQ NNAM +W+ IK K T+F
Sbjct  16   TIRQELSKIARESFQTTLGEWGNVEPAVAACANPNFGDYQINNAMGIWSTIKGKETEF  73



>gb|AFW82580.1| hypothetical protein ZEAMMB73_640075 [Zea mays]
Length=434

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +1

Query  379  STMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKV  558
            ST+ A GSVK+QL++L   SL+ T PD  +V+PM+ +  + KF DYQCNNAM LW+K+K 
Sbjct  66   STVRA-GSVKQQLSRLVLSSLQTTLPD-VEVEPMVEV--SAKFADYQCNNAMGLWSKVKG  121

Query  559  KGTQF  573
             GT F
Sbjct  122  SGTIF  126



>gb|AFW82579.1| hypothetical protein ZEAMMB73_640075 [Zea mays]
Length=384

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +1

Query  379  STMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKV  558
            ST+ A GSVK+QL++L   SL+ T PD  +V+PM+ +  + KF DYQCNNAM LW+K+K 
Sbjct  16   STVRA-GSVKQQLSRLVLSSLQTTLPD-VEVEPMVEV--SAKFADYQCNNAMGLWSKVKG  71

Query  559  KGTQF  573
             GT F
Sbjct  72   SGTIF  76



>ref|XP_002965180.1| hypothetical protein SELMODRAFT_83543 [Selaginella moellendorffii]
 gb|EFJ34018.1| hypothetical protein SELMODRAFT_83543 [Selaginella moellendorffii]
Length=578

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  385  MTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            M    SV+ +++++F+ + R+T  +   V+P++  CNNPKFGDYQ NNAM +W++IK
Sbjct  1    MARYPSVRNEISQIFQAAFRSTVGEWVSVEPIVIACNNPKFGDYQINNAMGIWSRIK  57



>gb|AFW82581.1| hypothetical protein ZEAMMB73_640075, partial [Zea mays]
Length=512

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +1

Query  379  STMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKV  558
            ST+ A GSVK+QL++L   SL+ T PD  +V+PM+ +  + KF DYQCNNAM LW+K+K 
Sbjct  66   STVRA-GSVKQQLSRLVLSSLQTTLPD-VEVEPMVEV--SAKFADYQCNNAMGLWSKVKG  121

Query  559  KGTQF  573
             GT F
Sbjct  122  SGTIF  126



>ref|NP_001148134.1| arginyl-tRNA synthetase [Zea mays]
 gb|ACF83404.1| unknown [Zea mays]
 gb|ACG29841.1| arginyl-tRNA synthetase [Zea mays]
Length=604

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = +1

Query  379  STMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKV  558
            ST+ A GSVK+QL++L   SL+ T PD  +V+PM+ +  + KF DYQCNNAM LW+K+K 
Sbjct  16   STVRA-GSVKQQLSRLVLSSLQTTLPD-VEVEPMVEV--SAKFADYQCNNAMGLWSKVKG  71

Query  559  KGTQF  573
             GT F
Sbjct  72   SGTIF  76



>ref|XP_002958524.1| hypothetical protein VOLCADRAFT_108162 [Volvox carteri f. nagariensis]
 gb|EFJ40444.1| hypothetical protein VOLCADRAFT_108162 [Volvox carteri f. nagariensis]
Length=656

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +1

Query  379  STMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            S  T+ GS++ +L +LF  +L  +FP  S  +P++A CNN K GDYQCNNAM+L+ K+K
Sbjct  3    SEKTSCGSIRNELLELFRTALTVSFPSVS-AEPVVAACNNAKNGDYQCNNAMALFGKLK  60



>ref|XP_002530974.1| arginyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF31409.1| arginyl-tRNA synthetase, putative [Ricinus communis]
Length=615

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            +G++K+QLAKL   SLR T P + D+ P++A C   KFGDYQCNNAM L++K++
Sbjct  34   MGNLKKQLAKLIAVSLRTTLPTQFDIDPLVASCRT-KFGDYQCNNAMGLFSKLR  86



>dbj|BAB08191.1| unnamed protein product [Oryza sativa Japonica Group]
Length=605

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = +1

Query  388  TAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGT  567
            T V SV++QL  L   SLRAT PD  DV+PM+ + + P FGDYQCNNAMS++++I+   T
Sbjct  20   TRVQSVEQQLCTLITSSLRATVPD-LDVEPMLEV-SKPGFGDYQCNNAMSVFSRIRGSAT  77

Query  568  QF  573
             F
Sbjct  78   NF  79



>gb|EEE53905.1| hypothetical protein OsJ_00455 [Oryza sativa Japonica Group]
Length=588

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +1

Query  391  AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            +V SV++QL  L   SLRAT PD  DV+PM+ + + P FGDYQCNNAMS++++I+   T 
Sbjct  9    SVQSVEQQLCTLITSSLRATVPD-LDVEPMLEV-SKPGFGDYQCNNAMSVFSRIRGSATN  66

Query  571  F  573
            F
Sbjct  67   F  67



>ref|XP_001695651.1| hypothetical protein CHLREDRAFT_119290 [Chlamydomonas reinhardtii]
 gb|EDP01438.1| predicted protein [Chlamydomonas reinhardtii]
Length=589

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            GSV+ ++A LF  +L   +P+ + ++P++A CNN K GDYQCNNAM+L+ K+  KGT+
Sbjct  8    GSVRAEVADLFRSALNTAYPN-AGIEPVVAACNNAKNGDYQCNNAMALFGKL--KGTE  62



>ref|XP_005646217.1| arginyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE21673.1| arginyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=596

