BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7309

Length=831
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG09712.1|  Chaperonin CPN60-2, mitochondrial                       324   9e-106   Gossypium arboreum [tree cotton]
ref|XP_004147171.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       330   1e-105   Cucumis sativus [cucumbers]
ref|XP_008460701.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       328   5e-105   Cucumis melo [Oriental melon]
ref|XP_002285608.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       328   8e-105   Vitis vinifera
gb|KHG24292.1|  Chaperonin CPN60-2, mitochondrial                       327   2e-104   Gossypium arboreum [tree cotton]
sp|Q05046.1|CH62_CUCMA  RecName: Full=Chaperonin CPN60-2, mitocho...    327   2e-104   Cucurbita maxima [Boston marrow]
gb|KJB37765.1|  hypothetical protein B456_006G219200                    327   3e-104   Gossypium raimondii
gb|KHG09711.1|  Chaperonin CPN60-2, mitochondrial                       327   3e-104   Gossypium arboreum [tree cotton]
ref|XP_010264000.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       325   7e-104   Nelumbo nucifera [Indian lotus]
ref|XP_007034504.1|  Heat shock protein 60 isoform 1                    325   1e-103   
sp|Q05045.1|CH61_CUCMA  RecName: Full=Chaperonin CPN60-1, mitocho...    325   2e-103   Cucurbita maxima [Boston marrow]
ref|NP_001064784.1|  Os10g0462900                                       324   2e-103   
gb|AGT98547.1|  heat shock protein 60                                   311   4e-103   Paeonia lactiflora [common garden peony]
ref|XP_010527490.1|  PREDICTED: chaperonin CPN60, mitochondrial         323   4e-103   Tarenaya hassleriana [spider flower]
ref|XP_010556941.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    323   7e-103   Tarenaya hassleriana [spider flower]
ref|XP_002303091.1|  Chaperonin CPN60-2 family protein                  323   7e-103   Populus trichocarpa [western balsam poplar]
gb|ABP01596.1|  heat shock protein 60                                   316   9e-103   Ageratina adenophora
ref|XP_010097984.1|  Chaperonin CPN60-2                                 318   1e-102   
ref|XP_011024539.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    323   1e-102   Populus euphratica
gb|AAP54159.2|  Chaperonin CPN60-1, mitochondrial precursor, puta...    324   1e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008349053.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    318   1e-102   
ref|XP_010243653.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    322   1e-102   Nelumbo nucifera [Indian lotus]
ref|XP_009800688.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       322   1e-102   Nicotiana sylvestris
ref|XP_004239874.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       322   2e-102   Solanum lycopersicum
ref|XP_006355738.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    322   2e-102   Solanum tuberosum [potatoes]
ref|XP_003591643.1|  Chaperonin CPN60-like protein                      322   2e-102   Medicago truncatula
gb|AFW68650.1|  chaperonin 1                                            309   2e-102   
emb|CDX79518.1|  BnaC03g18540D                                          308   4e-102   
ref|XP_010522438.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    321   6e-102   Tarenaya hassleriana [spider flower]
ref|XP_006662418.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    320   7e-102   Oryza brachyantha
emb|CDO99385.1|  unnamed protein product                                320   7e-102   Coffea canephora [robusta coffee]
ref|XP_008810807.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       320   8e-102   Phoenix dactylifera
ref|XP_010918836.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       320   1e-101   Elaeis guineensis
gb|KDO43056.1|  hypothetical protein CISIN_1g013743mg                   313   1e-101   Citrus sinensis [apfelsine]
gb|KDO43055.1|  hypothetical protein CISIN_1g013743mg                   315   2e-101   Citrus sinensis [apfelsine]
ref|XP_011091383.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       319   2e-101   Sesamum indicum [beniseed]
ref|XP_009616503.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       319   2e-101   Nicotiana tomentosiformis
ref|XP_009371099.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    319   3e-101   Pyrus x bretschneideri [bai li]
ref|XP_002885624.1|  hypothetical protein ARALYDRAFT_898985             319   3e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_007201704.1|  hypothetical protein PRUPE_ppa004110mg             317   4e-101   
ref|NP_189041.1|  heat shock protein 60                                 318   4e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CAA77646.1|  chaperonin hsp60                                       318   4e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAN63805.1|  heat shock protein 60                                   317   6e-101   Prunus dulcis [sweet almond]
ref|XP_010550847.1|  PREDICTED: chaperonin CPN60, mitochondrial-like    318   6e-101   Tarenaya hassleriana [spider flower]
gb|EYU46365.1|  hypothetical protein MIMGU_mgv1a026299mg                317   9e-101   Erythranthe guttata [common monkey flower]
gb|EMS57340.1|  Chaperonin CPN60-2, mitochondrial                       318   9e-101   Triticum urartu
ref|XP_010023772.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       317   1e-100   Eucalyptus grandis [rose gum]
ref|XP_008346198.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       317   1e-100   
gb|ABK92479.1|  unknown                                                 313   1e-100   Populus trichocarpa [western balsam poplar]
ref|XP_009599981.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    317   2e-100   Nicotiana tomentosiformis
ref|XP_008224072.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       317   3e-100   Prunus mume [ume]
ref|XP_006340914.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    317   3e-100   Solanum tuberosum [potatoes]
dbj|BAK05600.1|  predicted protein                                      316   3e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007225634.1|  hypothetical protein PRUPE_ppa003391mg             317   3e-100   Prunus persica
ref|XP_006492150.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    316   3e-100   Citrus sinensis [apfelsine]
ref|XP_004247810.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       316   4e-100   Solanum lycopersicum
gb|ACN31425.1|  unknown                                                 309   4e-100   Zea mays [maize]
ref|XP_004496080.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    316   4e-100   Cicer arietinum [garbanzo]
ref|XP_008372428.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin C...    315   6e-100   
ref|XP_003574012.1|  PREDICTED: chaperonin CPN60-1, mitochondrial       315   7e-100   Brachypodium distachyon [annual false brome]
emb|CDX93002.1|  BnaA03g37240D                                          314   8e-100   
ref|XP_003556325.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    315   1e-99    Glycine max [soybeans]
gb|EMT21164.1|  Chaperonin CPN60-2, mitochondrial                       316   1e-99    
ref|XP_012085173.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    315   1e-99    Jatropha curcas
ref|XP_010933209.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    315   1e-99    Elaeis guineensis
ref|XP_009758421.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    315   1e-99    Nicotiana sylvestris
ref|XP_008812917.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    316   1e-99    Phoenix dactylifera
ref|XP_004496079.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    315   1e-99    
ref|XP_006410461.1|  hypothetical protein EUTSA_v10016427mg             315   2e-99    Eutrema salsugineum [saltwater cress]
ref|XP_003536270.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    314   2e-99    Glycine max [soybeans]
ref|XP_009135882.1|  PREDICTED: chaperonin CPN60, mitochondrial         314   2e-99    Brassica rapa
emb|CDX94835.1|  BnaC03g43530D                                          314   2e-99    
ref|XP_002299295.2|  Chaperonin CPN60-2 family protein                  314   2e-99    Populus trichocarpa [western balsam poplar]
gb|EMT05673.1|  Chaperonin CPN60-2, mitochondrial                       314   2e-99    
emb|CDX84697.1|  BnaA03g15330D                                          313   2e-99    
gb|KHN00995.1|  Chaperonin CPN60-2, mitochondrial                       314   3e-99    Glycine soja [wild soybean]
ref|XP_009420744.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       313   3e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299212.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       313   6e-99    Fragaria vesca subsp. vesca
ref|XP_010469503.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    313   8e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010509916.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    313   8e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010413901.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    313   9e-99    Camelina sativa [gold-of-pleasure]
ref|XP_006297236.1|  hypothetical protein CARUB_v10013241mg             313   9e-99    
ref|XP_011002149.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       312   9e-99    Populus euphratica
ref|XP_006841664.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       312   1e-98    Amborella trichopoda
ref|XP_010513304.1|  PREDICTED: chaperonin CPN60, mitochondrial-like    312   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_002467123.1|  hypothetical protein SORBIDRAFT_01g020010          312   1e-98    Sorghum bicolor [broomcorn]
ref|XP_009132917.1|  PREDICTED: chaperonin CPN60, mitochondrial         312   1e-98    Brassica rapa
ref|XP_007144180.1|  hypothetical protein PHAVU_007G135100g             312   1e-98    Phaseolus vulgaris [French bean]
ref|XP_006410460.1|  hypothetical protein EUTSA_v10016425mg             312   1e-98    Eutrema salsugineum [saltwater cress]
ref|XP_010466805.1|  PREDICTED: chaperonin CPN60, mitochondrial         312   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_004982955.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    312   1e-98    Setaria italica
ref|XP_002881268.1|  hypothetical protein ARALYDRAFT_902390             312   2e-98    Arabidopsis lyrata subsp. lyrata
ref|XP_004290029.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    312   2e-98    Fragaria vesca subsp. vesca
sp|P35480.1|CH60_BRANA  RecName: Full=Chaperonin CPN60, mitochond...    312   2e-98    Brassica napus [oilseed rape]
ref|XP_012077667.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       311   2e-98    Jatropha curcas
gb|AAC04902.1|  mitochondrial chaperonin (HSP60)                        310   2e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AFK46346.1|  unknown                                                 304   2e-98    Medicago truncatula
ref|XP_002521151.1|  chaperonin-60kD, ch60, putative                    311   3e-98    Ricinus communis
ref|XP_006651029.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    311   3e-98    Oryza brachyantha
ref|XP_002518171.1|  chaperonin-60kD, ch60, putative                    311   3e-98    Ricinus communis
ref|XP_007145430.1|  hypothetical protein PHAVU_007G238500g             311   3e-98    Phaseolus vulgaris [French bean]
ref|NP_850203.1|  heat shock protein 60-2                               311   3e-98    Arabidopsis thaliana [mouse-ear cress]
sp|P29185.2|CH61_MAIZE  RecName: Full=Chaperonin CPN60-1, mitocho...    311   4e-98    Zea mays [maize]
ref|NP_001105690.1|  chaperonin CPN60-2, mitochondrial precursor        311   4e-98    Zea mays [maize]
emb|CAA77645.1|  chaperonin hsp60                                       311   4e-98    Zea mays [maize]
ref|XP_008644293.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    311   5e-98    
ref|XP_003535967.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    310   5e-98    Glycine max [soybeans]
ref|NP_001189665.1|  heat shock protein 60-2                            311   5e-98    Arabidopsis thaliana [mouse-ear cress]
gb|EMS53265.1|  Chaperonin CPN60-2, mitochondrial                       312   5e-98    Triticum urartu
ref|NP_001105716.1|  chaperonin CPN60-1, mitochondrial precursor        310   6e-98    Zea mays [maize]
emb|CAA78101.1|  mitochondrial chaperonin-60                            310   6e-98    Zea mays [maize]
ref|XP_003558831.1|  PREDICTED: chaperonin CPN60-1, mitochondrial       310   6e-98    Brachypodium distachyon [annual false brome]
gb|KJB42389.1|  hypothetical protein B456_007G151700                    308   8e-98    Gossypium raimondii
emb|CDY59050.1|  BnaC07g48200D                                          302   8e-98    Brassica napus [oilseed rape]
ref|XP_003591642.1|  Chaperonin CPN60-2                                 309   2e-97    Medicago truncatula
gb|KJB42386.1|  hypothetical protein B456_007G151700                    309   2e-97    Gossypium raimondii
gb|KFK31072.1|  hypothetical protein AALP_AA6G064600                    309   3e-97    Arabis alpina [alpine rockcress]
ref|XP_009362047.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    308   3e-97    Pyrus x bretschneideri [bai li]
ref|XP_006293894.1|  hypothetical protein CARUB_v10022887mg             308   4e-97    Capsella rubella
gb|AAA33450.1|  chaperonin 60                                           308   4e-97    Zea mays [maize]
ref|XP_003555721.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    308   4e-97    Glycine max [soybeans]
ref|XP_010109672.1|  Chaperonin CPN60-2                                 307   1e-96    Morus notabilis
ref|XP_011622760.1|  PREDICTED: chaperonin CPN60, mitochondrial         307   1e-96    Amborella trichopoda
ref|XP_008358471.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       307   1e-96    
ref|XP_009377449.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       307   1e-96    Pyrus x bretschneideri [bai li]
emb|CDY17152.1|  BnaA05g10360D                                          307   1e-96    Brassica napus [oilseed rape]
ref|XP_009405691.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    307   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|ERN04382.1|  hypothetical protein AMTR_s00147p00091670               306   2e-96    Amborella trichopoda
ref|XP_009143882.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    307   2e-96    Brassica rapa
emb|CDY19471.1|  BnaC04g11280D                                          306   2e-96    Brassica napus [oilseed rape]
ref|NP_001048938.1|  Os03g0143400                                       306   3e-96    
ref|XP_007049890.1|  Heat shock protein 60 isoform 1                    304   2e-95    
ref|XP_004139642.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    303   5e-95    Cucumis sativus [cucumbers]
ref|XP_004985740.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    301   2e-94    Setaria italica
gb|EYU43803.1|  hypothetical protein MIMGU_mgv1a003536mg                301   4e-94    Erythranthe guttata [common monkey flower]
gb|KFK31073.1|  hypothetical protein AALP_AA6G064700                    300   6e-94    Arabis alpina [alpine rockcress]
emb|CDP03832.1|  unnamed protein product                                298   4e-93    Coffea canephora [robusta coffee]
ref|XP_011020718.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    297   8e-93    Populus euphratica
ref|XP_010666478.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       290   3e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002966324.1|  hypothetical protein SELMODRAFT_85251              288   1e-89    
ref|XP_008235753.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    287   4e-89    Prunus mume [ume]
ref|XP_001772410.1|  predicted protein                                  287   6e-89    
ref|XP_002978237.1|  hypothetical protein SELMODRAFT_108429             286   1e-88    
gb|KFK24236.1|  hypothetical protein AALP_AAs53933U000100               273   3e-88    Arabis alpina [alpine rockcress]
ref|XP_001783814.1|  predicted protein                                  283   1e-87    
ref|XP_001760735.1|  predicted protein                                  281   1e-86    
ref|XP_001762115.1|  predicted protein                                  281   1e-86    
ref|XP_008808005.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    270   6e-84    Phoenix dactylifera
gb|AEZ00902.1|  putative mitochondrial chaperonin HSP60 protein         258   1e-82    Elaeis guineensis
ref|XP_008807997.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    271   1e-82    Phoenix dactylifera
ref|XP_009410784.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    270   3e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925015.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    265   5e-82    
ref|XP_010106240.1|  hypothetical protein L484_005105                   267   1e-81    
ref|XP_010925013.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    266   5e-81    Elaeis guineensis
gb|EMT28156.1|  Chaperonin CPN60-like 2, mitochondrial                  266   1e-80    
dbj|BAJ88210.1|  predicted protein                                      265   1e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001140224.1|  uncharacterized protein LOC100272259               261   1e-80    
ref|XP_010242227.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    265   3e-80    Nelumbo nucifera [Indian lotus]
ref|XP_004961365.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    264   4e-80    Setaria italica
ref|XP_007215308.1|  hypothetical protein PRUPE_ppa003440mg             263   8e-80    Prunus persica
ref|XP_008228292.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    263   1e-79    Prunus mume [ume]
ref|XP_003567994.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    262   2e-79    Brachypodium distachyon [annual false brome]
ref|XP_008647482.1|  PREDICTED: uncharacterized protein LOC100272...    262   2e-79    Zea mays [maize]
ref|XP_008647480.1|  PREDICTED: uncharacterized protein LOC100272...    262   2e-79    
ref|XP_002441451.1|  hypothetical protein SORBIDRAFT_09g026970          262   2e-79    Sorghum bicolor [broomcorn]
ref|XP_010654528.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    261   5e-79    Vitis vinifera
emb|CAN78641.1|  hypothetical protein VITISV_031740                     261   7e-79    Vitis vinifera
emb|CBI35954.3|  unnamed protein product                                260   8e-79    Vitis vinifera
ref|XP_002967038.1|  hypothetical protein SELMODRAFT_87823              259   1e-78    
gb|AFW78925.1|  putative TCP-1/cpn60 chaperonin family protein          262   1e-78    
ref|XP_012068975.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    259   2e-78    Jatropha curcas
ref|XP_012068973.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    259   3e-78    Jatropha curcas
ref|XP_008391328.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    259   4e-78    Malus domestica [apple tree]
gb|KHN11282.1|  Chaperonin CPN60-like 2, mitochondrial                  258   4e-78    Glycine soja [wild soybean]
ref|XP_002946991.1|  hypothetical protein VOLCADRAFT_79395              258   5e-78    Volvox carteri f. nagariensis
ref|XP_006585518.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    256   6e-78    
ref|XP_006655538.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    258   9e-78    Oryza brachyantha
gb|KDO65217.1|  hypothetical protein CISIN_1g0081811mg                  246   1e-77    Citrus sinensis [apfelsine]
gb|KJB56921.1|  hypothetical protein B456_009G141700                    253   1e-77    Gossypium raimondii
ref|XP_002960969.1|  hypothetical protein SELMODRAFT_74977              256   1e-77    
ref|XP_003531614.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    257   2e-77    Glycine max [soybeans]
ref|XP_009341038.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    256   3e-77    Pyrus x bretschneideri [bai li]
ref|XP_001691353.1|  chaperonin 60C                                     255   3e-77    Chlamydomonas reinhardtii
ref|XP_004510380.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    256   6e-77    Cicer arietinum [garbanzo]
gb|AFK48092.1|  unknown                                                 249   6e-77    Lotus japonicus
emb|CBL93634.1|  mitochondrial chaperonin 60 precursor                  256   7e-77    Chlamydomonas reinhardtii
ref|XP_004297534.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    255   1e-76    Fragaria vesca subsp. vesca
ref|XP_003627097.1|  Chaperonin CPN60-like protein                      255   1e-76    Medicago truncatula
gb|KJB56920.1|  hypothetical protein B456_009G141700                    253   1e-76    Gossypium raimondii
ref|XP_007135549.1|  hypothetical protein PHAVU_010G138700g             254   1e-76    Phaseolus vulgaris [French bean]
emb|CDO97909.1|  unnamed protein product                                254   2e-76    Coffea canephora [robusta coffee]
gb|KJB56919.1|  hypothetical protein B456_009G141700                    254   3e-76    Gossypium raimondii
ref|NP_566466.1|  heat shock protein 60-3A                              254   3e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011072524.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    253   5e-76    Sesamum indicum [beniseed]
ref|XP_006583012.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    253   7e-76    Glycine max [soybeans]
gb|EYU21369.1|  hypothetical protein MIMGU_mgv1a003594mg                253   8e-76    Erythranthe guttata [common monkey flower]
ref|XP_002527401.1|  chaperonin-60kD, ch60, putative                    252   1e-75    Ricinus communis
ref|XP_002884993.1|  hypothetical protein ARALYDRAFT_478789             252   1e-75    Arabidopsis lyrata subsp. lyrata
ref|XP_010534892.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    252   2e-75    Tarenaya hassleriana [spider flower]
ref|NP_001056181.1|  Os05g0540300                                       251   3e-75    
ref|XP_007024507.1|  Heat shock protein 60-3A isoform 3                 250   3e-75    
gb|KHN39306.1|  Chaperonin CPN60-like 2, mitochondrial                  251   4e-75    Glycine soja [wild soybean]
ref|XP_010465258.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    250   6e-75    Camelina sativa [gold-of-pleasure]
ref|XP_007024505.1|  Heat shock protein 60-3A isoform 1                 250   7e-75    
ref|XP_009796310.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    250   7e-75    Nicotiana sylvestris
ref|XP_010501368.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    250   8e-75    Camelina sativa [gold-of-pleasure]
ref|XP_006385442.1|  hypothetical protein POPTR_0003s04540g             245   8e-75    
gb|EEC79614.1|  hypothetical protein OsI_20809                          250   1e-74    Oryza sativa Indica Group [Indian rice]
emb|CDX82514.1|  BnaA03g33070D                                          249   1e-74    
ref|XP_010685392.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    249   2e-74    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009135334.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    249   2e-74    Brassica rapa
emb|CDX75733.1|  BnaC03g38160D                                          249   3e-74    
ref|XP_004235594.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    249   3e-74    Solanum lycopersicum
ref|XP_009629888.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    248   4e-74    Nicotiana tomentosiformis
ref|XP_006342978.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin C...    248   4e-74    
ref|XP_011659644.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    248   4e-74    Cucumis sativus [cucumbers]
ref|XP_010062630.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    248   5e-74    Eucalyptus grandis [rose gum]
ref|XP_006296696.1|  hypothetical protein CARUB_v10013333mg             248   6e-74    Capsella rubella
ref|XP_010487162.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    248   6e-74    Camelina sativa [gold-of-pleasure]
gb|KFK38736.1|  hypothetical protein AALP_AA3G153700                    247   1e-73    Arabis alpina [alpine rockcress]
ref|XP_006466018.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    246   2e-73    Citrus sinensis [apfelsine]
ref|XP_006426562.1|  hypothetical protein CICLE_v10025257mg             246   2e-73    Citrus clementina [clementine]
gb|KDP40768.1|  hypothetical protein JCGZ_24767                         255   2e-73    Jatropha curcas
ref|XP_008462350.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    246   4e-73    Cucumis melo [Oriental melon]
gb|KCW69759.1|  hypothetical protein EUGRSUZ_F03134                     247   5e-73    Eucalyptus grandis [rose gum]
gb|ABX76300.1|  heat shock protein 60                                   244   7e-73    Ageratina adenophora