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 5/78 (6%)
 Frame = +1

Query  328  STSSRFRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKF  507
            ++++  +++G+ T    ST   V SV+  LA +F  +LR  FP+  D+QP +A  NN   
Sbjct  2    ASAAPAQTLGQFT----STAKRVPSVRTDLAGVFSTALRTAFPN-VDIQPAVAATNNRDH  56

Query  508  GDYQCNNAMSLWAKIKVK  561
            GDYQCNNAM+L+ ++K K
Sbjct  57   GDYQCNNAMALFGRMKGK  74



>gb|KFK38730.1| hypothetical protein AALP_AA3G153100 [Arabis alpina]
Length=480

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 3/57 (5%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGT  567
            G++ ++L +LF+ SL+ T PDE  V PM+ +    KFGDYQC+N M  W+K+K K T
Sbjct  9    GNLIQKLEELFDVSLKLTVPDEPSVDPMITVG---KFGDYQCDNTMKPWSKLKGKST  62



>gb|KFK38731.1| hypothetical protein AALP_AA3G153100 [Arabis alpina]
Length=514

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 3/57 (5%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGT  567
            G++ ++L +LF+ SL+ T PDE  V PM+ +    KFGDYQC+N M  W+K+K K T
Sbjct  9    GNLIQKLEELFDVSLKLTVPDEPSVDPMITVG---KFGDYQCDNTMKPWSKLKGKST  62



>ref|XP_011161033.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Solenopsis 
invicta]
Length=290

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQF  573
            S+++QL  +F +++  T+PD +D   ++   +NPKFGDYQCN+AM L   + + GT+ 
Sbjct  92   SIRDQLCSIFHKAISITYPDITDPPVIVTTSSNPKFGDYQCNSAMPLAQLLSISGTKI  149



>ref|XP_006654081.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Oryza brachyantha]
Length=606

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 8/80 (10%)
 Frame = +1

Query  352  VGKVTATPISTMT------AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGD  513
            +G  T+T + T +        GSVK+QL+KL   SL+ T   E +V+PM+ +C   KFGD
Sbjct  1    MGDETSTSVDTQSHEPAGVGAGSVKQQLSKLVTASLQTT-VPEVEVEPMVEVCTG-KFGD  58

Query  514  YQCNNAMSLWAKIKVKGTQF  573
            YQCNNAM LW++IK  GT F
Sbjct  59   YQCNNAMGLWSRIKGSGTSF  78



>ref|XP_008548167.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Microplitis demolitor]
 gb|EZA45328.1| arginine--tRNA ligase [Microplitis demolitor]
Length=681

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            S+  QL +LF E+++ ++PD  D   +++   NPKFGDYQCN+AMSL  ++   G +
Sbjct  96   SISVQLEELFLEAIKKSYPDIPDPPVVISASGNPKFGDYQCNSAMSLSKQLGASGVK  152



>ref|XP_012063930.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Atta cephalotes]
Length=675

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            S+K+ L+ +F +++ A +PD  D   ++    NPKFGDYQCN+AM L  ++   GT+
Sbjct  90   SIKDNLSAVFHKAISAAYPDILDPPVIVTTSTNPKFGDYQCNSAMPLAQQLSSSGTK  146



>ref|XP_004977115.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Setaria italica]
Length=656

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = +1

Query  391  AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
              GSVK+QL++L   SLRAT     +V+    +  + KF DYQCNNAM LW+KIK  GT 
Sbjct  71   GAGSVKQQLSRLVISSLRAT---VPEVEVEPMVEVSAKFADYQCNNAMGLWSKIKGSGTS  127

Query  571  F  573
            F
Sbjct  128  F  128



>ref|XP_008647544.1| PREDICTED: uncharacterized protein LOC100273441 isoform X3 [Zea 
mays]
 gb|AFW77201.1| hypothetical protein ZEAMMB73_220224 [Zea mays]
Length=653

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +1

Query  349  SVGKVTATPISTM----TAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDY  516
            ++G  T+T ++      T  GSVK+QL+ L   SLRAT     +V+    +  + KF DY
Sbjct  50   TMGDETSTSVAPQEQESTVAGSVKQQLSGLVLMSLRAT---VPEVEVEPMVEVSAKFADY  106

Query  517  QCNNAMSLWAKIKVKGTQF  573
            QCNNAM LW+K+K  GT F
Sbjct  107  QCNNAMGLWSKVKGSGTSF  125



>ref|XP_011266122.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Camponotus floridanus]
Length=676

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +1

Query  358  KVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMS  537
            K +A   ++ + + S+ + L ++F +++ A +PD  +   ++   NNPKFGDYQCN+AM 
Sbjct  77   KASAMSNTSQSNIISINDTLCEIFRKAITAAYPDVLNPPVIVTTSNNPKFGDYQCNSAMP  136

Query  538  LWAKIKVKGTQ  570
            L  ++   G +
Sbjct  137  LAQQLSSSGNK  147



>gb|EFN61656.1| Arginyl-tRNA synthetase, cytoplasmic [Camponotus floridanus]
Length=642

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +1

Query  358  KVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMS  537
            K +A   ++ + + S+ + L ++F +++ A +PD  +   ++   NNPKFGDYQCN+AM 
Sbjct  77   KASAMSNTSQSNIISINDTLCEIFRKAITAAYPDVLNPPVIVTTSNNPKFGDYQCNSAMP  136

Query  538  LWAKIKVKGTQ  570
            L  ++   G +
Sbjct  137  LAQQLSSSGNK  147



>ref|XP_008647546.1| PREDICTED: uncharacterized protein LOC100273441 isoform X4 [Zea 
mays]
Length=603

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = +1

Query  388  TAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGT  567
            T  GSVK+QL+ L   SLRAT     +V+    +  + KF DYQCNNAM LW+K+K  GT
Sbjct  17   TVAGSVKQQLSGLVLMSLRAT---VPEVEVEPMVEVSAKFADYQCNNAMGLWSKVKGSGT  73

Query  568  QF  573
             F
Sbjct  74   SF  75



>ref|XP_006632005.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Lepisosteus 
oculatus]
Length=660

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            ++ +QL +LFE ++RA +PD  +    +     PKFGDYQCN+AM +   +K KG +
Sbjct  75   NINQQLQELFEGAIRAAYPDLENPPLAVTPSQQPKFGDYQCNSAMGMAQMMKAKGQK  131



>ref|XP_002051105.1| GJ14045 [Drosophila virilis]
 gb|EDW63260.1| GJ14045 [Drosophila virilis]
Length=594

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICN-NPKFGDYQCNNAMSLWAKIKVKG  564
            ++ E L K+F +++   +P  S+V  ++A  N +PKFGDYQCNNAM L  K+K +G
Sbjct  8    AITEHLEKVFTQAIATAYPRFSNVPAIIAAVNASPKFGDYQCNNAMGLSKKMKDEG  63



>ref|XP_003706581.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Megachile rotundata]
Length=675

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +1

Query  376  ISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            ++T   V S+ + L  LF+ ++ A +PD  D   ++   NNPKFGDYQCN+AM L  ++ 
Sbjct  83   MTTENIVVSICDTLFDLFKNAITAAYPDVCDPPVIITSSNNPKFGDYQCNSAMPLSKQLN  142

Query  556  VKGTQ  570
              G +
Sbjct  143  SNGNK  147



>gb|ERL94414.1| hypothetical protein D910_11692 [Dendroctonus ponderosae]
Length=635

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/66 (38%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +1

Query  349  SVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPM-MAICN-NPKFGDYQC  522
            ++GK++  P++    + S+ + L  +F  ++ A  PD  ++ P+ +A+   NPKFGDYQC
Sbjct  32   AIGKMSKPPVTMEVGLESILQILQNIFSNAIEAACPDIRNIPPVDIALSGANPKFGDYQC  91

Query  523  NNAMSL  540
            N+AMSL
Sbjct  92   NSAMSL  97



>ref|XP_011698318.1| PREDICTED: probable arginine--tRNA ligase, cytoplasmic [Wasmannia 
auropunctata]
Length=674

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            S+++ L  +F  ++ A +PD +D   ++   +NPKFGDYQCN+AM L  ++   GT+
Sbjct  89   SIRDNLVAVFRSAIGAAYPDVADPPVIVTTSSNPKFGDYQCNSAMPLAQQLSGAGTK  145



>ref|XP_011630540.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Pogonomyrmex barbatus]
Length=672

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            V S+ + L++LF +++   +P+ +D   ++ + +NPKFGDYQCN+AM L  ++   GT+
Sbjct  85   VISINDTLSELFRKAINTAYPNITDPPVVVTVSSNPKFGDYQCNSAMPLAHQLSNSGTK  143



>gb|ACR35119.1| unknown [Zea mays]
Length=390

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = +1

Query  379  STMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKV  558
            ST+ A GSVK+QL+ L   SLRAT     +V+    +  + KF DYQCNNAM LW+K+K 
Sbjct  66   STVQA-GSVKQQLSGLVLMSLRAT---VPEVEVEPMVEVSAKFADYQCNNAMGLWSKVKG  121

Query  559  KGTQF  573
             GT F
Sbjct  122  SGTSF  126



>gb|KKA66114.1| tRNA synthetase [Pristionchus pacificus]
Length=435

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  397  GSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGT  567
            GS+  +LA +F+++++  FP  S V  ++A   NPKFGDYQCN+AM + A +K +GT
Sbjct  116  GSIMGRLAHVFKKAIKEAFPTVS-VPLVLAEATNPKFGDYQCNSAMGISAALKAQGT  171



>ref|XP_003492480.1| PREDICTED: arginyl-tRNA synthetase, cytoplasmic-like [Bombus 
impatiens]
Length=674

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  382  TMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSL  540
            T   V S+ + L+ LF+E++   +PD  D   ++   NNPKFGDYQCN+AM L
Sbjct  84   TENNVISIYDTLSNLFKEAISVAYPDVCDPPVIITSSNNPKFGDYQCNSAMPL  136



>emb|CDJ98304.1| Arginyl tRNA synthetase and Arginyl-tRNA synthetase and DALR 
anticodon binding domain containing protein [Haemonchus contortus]
Length=718

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGT  567
            S+  +L+ LF++++   FP    V   +    NPKFGDYQCN+AM++ AK+K  GT
Sbjct  134  SIISRLSDLFKDAIEEAFPSIERVSVALTETTNPKFGDYQCNSAMAISAKLKASGT  189



>ref|XP_003394872.1| PREDICTED: arginyl-tRNA synthetase, cytoplasmic-like [Bombus 
terrestris]
Length=674

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  382  TMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSL  540
            T   V S+ + L+ LF+E++   +PD  D   ++   NNPKFGDYQCN+AM L
Sbjct  84   TENNVISIYDTLSNLFKEAISVAYPDVCDPPVIITSSNNPKFGDYQCNSAMPL  136



>ref|XP_011556293.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Plutella xylostella]
Length=681

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/133 (29%), Positives = 61/133 (46%), Gaps = 17/133 (13%)
 Frame = +1