ref|XP_002881304.1|  predicted protein                                  233   1e-72    
gb|EPS57724.1|  hypothetical protein M569_17093                         233   1e-72    Genlisea aurea
ref|XP_006407158.1|  hypothetical protein EUTSA_v10020386mg             244   2e-72    Eutrema salsugineum [saltwater cress]
emb|CDY37741.1|  BnaA04g19270D                                          244   4e-72    Brassica napus [oilseed rape]
ref|XP_007034505.1|  Heat shock protein 60 isoform 2                    241   4e-72    
gb|EWM24608.1|  Chaperonin Cpn60/TCP-1                                  241   3e-71    Nannochloropsis gaditana
gb|EWM24609.1|  Chaperonin Cpn60/TCP-1                                  240   5e-71    Nannochloropsis gaditana
dbj|GAM29219.1|  hypothetical protein SAMD00019534_123950               237   3e-70    Acytostelium subglobosum LB1
dbj|BAL45644.1|  heat shock protein 60                                  236   2e-69    Ulva pertusa
dbj|BAL45642.1|  heat shock protein 60                                  235   5e-69    Ulva pertusa
ref|XP_008299606.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    232   1e-68    Stegastes partitus
ref|XP_005848352.1|  hypothetical protein CHLNCDRAFT_51922              232   2e-68    Chlorella variabilis
gb|KDD77186.1|  TCP-1/cpn60 chaperonin                                  233   4e-68    Helicosporidium sp. ATCC 50920
emb|CBJ29791.1|  conserved unknown protein                              232   5e-68    Ectocarpus siliculosus
ref|XP_008299605.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    232   8e-68    Stegastes partitus
ref|XP_008862081.1|  chaperonin GroL                                    231   1e-67    Aphanomyces invadans
gb|EUC55864.1|  TCP-1/cpn60 chaperonin family protein                   221   1e-67    Rhizoctonia solani AG-3 Rhs1AP
ref|XP_011401079.1|  Chaperonin CPN60, mitochondrial                    231   1e-67    Auxenochlorella protothecoides
ref|XP_008862079.1|  chaperonin GroL                                    231   2e-67    Aphanomyces invadans
ref|XP_003064760.1|  predicted protein                                  230   2e-67    Micromonas pusilla CCMP1545
ref|XP_004359903.1|  chaperonin 60                                      230   2e-67    Cavenderia fasciculata
gb|KEP47507.1|  heat shock protein                                      221   3e-67    Rhizoctonia solani 123E
gb|ADM73510.1|  heat shock protein                                      230   3e-67    Epinephelus akaara
ref|WP_025898344.1|  molecular chaperone GroEL                          229   3e-67    Sneathiella glossodoripedis
ref|XP_010746058.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    229   3e-67    
ref|XP_003456322.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    230   4e-67    Oreochromis niloticus
gb|AIS72878.1|  heat shock protein 60                                   230   4e-67    Epinephelus coioides [estuary cod]
ref|XP_010746059.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    230   5e-67    
ref|XP_006805883.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    229   6e-67    Neolamprologus brichardi [lyretail cichlid]
ref|XP_009842908.1|  chaperonin GroL                                    229   6e-67    Aphanomyces astaci
ref|XP_003286221.1|  chaperonin 60                                      228   1e-66    Dictyostelium purpureum
ref|XP_008894090.1|  chaperonin GroL                                    229   1e-66    Phytophthora parasitica INRA-310
ref|XP_009141297.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    228   2e-66    
ref|XP_006811178.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    220   2e-66    Saccoglossus kowalevskii
gb|KJB42388.1|  hypothetical protein B456_007G151700                    226   2e-66    Gossypium raimondii
ref|XP_004569892.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    228   2e-66    
ref|WP_028831782.1|  molecular chaperone GroEL                          227   2e-66    
ref|XP_002901426.1|  chaperonin CPN60-1, mitochondrial precursor        228   3e-66    Phytophthora infestans T30-4
emb|CDY66712.1|  BnaCnng52030D                                          228   3e-66    Brassica napus [oilseed rape]
ref|XP_005746374.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    228   3e-66    Pundamilia nyererei
ref|XP_003886122.1|  KLLA0F09449p, related                              228   3e-66    Neospora caninum Liverpool
gb|ABE02805.1|  heat shock protein 60                                   228   3e-66    Rhizophagus intraradices
gb|ADR79280.1|  Hsp60                                                   228   4e-66    Brachionus ibericus
ref|XP_002504338.1|  predicted protein                                  226   4e-66    Micromonas commoda
ref|XP_005816401.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    227   4e-66    Xiphophorus maculatus
ref|XP_007578942.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    227   4e-66    Poecilia formosa
ref|XP_008435956.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    227   4e-66    Poecilia reticulata
ref|XP_008604447.1|  chaperonin GroL                                    227   5e-66    Saprolegnia diclina VS20
ref|XP_008883792.1|  heat shock protein HSP60                           227   6e-66    
gb|AAD38419.1|  heat shock protein 60                                   227   6e-66    Toxoplasma gondii
ref|XP_002367122.1|  heat shock protein 60                              227   6e-66    Toxoplasma gondii ME49
emb|CBK24112.2|  unnamed protein product                                226   7e-66    Blastocystis hominis
gb|ABE02806.1|  heat shock protein 60                                   227   7e-66    Rhizophagus intraradices
ref|XP_002963470.1|  hypothetical protein SELMODRAFT_405358             225   7e-66    
ref|XP_002110795.1|  hypothetical protein TRIADDRAFT_54071              226   1e-65    
gb|AGU38790.1|  60 kDa heat shock protein                               226   1e-65    
ref|XP_504920.1|  YALI0F02805p                                          226   1e-65    
ref|XP_003961681.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    226   1e-65    
ref|XP_007227826.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    226   1e-65    
ref|XP_009535382.1|  hypothetical protein PHYSODRAFT_549587             226   2e-65    
gb|ADU34083.1|  60 kDa heat shock protein                               226   2e-65    
gb|AEM65177.1|  heat shock protein 60                                   225   2e-65    
emb|CEF99267.1|  Chaperonin Cpn60                                       226   2e-65    
gb|ACN60194.1|  60 kDa heat shock protein, mitochondrial precursor      218   2e-65    
ref|WP_022727012.1|  molecular chaperone GroEL                          224   2e-65    
ref|NP_851847.1|  60 kDa heat shock protein, mitochondrial              225   3e-65    
gb|ADK27679.1|  heat shock protein 60                                   225   3e-65    
gb|ABN11936.1|  putative 60 kDa heat shock protein                      214   3e-65    
emb|CCQ48609.1|  chaperonin 60                                          225   3e-65    
ref|XP_004086930.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    225   4e-65    
emb|CEG63693.1|  Putative Chaperonin Cpn60                              225   4e-65    
emb|CEI91416.1|  Putative Heat shock protein 60                         224   4e-65    
gb|EJY67525.1|  hypothetical protein OXYTRI_11964                       225   4e-65    
ref|WP_026986320.1|  molecular chaperone GroEL                          224   4e-65    
ref|XP_011471912.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    225   4e-65    
gb|ABB76381.1|  heat shock protein 60 kDa                               224   4e-65    
ref|WP_037990063.1|  molecular chaperone GroEL                          224   5e-65    
ref|WP_007090383.1|  molecular chaperone GroEL                          224   5e-65    
ref|XP_003081465.1|  chaperonin-60, mitochondrial precursor (IC)        226   5e-65    
gb|ABB76384.1|  heat shock protein 60 kDa                               224   5e-65    
ref|XP_007586200.1|  putative heat shock protein mitochondrial pr...    224   5e-65    
emb|CBM69252.1|  heat shock protein 60                                  224   5e-65    
gb|ESA22226.1|  hypothetical protein GLOINDRAFT_115691                  224   5e-65    
gb|AAH18545.1|  Hspd1 protein                                           215   6e-65    
gb|KEP46963.1|  heat shock protein                                      224   6e-65    
ref|WP_022187336.1|  molecular chaperone GroEL                          224   6e-65    
gb|EKG16075.1|  Chaperonin Cpn60                                        224   6e-65    
gb|EKF32414.1|  chaperonin HSP60/CNP60, putative                        213   7e-65    
ref|XP_002988181.1|  hypothetical protein SELMODRAFT_159265             223   7e-65    
emb|CAG02593.1|  unnamed protein product                                224   8e-65    
emb|CDS09381.1|  Putative Hsp60-like protein                            224   1e-64    
ref|WP_038036676.1|  molecular chaperone GroEL                          223   1e-64    
gb|ABQ85794.1|  chaperonin 60                                           223   1e-64    
gb|EIE82168.1|  hsp60-like protein                                      223   1e-64    
ref|WP_043647224.1|  molecular chaperone GroEL                          212   1e-64    
gb|ACZ97602.1|  heat shock protein 60                                   213   1e-64    
ref|WP_025291094.1|  molecular chaperone GroEL                          222   2e-64    
ref|WP_022005890.1|  molecular chaperone GroEL                          222   2e-64    
ref|WP_044827409.1|  molecular chaperone GroEL                          222   2e-64    
ref|XP_002785716.1|  heat shock protein 60, putative                    223   2e-64    
gb|ABJ97613.1|  mitochondrial 60 kDa heat shock protein                 221   2e-64    
ref|XP_009227414.1|  heat shock protein 60                              223   2e-64    
ref|WP_024080866.1|  molecular chaperone GroEL                          222   2e-64    
gb|KHJ33155.1|  putative heat shock protein 60                          223   2e-64    
gb|AGK45628.1|  heat shock protein 60                                   223   2e-64    
ref|WP_008829923.1|  molecular chaperone GroEL                          222   2e-64    
emb|CCO36244.1|  Heat shock protein 60 AltName: Full=60 kDa chape...    223   2e-64    
ref|XP_001419890.1|  chaperonin 60, mitochondrial                       223   2e-64    
ref|XP_005646765.1|  mitochondrial chaperonin 60                        222   3e-64    
gb|AHN60091.1|  heat shock protein 60                                   223   3e-64    
ref|WP_036528739.1|  molecular chaperone GroEL                          221   3e-64    
ref|WP_033067622.1|  molecular chaperone GroEL                          222   3e-64    
gb|EKF28291.1|  chaperonin HSP60/CNP60, putative                        214   3e-64    
gb|EIE77419.1|  hsp60-like protein                                      222   3e-64    
ref|XP_003716826.1|  heat shock protein 60                              223   3e-64    
ref|XP_007510337.1|  chaperonin GroEL                                   223   4e-64    
emb|CCO36707.1|  Heat shock protein 60 AltName: Full=60 kDa chape...    222   5e-64    
ref|XP_636839.1|  chaperonin 60                                         221   5e-64    
emb|CEL61194.1|  Heat shock protein 60, mitochondrial OS=Paracocc...    222   5e-64    
ref|XP_819510.1|  chaperonin HSP60, mitochondrial precursor             213   5e-64    
gb|AAK49534.1|AF359268_1  chaperonin 60                                 221   5e-64    
gb|AFM73646.1|  heat shock protein 60                                   213   6e-64    
gb|AGK38254.1|  HSP60                                                   221   6e-64    
ref|XP_009863848.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   6e-64    
gb|AHB82279.1|  heat shock protein 60                                   221   7e-64    
gb|KFP74423.1|  hypothetical protein N311_07171                         217   7e-64    
gb|EWZ01910.1|  heat shock protein 60, mitochondrial                    218   7e-64    
gb|EWG43456.1|  heat shock protein 60, mitochondrial                    218   7e-64    
gb|EPQ64594.1|  Tetradecameric mitochondrial chaperonin                 221   8e-64    
ref|WP_044418420.1|  molecular chaperone GroEL                          213   9e-64    
ref|XP_001395564.1|  heat shock protein 60                              221   9e-64    
ref|WP_045776103.1|  molecular chaperone GroEL                          217   9e-64    
emb|CCA20827.1|  mitochondriatargeted chaperonin putative               221   9e-64    
ref|WP_022079109.1|  molecular chaperone GroEL                          220   1e-63    
ref|WP_027298755.1|  molecular chaperone GroEL                          220   1e-63    
gb|KHO02050.1|  Heat shock protein 60 precursor (Antigen HIS-62)        221   1e-63    
ref|XP_005708137.1|  chaperonin GroEL                                   221   1e-63    
gb|KIJ57314.1|  hypothetical protein M422DRAFT_773922                   221   1e-63    
gb|ADN34111.1|  chaperonin-60 kDa protein                               225   1e-63    
ref|WP_011542364.1|  molecular chaperone GroEL                          220   1e-63    
ref|WP_020694061.1|  molecular chaperone GroEL                          220   1e-63    
ref|XP_663693.1|  HS60_PARBR Heat shock protein 60, mitochondrial...    221   1e-63    
gb|ABI26641.1|  HSP60                                                   221   1e-63    
ref|XP_002778119.1|  heat shock protein 60, putative                    220   1e-63    
ref|WP_020818487.1|  MULTISPECIES: molecular chaperone GroEL            219   2e-63    
ref|XP_011324894.1|  heat shock protein 60                              221   2e-63    
ref|XP_008713891.1|  hsp60-like protein                                 221   2e-63    
gb|AIU47033.1|  heat shock protein                                      220   2e-63    
ref|XP_002783469.1|  heat shock protein 60, putative                    220   2e-63    
ref|WP_028739813.1|  hypothetical protein                               211   2e-63    
gb|AEE61633.1|  unknown                                                 220   2e-63    
emb|CCI46088.1|  unnamed protein product                                220   2e-63    
ref|XP_006117980.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    220   2e-63    
emb|CDK26533.1|  unnamed protein product                                220   2e-63    
ref|XP_971630.1|  PREDICTED: 60 kDa heat shock protein, mitochond...    220   2e-63    
ref|WP_029009456.1|  molecular chaperone GroEL                          219   2e-63    
ref|XP_001218472.1|  heat shock protein 60, mitochondrial precursor     220   3e-63    
gb|ENN78676.1|  hypothetical protein YQE_04848                          221   3e-63    
ref|XP_007910972.1|  putative heat shock protein 60 protein             220   3e-63    
ref|WP_022730236.1|  molecular chaperone GroEL                          219   3e-63    
dbj|GAM33428.1|  mitochondrial heat shock protein                       220   3e-63    
emb|CDW59388.1|  chaperonin protein heat shock protein60                220   3e-63    
emb|CCU80781.1|  heat shock protein 60, mitochondrial precursor         219   3e-63    
ref|WP_014745213.1|  molecular chaperone GroEL                          219   4e-63    
ref|XP_006961679.1|  hsp60 mitochondrial precursor-like protein         219   4e-63    
dbj|GAA86507.1|  heat shock protein 60, mitochondrial precursor         219   4e-63    
ref|WP_011387923.1|  molecular chaperone GroEL                          219   4e-63    
ref|WP_021243898.1|  molecular chaperone GroEL                          219   4e-63    
ref|XP_009252354.1|  hypothetical protein FPSE_00959                    221   4e-63    
ref|WP_027287787.1|  molecular chaperone GroEL                          219   4e-63    
ref|WP_025548312.1|  MULTISPECIES: molecular chaperone GroEL            218   4e-63    
emb|CDH58893.1|  heat shock protein 60                                  219   5e-63    
ref|WP_035670811.1|  molecular chaperone GroEL                          218   5e-63    
ref|XP_010878297.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    219   5e-63    
gb|EWG43455.1|  heat shock protein 60, mitochondrial                    219   6e-63    
ref|WP_028166259.1|  molecular chaperone GroEL                          218   6e-63    
ref|WP_027288941.1|  molecular chaperone GroEL                          218   6e-63    
gb|EMT68514.1|  Heat shock protein 60, mitochondrial                    219   6e-63    
ref|WP_038383540.1|  molecular chaperone GroEL                          211   6e-63    
gb|KHJ42381.1|  chaperonin GroL                                         218   6e-63    
ref|XP_005230978.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    219   7e-63    
ref|XP_004178421.1|  hypothetical protein TBLA_0B00580                  219   7e-63    
ref|NP_001012934.1|  60 kDa heat shock protein, mitochondrial pre...    219   7e-63    
gb|EHK24462.1|  hypothetical protein TRIVIDRAFT_79041                   219   7e-63    
ref|XP_008326223.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    219   7e-63    
ref|XP_007792474.1|  putative heat shock protein 60 protein             219   7e-63    
ref|WP_008890519.1|  molecular chaperone GroEL                          218   7e-63    
ref|XP_002765682.1|  heat shock protein 60, putative                    218   7e-63    
ref|WP_022196717.1|  molecular chaperone GroEL                          218   8e-63    
ref|WP_045581145.1|  molecular chaperone GroEL                          218   8e-63    
ref|XP_006035534.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    218   8e-63    
ref|NP_001274213.1|  heat shock 60kDa protein 1 (chaperonin)            218   8e-63    
dbj|GAO14262.1|  hypothetical protein UVI_013200                        219   8e-63    
gb|EYE97023.1|  chaperonin GroL                                         218   9e-63    
gb|EHK48995.1|  hypothetical protein TRIATDRAFT_297734                  219   9e-63    
ref|WP_018455623.1|  hypothetical protein                               209   9e-63    
gb|ACN11370.1|  60 kDa heat shock protein, mitochondrial precursor      218   9e-63    
emb|CDQ82625.1|  unnamed protein product                                218   1e-62    
ref|XP_001731319.1|  hypothetical protein MGL_1502                      218   1e-62    
gb|KJK61472.1|  GroEL                                                   218   1e-62    
ref|WP_018316496.1|  molecular chaperone GroEL                          209   1e-62    
emb|CDS13330.1|  Putative Heat shock protein 60, mitochondrial          218   1e-62    
ref|XP_007815914.1|  Heat shock protein 60 precursor (Antigen HIS...    218   1e-62    
ref|WP_044432070.1|  molecular chaperone GroEL                          218   1e-62    
ref|XP_003657887.1|  hypothetical protein THITE_127923                  218   1e-62    
ref|WP_028336830.1|  hypothetical protein                               208   1e-62    
ref|XP_001826345.1|  heat shock protein 60                              218   1e-62    
gb|EDL32336.1|  mCG116284                                               216   1e-62    
ref|WP_008833305.1|  molecular chaperone GroEL                          217   1e-62    
ref|WP_028343952.1|  hypothetical protein                               207   1e-62    
ref|XP_009923792.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   1e-62    
gb|EEH17213.1|  hsp60-like protein                                      218   1e-62    
ref|WP_027298203.1|  molecular chaperone GroEL                          217   1e-62    
gb|KFZ46253.1|  hypothetical protein N321_13520                         216   1e-62    
gb|EQL02142.1|  hsp60 mitochondrial precursor-like protein              218   1e-62    
ref|XP_010763632.1|  hsp60-like protein                                 218   1e-62    
ref|WP_008946164.1|  molecular chaperone GroEL                          217   1e-62    
ref|XP_002484775.1|  antigenic mitochondrial protein HSP60, putative    218   2e-62    
ref|WP_040966135.1|  molecular chaperone GroEL                          217   2e-62    
ref|XP_003667025.1|  hypothetical protein MYCTH_2097570                 218   2e-62    
ref|XP_010161784.1|  PREDICTED: LOW QUALITY PROTEIN: 60 kDa heat ...    216   2e-62    
ref|WP_018009709.1|  hypothetical protein                               207   2e-62    
ref|XP_007784928.1|  heat shock protein 60                              218   2e-62    
ref|XP_007728396.1|  heat shock protein 60                              218   2e-62    
dbj|GAD98027.1|  heat shock protein 60, mitochondrial precursor         218   2e-62    
gb|KFH41613.1|  Heat shock protein-like protein                         218   2e-62    
ref|XP_001260425.1|  antigenic mitochondrial protein HSP60, putative    218   2e-62    
ref|XP_755263.1|  antigenic mitochondrial protein HSP60                 218   2e-62    
ref|WP_028142935.1|  hypothetical protein                               208   2e-62    
ref|XP_007341550.1|  chaperonin GroL                                    217   2e-62    
ref|WP_014239089.1|  molecular chaperone GroEL                          217   2e-62    
gb|KFD69477.1|  hypothetical protein M514_07906                         218   2e-62    
ref|XP_010083615.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   2e-62    
ref|WP_022691731.1|  molecular chaperone GroEL                          216   2e-62    
ref|XP_003051567.1|  predicted protein                                  218   2e-62    
ref|WP_012042708.1|  molecular chaperone GroEL                          216   2e-62    
ref|WP_028339955.1|  hypothetical protein                               206   2e-62    
ref|WP_013046767.1|  molecular chaperone GroEL                          217   2e-62    
gb|KFR00091.1|  hypothetical protein N306_13046                         216   3e-62    
ref|XP_009816210.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   3e-62    
gb|ACI33148.1|  60 kDa heat shock protein, mitochondrial precursor      217   3e-62    
ref|WP_019646754.1|  molecular chaperone GroEL                          216   3e-62    
ref|WP_028344430.1|  hypothetical protein                               207   3e-62    
ref|XP_010281402.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   3e-62    
ref|WP_011413797.1|  molecular chaperone GroEL                          216   3e-62    
ref|XP_006636350.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   3e-62    
emb|CCU99710.1|  unnamed protein product                                217   3e-62    
ref|XP_007267381.1|  chaperonin GroL                                    217   3e-62    
gb|KIL91661.1|  heat shock protein mitochondrial                        217   3e-62    
gb|ELU39076.1|  heat shock protein 60                                   217   3e-62    
gb|KDQ33327.1|  hypothetical protein PLEOSDRAFT_1073596                 218   3e-62    
ref|XP_010005666.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   3e-62    
ref|XP_002544588.1|  chaperonin GroL                                    217   3e-62    
ref|WP_037452017.1|  molecular chaperone GroEL                          216   3e-62    
ref|WP_041954938.1|  molecular chaperone GroEL                          206   3e-62    
emb|CDQ81357.1|  unnamed protein product                                217   3e-62    
ref|WP_027298450.1|  molecular chaperone GroEL                          216   3e-62    
ref|XP_009966601.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   3e-62    
ref|XP_009888462.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   4e-62    
ref|XP_009923791.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   4e-62    
ref|XP_007823874.1|  hsp60 mitochondrial precursor-like protein         217   4e-62    
gb|KID98635.1|  Heat shock protein 60 (Antigen HIS-62)                  217   4e-62    
gb|KID91490.1|  Heat shock protein 60 (Antigen HIS-62)                  217   4e-62    
gb|KFZ52788.1|  hypothetical protein N338_03137                         217   4e-62    
ref|XP_010185448.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   4e-62    
ref|XP_004338977.1|  chaperonin GroL, putative                          217   4e-62    
ref|XP_009460526.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   4e-62    
ref|XP_009486204.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   4e-62    
ref|WP_044425354.1|  molecular chaperone GroEL                          216   4e-62    
ref|WP_024325676.1|  hypothetical protein                               207   4e-62    
ref|XP_009980100.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    216   4e-62    
ref|XP_010210566.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    216   4e-62    
ref|XP_009581096.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    216   4e-62    
ref|XP_009329761.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    216   4e-62    