Query  223  SSTCERSAGMLLNGHHQIVKASSLENLMSNNGTLR----------STSSRFRSVGKVTAT  372
            +S  E     L  G    V    L+ L S N  L+             S  ++V K    
Sbjct  20   ASAIEEELNKLAKGDLSFVGDERLDKLASENEKLKHRLEVLENAIKAESSSKAVKKEPRK  79

Query  373  PISTMTAVGSVK------EQLAKLFEESLRATFPDESDVQPMMAIC-NNPKFGDYQCNNA  531
              S +T + SV+      E+L  +FE ++ + +PD  D   ++ +  NNPKFGDYQCN++
Sbjct  80   RPSLITDINSVESNFCILEELKNIFEVAIGSAYPDLEDPPIIITLSGNNPKFGDYQCNSS  139

Query  532  MSLWAKIKVKGTQ  570
            M++   +K K  +
Sbjct  140  MAIAQLLKAKNVK  152



>ref|XP_008647543.1| PREDICTED: uncharacterized protein LOC100273441 isoform X2 [Zea 
mays]
 gb|AFW77202.1| arginyl-tRNA synthetase [Zea mays]
Length=654

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 8/80 (10%)
 Frame = +1

Query  349  SVGKVTATPIS-----TMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGD  513
            ++G  T+T ++     +    GSVK+QL+ L   SLRAT     +V+    +  + KF D
Sbjct  50   TMGDETSTSVAPQEQESTVQAGSVKQQLSGLVLMSLRAT---VPEVEVEPMVEVSAKFAD  106

Query  514  YQCNNAMSLWAKIKVKGTQF  573
            YQCNNAM LW+K+K  GT F
Sbjct  107  YQCNNAMGLWSKVKGSGTSF  126



>ref|XP_005708392.1| arginyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME31872.1| arginyl-tRNA synthetase [Galdieria sulphuraria]
Length=681

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 2/135 (1%)
 Frame = +1

Query  166  SVVCTFVLSSLNRSRKPYISSTCERSAGMLLNGHHQIVKASSLENLMSNNGTLRSTSSRF  345
            +VV  F LS L   +KP +  +C     +   G    +  + L +L      LR  + + 
Sbjct  21   TVVGYFRLSFLFL-QKPLVDRSCPAITCINRCGSRPRIFRNILSSLGCRRNPLRGKAQQ-  78

Query  346  RSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCN  525
              + +    PI+ + +  + +E LA    ++L   FPDE++ +P +     P+FGDYQ N
Sbjct  79   SFIQRTIRNPIAAIQSDMTTRELLANRVTQALTNLFPDENNWEPQLTAATRPEFGDYQSN  138

Query  526  NAMSLWAKIKVKGTQ  570
             A+SL  K K+   Q
Sbjct  139  AALSLAKKRKMNPLQ  153



>ref|NP_001141350.1| uncharacterized protein LOC100273441 [Zea mays]
 ref|XP_008647545.1| PREDICTED: uncharacterized protein LOC100273441 isoform X1 [Zea 
mays]
 gb|ACF86143.1| unknown [Zea mays]
 gb|AFW77199.1| arginyl-tRNA synthetase isoform 1 [Zea mays]
 gb|AFW77200.1| arginyl-tRNA synthetase isoform 2 [Zea mays]
Length=604

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = +1

Query  379  STMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKV  558
            ST+ A GSVK+QL+ L   SLRAT     +V+    +  + KF DYQCNNAM LW+K+K 
Sbjct  16   STVQA-GSVKQQLSGLVLMSLRAT---VPEVEVEPMVEVSAKFADYQCNNAMGLWSKVKG  71

Query  559  KGTQF  573
             GT F
Sbjct  72   SGTSF  76



>ref|XP_006610429.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Apis dorsata]
Length=674

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 45/79 (57%), Gaps = 4/79 (5%)
 Frame = +1

Query  334  SSRFRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGD  513
            + R +S  K  AT  + +    S+ + L  LFE+++   +P+  +   +++I  NPKFGD
Sbjct  72   TERAKSESKAKATENNAV----SIYDTLYNLFEKAISTAYPNVCEPPIIISISTNPKFGD  127

Query  514  YQCNNAMSLWAKIKVKGTQ  570
            YQCN+AM L  ++   G Q
Sbjct  128  YQCNSAMPLCKQLNNDGIQ  146



>ref|XP_623301.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Apis mellifera]
Length=674

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 45/79 (57%), Gaps = 4/79 (5%)
 Frame = +1

Query  334  SSRFRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGD  513
            + R +S  K  AT  + +    S+ + L  LFE+++   +P+  +   +++I  NPKFGD
Sbjct  72   TERAKSESKTKATENNAV----SIYDTLYNLFEKAISIAYPNVCEPPVIISISTNPKFGD  127

Query  514  YQCNNAMSLWAKIKVKGTQ  570
            YQCN+AM L  ++   G Q
Sbjct  128  YQCNSAMPLCKQLNNDGIQ  146



>ref|XP_007565550.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Poecilia formosa]
Length=660

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNN--PKFGDYQCNNAMSLWAKIKVKGTQ  570
            ++ ++L  +F E++RA+FPD  +  P +A+  N   KFGDYQCN+AM +   +K KGT+
Sbjct  75   NINQRLQDVFGEAIRASFPDLDN--PPLAVTPNQQAKFGDYQCNSAMGMAQMLKAKGTK  131



>ref|XP_008426663.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Poecilia reticulata]
Length=708

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNN--PKFGDYQCNNAMSLWAKIKVKGTQ  570
            ++ ++L  +F E++RA+FPD  +  P +A+  N   KFGDYQCN+AM +   +K KGT+
Sbjct  123  NINQRLQDVFGEAIRASFPDLDN--PPLAVTPNQQAKFGDYQCNSAMGMAQMLKAKGTK  179