>gb|KHG09712.1| Chaperonin CPN60-2, mitochondrial [Gossypium arboreum]
Length=380

 Score =   324 bits (831),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  199  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  258

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  259  SKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  318

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EK+ PAM GGMGGM
Sbjct  319  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPAMPGGMGGM  378

Query  289  DY  284
            DY
Sbjct  379  DY  380



>ref|XP_004147171.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Cucumis sativus]
 gb|KGN61548.1| hypothetical protein Csa_2G169720 [Cucumis sativus]
Length=575

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 175/182 (96%), Positives = 181/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++VELPK+EKE PAMGGGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKDEKEVPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_008460701.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Cucumis melo]
Length=575

 Score =   328 bits (842),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 174/182 (96%), Positives = 181/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++VELP++EKE PAMGGGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPQDEKEVPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_002285608.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Vitis vinifera]
 emb|CBI33329.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   328 bits (841),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 174/182 (96%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPT+NFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLPTSNFDQKIGVQIIQNALKTPVFTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EKE PAMGGGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKEVPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>gb|KHG24292.1| Chaperonin CPN60-2, mitochondrial [Gossypium arboreum]
 gb|KJB37762.1| hypothetical protein B456_006G219100 [Gossypium raimondii]
 gb|KJB37763.1| hypothetical protein B456_006G219100 [Gossypium raimondii]
 gb|KJB37764.1| hypothetical protein B456_006G219100 [Gossypium raimondii]
Length=575

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EK+ PAM GGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPAMPGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>sp|Q05046.1|CH62_CUCMA RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; 
Flags: Precursor [Cucurbita maxima]
 pir||S29316 chaperonin 60 - cucurbit
 emb|CAA50218.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri]
Length=575

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEA++VELPK+EKE PAMGGGMGGM
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKDEKEVPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>gb|KJB37765.1| hypothetical protein B456_006G219200 [Gossypium raimondii]
 gb|KJB37766.1| hypothetical protein B456_006G219200 [Gossypium raimondii]
Length=575

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EK+ PAM GGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPAMPGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>gb|KHG09711.1| Chaperonin CPN60-2, mitochondrial [Gossypium arboreum]
Length=575

 Score =   327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EK+ PAM GGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPAMPGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_010264000.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Nelumbo nucifera]
Length=575

 Score =   325 bits (834),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLHTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EKE P MG GMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKEAPGMGAGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_007034504.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
 gb|EOY05430.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
Length=575

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 172/182 (95%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGI+DPLKVIRTALVDAASVSSL+TTTEA++VELPK+EK+  AM GGMGGM
Sbjct  514  KGEYVDMVKAGIVDPLKVIRTALVDAASVSSLMTTTEAIVVELPKDEKDVSAMPGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>sp|Q05045.1|CH61_CUCMA RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: Full=HSP60-1; 
Flags: Precursor [Cucurbita maxima]
 pir||S29315 chaperonin 60 - cucurbit
 emb|CAA50217.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri]
Length=575

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQD+PDLGYDAA
Sbjct  454  SKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTE V+VELPK+E E PAMGGGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEVVVVELPKDENEVPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|NP_001064784.1| Os10g0462900 [Oryza sativa Japonica Group]
 gb|AAN05528.1| mitochondrial chaperonin-60 [Oryza sativa Japonica Group]
 dbj|BAF26698.1| Os10g0462900 [Oryza sativa Japonica Group]
 gb|EEC67118.1| hypothetical protein OsI_33923 [Oryza sativa Indica Group]
 gb|EEE51095.1| hypothetical protein OsJ_31804 [Oryza sativa Japonica Group]
 gb|ADR66966.1| 60 kDa chaperonin [Oryza sativa Japonica Group]
Length=574

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/172 (95%), Positives = 170/172 (99%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  454  SKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNTDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEEKE PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEKEAPA  565



>gb|AGT98547.1| heat shock protein 60, partial [Paeonia lactiflora]
Length=214

 Score =   311 bits (797),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 178/183 (97%), Gaps = 1/183 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAV EGIVPGGGVALLYA
Sbjct  32   EKLQERLAKLSGGVAVLKIGGASEAEVNEKKDRVTDALNATKAAVVEGIVPGGGVALLYA  91

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S+ELDKL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLEQDNP+LGYDAA
Sbjct  92   SRELDKLQTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPELGYDAA  151

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE-TPAmgggmgg  293
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++VELPK++KE TP MGGGMGG
Sbjct  152  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKDDKEATPGMGGGMGG  211

Query  292  MDY  284
            MDY
Sbjct  212  MDY  214



>ref|XP_010527490.1| PREDICTED: chaperonin CPN60, mitochondrial [Tarenaya hassleriana]
Length=574

 Score =   323 bits (829),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KLPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  453  SKELEKLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK+E E+     GMGGM
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDENESAGAAAGMGGM  572

Query  289  DY  284
            DY
Sbjct  573  DY  574



>ref|XP_010556941.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Tarenaya hassleriana]
Length=576

 Score =   323 bits (828),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 163/173 (94%), Positives = 171/173 (99%), Gaps = 1/173 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV++GKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIIGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE-TPA  314
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+PKEEKE +PA
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPKEEKEASPA  566



>ref|XP_002303091.1| Chaperonin CPN60-2 family protein [Populus trichocarpa]
 gb|EEE82364.1| Chaperonin CPN60-2 family protein [Populus trichocarpa]
Length=575

 Score =   323 bits (828),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 163/172 (95%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  395  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  454

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  455  SKELDKLHTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  514

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTEA++ ELPK EKETPA
Sbjct  515  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVYELPKVEKETPA  566



>gb|ABP01596.1| heat shock protein 60 [Ageratina adenophora]
Length=359

 Score =   316 bits (809),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 168/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            +KL+ERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  188  DKLRERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  247

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALK PV+TIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  248  SKELDKLQTANFDQKIGVQIIQNALKAPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  307

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KG+YVDMVK GIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPK+EKE+PA
Sbjct  308  KGQYVDMVKGGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKDEKESPA  359



>ref|XP_010097984.1| Chaperonin CPN60-2 [Morus notabilis]
 gb|EXB73714.1| Chaperonin CPN60-2 [Morus notabilis]
Length=439

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 170/172 (99%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  262  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  321

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL++L TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  322  SKELEELQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  381

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK++K+ PA
Sbjct  382  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDDKDVPA  433



>ref|XP_011024539.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Populus euphratica]
Length=575

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/172 (95%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  395  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  454

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  455  SKELDKLHTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  514

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTEA++ ELPK EKETPA
Sbjct  515  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVSELPKVEKETPA  566



>gb|AAP54159.2| Chaperonin CPN60-1, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=634

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/172 (95%), Positives = 170/172 (99%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  454  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  513

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  514  SKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNTDLGYDAA  573

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEEKE PA
Sbjct  574  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEKEAPA  625



>ref|XP_008349053.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Malus domestica]
Length=426

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAK+SGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  245  EKLQERLAKISGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  304

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALK PV TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  305  SKELEKLXTANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  364

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EKETPAMGGGMGGM
Sbjct  365  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPAMGGGMGGM  424

Query  289  DY  284
            DY
Sbjct  425  DY  426



>ref|XP_010243653.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Nelumbo nucifera]
Length=574

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/172 (95%), Positives = 168/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLHTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VE PK+EKE PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVEFPKDEKEVPA  565



>ref|XP_009800688.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Nicotiana sylvestris]
Length=575

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/182 (95%), Positives = 180/182 (99%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAK+SGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKISGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQD+ DLGYDAA
Sbjct  454  AKELDKLETANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDTDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK+EKETPAMGGGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_004239874.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Solanum lycopersicum]
Length=573

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 168/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLA+LSGGVAVLK+GGASE EVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  394  EKLQERLARLSGGVAVLKVGGASEVEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELD LPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEG+VVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDSLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGSVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPK+EK  PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKDEKAAPA  565



>ref|XP_006355738.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Solanum tuberosum]
Length=573

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLA+LSGGVAVLK+GGASE EVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  394  EKLQERLARLSGGVAVLKVGGASEIEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELD LPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEG+VVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDSLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGSVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPK+EK +PA
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKDEKASPA  565



>ref|XP_003591643.1| Chaperonin CPN60-like protein [Medicago truncatula]
 gb|ABE86688.1| GroEL-like chaperone, ATPase [Medicago truncatula]
 gb|AES61894.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=574

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S EL KLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SNELSKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTEAV+ ELPKE+K+TPA
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKEDKDTPA  565



>gb|AFW68650.1| chaperonin 1 [Zea mays]
Length=203

 Score =   309 bits (792),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  22   EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  81

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  82   SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAA  141

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PAMGGGMGGM
Sbjct  142  KGEYVDMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPAMGGGMGGM  201

Query  289  DY  284
            DY
Sbjct  202  DY  203



>emb|CDX79518.1| BnaC03g18540D [Brassica napus]
Length=202

 Score =   308 bits (790),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  12   EKLQERLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  71

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLE DNPDLGYDAA
Sbjct  72   SKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLESDNPDLGYDAA  131

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAV+ E+P +E  +PA
Sbjct  132  KGEYVDMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEDASPA  183



>ref|XP_010522438.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Tarenaya hassleriana]
Length=580

 Score =   321 bits (822),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 161/169 (95%), Positives = 167/169 (99%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELD LPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV++GKLLEQDNPDLGYDAA
Sbjct  454  SKELDTLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIIGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+PKEEKE
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVSEIPKEEKE  562



>ref|XP_006662418.1| PREDICTED: chaperonin CPN60-1, mitochondrial-like [Oryza brachyantha]
Length=574

 Score =   320 bits (821),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNTDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTE+++VE+PKEEKE PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIVVEIPKEEKEAPA  565



>emb|CDO99385.1| unnamed protein product [Coffea canephora]
Length=575

 Score =   320 bits (821),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKV+RTALVDAASVSSLLTTTEAV+VELPK+EK  PAMGGGMG M
Sbjct  514  KGEYVDMVKAGIIDPLKVLRTALVDAASVSSLLTTTEAVVVELPKDEKAAPAMGGGMGDM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_008810807.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Phoenix dactylifera]
Length=576

 Score =   320 bits (821),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S EL+KL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVV+GKLLEQDNPDLGYDAA
Sbjct  454  SNELEKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVIGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVD+ASVSSL+TTTEAV+VELPKEEK+ PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDSASVSSLMTTTEAVVVELPKEEKDVPA  565



>ref|XP_010918836.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Elaeis guineensis]
Length=575

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGE+KDRVTDALNATKAAVEEGIV GGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGERKDRVTDALNATKAAVEEGIVTGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPV+TIA+NAGVEGAVV+GKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLQTANFDQKIGVQIIQNALKTPVHTIATNAGVEGAVVIGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPKEEK+ PAMGGGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKEEKDVPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>gb|KDO43056.1| hypothetical protein CISIN_1g013743mg [Citrus sinensis]
 gb|KDO43057.1| hypothetical protein CISIN_1g013743mg [Citrus sinensis]
Length=382

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  198  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  257

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KEL+KL TANFDQKIGVQ+IQNALKTPV+TIA+NAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  258  AKELEKLSTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNTDLGYDAA  317

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTEA++VELPKEEKE P
Sbjct  318  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEEKEAP  368



>gb|KDO43055.1| hypothetical protein CISIN_1g013743mg [Citrus sinensis]
Length=437

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  253  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  312

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KEL+KL TANFDQKIGVQ+IQNALKTPV+TIA+NAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  313  AKELEKLSTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNTDLGYDAA  372

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTEA++VELPKEEKE P
Sbjct  373  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEEKEAP  423



>ref|XP_011091383.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Sesamum indicum]
Length=575

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KLPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLE DNPDLGYDAA
Sbjct  454  SKELEKLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLESDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++VE PK+EK  P MGGGMG M
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVEQPKDEKPAPPMGGGMGEM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_009616503.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Nicotiana tomentosiformis]
Length=575

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAK+SGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKISGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQD+ DLGYDAA
Sbjct  454  AKELDKLETANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDADLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMV+AGIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK+EKETP MGGGMGGM
Sbjct  514  KGEYVDMVRAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPPMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_009371099.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Pyrus x bretschneideri]
Length=575

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALK PV TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLVTANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK++KETPAMGGGMGGM
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDDKETPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_002885624.1| hypothetical protein ARALYDRAFT_898985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61883.1| hypothetical protein ARALYDRAFT_898985 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/170 (94%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++EL+KLPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  453  ARELEKLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK+E E+
Sbjct  513  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDESES  562



>ref|XP_007201704.1| hypothetical protein PRUPE_ppa004110mg [Prunus persica]
 gb|EMJ02903.1| hypothetical protein PRUPE_ppa004110mg [Prunus persica]
Length=529

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAK+SGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  348  EKLQERLAKISGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  407

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALK PV TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  408  SKELDKLATANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  467

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EKETP MGGGMGGM
Sbjct  468  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPGMGGGMGGM  527

Query  289  DY  284
            DY
Sbjct  528  DY  529



>ref|NP_189041.1| heat shock protein 60 [Arabidopsis thaliana]
 sp|P29197.2|CH60A_ARATH RecName: Full=Chaperonin CPN60, mitochondrial; AltName: Full=HSP60; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03017.1| chaperonin hsp60, mitochondrial precursor (HSP60) [Arabidopsis 
thaliana]
 gb|AAM20445.1| mitochondrial chaperonin hsp60 [Arabidopsis thaliana]
 gb|AAQ56841.1| At3g23990 [Arabidopsis thaliana]
 gb|AEE76842.1| heat shock protein 60 [Arabidopsis thaliana]
Length=577

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/170 (94%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++EL+KLPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  453  ARELEKLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+V+LPK+E E+
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES  562



>emb|CAA77646.1| chaperonin hsp60 [Arabidopsis thaliana]
Length=577

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/170 (94%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++EL+KLPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  453  ARELEKLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+V+LPK+E E+
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES  562



>gb|AAN63805.1| heat shock protein 60 [Prunus dulcis]
Length=545

 Score =   317 bits (813),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAK+SGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  364  EKLQERLAKISGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  423

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALK PV TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  424  SKELDKLATANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  483

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EKETP MGGGMGGM
Sbjct  484  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPGMGGGMGGM  543

Query  289  DY  284
            DY
Sbjct  544  DY  545



>ref|XP_010550847.1| PREDICTED: chaperonin CPN60, mitochondrial-like [Tarenaya hassleriana]
Length=574

 Score =   318 bits (815),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGILPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGK+LEQDNPD GYDAA
Sbjct  453  SKELDKLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKILEQDNPDFGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            K EYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK+E E+     GMGGM
Sbjct  513  KDEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDENESSGAAAGMGGM  572

Query  289  DY  284
            DY
Sbjct  573  DY  574



>gb|EYU46365.1| hypothetical protein MIMGU_mgv1a026299mg, partial [Erythranthe 
guttata]
Length=548

 Score =   317 bits (812),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  374  EKLQERLAKLSGGVAVLKIGGASEVEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  433

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQK+GVQ+IQNALK PV+TIASNAGVEG+VVVGKLLEQDNPDLGYDAA
Sbjct  434  SKELEKLQTANFDQKVGVQIIQNALKAPVHTIASNAGVEGSVVVGKLLEQDNPDLGYDAA  493

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK+EKE+P
Sbjct  494  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDEKESP  544



>gb|EMS57340.1| Chaperonin CPN60-2, mitochondrial [Triticum urartu]
Length=587

 Score =   318 bits (815),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK+QERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  405  EKIQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  464

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK+LDKLPTANFDQKIGVQ+IQNALKTPV+TIA+NAGVEGAV+VGKLLEQDN DLGYDAA
Sbjct  465  SKDLDKLPTANFDQKIGVQIIQNALKTPVHTIATNAGVEGAVIVGKLLEQDNTDLGYDAA  524

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA+IVE+PKE+K  PA
Sbjct  525  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIIVEIPKEDKAAPA  576



>ref|XP_010023772.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Eucalyptus grandis]
 gb|KCW60142.1| hypothetical protein EUGRSUZ_H02866 [Eucalyptus grandis]
Length=575

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KG+YVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK++KE  +M  GMGGM
Sbjct  514  KGDYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDDKEGASMPPGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_008346198.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Malus domestica]
Length=575

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 171/182 (94%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIV GGG ALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVAGGGAALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALK PV TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLVTANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EKETPAMGGGMGGM
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>gb|ABK92479.1| unknown [Populus trichocarpa]
Length=422

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  242  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  301

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  302  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  361

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+ +LPK+ K+ PA
Sbjct  362  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVTDLPKDVKDAPA  413



>ref|XP_009599981.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=573

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 168/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLK+GGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKVGGASELEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELD LPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQD+PDLGYDAA
Sbjct  454  SKELDNLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK+E  +PA
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDETPSPA  565



>ref|XP_008224072.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Prunus mume]
Length=578

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 168/172 (98%), Gaps = 1/172 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASETEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KLPTANFDQKIGVQ+IQNALK PV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLPTANFDQKIGVQIIQNALKAPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+VELP  +KETPA
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELP-SDKETPA  564



>ref|XP_006340914.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Solanum tuberosum]
Length=575

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++ELD L TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLL+QDN DLGYDAA
Sbjct  454  ARELDNLTTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLDQDNLDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDM+KAGIIDP+KVIRTALVDAASVSSLLTTTEAV+VELPK+EKE+PAMGGGMGGM
Sbjct  514  KGEYVDMIKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKESPAMGGGMGGM  573

Query  289  DY  284
            D+
Sbjct  574  DF  575



>dbj|BAK05600.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK LDKL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  454  SKALDKLETANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNTDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTEA+IVE+PKEEKE P
Sbjct  514  KGEYVDMVKVGIIDPLKVIRTALVDAASVSSLMTTTEAIIVEIPKEEKEAP  564



>ref|XP_007225634.1| hypothetical protein PRUPE_ppa003391mg [Prunus persica]
 gb|EMJ26833.1| hypothetical protein PRUPE_ppa003391mg [Prunus persica]
Length=578

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 168/172 (98%), Gaps = 1/172 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASETEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KLPTANFDQKIGVQ+IQNALK PV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLPTANFDQKIGVQIIQNALKAPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+VELP  +KETPA
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELP-SDKETPA  564



>ref|XP_006492150.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Citrus sinensis]
Length=578

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KEL+KL TANFDQKIGVQ+IQNALKTPV+TIA+NAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  454  AKELEKLSTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNTDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTEA++VELPKEEKE P
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEEKEAP  564



>ref|XP_004247810.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Solanum lycopersicum]
Length=579

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++ELD L TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLL+QDN DLGYDAA
Sbjct  454  ARELDNLTTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLDQDNLDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDM+KAGIIDP+KVIRTALVDAASVSSLLTTTEAV+VELPK+EKE+PA
Sbjct  514  KGEYVDMIKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKESPA  565



>gb|ACN31425.1| unknown [Zea mays]
Length=352

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  171  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  230

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  231  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAA  290

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PAMGGGMGGM
Sbjct  291  KGEYVDMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPAMGGGMGGM  350

Query  289  DY  284
            DY
Sbjct  351  DY  352



>ref|XP_004496080.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cicer arietinum]
Length=575

 Score =   316 bits (809),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S EL KL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SNELSKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++ ELPKE+  +PAM GGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVYELPKEDNSSPAMPGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_008372428.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin CPN60-2, mitochondrial-like 
[Malus domestica]
Length=576

 Score =   315 bits (808),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 161/172 (94%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIV GGG ALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVAGGGAALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALK PV TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLVTANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EKETPA
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPA  565



>ref|XP_003574012.1| PREDICTED: chaperonin CPN60-1, mitochondrial [Brachypodium distachyon]
Length=574

 Score =   315 bits (808),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGG+AVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGIAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK LDKL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  454  SKALDKLQTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNTDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEEKE PA
Sbjct  514  KGEYVDMVKVGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEKEAPA  565



>emb|CDX93002.1| BnaA03g37240D [Brassica napus]
Length=550

 Score =   314 bits (805),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  366  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  425

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++EL+KLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAA
Sbjct  426  ARELEKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAA  485

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+V+LPK+E E+
Sbjct  486  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES  535



>ref|XP_003556325.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 [Glycine 
max]
Length=575

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S ELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ++PDLGYDAA
Sbjct  454  SSELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQNDPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTEAV+ ELPK++K+ PAMGGGMGGM
Sbjct  514  KGEYVDMVKTGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDDKDVPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>gb|EMT21164.1| Chaperonin CPN60-2, mitochondrial [Aegilops tauschii]
Length=626

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK+QERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  444  EKIQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  503

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK+LDKLPTANFDQKIGVQ+IQNALKTPV+TIA+NAGVEGAV+VGKLLEQ+N DLGYDAA
Sbjct  504  SKDLDKLPTANFDQKIGVQIIQNALKTPVHTIATNAGVEGAVIVGKLLEQENTDLGYDAA  563

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA+IVE+PKE+K  PA
Sbjct  564  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIIVEIPKEDKAAPA  615



>ref|XP_012085173.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Jatropha curcas]
 gb|KDP26429.1| hypothetical protein JCGZ_17587 [Jatropha curcas]
Length=574

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALK PV+TIA+NAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKMPVHTIAANAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVI+TAL+DAASVSSL+TTTEAV+ ELPK+E E PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIKTALMDAASVSSLMTTTEAVVSELPKDESEAPA  565



>ref|XP_010933209.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Elaeis guineensis]
Length=575

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 178/182 (98%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRV DALNATKAAVEEGI+PGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVNDALNATKAAVEEGILPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPV+TIA+NAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLQTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            K EYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EK+ PA+GGGMGGM
Sbjct  514  KDEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPALGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_009758421.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Nicotiana 
sylvestris]
Length=573

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLK+GGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKVGGASELEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELD LPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQD+PDLGYDAA
Sbjct  454  SKELDNLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK+E  +P
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDETPSP  564



>ref|XP_008812917.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Phoenix dactylifera]
Length=621

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRV DALNATKAAVEEG +PGGGVALLYA
Sbjct  440  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVNDALNATKAAVEEGTLPGGGVALLYA  499

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPV+TIA+NAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  500  SKELEKLQTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNPDLGYDAA  559

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EK+ PA GGGMGGM
Sbjct  560  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPAPGGGMGGM  619

Query  289  DY  284
            DY
Sbjct  620  DY  621



>ref|XP_004496079.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cicer arietinum]
Length=575

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S EL KL TANFDQKIGVQ+IQNALKTPV TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SNELSKLQTANFDQKIGVQIIQNALKTPVQTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++ ELPKE+  +PAM GGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVYELPKEDNSSPAMPGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_006410461.1| hypothetical protein EUTSA_v10016427mg [Eutrema salsugineum]
 gb|ESQ51914.1| hypothetical protein EUTSA_v10016427mg [Eutrema salsugineum]
Length=582

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 168/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGG+SEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGSSEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+P +E+ +PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPAKEEASPA  565



>ref|XP_003536270.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 [Glycine 
max]
 gb|KHN30688.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=577

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 168/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S ELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ++PDLGYDAA
Sbjct  454  SSELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQNDPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++ ELPK++K+ PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVSELPKDDKDVPA  565



>ref|XP_009135882.1| PREDICTED: chaperonin CPN60, mitochondrial [Brassica rapa]
Length=577

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++EL+KLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAA
Sbjct  453  ARELEKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+V+LPK+E E+
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES  562



>emb|CDX94835.1| BnaC03g43530D [Brassica napus]
Length=577

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++EL+KLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAA
Sbjct  453  ARELEKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+V+LPK+E E+
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES  562



>ref|XP_002299295.2| Chaperonin CPN60-2 family protein [Populus trichocarpa]
 gb|EEE84100.2| Chaperonin CPN60-2 family protein [Populus trichocarpa]
Length=574

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+ +LPK+ K+ PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVTDLPKDVKDAPA  565



>gb|EMT05673.1| Chaperonin CPN60-2, mitochondrial [Aegilops tauschii]
Length=574

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK LDKL TANFDQKIGVQ+IQNALKTPVYTIA NAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  454  SKALDKLQTANFDQKIGVQIIQNALKTPVYTIACNAGVEGAVVVGKLLEQENTDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTEA+IVE+PKEEKE PA
Sbjct  514  KGEYVDMVKVGIIDPLKVIRTALVDAASVSSLMTTTEAIIVEVPKEEKEAPA  565



>emb|CDX84697.1| BnaA03g15330D [Brassica napus]
Length=563

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  376  EKLQERLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  435

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLE DNPDLGYDAA
Sbjct  436  SKELDKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLESDNPDLGYDAA  495

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAV+ E+P +E  +PA
Sbjct  496  KGEYVDMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEDASPA  547



>gb|KHN00995.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=575

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S ELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ++PDLGYDAA
Sbjct  454  SSELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQNDPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTEAV+ ELPK++K+ PAMGGG+GGM
Sbjct  514  KGEYVDMVKTGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDDKDVPAMGGGIGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_009420744.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=575

 Score =   313 bits (803),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEIEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S+ELDKL TANFDQKIGVQ+IQNALK+P +TIASNAGVEGAVVVGKLLEQ+NPDLGYDAA
Sbjct  454  SRELDKLQTANFDQKIGVQIIQNALKSPAHTIASNAGVEGAVVVGKLLEQENPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVD+VK+GIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EKETP MG GMGGM
Sbjct  514  KGEYVDLVKSGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPPMGPGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_004299212.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=577

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 168/172 (98%), Gaps = 1/172 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDKL TANFDQKIGVQ+IQNALK PV+TIASNAGVEGAV+VGKLLEQD+PDLGYDAA
Sbjct  454  AKELDKLSTANFDQKIGVQIIQNALKAPVHTIASNAGVEGAVIVGKLLEQDDPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAAS+SSLLTTTEAV+VELP  +KETPA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASISSLLTTTEAVVVELP-SDKETPA  564



>ref|XP_010469503.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Camelina sativa]
Length=585

 Score =   313 bits (801),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+P +E+ +P
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEEASP  564



>ref|XP_010509916.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Camelina sativa]
Length=585

 Score =   313 bits (801),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+P +E+ +P
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEEASP  564



>ref|XP_010413901.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Camelina sativa]
Length=583

 Score =   313 bits (801),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+P +E+ +P
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEEASP  564



>ref|XP_006297236.1| hypothetical protein CARUB_v10013241mg, partial [Capsella rubella]
 gb|EOA30134.1| hypothetical protein CARUB_v10013241mg, partial [Capsella rubella]
Length=617

 Score =   313 bits (803),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  433  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  492

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++EL+KLPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLEQ+N DLGYDAA
Sbjct  493  ARELEKLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQENTDLGYDAA  552

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK++ E+
Sbjct  553  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDDSES  602



>ref|XP_011002149.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Populus euphratica]
Length=574

 Score =   312 bits (800),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            +GEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+ +LPK+ K+ PA
Sbjct  514  EGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVTDLPKDVKDAPA  565



>ref|XP_006841664.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Amborella trichopoda]
 gb|ERN03339.1| hypothetical protein AMTR_s00003p00241820 [Amborella trichopoda]
Length=575

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/183 (92%), Positives = 176/183 (96%), Gaps = 1/183 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEVEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S+EL+KL TANFDQKIGVQ+IQNALK PV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  453  SRELEKLHTANFDQKIGVQIIQNALKMPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE-TPAmgggmgg  293
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA +VELPK+EKE TP MGGGMGG
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEATVVELPKDEKEMTPPMGGGMGG  572

Query  292  MDY  284
            MDY
Sbjct  573  MDY  575



>ref|XP_010513304.1| PREDICTED: chaperonin CPN60, mitochondrial-like [Camelina sativa]
Length=577

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++EL+KLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAA
Sbjct  453  ARELEKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+V+LPK++ E+
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDDSES  562



>ref|XP_002467123.1| hypothetical protein SORBIDRAFT_01g020010 [Sorghum bicolor]
 gb|EER94121.1| hypothetical protein SORBIDRAFT_01g020010 [Sorghum bicolor]
Length=577

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  396  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  455

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  456  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAA  515

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PAMGGGMGGM
Sbjct  516  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPAMGGGMGGM  575

Query  289  DY  284
            DY
Sbjct  576  DY  577



>ref|XP_009132917.1| PREDICTED: chaperonin CPN60, mitochondrial [Brassica rapa]
Length=584

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKL+GGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLAGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLE DNPDLGYDAA
Sbjct  454  SKELDKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLESDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAV+ E+P +E  +PA
Sbjct  514  KGEYVDMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEDASPA  565



>ref|XP_007144180.1| hypothetical protein PHAVU_007G135100g [Phaseolus vulgaris]
 gb|ESW16174.1| hypothetical protein PHAVU_007G135100g [Phaseolus vulgaris]
Length=575

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANF QKIGVQ+IQNALK  V+TIASNAGVEGAVVVGKLLEQ+NPDLGYDAA
Sbjct  454  SKELDKLHTANFGQKIGVQIIQNALKASVHTIASNAGVEGAVVVGKLLEQNNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+ ELPK++K+ PAMGGGMGGM
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDDKDVPAMGGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_006410460.1| hypothetical protein EUTSA_v10016425mg [Eutrema salsugineum]
 gb|ESQ51913.1| hypothetical protein EUTSA_v10016425mg [Eutrema salsugineum]
Length=583

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 168/172 (98%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAV+ E+P +E+ +PA
Sbjct  514  KGEYVDMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEEASPA  565



>ref|XP_010466805.1| PREDICTED: chaperonin CPN60, mitochondrial [Camelina sativa]
 ref|XP_010488513.1| PREDICTED: chaperonin CPN60, mitochondrial [Camelina sativa]
Length=577

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++EL+KLPTANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAA
Sbjct  453  ARELEKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+V+LPK++ E+
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDDSES  562



>ref|XP_004982955.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Setaria italica]
Length=576

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  396  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  455

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ N DLGYDAA
Sbjct  456  AKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQGNTDLGYDAA  515

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PA
Sbjct  516  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPA  567



>ref|XP_002881268.1| hypothetical protein ARALYDRAFT_902390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57527.1| hypothetical protein ARALYDRAFT_902390 [Arabidopsis lyrata subsp. 
lyrata]
Length=581

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+P +E  +P
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEVVSP  564



>ref|XP_004290029.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Fragaria vesca 
subsp. vesca]
Length=576

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 164/172 (95%), Gaps = 2/172 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASETEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALK PVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKMPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEAV+V LP  EKE PA
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVSLP--EKEAPA  563



>sp|P35480.1|CH60_BRANA RecName: Full=Chaperonin CPN60, mitochondrial; Flags: Precursor 
[Brassica napus]
 emb|CAA81689.1| mitochondrial chaperonin [Brassica napus]
Length=587

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  397  EKLQERLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  456

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFD KIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLE DNPDLGYDAA
Sbjct  457  SKELDKLSTANFDHKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLESDNPDLGYDAA  516

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAV+ E+P +E  +PA
Sbjct  517  KGEYVDMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEDASPA  568



>ref|XP_012077667.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Jatropha curcas]
 gb|KDP33373.1| hypothetical protein JCGZ_12922 [Jatropha curcas]
Length=574

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIV GGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVAGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNNDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+ ELPK+EK+  A
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDEKDAAA  565



>gb|AAC04902.1| mitochondrial chaperonin (HSP60) [Arabidopsis thaliana]
Length=524

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  333  EKLQERLAKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  392

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  393  SKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  452

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+P +E  +P
Sbjct  453  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEVASP  503