>ref|XP_005837068.1| hypothetical protein GUITHDRAFT_200394 [Guillardia theta CCMP2712]
 gb|EKX50088.1| hypothetical protein GUITHDRAFT_200394 [Guillardia theta CCMP2712]
Length=649

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +1

Query  337  SRFR-SVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDE-SDVQPMMAICNNPKFG  510
            SR R S G V +  + T+     V++ L +   ++L   F +E  DV PM+AI + P+FG
Sbjct  51   SRLRLSGGSVDSASLETVY----VQQWLERKVTQALCEAFGEEVKDVNPMVAIASKPEFG  106

Query  511  DYQCNNAMSLWAKIKVK  561
            DYQCN AMSL  K+ +K
Sbjct  107  DYQCNVAMSLSKKVGMK  123



>gb|KDR16424.1| Arginyl-tRNA synthetase, cytoplasmic, partial [Zootermopsis nevadensis]
Length=598

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/69 (35%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +1

Query  364  TATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLW  543
            + T  S  +++  ++E+L + F E++ A FPD  DV   + +  +PKFGD+QCN A+ L 
Sbjct  2    SKTRYSGRSSMQCIQEELVQTFTEAVEAAFPDVPDVG--IPVVPSPKFGDFQCNTALQLS  59

Query  544  AKIKVKGTQ  570
              +K +G +
Sbjct  60   QLLKARGVK  68



>ref|XP_008206548.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Nasonia vitripennis]
Length=677

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  322  LRSTSSRFRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNP  501
            L+ T    +S     +T +S    + S+ + L  LFE+++   +PD +D   +++  NNP
Sbjct  64   LKKTLEERKSKHLAVSTNMSESGHMVSIYDTLYTLFEKAIIEAYPDLTDPPVVISSSNNP  123

Query  502  KFGDYQCNNAMSL  540
            KFGDYQCN+A+ L
Sbjct  124  KFGDYQCNSALPL  136



>ref|XP_005991871.1| PREDICTED: arginine--tRNA ligase, cytoplasmic isoform X2 [Latimeria 
chalumnae]
Length=588

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            ++  +L KLF ++++AT+PD  +    +     PKFGDYQCN+AM++   +K KG +
Sbjct  3    NINNRLQKLFGDAIKATYPDMENPPLAVTPSQQPKFGDYQCNSAMAVGQMLKQKGQK  59



>ref|XP_005991870.1| PREDICTED: arginine--tRNA ligase, cytoplasmic isoform X1 [Latimeria 
chalumnae]
Length=660

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            ++  +L KLF ++++AT+PD  +    +     PKFGDYQCN+AM++   +K KG +
Sbjct  75   NINNRLQKLFGDAIKATYPDMENPPLAVTPSQQPKFGDYQCNSAMAVGQMLKQKGQK  131



>ref|XP_005837067.1| Arginyl-tRNA synthetase [Guillardia theta CCMP2712]
 gb|EKX50087.1| Arginyl-tRNA synthetase [Guillardia theta CCMP2712]
Length=695

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +1

Query  337  SRFR-SVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDE-SDVQPMMAICNNPKFG  510
            SR R S G V +  + T+     V++ L +   ++L   F +E  DV PM+AI + P+FG
Sbjct  93   SRLRLSGGSVDSASLETVY----VQQWLERKVTQALCEAFGEEVKDVNPMVAIASKPEFG  148

Query  511  DYQCNNAMSLWAKIKVK  561
            DYQCN AMSL  K+ +K
Sbjct  149  DYQCNVAMSLSKKVGMK  165



>ref|XP_002611646.1| hypothetical protein BRAFLDRAFT_117121 [Branchiostoma floridae]
 gb|EEN67656.1| hypothetical protein BRAFLDRAFT_117121 [Branchiostoma floridae]
Length=485

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 52/96 (54%), Gaps = 4/96 (4%)
 Frame = +1

Query  286  SSLENLMSNNGTLRSTSSRF-RSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDE  462
            + LE L + N  L+  +++  RS+ +  +   + M    +++ QL  +F  S+   FP  
Sbjct  40   AQLEKLYTENAKLKYQANQLKRSLAEEQSRKPAHML---NIQRQLVDIFSLSIHKAFPTL  96

Query  463  SDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            +D   M+ +    KFGDYQCN+AMS+   +K +G +
Sbjct  97   ADPPVMVTLSTQEKFGDYQCNSAMSIGQLLKAQGKK  132



>ref|XP_003690660.1| PREDICTED: LOW QUALITY PROTEIN: arginine--tRNA ligase, cytoplasmic-like 
[Apis florea]
Length=674

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            S+ + L  LFE+++   +P+  +   +++I  NPKFGDYQCN+AM L  ++   G Q
Sbjct  90   SIYDTLYNLFEKAISTAYPNVCEPPVIISISTNPKFGDYQCNSAMPLCKQLNNDGIQ  146



>ref|NP_573081.1| Arginyl-tRNA synthetase [Drosophila melanogaster]
 sp|Q9VXN4.1|SYRC_DROME RecName: Full=Probable arginine--tRNA ligase, cytoplasmic; AltName: 
Full=Arginyl-tRNA synthetase; Short=ArgRS [Drosophila 
melanogaster]
 gb|AAF48524.1| Arginyl-tRNA synthetase [Drosophila melanogaster]
 gb|AAL48546.1| RE02962p [Drosophila melanogaster]
 gb|ACL86432.1| Aats-arg-PA, partial [synthetic construct]
Length=665

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNN--PKFGDYQCNNAMSLWAKIKVKG  564
            S+ E L  +F +++ + FP+  D   ++A  N+   KFGDYQCNNAM L  K+K KG
Sbjct  78   SITEHLESVFRQAIASAFPEFRDTPVIIAPVNSTSAKFGDYQCNNAMGLSKKLKEKG  134



>ref|WP_019487092.1| arginyl-tRNA synthetase [Kamptonema formosum]
Length=585

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATF-PDESDVQPMMAICNNPKFGDYQCNNAMSLWAKI  552
            S  EQL   F+ ++ A F  D +   PM+ + +NPKFGDYQCN AMSL  K+
Sbjct  3    STIEQLKAKFDRAIIAAFGEDLAGTDPMLVLASNPKFGDYQCNAAMSLTKKL  54



>ref|XP_006263319.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Alligator mississippiensis]
Length=661

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 46/87 (53%), Gaps = 4/87 (5%)
 Frame = +1

Query  283  ASSLENLMSNNGTLRSTSSRFR-SVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPD  459
            + SLE L   N  L+   +  R S+      PI +M  + S   +L KLF E+++A +PD
Sbjct  38   SPSLEALRDENTKLKYRLNFLRKSLLDERNKPIKSMININS---RLQKLFGEAIKAAYPD  94

Query  460  ESDVQPMMAICNNPKFGDYQCNNAMSL  540
              +    +     PKFGDYQCN+AM +
Sbjct  95   LENPPLAVTPSQQPKFGDYQCNSAMGI  121



>emb|CAF89939.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=696

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 29/97 (30%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = +1

Query  283  ASSLENLMSNNGTLRSTSSRFRSVGKVTATPISTMT-AVGSVKEQLAKLFEESLRATFPD  459
            ++ LE LM  N  L+    RF  + +      +    A+ ++ ++L ++F  ++R +FP+
Sbjct  38   SAELEALMEENSRLKY---RFNILNRALQEERTRCGHAMVNINQRLQEVFGLAIRTSFPE  94

Query  460  ESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
              +    +A    PKFGDYQCN+AM++   +K KG +
Sbjct  95   LENPPLALAPNQQPKFGDYQCNSAMAMAQMLKAKGVK  131



>emb|CAF97279.1| unnamed protein product [Tetraodon nigroviridis]
Length=697

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 29/97 (30%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = +1

Query  283  ASSLENLMSNNGTLRSTSSRFRSVGKVTATPISTMT-AVGSVKEQLAKLFEESLRATFPD  459
            ++ LE LM  N  L+    RF  + +      +    A+ ++ ++L ++F  ++R +FP+
Sbjct  38   SAELEALMEENSRLKY---RFNILNRALQEERTRCGHAMVNINQRLQEVFGLAIRTSFPE  94

Query  460  ESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
              +    +A    PKFGDYQCN+AM++   +K KG +
Sbjct  95   LENPPLALAPNQQPKFGDYQCNSAMAMAQMLKAKGVK  131



>ref|XP_008292304.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Stegastes partitus]
Length=660

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNN--PKFGDYQCNNAMSLWAKIKVKGTQ  570
            ++ ++L ++F E++RA+ PD  D  P +A+  N   KFGDYQCN+AM+L   +K KG +
Sbjct  75   NINQRLQEIFGEAIRASCPDLDD--PPLAVTPNQQAKFGDYQCNSAMALAQMLKAKGMK  131



>ref|XP_001978023.1| GG19367 [Drosophila erecta]
 gb|EDV46950.1| GG19367 [Drosophila erecta]
Length=664

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNN--PKFGDYQCNNAMSLWAKIKVKG  564
            S+ E L  +F +++ + FP+  D   ++A  N+   KFGDYQCNNAM L  K+K KG
Sbjct  77   SITEHLESVFGQAIASAFPEFRDTPVIIAPVNSTSAKFGDYQCNNAMGLSKKLKEKG  133



>ref|XP_005800426.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Xiphophorus 
maculatus]
Length=658

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 4/60 (7%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNN--PKFGDYQCNNAMSLWAKIKVKGTQF  573
            ++ ++L  +F E++RA+FPD  +  P +A+  N   KFGDYQCN+AM +   +K KG + 
Sbjct  75   NINQRLQDVFGEAIRASFPDLDN--PPLAVTPNQQAKFGDYQCNSAMGMAQMLKTKGAKL  132



>ref|XP_002044201.1| GM22521 [Drosophila sechellia]
 gb|EDW51533.1| GM22521 [Drosophila sechellia]
Length=665

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 44/82 (54%), Gaps = 6/82 (7%)
 Frame = +1

Query  325  RSTSSRFRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNN--  498
            +S +    + G   A P  +     S+ E L  +F +++ + FP+  D   ++A  N+  
Sbjct  57   KSIAEESNAGGGAAAKPKES----SSITEHLESVFGQAIASAFPEFRDTPVIIAPVNSTS  112

Query  499  PKFGDYQCNNAMSLWAKIKVKG  564
             KFGDYQCNNAM L  K+K KG
Sbjct  113  AKFGDYQCNNAMGLSKKLKEKG  134



>ref|XP_002100732.1| GE16015 [Drosophila yakuba]
 gb|EDX01840.1| GE16015 [Drosophila yakuba]
Length=664

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNN--PKFGDYQCNNAMSLWAKIKVKG  564
            S+ E L  +F +++ + FP+  D   ++A  N+   KFGDYQCNNAM L  K+K KG
Sbjct  77   SITEHLESVFGQAIASAFPEFRDTPVIIAPVNSTSAKFGDYQCNNAMGLSKKLKEKG  133