>gb|AFK46346.1| unknown [Medicago truncatula]
Length=353

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            +KLQERLAKLSGGV VLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  171  DKLQERLAKLSGGVVVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  230

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S EL KL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  231  SNELSKLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  290

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++ +LP E+K+
Sbjct  291  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVSDLPSEDKD  339



>ref|XP_002521151.1| chaperonin-60kD, ch60, putative [Ricinus communis]
 gb|EEF41302.1| chaperonin-60kD, ch60, putative [Ricinus communis]
Length=575

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK+LDKL TANFDQKIGVQ+IQNALK PV+TIA+NAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKDLDKLHTANFDQKIGVQIIQNALKMPVHTIAANAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTEA++ ELPK+EKE
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVTELPKDEKE  562



>ref|XP_006651029.1| PREDICTED: chaperonin CPN60-1, mitochondrial-like [Oryza brachyantha]
Length=577

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK+LDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEG+V+VGKLLEQDN DLGYDAA
Sbjct  454  SKDLDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGSVIVGKLLEQDNIDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PA
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEVAAPA  565



>ref|XP_002518171.1| chaperonin-60kD, ch60, putative [Ricinus communis]
 gb|EEF44304.1| chaperonin-60kD, ch60, putative [Ricinus communis]
Length=574

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KEL+KL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  454  TKELEKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNYDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+ ELPK+E   PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDESAAPA  565



>ref|XP_007145430.1| hypothetical protein PHAVU_007G238500g [Phaseolus vulgaris]
 gb|ESW17424.1| hypothetical protein PHAVU_007G238500g [Phaseolus vulgaris]
Length=575

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV TIASNAGVEGAVVVGKLLEQD+ DLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKTPVLTIASNAGVEGAVVVGKLLEQDDLDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
             GEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTEAV+ ELPK++K+ PAM GGMGGM
Sbjct  514  NGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDDKDIPAMAGGMGGM  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|NP_850203.1| heat shock protein 60-2 [Arabidopsis thaliana]
 sp|Q8L7B5.1|CH60B_ARATH RecName: Full=Chaperonin CPN60-like 1, mitochondrial; AltName: 
Full=HSP60-like 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM97026.1| mitochondrial chaperonin HSP60 [Arabidopsis thaliana]
 gb|AAN15422.1| mitochondrial chaperonin HSP60 [Arabidopsis thaliana]
 dbj|BAD43178.1| mitochondrial chaperonin (HSP60) [Arabidopsis thaliana]
 gb|AEC08799.1| heat shock protein 60-2 [Arabidopsis thaliana]
Length=585

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+P +E  +P
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEVASP  564



>sp|P29185.2|CH61_MAIZE RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: Full=HSP60-1; 
Flags: Precursor [Zea mays]
Length=577

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  396  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  455

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  456  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAA  515

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PAMGGGMGGM
Sbjct  516  KGEYVDMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPAMGGGMGGM  575

Query  289  DY  284
            DY
Sbjct  576  DY  577



>ref|NP_001105690.1| chaperonin CPN60-2, mitochondrial precursor [Zea mays]
 sp|Q43298.1|CH62_MAIZE RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; 
Flags: Precursor [Zea mays]
 gb|AAA33451.1| chaperonin 60 [Zea mays]
 gb|AAA33452.1| mitochondrial chaperonin 60 [Zea mays]
 tpg|DAA49764.1| TPA: putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=576

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  396  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  455

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ N DLGYDAA
Sbjct  456  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQGNTDLGYDAA  515

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            K EYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PA
Sbjct  516  KDEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPA  567



>emb|CAA77645.1| chaperonin hsp60 [Zea mays]
Length=577

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  396  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  455

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  456  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAA  515

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PAMGGGMGGM
Sbjct  516  KGEYVDMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPAMGGGMGGM  575

Query  289  DY  284
            DY
Sbjct  576  DY  577



>ref|XP_008644293.1| PREDICTED: chaperonin CPN60-1, mitochondrial isoform X1 [Zea 
mays]
Length=579

 Score =   311 bits (796),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  398  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  457

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  458  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAA  517

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PAMGGGMGGM
Sbjct  518  KGEYVDMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPAMGGGMGGM  577

Query  289  DY  284
            DY
Sbjct  578  DY  579



>ref|XP_003535967.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 [Glycine 
max]
 gb|KHN10297.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=575

 Score =   310 bits (795),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIV GGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVSGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV TIASNAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKTPVLTIASNAGVEGAVVVGKLLEQENHDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+ ELP ++K+TP
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPNDDKDTP  564



>ref|NP_001189665.1| heat shock protein 60-2 [Arabidopsis thaliana]
 gb|AEC08800.1| heat shock protein 60-2 [Arabidopsis thaliana]
Length=580

 Score =   311 bits (796),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  389  EKLQERLAKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  448

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  449  SKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  508

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+P +E  +P
Sbjct  509  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEVASP  559



>gb|EMS53265.1| Chaperonin CPN60-2, mitochondrial [Triticum urartu]
Length=640

 Score =   312 bits (800),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/172 (93%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  460  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  519

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK LDKL TANFDQKIGVQ+IQNALKTPVYTIA NAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  520  SKALDKLQTANFDQKIGVQIIQNALKTPVYTIACNAGVEGAVVVGKLLEQENTDLGYDAA  579

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTEA+IVE+PKEEKE PA
Sbjct  580  KGEYVDMVKVGIIDPLKVIRTALVDAASVSSLMTTTEAIIVEVPKEEKEAPA  631



>ref|NP_001105716.1| chaperonin CPN60-1, mitochondrial precursor [Zea mays]
 emb|CAA78100.1| mitochondrial chaperonin-60 [Zea mays]
Length=577

 Score =   310 bits (795),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  396  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  455

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  456  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAA  515

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PAMGGGMGGM
Sbjct  516  KGEYVDMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPAMGGGMGGM  575

Query  289  DY  284
            DY
Sbjct  576  DY  577



>emb|CAA78101.1| mitochondrial chaperonin-60 [Zea mays]
Length=576

 Score =   310 bits (795),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  396  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  455

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ N DLGYDAA
Sbjct  456  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQGNTDLGYDAA  515

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            K EYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PA
Sbjct  516  KDEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPA  567



>ref|XP_003558831.1| PREDICTED: chaperonin CPN60-1, mitochondrial [Brachypodium distachyon]
Length=575

 Score =   310 bits (795),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK+QERLAKLSGG+AVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKIQERLAKLSGGIAVLKIGGASEPEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S++LDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAA
Sbjct  454  SRDLDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEA+IVE P EEK  PA
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAIIVETPTEEKSAPA  565



>gb|KJB42389.1| hypothetical protein B456_007G151700 [Gossypium raimondii]
Length=521

 Score =   308 bits (790),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            +KLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  340  DKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  399

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+ L TANFDQKIGVQ+IQNALK PV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  400  SKELENLETANFDQKIGVQIIQNALKMPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  459

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++ ELPK++KE  A  GGMGG+
Sbjct  460  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVTELPKDDKEGAATAGGMGGL  519

Query  289  DY  284
            DY
Sbjct  520  DY  521



>emb|CDY59050.1| BnaC07g48200D [Brassica napus]
Length=338

 Score =   302 bits (774),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERL KLSGGVAVLKIGGASEAEV EKKDRVTDALNATKA VEEGI+PGGGVALLYA
Sbjct  158  EKLQERLTKLSGGVAVLKIGGASEAEVCEKKDRVTDALNATKATVEEGILPGGGVALLYA  217

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++EL+KL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAV+VGKL+EQDN DLGYDAA
Sbjct  218  ARELEKLATANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLMEQDNTDLGYDAA  277

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK+E E
Sbjct  278  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDESE  326



>ref|XP_003591642.1| Chaperonin CPN60-2 [Medicago truncatula]
 gb|ABE86687.1| GroEL-like chaperone, ATPase [Medicago truncatula]
 gb|AES61893.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=576

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            +KLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  DKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S EL KL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SNELSKLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++ +LP E+K+
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVSDLPSEDKD  562



>gb|KJB42386.1| hypothetical protein B456_007G151700 [Gossypium raimondii]
Length=575

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            +KLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  394  DKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+ L TANFDQKIGVQ+IQNALK PV+TIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELENLETANFDQKIGVQIIQNALKMPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++ ELPK++KE  A  GGMGG+
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVTELPKDDKEGAATAGGMGGL  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>gb|KFK31072.1| hypothetical protein AALP_AA6G064600 [Arabis alpina]
Length=583

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALK PV+TIASNAGVEGAV+VGKLLEQDN DLGYDAA
Sbjct  454  SKELEKLSTANFDQKIGVQIIQNALKMPVHTIASNAGVEGAVIVGKLLEQDNYDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+P +E E PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPSKEPEAPA  565



>ref|XP_009362047.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Pyrus x bretschneideri]
Length=578

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL T NFDQK+GVQ+IQNALK PV+TIASNAGVEGAVVVGKLLEQDN DLGYDAA
Sbjct  454  SKELEKLRTVNFDQKVGVQIIQNALKAPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSLLTTTEAV+VELP  EKETPA
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELP-SEKETPA  564



>ref|XP_006293894.1| hypothetical protein CARUB_v10022887mg [Capsella rubella]
 gb|EOA26792.1| hypothetical protein CARUB_v10022887mg [Capsella rubella]
Length=583

 Score =   308 bits (790),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL  L TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELGNLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSLLTTTEAV+ E+P +EK+
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEKD  562



>gb|AAA33450.1| chaperonin 60 [Zea mays]
Length=577

 Score =   308 bits (789),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERL KLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  396  EKLQERLPKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  455

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  456  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAA  515

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK GIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PKEE   PAMGGGMGGM
Sbjct  516  KGEYVDMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPAMGGGMGGM  575

Query  289  DY  284
            DY
Sbjct  576  DY  577



>ref|XP_003555721.1| PREDICTED: chaperonin CPN60-2, mitochondrial isoform 1 [Glycine 
max]
 gb|KHN31621.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=575

 Score =   308 bits (789),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S+ELDKL TANF QKIGVQ+IQNALKTPV TIASNAGVEGAVVVGKLLEQ+N DLGYDAA
Sbjct  454  SRELDKLQTANFGQKIGVQIIQNALKTPVLTIASNAGVEGAVVVGKLLEQENHDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEAV+ ELP + K+TP
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPNDNKDTP  564



>ref|XP_010109672.1| Chaperonin CPN60-2 [Morus notabilis]
 gb|EXC24142.1| Chaperonin CPN60-2 [Morus notabilis]
Length=574

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALK PVYTIASNAGVEG+VVVGKLLEQDN DLGYDAA
Sbjct  454  SKELEKLETANFDQKIGVQIIQNALKMPVYTIASNAGVEGSVVVGKLLEQDNHDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KGEYVD++K+GIIDPLKVIRTALVDAASVSSLLTTTEAV+VELPK+E+
Sbjct  514  KGEYVDLIKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDEE  561



>ref|XP_011622760.1| PREDICTED: chaperonin CPN60, mitochondrial [Amborella trichopoda]
Length=575

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEVEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KEL+KL TANFDQKIGVQ+IQNALKTP  TIA+NAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  453  TKELEKLQTANFDQKIGVQIIQNALKTPALTIAANAGVEGAVVVGKLLEQDNPDLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+T TEAV+ E PK E  +PA
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTMTEAVVAEFPKNESASPA  564



>ref|XP_008358471.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Malus domestica]
Length=576

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 175/183 (96%), Gaps = 1/183 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGV-AVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLY  653
            EKLQERLAK+   V AVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLY
Sbjct  394  EKLQERLAKIFWVVFAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLY  453

Query  652  ASKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDA  473
            ASKEL+KL TANFDQKIGVQ+IQNALK PV TIASNAGVEGAVVVGKLLEQDNPDLGYDA
Sbjct  454  ASKELEKLXTANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDA  513

Query  472  AKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmgg  293
            AKGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EKETPAMGGGMGG
Sbjct  514  AKGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPAMGGGMGG  573

Query  292  MDY  284
            MDY
Sbjct  574  MDY  576



>ref|XP_009377449.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Pyrus x bretschneideri]
Length=578

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL T NFDQK+GVQ+IQNALK PV+TIASNAGVEGAVVVGKLLE DN DLGYDAA
Sbjct  454  SKELEKLRTVNFDQKVGVQIIQNALKAPVHTIASNAGVEGAVVVGKLLEHDNADLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSLLTTTEAV+VELP  EKETPA
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELP-SEKETPA  564



>emb|CDY17152.1| BnaA05g10360D [Brassica napus]
Length=574

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  382  EKLQERLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  441

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLE D+PDLGYDAA
Sbjct  442  SKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLESDDPDLGYDAA  501

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDP+KVIRTALVDAASV+SLLTTTEAV+ ++P +E  +PA
Sbjct  502  KGEYVDMVKSGIIDPVKVIRTALVDAASVASLLTTTEAVVTDIPTKEDASPA  553



>ref|XP_009405691.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=577

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/167 (95%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKQQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEGAVVVGKLLEQD  DLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDELDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTE+VIVELPK E
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTESVIVELPKNE  560



>gb|ERN04382.1| hypothetical protein AMTR_s00147p00091670 [Amborella trichopoda]
Length=560

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  378  EKLQERLAKLSGGVAVLKIGGASEVEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  437

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KEL+KL TANFDQKIGVQ+IQNALKTP  TIA+NAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  438  TKELEKLQTANFDQKIGVQIIQNALKTPALTIAANAGVEGAVVVGKLLEQDNPDLGYDAA  497

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+T TEAV+ E PK E  +PA
Sbjct  498  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTMTEAVVAEFPKNESASPA  549



>ref|XP_009143882.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Brassica rapa]
Length=586

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLE D+PDLGYDAA
Sbjct  454  SKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLESDDPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDP+KVIRTALVDAASV+SLLTTTEAV+ ++P +E  +PA
Sbjct  514  KGEYVDMVKSGIIDPVKVIRTALVDAASVASLLTTTEAVVTDIPTKEDASPA  565



>emb|CDY19471.1| BnaC04g11280D [Brassica napus]
Length=593

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 166/172 (97%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  401  EKLQERLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  460

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLE D+PDLGYDAA
Sbjct  461  SKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLESDDPDLGYDAA  520

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVK+GIIDP+KVIRTALVDAASV+SLLTTTEAV+ ++P +E  +PA
Sbjct  521  KGEYVDMVKSGIIDPVKVIRTALVDAASVASLLTTTEAVVTDIPTKEDASPA  572



>ref|NP_001048938.1| Os03g0143400 [Oryza sativa Japonica Group]
 gb|ABF93929.1| Chaperonin CPN60-1, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10852.1| Os03g0143400 [Oryza sativa Japonica Group]
 dbj|BAG93753.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74496.1| hypothetical protein OsI_09970 [Oryza sativa Indica Group]
 gb|EEE58306.1| hypothetical protein OsJ_09368 [Oryza sativa Japonica Group]
 gb|ADB84620.1| chaperonin [Oryza sativa Japonica Group]
Length=577

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK+LDKL TANFDQKIGVQ+IQNALKTPV+TIASNAGVEG+V++GKLLEQDN DLGYDAA
Sbjct  454  SKDLDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGSVIIGKLLEQDNTDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPK  335
            KGEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTE++IVE+PK
Sbjct  514  KGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPK  558



>ref|XP_007049890.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
 gb|EOX94047.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
Length=575

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            +KLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  DKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+ L TANFDQKIGVQ+IQNAL  PV+ IASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELENLHTANFDQKIGVQIIQNALMMPVHAIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++ ELP +EK  PA  GGMGG+
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVTELPNDEKAGPAAPGGMGGL  573

Query  289  DY  284
            DY
Sbjct  574  DY  575



>ref|XP_004139642.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cucumis sativus]
 gb|KGN44557.1| hypothetical protein Csa_7G332900 [Cucumis sativus]
Length=572

 Score =   303 bits (775),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 166/173 (96%), Gaps = 1/173 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDA+NAT+AAVEEGIV GGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDAVNATRAAVEEGIVAGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALK P+YTIASNAGVEGA+V+GKLL+QDN +LGYDAA
Sbjct  454  SKELEKLQTANFDQKIGVQIIQNALKMPIYTIASNAGVEGAIVIGKLLQQDNHELGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE-TPA  314
            KGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VE P +EKE TP+
Sbjct  514  KGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVEQPNDEKEATPS  566



>ref|XP_004985740.1| PREDICTED: chaperonin CPN60-1, mitochondrial-like [Setaria italica]
Length=570

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL+ERLAKLSGGVAVLKIGGASEAEVGEKKDRV DALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLKERLAKLSGGVAVLKIGGASEAEVGEKKDRVIDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK+LDKL +AN DQKIGVQ+IQNALKTPV TIASNAGVEGAV+VGKLLEQ+N DLGYDAA
Sbjct  454  SKDLDKLQSANLDQKIGVQIIQNALKTPVQTIASNAGVEGAVIVGKLLEQENTDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKVIRTAL+DAASVSSL+TTTE++IVE PKEE   PA
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALMDAASVSSLMTTTESIIVESPKEESSAPA  565



>gb|EYU43803.1| hypothetical protein MIMGU_mgv1a003536mg [Erythranthe guttata]
Length=579

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDKL TANFDQKIGVQ+IQNALK PVYTIA+NAGVEGAVVVGKLLE  +PDLGYDAA
Sbjct  454  AKELDKLATANFDQKIGVQIIQNALKMPVYTIAANAGVEGAVVVGKLLESVDPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTEA++VE P  +K
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVEQPSSDK  561



>gb|KFK31073.1| hypothetical protein AALP_AA6G064700 [Arabis alpina]
Length=580

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EV E KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASETEVSETKDRVTDALNATRAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALK PV+TIASNAGVEGAV+VGKLLEQDN DLGYDAA
Sbjct  454  SKELEKLSTANFDQKIGVQIIQNALKMPVHTIASNAGVEGAVIVGKLLEQDNYDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEA++ E+P +E E
Sbjct  514  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAIVTEIPSKETE  562



>emb|CDP03832.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EK DRVTDALNATKAAVEEGIV GGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVSEKMDRVTDALNATKAAVEEGIVQGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+ L T+NFDQKIGVQ+IQNALK PV TIASNAG EGAVVVGKL+EQDNPDLGYDAA
Sbjct  454  SKELENLQTSNFDQKIGVQIIQNALKAPVQTIASNAGAEGAVVVGKLMEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
             GEYVDM+KAGI+DPLKVIRTALVDAASVSSLLTTTEAV+VE PK+EKE+
Sbjct  514  NGEYVDMIKAGIMDPLKVIRTALVDAASVSSLLTTTEAVVVEHPKDEKES  563



>ref|XP_011020718.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform X1 
[Populus euphratica]
 ref|XP_011020719.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform X1 
[Populus euphratica]
 ref|XP_011020720.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform X2 
[Populus euphratica]
Length=574

 Score =   297 bits (760),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL ERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYA
Sbjct  394  EKLHERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPV+TIA+NAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKTPVHTIATNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            K EYVDMVKAGIIDPLKVIRTALVDAASVSSL+TTTE V+ ELPK+E + PA
Sbjct  514  KDEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTETVVTELPKDENDAPA  565



>ref|XP_010666478.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL+ERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAV EGIVPGGGVALLYA
Sbjct  391  EKLEERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVAEGIVPGGGVALLYA  450

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TAN+DQKIGV++IQ ALKT V+TIASNAGVEGA+VVGKLLEQ++ DLGYDAA
Sbjct  451  SKELDKLQTANYDQKIGVRIIQAALKTSVHTIASNAGVEGALVVGKLLEQEDHDLGYDAA  510

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK+GIIDPLKVIRTAL DAASVSSL+ TTEAV+VE PK+EK++    GGMGGM
Sbjct  511  KGEYVDMVKSGIIDPLKVIRTALSDAASVSSLMITTEAVVVEAPKDEKDSAPAMGGMGGM  570

Query  289  DY  284
            DY
Sbjct  571  DY  572



>ref|XP_002966324.1| hypothetical protein SELMODRAFT_85251, partial [Selaginella moellendorffii]
 gb|EFJ32351.1| hypothetical protein SELMODRAFT_85251, partial [Selaginella moellendorffii]
Length=557

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGG SEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  376  EKLQERLAKLSGGVAVLKIGGGSEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  435

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S++LDKL T NFDQK+GVQ+IQ+ALK P YTIA+NAGVEGAVVVGKL EQ++ +LGYDAA
Sbjct  436  SRDLDKLETPNFDQKVGVQIIQSALKMPTYTIAANAGVEGAVVVGKLWEQNDYNLGYDAA  495

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDP+KV+RTAL DAASVSSLLTTTEAV+ +LPKEEK     G G   +
Sbjct  496  KGEYVDMVKAGIIDPVKVLRTALGDAASVSSLLTTTEAVVYDLPKEEKAAAGGGMGGHDL  555

Query  289  DY  284
            DY
Sbjct  556  DY  557



>ref|XP_008235753.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Prunus mume]
Length=555

 Score =   287 bits (734),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 166/183 (91%), Gaps = 3/183 (2%)
 Frame = -3

Query  823  LQERLAKLSGGVAVLK---IGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLY  653
            ++ER  +L   + +     IGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLY
Sbjct  373  IEERCEQLRSSIELSTSDYIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLY  432

Query  652  ASKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDA  473
            ASKELDKL TANFDQKIGVQ+IQNALK PV TIASNAGVEGAVVVGKLLEQDNPDLGYDA
Sbjct  433  ASKELDKLATANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDA  492

Query  472  AKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmgg  293
            AKGEYVDM+KAGIIDPLKVIRTALVDAASVSSL+TTTEAV+VELPK+EKETP MGGGMGG
Sbjct  493  AKGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPGMGGGMGG  552

Query  292  MDY  284
            MDY
Sbjct  553  MDY  555



>ref|XP_001772410.1| predicted protein [Physcomitrella patens]
 gb|EDQ62881.1| predicted protein [Physcomitrella patens]
Length=580

 Score =   287 bits (735),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEVEVNEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S+EL+K+ TANFDQKIGVQ+IQNAL+ P YTIA NAGVEGAVVVGKL+EQ N  +GYDAA
Sbjct  453  SRELEKVQTANFDQKIGVQIIQNALRMPAYTIARNAGVEGAVVVGKLMEQTNMSIGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            K EYVDMVKAGIIDP+KVIRTALVDAASV+SL+TTTEAVI + PK++KE
Sbjct  513  KAEYVDMVKAGIIDPVKVIRTALVDAASVASLMTTTEAVIADFPKDDKE  561



>ref|XP_002978237.1| hypothetical protein SELMODRAFT_108429, partial [Selaginella 
moellendorffii]
 gb|EFJ20894.1| hypothetical protein SELMODRAFT_108429, partial [Selaginella 
moellendorffii]
Length=557

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGG SEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  376  EKLQERLAKLSGGVAVLKIGGGSEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  435

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S++LDKL T NFDQK+GVQ+IQ+ALK P YTIA+NAGVEGAVVVGKL EQ++ +LGYDAA
Sbjct  436  SRDLDKLETPNFDQKVGVQIIQSALKMPTYTIAANAGVEGAVVVGKLWEQNDYNLGYDAA  495

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDP+KV+RTAL DAASVSSLLTTTEAV+ +LPKEEK     G G   +
Sbjct  496  KGEYVDMVKAGIIDPVKVLRTALGDAASVSSLLTTTEAVVYDLPKEEKAAAGGGMGGHDL  555

Query  289  DY  284
            DY
Sbjct  556  DY  557



>gb|KFK24236.1| hypothetical protein AALP_AAs53933U000100, partial [Arabis alpina]
Length=182

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 152/170 (89%), Gaps = 10/170 (6%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL+ERLAKLSGGVAVLKIGGASEAEVGEKKDR TDALNATK  VEEGI+PGGGVAL   
Sbjct  8    EKLKERLAKLSGGVAVLKIGGASEAEVGEKKDRETDALNATKVVVEEGILPGGGVAL---  64

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
                   PTANFD+KIGVQ+IQNA KTPVYTIASNAGVEGAV+VGKLLEQDNPDL YDAA
Sbjct  65   -------PTANFDKKIGVQIIQNAFKTPVYTIASNAGVEGAVIVGKLLEQDNPDLSYDAA  117

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            K E+VDMVKAGIIDPLKVIRTALV AASVSSLLTTTEAV+VELPK+E E+
Sbjct  118  KCEFVDMVKAGIIDPLKVIRTALVGAASVSSLLTTTEAVVVELPKDESES  167



>ref|XP_001783814.1| predicted protein [Physcomitrella patens]
 gb|EDQ51354.1| predicted protein [Physcomitrella patens]
Length=578

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  393  EKLQERLAKLSGGVAVLKIGGASEVEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S+ELD + T+NFDQK+GVQ+IQNALK P YTIA NAGVEGAVVVGKLLE+ N ++GYDAA
Sbjct  453  SRELDNVQTSNFDQKVGVQIIQNALKMPAYTIARNAGVEGAVVVGKLLEEANLNIGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            K EYVDMVKAGIIDP+KVIRTALVDAASV+SLLTTTEA++ + PK+++  P
Sbjct  513  KAEYVDMVKAGIIDPVKVIRTALVDAASVASLLTTTEAIVADFPKDDEAMP  563



>ref|XP_001760735.1| predicted protein [Physcomitrella patens]
 gb|EDQ74474.1| predicted protein [Physcomitrella patens]
Length=580

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL+ERLAKLSGGVAVLKIGG SE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  392  EKLEERLAKLSGGVAVLKIGGTSEVEVNEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  451

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL K+PT NFDQ+IGVQ+IQNALK P YTIA NAG+EGAVVVGKLL+Q N ++GYDAA
Sbjct  452  SKELYKIPTNNFDQRIGVQIIQNALKMPAYTIAHNAGLEGAVVVGKLLDQSNLNIGYDAA  511

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            KGEYVDMVKAGIIDP+KVIRTA VDAASV+SL+TTTEAV+ E  KEEK+
Sbjct  512  KGEYVDMVKAGIIDPVKVIRTAFVDAASVASLMTTTEAVVAESNKEEKD  560



>ref|XP_001762115.1| predicted protein [Physcomitrella patens]
 gb|EDQ73219.1| predicted protein [Physcomitrella patens]
Length=575

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 156/170 (92%), Gaps = 1/170 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  390  EKLQERLAKLSGGVAVLKIGGASEVEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  449

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S+ELDK+ TANFDQK+GVQ+IQNALK P YTIA NAGVEGAVVVGKLLEQ N  +GYDAA
Sbjct  450  SRELDKIQTANFDQKVGVQIIQNALKMPAYTIAQNAGVEGAVVVGKLLEQTNMSIGYDAA  509

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPK-EEKE  323
            K EYVDMVKAGIIDP+KVIRT+LVDAASV+SL+TTTE+V+ +  K E+KE
Sbjct  510  KAEYVDMVKAGIIDPVKVIRTSLVDAASVASLMTTTESVVADFNKAEDKE  559



>ref|XP_008808005.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X2 
[Phoenix dactylifera]
Length=431

 Score =   270 bits (690),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASEAEVGE+KD+VTDALNA++AAVEEGIVPGGGVALLYA
Sbjct  250  EKAQERLSKLSGGVAVLKIGGASEAEVGERKDKVTDALNASRAAVEEGIVPGGGVALLYA  309

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++ELD++ T+N ++KIGVQ+I+NALK P +TIA+NAGV+GAV++GKLLEQ+N +LGYDAA
Sbjct  310  TRELDRIQTSNGNEKIGVQIIKNALKAPTFTIATNAGVDGAVIIGKLLEQENLNLGYDAA  369

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK+GIIDPLKVIRTALVDAASVS LLTTTEA +VEL + ++   +    M  M
Sbjct  370  KGEYVDMVKSGIIDPLKVIRTALVDAASVSVLLTTTEAAVVELAEAKRPRASRMPEMDDM  429

Query  289  DY  284
            DY
Sbjct  430  DY  431



>gb|AEZ00902.1| putative mitochondrial chaperonin HSP60 protein, partial [Elaeis 
guineensis]
Length=178

 Score =   258 bits (659),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  817  ERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL  638
            ERL+KLSGGVAVLK+GGASEAEV E+KDRVTD+LNA +AAVEEGIVPGGGVALLYA++EL
Sbjct  1    ERLSKLSGGVAVLKVGGASEAEVSERKDRVTDSLNAARAAVEEGIVPGGGVALLYAAREL  60

Query  637  DKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEY  458
            D + T+N D+KIGVQ+I+NALK P +TIA+NAGV+GAV++GKLLEQ+N +LGYDAAKGEY
Sbjct  61   DSIQTSNGDEKIGVQIIKNALKAPTFTIATNAGVDGAVIIGKLLEQENLNLGYDAAKGEY  120

Query  457  VDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVEL  341
            VDMVKAGI+DPLKVIRTALVDAASVS LLTTTEA +VEL
Sbjct  121  VDMVKAGILDPLKVIRTALVDAASVSVLLTTTEAAVVEL  159



>ref|XP_008807997.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X1 
[Phoenix dactylifera]
Length=576

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASEAEVGE+KD+VTDALNA++AAVEEGIVPGGGVALLYA
Sbjct  395  EKAQERLSKLSGGVAVLKIGGASEAEVGERKDKVTDALNASRAAVEEGIVPGGGVALLYA  454

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++ELD++ T+N ++KIGVQ+I+NALK P +TIA+NAGV+GAV++GKLLEQ+N +LGYDAA
Sbjct  455  TRELDRIQTSNGNEKIGVQIIKNALKAPTFTIATNAGVDGAVIIGKLLEQENLNLGYDAA  514

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVK+GIIDPLKVIRTALVDAASVS LLTTTEA +VEL + ++   +    M  M
Sbjct  515  KGEYVDMVKSGIIDPLKVIRTALVDAASVSVLLTTTEAAVVELAEAKRPRASRMPEMDDM  574

Query  289  DY  284
            DY
Sbjct  575  DY  576



>ref|XP_009410784.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGI+PGGGV+LLYA
Sbjct  401  EKAQERLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGILPGGGVSLLYA  460

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDK+ T+N D+ IGVQ+I+NALK P  TIA NAGV+GAVVVGKLLEQ+N +LGYDAA
Sbjct  461  TKELDKIQTSNSDENIGVQIIKNALKAPTLTIAGNAGVDGAVVVGKLLEQENLNLGYDAA  520

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            KGEYVDMV+AGIIDPLKV+RTALVDAASVS LLTTTEA +VELP
Sbjct  521  KGEYVDMVEAGIIDPLKVVRTALVDAASVSVLLTTTEAAVVELP  564



>ref|XP_010925015.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X2 
[Elaeis guineensis]
Length=431

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLK+GGASEAEV E+KDRVTD+LNA +AAVEEGIVPGGGVALLYA
Sbjct  250  EKAQERLSKLSGGVAVLKVGGASEAEVSERKDRVTDSLNAARAAVEEGIVPGGGVALLYA  309

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++ELD + T+N D+KIGVQ+I+NALK P +TIA+NAGV+GAV++GKLLEQ+N +LGYDAA
Sbjct  310  ARELDSIQTSNGDEKIGVQIIKNALKAPTFTIATNAGVDGAVIIGKLLEQENLNLGYDAA  369

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVEL  341
            KGEYVDMVKAGI+DPLKVIRTALVDAASVS LLTTTEA +VEL
Sbjct  370  KGEYVDMVKAGILDPLKVIRTALVDAASVSVLLTTTEAAVVEL  412



>ref|XP_010106240.1| hypothetical protein L484_005105 [Morus notabilis]
 gb|EXC09149.1| hypothetical protein L484_005105 [Morus notabilis]
Length=528

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERLAKLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  348  EKAQERLAKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  407

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK L+ L T N DQKIGVQ+IQNA+K P +TIA+NAG +GA+V+GKLLEQD+ +LGYDAA
Sbjct  408  SKALENLQTQNGDQKIGVQIIQNAIKAPTFTIATNAGFDGALVLGKLLEQDDYNLGYDAA  467

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYVDMVKAGIIDPLKV+RTALVDAAS+S LLTTTEA ++E P + K+ P+    M   
Sbjct  468  KGEYVDMVKAGIIDPLKVVRTALVDAASISLLLTTTEAAVLENP-DVKKPPSRMPDMDSF  526

Query  289  DY  284
            DY
Sbjct  527  DY  528



>ref|XP_010925013.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X1 
[Elaeis guineensis]
Length=576

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 156/171 (91%), Gaps = 2/171 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLK+GGASEAEV E+KDRVTD+LNA +AAVEEGIVPGGGVALLYA
Sbjct  395  EKAQERLSKLSGGVAVLKVGGASEAEVSERKDRVTDSLNAARAAVEEGIVPGGGVALLYA  454

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++ELD + T+N D+KIGVQ+I+NALK P +TIA+NAGV+GAV++GKLLEQ+N +LGYDAA
Sbjct  455  ARELDSIQTSNGDEKIGVQIIKNALKAPTFTIATNAGVDGAVIIGKLLEQENLNLGYDAA  514

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KGEYVDMVKAGI+DPLKVIRTALVDAASVS LLTTTEA +VEL   E ++P
Sbjct  515  KGEYVDMVKAGILDPLKVIRTALVDAASVSVLLTTTEAAVVELA--EAKSP  563



>gb|EMT28156.1| Chaperonin CPN60-like 2, mitochondrial [Aegilops tauschii]
Length=592

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVA+LKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA
Sbjct  411  EKAQERLSKLSGGVAILKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYA  470

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELD + T++ D+KIGVQ+I+NALK P+ TIA+NAGV+GA+V+GKLLEQDN  LGYDAA
Sbjct  471  TKELDNISTSHEDEKIGVQIIKNALKAPLMTIAANAGVDGAIVIGKLLEQDNLSLGYDAA  530

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            KGEYVDM+KAGIIDP+KVIRTAL DAASVS L+TTTEA + ELP
Sbjct  531  KGEYVDMIKAGIIDPVKVIRTALQDAASVSLLMTTTEAAVAELP  574



>dbj|BAJ88210.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=582

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA
Sbjct  401  EKAQERLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYA  460

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELD++ T++ D++IGVQ+I+NALK P+ TIA+NAGV+GA+V+GKLLEQDN  LGYDAA
Sbjct  461  AKELDQISTSHEDERIGVQIIKNALKAPLMTIAANAGVDGAIVIGKLLEQDNLSLGYDAA  520

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            KGEYVDM+KAGIIDP+KVIRTAL DAASVS L+TTTEA + ELP
Sbjct  521  KGEYVDMIKAGIIDPVKVIRTALQDAASVSLLMTTTEAAVAELP  564



>ref|NP_001140224.1| uncharacterized protein LOC100272259 [Zea mays]
 gb|ACF83366.1| unknown [Zea mays]
Length=441

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA
Sbjct  260  EKAQERLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYA  319

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDK+ TAN D+KIGVQ+I+N+LK P+ TIA+NAG++GA+V+GKL+EQ++  LGYDAA
Sbjct  320  TKELDKISTANEDEKIGVQIIKNSLKAPLMTIAANAGIDGAIVIGKLIEQEDLSLGYDAA  379

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            KGEYVDM+KAGIIDP+KVIRTAL DAASVS L+ TTEA + ELP
Sbjct  380  KGEYVDMIKAGIIDPVKVIRTALQDAASVSLLMATTEAAVSELP  423



>ref|XP_010242227.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Nelumbo nucifera]
Length=574

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK L+ L T+N DQK G+Q+IQ+A+K P +TIASNAGV+G+VV+GKLLEQ++ +LGYDAA
Sbjct  453  SKALENLETSNSDQKRGIQIIQDAVKAPTFTIASNAGVDGSVVLGKLLEQEDFNLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            +GEYVDMVKAGIIDPLKV+RTALVDAASVS LLTT+EA +V+ P      P     M  M
Sbjct  513  RGEYVDMVKAGIIDPLKVVRTALVDAASVSLLLTTSEAAVVDHPDASSSVPNRMPVMDDM  572

Query  289  DY  284
            DY
Sbjct  573  DY  574



>ref|XP_004961365.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Setaria 
italica]
Length=579

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA KAAVEEGIVPGGGVALLYA
Sbjct  398  EKAQERLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAAKAAVEEGIVPGGGVALLYA  457

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDK+ TAN D+KIGVQ+I+NALK P+ TIA+NAG++GA+V+GKL EQD+  LGYDA+
Sbjct  458  TKELDKISTANEDEKIGVQIIKNALKAPLMTIAANAGIDGAIVIGKLSEQDDLSLGYDAS  517

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            +GEYVDM+KAGIIDP+KVIRTAL DAASVS L+TTTEA + ELP
Sbjct  518  RGEYVDMIKAGIIDPVKVIRTALQDAASVSLLMTTTEAAVSELP  561



>ref|XP_007215308.1| hypothetical protein PRUPE_ppa003440mg [Prunus persica]
 gb|EMJ16507.1| hypothetical protein PRUPE_ppa003440mg [Prunus persica]
Length=574

 Score =   263 bits (672),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L   N DQ+ GVQ+IQNALK P +TI SNAG +G +V+GKLLEQD+P LGYDAA
Sbjct  453  TKALDNLQVQNEDQRRGVQIIQNALKAPTFTIVSNAGFDGPLVLGKLLEQDDPKLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KGEYVDMVKAGIIDPLKVIRTAL+DAASVS LLTTTEA +V+ P E+K
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALIDAASVSLLLTTTEAAVVDKPNEKK  560



>ref|XP_008228292.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Prunus mume]
Length=574

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L   N DQ+ GVQ+IQNALK P +TI SNAG +G +V+GKLLEQD+P LGYDAA
Sbjct  453  TKALDNLQVQNEDQRRGVQIIQNALKAPTFTIVSNAGFDGPLVLGKLLEQDDPKLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KGE+VDMVKAGIIDPLKVIRTALVDAASVS LLTTTEA +V+ P E+K
Sbjct  513  KGEFVDMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAVVDKPNEKK  560