>ref|XP_011063314.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Acromyrmex echinatior]
Length=675

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKG  564
            S+K  ++ +F +++ A +PD  D   ++    NPKFGDYQCN+AM L  ++   G
Sbjct  90   SIKNNVSAVFHKAISAAYPDILDPPVIVTTSTNPKFGDYQCNSAMPLAQQLSSSG  144



>gb|EGI70362.1| Arginyl-tRNA synthetase, cytoplasmic [Acromyrmex echinatior]
Length=684

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKG  564
            S+K  ++ +F +++ A +PD  D   ++    NPKFGDYQCN+AM L  ++   G
Sbjct  96   SIKNNVSAVFHKAISAAYPDILDPPVIVTTSTNPKFGDYQCNSAMPLAQQLSSSG  150



>ref|XP_002076727.1| GD24677 [Drosophila simulans]
 gb|EDX16293.1| GD24677 [Drosophila simulans]
Length=665

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNN--PKFGDYQCNNAMSLWAKIKVKG  564
            S+ E L  +F +++ + FP+  D   ++A  N+   KFGDYQCNNAM L  K+K KG
Sbjct  78   SITEHLESVFGQAIASAFPEFRDTPVIIAPVNSTSAKFGDYQCNNAMGLSKKLKEKG  134



>ref|XP_003056579.1| arginyl-tRNA synthetase [Micromonas pusilla CCMP1545]
 gb|EEH59955.1| arginyl-tRNA synthetase [Micromonas pusilla CCMP1545]
Length=654

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (59%), Gaps = 7/80 (9%)
 Frame = +1

Query  337  SRFRSVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDY  516
            +RF  +    A P+ST     S++  +  +F ++    FP ES +   +A C+N   GDY
Sbjct  55   ARFSEI----AAPVST--GGDSLRSTMKLMFSQAGNVVFPGESSLDFEIAECSNRALGDY  108

Query  517  QCNNAMSLWAKIKVKG-TQF  573
            QCN+AM ++A++K +G T+F
Sbjct  109  QCNSAMKIFAELKDRGDTRF  128



>ref|XP_002425430.1| Arginyl-tRNA synthetase, putative [Pediculus humanus corporis]
 gb|EEB12692.1| Arginyl-tRNA synthetase, putative [Pediculus humanus corporis]
Length=575

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            S++  L  +F+E+++  FP+  +   ++A  NN KFGDYQCN+AM +   +K +G +
Sbjct  59   SIQNTLVSIFKEAIQRAFPELKNAPVVIAASNNSKFGDYQCNSAMPIVQLLKSEGKK  115



>gb|EFX66770.1| hypothetical protein DAPPUDRAFT_302451 [Daphnia pulex]
Length=632

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 36/110 (33%), Positives = 59/110 (54%), Gaps = 11/110 (10%)
 Frame = +1

Query  238  RSAGMLLNGHHQIVKASSLENLMSNNGTLRSTSSRFR-SVGKVTATPISTMTAVGSVKEQ  414
            +S G++    H    AS +E L++ NG L      +R ++ K TA+  S    + ++  +
Sbjct  3    KSGGVV---QHDPEDASEVEKLVAENGKLN-----YRINIMKRTASK-SDPNGMVNILGK  53

Query  415  LAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKG  564
            L +LF+ +++  FPD  D Q ++ +   P FGDYQ N AMSL   +K  G
Sbjct  54   LEELFDSAIKKAFPDIKDFQ-VVVVSTTPNFGDYQFNGAMSLSKLLKTLG  102



>ref|XP_003454001.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 
[Oreochromis niloticus]
Length=661

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  391  AVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            A+ ++ ++L ++F E++RA+ P+  +    +A     KFGDYQCN+AMS+   +K KGT+
Sbjct  73   AMLNINQRLQEVFGEAIRASCPELDNPPLSIAPSQQAKFGDYQCNSAMSMSQMLKAKGTK  132



>ref|XP_011151941.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Harpegnathos saltator]
Length=680

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/65 (37%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  376  ISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            +S  + V S+   L  +F E++   +PD SD   ++   NN KFGDYQCN+AM L   + 
Sbjct  87   VSQDSDVISINNTLCDIFREAIHLAYPDISDPPVIVTTSNNLKFGDYQCNSAMPLAQHLS  146

Query  556  VKGTQ  570
              G +
Sbjct  147  SSGIK  151



>gb|EFN76202.1| Arginyl-tRNA synthetase, cytoplasmic [Harpegnathos saltator]
Length=683

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/65 (37%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +1

Query  376  ISTMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIK  555
            +S  + V S+   L  +F E++   +PD SD   ++   NN KFGDYQCN+AM L   + 
Sbjct  87   VSQDSDVISINNTLCDIFREAIHLAYPDISDPPVIVTTSNNLKFGDYQCNSAMPLAQHLS  146

Query  556  VKGTQ  570
              G +
Sbjct  147  SSGIK  151



>ref|WP_015176954.1| arginyl-tRNA synthetase [Oscillatoria nigro-viridis]
 gb|AFZ07686.1| arginyl-tRNA synthetase [Oscillatoria nigro-viridis PCC 7112]
Length=585

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDE-SDVQPMMAICNNPKFGDYQCNNAMSLWAKI  552
            + S+ +QL   FE++  A F +  +   PM+A  +NP FGD+QCN AMSL  K+
Sbjct  1    MNSIAQQLKAKFEKAFTAAFGESYAGADPMLAAASNPNFGDFQCNAAMSLGKKL  54