>ref|XP_003567994.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Brachypodium 
distachyon]
Length=576

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL++LSGGVA+LKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA
Sbjct  395  EKAQERLSRLSGGVAILKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYA  454

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LDK+ T++ D+KIGVQ+I+NALK P+ TIA+NAGV+GA+V+GKLLEQDNP LGYDAA
Sbjct  455  TKVLDKISTSHEDEKIGVQIIKNALKAPLMTIAANAGVDGAIVIGKLLEQDNPSLGYDAA  514

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            K EYVDMVKAGIIDP+KVIRTAL DAASVS L+ TTEA + ELP
Sbjct  515  KEEYVDMVKAGIIDPVKVIRTALQDAASVSLLMATTEAAVSELP  558



>ref|XP_008647482.1| PREDICTED: uncharacterized protein LOC100272259 isoform X2 [Zea 
mays]
 gb|AFW78923.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=565

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA
Sbjct  384  EKAQERLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYA  443

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDK+ TAN D+KIGVQ+I+N+LK P+ TIA+NAG++GA+V+GKL+EQ++  LGYDAA
Sbjct  444  TKELDKISTANEDEKIGVQIIKNSLKAPLMTIAANAGIDGAIVIGKLIEQEDLSLGYDAA  503

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            KGEYVDM+KAGIIDP+KVIRTAL DAASVS L+ TTEA + ELP
Sbjct  504  KGEYVDMIKAGIIDPVKVIRTALQDAASVSLLMATTEAAVSELP  547



>ref|XP_008647480.1| PREDICTED: uncharacterized protein LOC100272259 isoform X1 [Zea 
mays]
 gb|ACN25829.1| unknown [Zea mays]
 gb|AFW78924.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=580

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA
Sbjct  399  EKAQERLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYA  458

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDK+ TAN D+KIGVQ+I+N+LK P+ TIA+NAG++GA+V+GKL+EQ++  LGYDAA
Sbjct  459  TKELDKISTANEDEKIGVQIIKNSLKAPLMTIAANAGIDGAIVIGKLIEQEDLSLGYDAA  518

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            KGEYVDM+KAGIIDP+KVIRTAL DAASVS L+ TTEA + ELP
Sbjct  519  KGEYVDMIKAGIIDPVKVIRTALQDAASVSLLMATTEAAVSELP  562



>ref|XP_002441451.1| hypothetical protein SORBIDRAFT_09g026970 [Sorghum bicolor]
 gb|EES19881.1| hypothetical protein SORBIDRAFT_09g026970 [Sorghum bicolor]
Length=581

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA
Sbjct  400  EKAQERLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYA  459

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDK+ T+N D+KIGVQ+I+N+LK P+ TIA+NAG++GA+V+GKL+EQ++  LGYDAA
Sbjct  460  TKELDKISTSNEDEKIGVQIIKNSLKAPLMTIAANAGIDGAIVIGKLIEQEDLSLGYDAA  519

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            KGEYVDM+KAGIIDP+KVIRTAL DAASVS L+TTTEA + ELP
Sbjct  520  KGEYVDMIKAGIIDPVKVIRTALQDAASVSLLMTTTEAAVSELP  563



>ref|XP_010654528.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Vitis vinifera]
Length=574

 Score =   261 bits (667),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AA+EEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAIEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ + T+N DQK GVQ+IQN LK P +TI SNAG +GA+V+GKLLEQD+ +LGYDAA
Sbjct  453  TKVLENIQTSNEDQKRGVQIIQNGLKAPTFTIVSNAGGDGALVLGKLLEQDDLNLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KG YVDMVKAGIIDPLKV+RTALVDAASVS LLTTTEA +V+ P E+   P+
Sbjct  513  KGVYVDMVKAGIIDPLKVVRTALVDAASVSLLLTTTEATVVDHPDEKNSAPS  564



>emb|CAN78641.1| hypothetical protein VITISV_031740 [Vitis vinifera]
Length=579

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AA+EEGIVPGGGVALLYA
Sbjct  398  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAIEEGIVPGGGVALLYA  457

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ + T+N DQK GVQ+IQN LK P +TI SNAG +GA+V+GKLLEQD+ +LGYDAA
Sbjct  458  TKVLENIQTSNEDQKRGVQIIQNGLKAPTFTIVSNAGGDGALVLGKLLEQDDLNLGYDAA  517

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KG YVDMVKAGIIDPLKV+RTALVDAASVS LLTTTEA +V+ P E+   P+
Sbjct  518  KGVYVDMVKAGIIDPLKVVRTALVDAASVSLLLTTTEATVVDHPDEKNSAPS  569



>emb|CBI35954.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   260 bits (665),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AA+EEGIVPGGGVALLYA
Sbjct  384  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAIEEGIVPGGGVALLYA  443

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ + T+N DQK GVQ+IQN LK P +TI SNAG +GA+V+GKLLEQD+ +LGYDAA
Sbjct  444  TKVLENIQTSNEDQKRGVQIIQNGLKAPTFTIVSNAGGDGALVLGKLLEQDDLNLGYDAA  503

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KG YVDMVKAGIIDPLKV+RTALVDAASVS LLTTTEA +V+ P E+   P+
Sbjct  504  KGVYVDMVKAGIIDPLKVVRTALVDAASVSLLLTTTEATVVDHPDEKNSAPS  555



>ref|XP_002967038.1| hypothetical protein SELMODRAFT_87823, partial [Selaginella moellendorffii]
 gb|EFJ31637.1| hypothetical protein SELMODRAFT_87823, partial [Selaginella moellendorffii]
Length=548

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL+ERL KLSGGVA+LK+GG SEAEV EKKDRV DALNAT AA+EEGIVPGGGVALLYA
Sbjct  361  EKLEERLGKLSGGVAMLKVGGGSEAEVMEKKDRVMDALNATNAAIEEGIVPGGGVALLYA  420

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            + EL  L   +FDQKIGVQVIQNALK P +TIA+NAGVEGA+VV KLLEQ +P+ GYDAA
Sbjct  421  ANELKNLSVPSFDQKIGVQVIQNALKIPTHTIAANAGVEGALVVSKLLEQSSPNFGYDAA  480

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
             GEYVDM+KAGIIDP+KVIR AL+DAAS+SSLLTTTE VI E+ +EE+E
Sbjct  481  TGEYVDMIKAGIIDPVKVIRIALMDAASISSLLTTTEVVITEVFREERE  529



>gb|AFW78925.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=648

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA
Sbjct  467  EKAQERLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYA  526

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDK+ TAN D+KIGVQ+I+N+LK P+ TIA+NAG++GA+V+GKL+EQ++  LGYDAA
Sbjct  527  TKELDKISTANEDEKIGVQIIKNSLKAPLMTIAANAGIDGAIVIGKLIEQEDLSLGYDAA  586

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            KGEYVDM+KAGIIDP+KVIRTAL DAASVS L+ TTEA + ELP
Sbjct  587  KGEYVDMIKAGIIDPVKVIRTALQDAASVSLLMATTEAAVSELP  630



>ref|XP_012068975.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X2 
[Jatropha curcas]
Length=573

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ L   N DQK G+Q+IQNALK P YTI SNAG +  VV+GKLLEQD+ + GYDAA
Sbjct  453  NKALEDLQAQNEDQKRGIQIIQNALKAPTYTIVSNAGFDAPVVLGKLLEQDDHNFGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYV+MVKAGIIDPLKVIRTALVDAASVS LLTTTEA IV+ P  EK+ P+    M  +
Sbjct  513  KGEYVNMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAIVDSPN-EKKPPSRMPNMDDL  571

Query  289  DY  284
            DY
Sbjct  572  DY  573



>ref|XP_012068973.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X1 
[Jatropha curcas]
Length=574

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  394  EKAQERLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ L   N DQK G+Q+IQNALK P YTI SNAG +  VV+GKLLEQD+ + GYDAA
Sbjct  454  NKALEDLQAQNEDQKRGIQIIQNALKAPTYTIVSNAGFDAPVVLGKLLEQDDHNFGYDAA  513

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGEYV+MVKAGIIDPLKVIRTALVDAASVS LLTTTEA IV+ P  EK+ P+    M  +
Sbjct  514  KGEYVNMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAIVDSPN-EKKPPSRMPNMDDL  572

Query  289  DY  284
            DY
Sbjct  573  DY  574



>ref|XP_008391328.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Malus domestica]
Length=574

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ L   N DQ+ GVQ+IQNALK P +TI SNAG +GA+V+GKLLEQD+  +GYDAA
Sbjct  453  TKSLENLHMQNEDQRRGVQIIQNALKAPTFTIVSNAGFDGALVIGKLLEQDDLKMGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KGEYVDMVKAGIIDPLKVIRTALVDAASVS LLTTTEA +V+ P ++K
Sbjct  513  KGEYVDMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAVVDNPDQKK  560



>gb|KHN11282.1| Chaperonin CPN60-like 2, mitochondrial [Glycine soja]
Length=559

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  378  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  437

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N D+K GVQ+IQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAA
Sbjct  438  TKVLDNLQTQNEDEKRGVQIIQNALKAPTSTIASNAGFDGALVHSKLLEQDDHNLGFDAA  497

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KG YVDMVKAGIIDPLKV+RTALVDAASVS LLTTTEA +++ P ++ ++P+
Sbjct  498  KGVYVDMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAVLDNPHDKNKSPS  549



>ref|XP_002946991.1| hypothetical protein VOLCADRAFT_79395 [Volvox carteri f. nagariensis]
 gb|EFJ52217.1| hypothetical protein VOLCADRAFT_79395 [Volvox carteri f. nagariensis]
Length=571

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASE EVGEKKDRV DALNATKAAVEEGIVPGGG ALL+A
Sbjct  390  EKLQERLAKLSGGVAVLKIGGASEVEVGEKKDRVVDALNATKAAVEEGIVPGGGAALLHA  449

Query  649  SKELDKLPTA--NFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            SK LD + +   NFDQKIGVQ+IQNAL+ P+ TIASNAGVEGAVVVGK+LE ++P +GY+
Sbjct  450  SKALDDVKSKLDNFDQKIGVQIIQNALRVPMKTIASNAGVEGAVVVGKVLELEDPAMGYN  509

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            AA G+Y DMVK GIIDPLKV+RTALVDAASVSSL+TT+E V+VE P+++K
Sbjct  510  AATGQYQDMVKGGIIDPLKVVRTALVDAASVSSLITTSECVVVEAPEDKK  559



>ref|XP_006585518.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=506

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  325  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  384

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N D+K GVQ+IQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAA
Sbjct  385  TKVLDNLQTQNEDEKRGVQIIQNALKAPTSTIASNAGFDGALVHSKLLEQDDHNLGFDAA  444

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KG YVDMVKAGIIDPLKV+RTALVDAASVS LLTTTEA +++ P ++ + P+
Sbjct  445  KGVYVDMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAVLDNPHDKNKPPS  496



>ref|XP_006655538.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Oryza 
brachyantha]
Length=578

 Score =   258 bits (659),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV+KIGGASEAEVGEKKDRVTDAL+A +AAVEEGIVPGGGVALLYA
Sbjct  396  EKAQERLSKLSGGVAVVKIGGASEAEVGEKKDRVTDALHAARAAVEEGIVPGGGVALLYA  455

Query  649  SKELDKLPTA-NFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDA  473
            +KELDK+ TA N D+KIGVQ+I+NALK P+ TIA+NAG++G VV+GKL+EQDN +LG+DA
Sbjct  456  TKELDKIITATNEDEKIGVQIIKNALKAPLMTIAANAGIDGGVVIGKLIEQDNLNLGFDA  515

Query  472  AKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELP  338
            A+GEYVDM+KAGIIDP+KVIRTAL DAASVS L+TTTEA + ELP
Sbjct  516  ARGEYVDMIKAGIIDPVKVIRTALQDAASVSLLMTTTEAAVAELP  560



>gb|KDO65217.1| hypothetical protein CISIN_1g0081811mg, partial [Citrus sinensis]
Length=194

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KL+GGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  13   EKAQERLSKLTGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  72

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ L T N DQ+ G+ +IQNALK P  TIASNAG +G+ ++GKLLEQD+ + G+DAA
Sbjct  73   TKALENLKTENEDQRRGIHIIQNALKAPTLTIASNAGFDGSTIIGKLLEQDDVNFGFDAA  132

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKV+RTAL DAASVS L TTTEA ++    ++ + P+
Sbjct  133  KGEYVDMVKAGIIDPLKVVRTALADAASVSLLFTTTEATVLVNSDDKNKPPS  184



>gb|KJB56921.1| hypothetical protein B456_009G141700 [Gossypium raimondii]
Length=429

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 152/182 (84%), Gaps = 2/182 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLY+
Sbjct  250  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGILPGGGVALLYS  309

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L  L T N DQK GVQ+IQ+ALK P  TIASNAG +G++V+GKLLEQD+ +LG+DA+
Sbjct  310  TKALQNLQTENEDQKRGVQIIQDALKAPTLTIASNAGYDGSLVLGKLLEQDDDNLGFDAS  369

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KG Y+DMVKAGIIDPLKVIRTALVDAASVS LLTTTEA ++E P E+K  P         
Sbjct  370  KGAYIDMVKAGIIDPLKVIRTALVDAASVSLLLTTTEASVLENPDEKK--PPSRMPDIDN  427

Query  289  DY  284
            DY
Sbjct  428  DY  429



>ref|XP_002960969.1| hypothetical protein SELMODRAFT_74977, partial [Selaginella moellendorffii]
 gb|EFJ38508.1| hypothetical protein SELMODRAFT_74977, partial [Selaginella moellendorffii]
Length=548

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL+ERL KLSGGVA+LK+GG SEAEV EKKDRV DALNAT AA+EEGIVPGGGVALLYA
Sbjct  361  EKLEERLGKLSGGVAMLKVGGGSEAEVMEKKDRVMDALNATNAAIEEGIVPGGGVALLYA  420

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +  L  L   +FDQKIGVQVIQNALK P +TIA+NAGVEGA+VV KLLEQ +P+ GYDAA
Sbjct  421  ANALKNLNVPSFDQKIGVQVIQNALKIPTHTIAANAGVEGALVVSKLLEQSSPNFGYDAA  480

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
             GEYVDM+KAGIIDP+KVIR AL+DAAS+SSLLTTTE VI E+ +EE+E
Sbjct  481  TGEYVDMIKAGIIDPVKVIRIALMDAASISSLLTTTEVVITEVFREERE  529



>ref|XP_003531614.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=574

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N D+K GVQ+IQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAA
Sbjct  453  TKVLDNLQTQNEDEKRGVQIIQNALKAPTSTIASNAGFDGALVHSKLLEQDDHNLGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KG YVDMVKAGIIDPLKV+RTALVDAASVS LLTTTEA +++ P ++ + P+
Sbjct  513  KGVYVDMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAVLDNPHDKNKPPS  564



>ref|XP_009341038.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Pyrus x bretschneideri]
Length=570

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  389  EKAQERLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  448

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
             K L+ L   N DQ+ GVQ+IQNALK P +TI SNAG +GA+V+GKLLEQD+  +GYDAA
Sbjct  449  IKSLENLHMQNEDQRRGVQIIQNALKAPTFTIVSNAGFDGALVLGKLLEQDDLKMGYDAA  508

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KGEYVDMVKAGIIDPLKVIRTALVDAASVS LLTTTEA +V+ P ++K
Sbjct  509  KGEYVDMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAVVDNPDQKK  556



>ref|XP_001691353.1| chaperonin 60C [Chlamydomonas reinhardtii]
 gb|EDP05086.1| chaperonin 60C, partial [Chlamydomonas reinhardtii]
Length=537

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAV+KIGGASE EVGEKKDRV DALNATKAAVEEGIVPGGG ALL+A
Sbjct  356  EKLQERLAKLSGGVAVIKIGGASEVEVGEKKDRVVDALNATKAAVEEGIVPGGGSALLHA  415

Query  649  SKELDKLPTA--NFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            SK LD +     NFDQKIGV +IQNAL+ P+ TIASNAGVEGAV+VGK+LE   P +GY+
Sbjct  416  SKTLDDVTAKLDNFDQKIGVNIIQNALRVPMKTIASNAGVEGAVIVGKVLEMAEPQMGYN  475

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            AA GE+VDM+K GIIDPLKV+RTALVDAASVSSL+TT+E V+VE P+++K
Sbjct  476  AATGEFVDMIKGGIIDPLKVVRTALVDAASVSSLITTSECVVVEAPEDKK  525



>ref|XP_004510380.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Cicer 
arietinum]
Length=576

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  395  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  454

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK LD L T N D++ GVQ+IQNALK P +TIASNAG +G +V  KLLEQD+ +LG+DAA
Sbjct  455  SKVLDNLQTKNEDERRGVQIIQNALKAPTFTIASNAGFDGTLVHSKLLEQDDLNLGFDAA  514

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KG YVDMVKAGIIDP+KV+RTALVDAAS+S LLTTTEA IVE   ++ + P     M  +
Sbjct  515  KGTYVDMVKAGIIDPVKVVRTALVDAASISLLLTTTEASIVESLSDKNKPPQRVADMDDL  574

Query  289  DY  284
            DY
Sbjct  575  DY  576



>gb|AFK48092.1| unknown [Lotus japonicus]
Length=352

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASE+EVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  171  EKAQERLSKLSGGVAVFKVGGASESEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  230

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ L T N D+K GVQ+IQNALK P  TI +NAG +G++V  KLLEQD+ +LG+DAA
Sbjct  231  TKVLENLETKNEDEKRGVQIIQNALKAPTVTIVANAGFDGSLVQNKLLEQDDHNLGFDAA  290

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
             G YVDMVKAGIIDPLKV+RTALVDAASVS LLTT EA +VE P  + ++P+    M  +
Sbjct  291  TGTYVDMVKAGIIDPLKVVRTALVDAASVSLLLTTMEAAVVENPNNKNKSPSPVADMDDL  350

Query  289  DY  284
            DY
Sbjct  351  DY  352



>emb|CBL93634.1| mitochondrial chaperonin 60 precursor [Chlamydomonas reinhardtii]
Length=571

 Score =   256 bits (653),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAV+KIGGASE EVGEKKDRV DALNATKAAVEEGIVPGGG ALL+A
Sbjct  390  EKLQERLAKLSGGVAVIKIGGASEVEVGEKKDRVVDALNATKAAVEEGIVPGGGSALLHA  449

Query  649  SKELDKLPTA--NFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            SK LD +     NFDQKIGV +IQNAL+ P+ TIASNAGVEGAV+VGK+LE   P +GY+
Sbjct  450  SKTLDDVTAKLDNFDQKIGVNIIQNALRVPMKTIASNAGVEGAVIVGKVLEMAEPQMGYN  509

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            AA GE+VDM+K GIIDPLKV+RTALVDAASVSSL+TT+E V+VE P+++K
Sbjct  510  AATGEFVDMIKGGIIDPLKVVRTALVDAASVSSLITTSECVVVEAPEDKK  559