>ref|WP_006634878.1| arginyl-tRNA synthetase [Microcoleus vaginatus]
 gb|EGK85094.1| Arginyl-tRNA synthetase [Microcoleus vaginatus FGP-2]
Length=585

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDE-SDVQPMMAICNNPKFGDYQCNNAMSLWAKI  552
            + S+ +QL   FE++  A F +  +   PM+A  +NP FGD+QCN AMSL  K+
Sbjct  1    MNSIAQQLKAKFEKAFTAAFGESYAGADPMLAAASNPNFGDFQCNAAMSLGKKL  54



>ref|WP_017659013.1| arginyl-tRNA synthetase [Geitlerinema sp. PCC 7105]
Length=584

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +1

Query  394  VGSVKEQLAKLFEESLRATFPDE-SDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVK  561
            + S+ EQL   F+ +L   F +E +   P++A  NNPKFGDYQ N AMSL  ++K K
Sbjct  1    MSSIPEQLRLKFDRALVDAFGEELAGTDPLLASTNNPKFGDYQANLAMSLAKRLKQK  57



>gb|EMT04827.1| Arginyl-tRNA synthetase [Aegilops tauschii]
Length=1251

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = +1

Query  379  STMTAVGSVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKV  558
            +T   V SVK  L++L  +SL A   D  DV+PM+ + +   FGDYQCNNAMSL+ +I+ 
Sbjct  22   ATQCRVESVKRHLSRLVVKSLCAVAAD-FDVEPMLEV-SKSGFGDYQCNNAMSLFPRIRE  79

Query  559  KGT  567
              T
Sbjct  80   SAT  82



>ref|XP_005472371.1| PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X2 
[Oreochromis niloticus]
Length=588

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNNPKFGDYQCNNAMSLWAKIKVKGTQ  570
            ++ ++L ++F E++RA+ P+  +    +A     KFGDYQCN+AMS+   +K KGT+
Sbjct  3    NINQRLQEVFGEAIRASCPELDNPPLSIAPSQQAKFGDYQCNSAMSMSQMLKAKGTK  59



>ref|WP_033374337.1| arginyl-tRNA synthetase, partial [Spirulina subsalsa]
Length=489

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQ-PMMAICNNPKFGDYQCNNAMSLWAKIKVK  561
            S+ EQL   F ++L A F +E   Q P++A  NNPKFGDYQCN A++L   ++ K
Sbjct  3    SILEQLKTQFTQALVAAFGEEMVTQDPLIAPTNNPKFGDYQCNVALTLAKPLQQK  57



>ref|XP_006015766.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Alligator sinensis]
Length=650

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 4/87 (5%)
 Frame = +1

Query  283  ASSLENLMSNNGTLRSTSSRFR-SVGKVTATPISTMTAVGSVKEQLAKLFEESLRATFPD  459
            + SLE L   N  L+   +  R S+      PI +M    ++  +L KLF E+++A +PD
Sbjct  27   SPSLEALRDENTKLKYRLNFLRKSLLDERNKPIKSMI---NINGRLQKLFGEAIKAAYPD  83

Query  460  ESDVQPMMAICNNPKFGDYQCNNAMSL  540
              +    +     PKFGDYQCN+AM +
Sbjct  84   LENPPLAVTPSQQPKFGDYQCNSAMGI  110



>gb|AHF48759.1| cytoplasmic arginyl-tRNA synthetase [Caryedes brasiliensis]
Length=672

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +1

Query  388  TAVGSVKEQLAKLFEESLRATFPDESDVQPMMAIC-NNPKFGDYQCNNAMSL  540
            T + S+ E L +LF  ++   FPD +D   ++A+  +NPKFGDYQCN+AM L
Sbjct  82   TRMESIIEVLTELFYNAISTAFPDVADPPVVIALAGSNPKFGDYQCNSAMPL  133



>ref|XP_008331579.1| PREDICTED: arginine--tRNA ligase, cytoplasmic [Cynoglossus semilaevis]
Length=699

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAICNN--PKFGDYQCNNAMSLWAKIKVKGTQ  570
            ++ +QL  +F +++RA+ P+  D  P +A+  N   KFGDYQCN+AM++   +KVKG +
Sbjct  114  NINQQLQHIFGQAIRASCPELQD--PPLAVTPNQQAKFGDYQCNSAMAMAQMLKVKGIK  170



>ref|XP_002771232.1| arginyl-tRNA synthetase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03048.1| arginyl-tRNA synthetase, putative [Perkinsus marinus ATCC 50983]
Length=602

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 8/56 (14%)
 Frame = +1

Query  403  VKEQLAKLFEESLRATFPDESDVQ-----PMMAICNNPKFGDYQCNNAMSLWAKIK  555
            V  Q+ + F ++LR+T P  S++Q     PM+A  N PKFGDYQCNNAM L  K K
Sbjct  4    VSSQVHEAFGKALRSTIP--SNLQASCPDPMVATAN-PKFGDYQCNNAMGLAKKFK  56



>ref|XP_002403306.1| arginyl-tRNA synthetase, putative [Ixodes scapularis]
 gb|EEC03056.1| arginyl-tRNA synthetase, putative [Ixodes scapularis]
Length=662

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 4/57 (7%)
 Frame = +1

Query  400  SVKEQLAKLFEESLRATFPDESDVQPMMAI--CNNPKFGDYQCNNAMSLWAKIKVKG  564
            S ++ L KLF +++RA FPD  D  P++ +   +N KFGDYQCN AM L   +K  G
Sbjct  80   SPRDVLLKLFRQAVRAAFPDVED--PLVPVLPSSNEKFGDYQCNAAMPLSQALKKAG  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 709432151500