>ref|XP_004297534.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=574

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGILPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L  + T N DQ+ GV++IQNALK P +TI  NAG +GA+VVGKLLEQD+  +GYDAA
Sbjct  453  TKALKNIQTQNEDQRRGVEIIQNALKAPTFTIVRNAGFDGALVVGKLLEQDDYRMGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
             GEYVDMVKAGIIDPLKV+RT+LVDAASVS LLTTTEA IV+ P E+K
Sbjct  513  NGEYVDMVKAGIIDPLKVVRTSLVDAASVSLLLTTTEASIVDSPTEKK  560



>ref|XP_003627097.1| Chaperonin CPN60-like protein [Medicago truncatula]
 gb|AET01573.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=576

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  395  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  454

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK L+ L T N D++ GVQ+IQNALK P YTIASNAG +G +V  KLLEQD+ +LG+DAA
Sbjct  455  SKVLENLQTKNEDERRGVQIIQNALKAPTYTIASNAGFDGTLVHSKLLEQDDFNLGFDAA  514

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KG YVDMVKAGIIDP+KV+RTALVDAASVS LLTTTEA IVE   ++ + P     M  +
Sbjct  515  KGTYVDMVKAGIIDPVKVVRTALVDAASVSLLLTTTEASIVENMSDKNKPPQRVPDMDDL  574

Query  289  DY  284
            DY
Sbjct  575  DY  576



>gb|KJB56920.1| hypothetical protein B456_009G141700 [Gossypium raimondii]
Length=527

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLY+
Sbjct  348  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGILPGGGVALLYS  407

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L  L T N DQK GVQ+IQ+ALK P  TIASNAG +G++V+GKLLEQD+ +LG+DA+
Sbjct  408  TKALQNLQTENEDQKRGVQIIQDALKAPTLTIASNAGYDGSLVLGKLLEQDDDNLGFDAS  467

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KG Y+DMVKAGIIDPLKVIRTALVDAASVS LLTTTEA ++E P E+K
Sbjct  468  KGAYIDMVKAGIIDPLKVIRTALVDAASVSLLLTTTEASVLENPDEKK  515



>ref|XP_007135549.1| hypothetical protein PHAVU_010G138700g [Phaseolus vulgaris]
 gb|ESW07543.1| hypothetical protein PHAVU_010G138700g [Phaseolus vulgaris]
Length=569

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  389  EKTQERLSKLSGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  448

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N D+K GVQ+IQNALK P +TIASNAG +GA+V  KLLEQD+ +LG+DAA
Sbjct  449  TKVLDNLQTQNEDEKRGVQIIQNALKAPTFTIASNAGFDGALVHSKLLEQDDHNLGFDAA  508

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVE  344
            KG YVDMVKAGIIDPLKV+RTALVDAASVS LLTTTEA +VE
Sbjct  509  KGIYVDMVKAGIIDPLKVVRTALVDAASVSLLLTTTEATVVE  550



>emb|CDO97909.1| unnamed protein product [Coffea canephora]
Length=574

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AA+EEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAIEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++ L  L  AN DQ+ G+Q+I+NALK P  TI SNAG +GA+V+GKLLEQD+ +LGYDAA
Sbjct  453  ARSLRHLQAANEDQRRGIQIIENALKAPTLTIVSNAGSDGALVIGKLLEQDDLNLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKE  332
            KG+YVDMVKAGIIDPLKVIRTALVDAASVS LLTT EA +V+L  E
Sbjct  513  KGQYVDMVKAGIIDPLKVIRTALVDAASVSLLLTTAEATVVDLEGE  558



>gb|KJB56919.1| hypothetical protein B456_009G141700 [Gossypium raimondii]
Length=572

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLY+
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGILPGGGVALLYS  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L  L T N DQK GVQ+IQ+ALK P  TIASNAG +G++V+GKLLEQD+ +LG+DA+
Sbjct  453  TKALQNLQTENEDQKRGVQIIQDALKAPTLTIASNAGYDGSLVLGKLLEQDDDNLGFDAS  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KG Y+DMVKAGIIDPLKVIRTALVDAASVS LLTTTEA ++E P E+K
Sbjct  513  KGAYIDMVKAGIIDPLKVIRTALVDAASVSLLLTTTEASVLENPDEKK  560



>ref|NP_566466.1| heat shock protein 60-3A [Arabidopsis thaliana]
 sp|Q93ZM7.2|CH60C_ARATH RecName: Full=Chaperonin CPN60-like 2, mitochondrial; AltName: 
Full=HSP60-like 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB02911.1| chaperonin; similar to GroEL protein [Arabidopsis thaliana]
 gb|AAM19824.1| AT3g13860/MCP4_7 [Arabidopsis thaliana]
 gb|AAU95459.1| At3g13860 [Arabidopsis thaliana]
 gb|AEE75427.1| heat shock protein 60-3A [Arabidopsis thaliana]
Length=572

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 150/171 (88%), Gaps = 2/171 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASE+EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGASESEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N DQ+ GVQ++QNALK P +TIA+NAG +G++VVGKLLEQD+ + G+DAA
Sbjct  453  TKALDNLQTENEDQRRGVQIVQNALKAPAFTIAANAGYDGSLVVGKLLEQDDCNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KG+YVDMVKAGIIDP+KVIRTAL DAASVS LLTTTEA +  L K ++ TP
Sbjct  513  KGKYVDMVKAGIIDPVKVIRTALTDAASVSLLLTTTEASV--LVKADENTP  561



>ref|XP_011072524.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Sesamum indicum]
Length=574

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
             + L  L TAN DQ+ GV+VI+NALK P YTIASNAG +G +V+GKLLEQD+ + GYDAA
Sbjct  453  KRVLRNLQTANEDQRRGVEVIENALKAPTYTIASNAGADGTLVLGKLLEQDDLNFGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVE  344
             GEYVDMVKAGIIDP+KVIRTALVDAASVS LLTTTEA IV+
Sbjct  513  TGEYVDMVKAGIIDPVKVIRTALVDAASVSLLLTTTEAAIVD  554



>ref|XP_006583012.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Glycine 
max]
Length=574

 Score =   253 bits (646),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 148/172 (86%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N D+K GVQ+IQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAA
Sbjct  453  TKVLDNLQTQNEDEKRGVQIIQNALKAPTITIASNAGFDGALVHSKLLEQDDHNLGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KG Y DMVKAGIIDPLKV+RTALVDAASVS LLTTTEA +V+   ++ + P+
Sbjct  513  KGVYADMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAVVDNSHDKNKPPS  564



>gb|EYU21369.1| hypothetical protein MIMGU_mgv1a003594mg [Erythranthe guttata]
Length=575

 Score =   253 bits (646),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            ++ L  L TAN DQK GV++I+NALK P +TIASNAG +GA+++GKLLEQD+ +LGYDAA
Sbjct  453  TRVLRDLQTANEDQKRGVEIIENALKAPTFTIASNAGADGALILGKLLEQDDLNLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVE  344
            KGEYV+MVKAGI+DP+KVIRTAL+DAASVS LLTTTEA+I +
Sbjct  513  KGEYVNMVKAGIVDPVKVIRTALLDAASVSLLLTTTEAIIAD  554



>ref|XP_002527401.1| chaperonin-60kD, ch60, putative [Ricinus communis]
 gb|EEF34967.1| chaperonin-60kD, ch60, putative [Ricinus communis]
Length=573

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L   N DQK G+++IQNALK P  TI SNAG    VV+GKLLEQD+ +LGYDAA
Sbjct  453  TKALDDLQAQNEDQKRGIEIIQNALKAPTSTIVSNAGFNAPVVLGKLLEQDDHNLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KGE+V+MV+AGIIDPLKVIRTALVDAASVS LLTTTEA +++ P  EK+ P+    M  M
Sbjct  513  KGEFVNMVQAGIIDPLKVIRTALVDAASVSLLLTTTEAAVIDNPN-EKKPPSRMPDMDAM  571

Query  289  DY  284
            DY
Sbjct  572  DY  573



>ref|XP_002884993.1| hypothetical protein ARALYDRAFT_478789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61252.1| hypothetical protein ARALYDRAFT_478789 [Arabidopsis lyrata subsp. 
lyrata]
Length=572

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASE+EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGASESEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N DQ+ GVQ++QNALK P +TIA NAG +G++VVGKLLEQD+ + G+DAA
Sbjct  453  TKALDNLQTQNEDQRRGVQIVQNALKAPAFTIAENAGYDGSLVVGKLLEQDDCNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KG YVDMVK+GIIDP+KVIRTAL DAASVS LLTTTEA +  L K ++ TP
Sbjct  513  KGTYVDMVKSGIIDPVKVIRTALTDAASVSLLLTTTEASV--LVKADENTP  561



>ref|XP_010534892.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Tarenaya hassleriana]
Length=572

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD + T N DQ+ GVQ++QNALK P  TIA+NAG +G++V+GKLLEQD+ + G+DAA
Sbjct  453  TKALDNVQTQNEDQRRGVQIVQNALKAPTLTIAANAGFDGSLVIGKLLEQDDNNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KG YVDMVKAGIIDP+KVI+TALVDAASVS LLTTTEA IV + ++EK
Sbjct  513  KGSYVDMVKAGIIDPVKVIKTALVDAASVSLLLTTTEASIV-VSRDEK  559



>ref|NP_001056181.1| Os05g0540300 [Oryza sativa Japonica Group]
 gb|AAV67812.1| putative chaperonin [Oryza sativa Japonica Group]
 dbj|BAF18095.1| Os05g0540300 [Oryza sativa Japonica Group]
 gb|EEE64532.1| hypothetical protein OsJ_19383 [Oryza sativa Japonica Group]
Length=581

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGGASE EVGEKKDRVTDAL+A +AAVEEGIVPGGGVALLYA
Sbjct  400  EKAQERLSKLSGGVAVLKIGGASEVEVGEKKDRVTDALHAARAAVEEGIVPGGGVALLYA  459

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDK+ TAN D+KIGVQ+I+NALK P+ TIA+NAG++G VV+GKL+EQDN ++GYDAA
Sbjct  460  TKELDKIITANEDEKIGVQIIKNALKAPLMTIAANAGIDGGVVIGKLIEQDNLNMGYDAA  519

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTT  362
            +GEYVDM+KAGIIDP+KVIRTAL DA+SVS L+TTT
Sbjct  520  RGEYVDMIKAGIIDPVKVIRTALQDASSVSLLMTTT  555



>ref|XP_007024507.1| Heat shock protein 60-3A isoform 3 [Theobroma cacao]
 gb|EOY27129.1| Heat shock protein 60-3A isoform 3 [Theobroma cacao]
Length=546

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLY 
Sbjct  367  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYG  426

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
             K L  L T N DQK G+Q+IQ+ALK+P  TI SNAG +G++V+G+LLEQD+ +LG+DA+
Sbjct  427  IKVLQNLQTQNEDQKRGIQIIQDALKSPTLTITSNAGYDGSLVLGRLLEQDDDNLGFDAS  486

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KG YVDMVKAGIIDPLKV+RTALVDAAS+S LLTTTEA ++E P E+K
Sbjct  487  KGTYVDMVKAGIIDPLKVVRTALVDAASISLLLTTTEASVLENPDEKK  534



>gb|KHN39306.1| Chaperonin CPN60-like 2, mitochondrial [Glycine soja]
Length=574

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGEGKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N D+K GVQ+IQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAA
Sbjct  453  TKVLDNLQTQNEDEKRGVQIIQNALKAPTITIASNAGFDGALVHSKLLEQDDHNLGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KG Y DMVKAGIIDPLKV+RTALVDAASVS LLTTTEA +V+   ++ + P+
Sbjct  513  KGVYADMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAVVDNSHDKNKPPS  564



>ref|XP_010465258.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Camelina sativa]
Length=572

 Score =   250 bits (639),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGASETEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N DQ+ GVQ++QNALK PV TIA NAG +G++VVGKLLEQD+ + G+DAA
Sbjct  453  TKALDDLQTQNEDQRRGVQIVQNALKAPVVTIAENAGYDGSLVVGKLLEQDDCNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KG YVDMVKAGIIDP+KVI+TAL DAASVS LLTTTEA +  L K +++TP
Sbjct  513  KGTYVDMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKADEDTP  561



>ref|XP_007024505.1| Heat shock protein 60-3A isoform 1 [Theobroma cacao]
 gb|EOY27127.1| Heat shock protein 60-3A isoform 1 [Theobroma cacao]
Length=572

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLY 
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYG  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
             K L  L T N DQK G+Q+IQ+ALK+P  TI SNAG +G++V+G+LLEQD+ +LG+DA+
Sbjct  453  IKVLQNLQTQNEDQKRGIQIIQDALKSPTLTITSNAGYDGSLVLGRLLEQDDDNLGFDAS  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KG YVDMVKAGIIDPLKV+RTALVDAAS+S LLTTTEA ++E P E+K
Sbjct  513  KGTYVDMVKAGIIDPLKVVRTALVDAASISLLLTTTEASVLENPDEKK  560



>ref|XP_009796310.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Nicotiana 
sylvestris]
Length=570

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  390  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  449

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L  L TAN  QK GV++I+NALK P +TIASNAGV+GA+V+GKLLEQD+ +LG+DAA
Sbjct  450  TKCLKDLQTANDGQKKGVEIIENALKAPTFTIASNAGVDGALVLGKLLEQDDLNLGFDAA  509

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            KG Y  MVKAGIIDPLKV+RTALVDAASVS LLTTTEA IV+   E+
Sbjct  510  KGTYRHMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAIVDRQGEK  556



>ref|XP_010501368.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Camelina sativa]
Length=572

 Score =   250 bits (638),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGASETEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N DQ+ GVQ++QNALK PV TIA NAG +G++VVGKLLEQD+ + G+DAA
Sbjct  453  TKALDDLQTQNEDQRRGVQIVQNALKAPVVTIAENAGYDGSLVVGKLLEQDDCNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KG YVDMVKAGIIDP+KVI+TAL DAASVS LLTTTEA +  L K ++ TP
Sbjct  513  KGTYVDMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKADENTP  561



>ref|XP_006385442.1| hypothetical protein POPTR_0003s04540g [Populus trichocarpa]
 gb|ERP63239.1| hypothetical protein POPTR_0003s04540g [Populus trichocarpa]
Length=382

 Score =   245 bits (625),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE++DRV DALNA++AAVEEGIVPGGGVALLY+
Sbjct  202  EKAQERLSKLSGGVAVFKVGGASEAEVGERRDRVADALNASRAAVEEGIVPGGGVALLYS  261

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+KL   N D+K G+Q+IQNALK P +TI SNAG + A V GKL EQD+ +LGYDAA
Sbjct  262  TKALEKLQAQNEDEKRGIQIIQNALKAPAHTIVSNAGFDSATVPGKLSEQDDYNLGYDAA  321

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KGEYV+MVKAGIID  KVIRTA+VDAASVS LLTTTEA ++E P+E+K
Sbjct  322  KGEYVEMVKAGIIDSFKVIRTAMVDAASVSLLLTTTEATVLENPQEKK  369



>gb|EEC79614.1| hypothetical protein OsI_20809 [Oryza sativa Indica Group]
Length=581

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAVLKIGG SE EVGEKKDRVTDAL+A +AAVEEGIVPGGGVALLYA
Sbjct  400  EKAQERLSKLSGGVAVLKIGGTSEVEVGEKKDRVTDALHAARAAVEEGIVPGGGVALLYA  459

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +KELDK+ TAN D+KIGVQ+I+NALK P+ TIA+NAG++G VV+GKL+EQDN ++GYDAA
Sbjct  460  TKELDKIITANEDEKIGVQIIKNALKAPLMTIAANAGIDGGVVIGKLIEQDNLNMGYDAA  519

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTT  362
            +GEYVDM+KAGIIDP+KVIRTAL DA+SVS L+TTT
Sbjct  520  RGEYVDMIKAGIIDPVKVIRTALQDASSVSLLMTTT  555



>emb|CDX82514.1| BnaA03g33070D [Brassica napus]
Length=572

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N DQ+ GVQ++QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DA+
Sbjct  453  TKALDNLETQNEDQRRGVQIVQNALKAPALTIAANAGYDGSLVVGKLLEQDDCNFGFDAS  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KG YVDMVKAGIIDP+KVI+TAL DAASVS LLTTTEA +  L K E++T
Sbjct  513  KGSYVDMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKAEEKT  560



>ref|XP_010685392.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010685393.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010685394.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=570

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KL+GGVAV K+GGASEAEV E+KDRV DALNAT+AAVEEGIVPGGGVALL+A
Sbjct  390  EKAQERLSKLAGGVAVFKVGGASEAEVSERKDRVIDALNATRAAVEEGIVPGGGVALLHA  449

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SK L+ + T N DQK GV+++QNALK P  TI SNAG E  +V+GKL+EQD+ ++GYDA+
Sbjct  450  SKALENIHTKNEDQKRGVRIVQNALKAPTVTIVSNAGGEAPLVIGKLMEQDDHNIGYDAS  509

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEK  326
            KGEYV+MVKAGIIDP+KVIRTALVDAASVSSLLTT EAVI E P++ K
Sbjct  510  KGEYVNMVKAGIIDPVKVIRTALVDAASVSSLLTTNEAVITEHPEQSK  557



>ref|XP_009135334.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Brassica rapa]
Length=572

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N DQ+ GVQ++QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DA+
Sbjct  453  TKALDNLETQNEDQRRGVQIVQNALKAPALTIAANAGYDGSLVVGKLLEQDDCNFGFDAS  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KG YVDMVKAGIIDP+KVI+TAL DAASVS LLTTTEA +  L K E++T
Sbjct  513  KGSYVDMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKAEEKT  560



>emb|CDX75733.1| BnaC03g38160D [Brassica napus]
Length=572

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N DQ+ GVQ++QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DA+
Sbjct  453  TKALDNLETQNEDQRRGVQIVQNALKAPALTIAANAGYDGSLVVGKLLEQDDCNFGFDAS  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKET  320
            KG YVDMVKAGIIDP+KVI+TAL DAASVS LLTTTEA +  L K E++T
Sbjct  513  KGSYVDMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKAEEKT  560



>ref|XP_004235594.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Solanum lycopersicum]
Length=573

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L  L TAN  QK GV++I+NALK P +TIASNAG +GA+VVGKLLEQD+ +LGYDAA
Sbjct  453  TKCLKGLQTANDGQKRGVEIIENALKAPTFTIASNAGADGALVVGKLLEQDDLNLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            KG Y+ MVKAGIIDP+KV+RTAL+DAASVS LLTT EA IV+   EE
Sbjct  513  KGTYLHMVKAGIIDPVKVVRTALMDAASVSLLLTTAEAAIVDRQGEE  559



>ref|XP_009629888.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Nicotiana 
tomentosiformis]
Length=573

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L  L TAN  QK GV++I+NALK P +TIASNAG +GA+V+GKLLEQD+ +LG+DAA
Sbjct  453  TKCLKDLQTANDGQKKGVEIIENALKAPTFTIASNAGADGALVLGKLLEQDDLNLGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            KG Y  MVKAGIIDPLKV+RTALVDAASVS LLTTTEA IV+   E+
Sbjct  513  KGTYRHMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAIVDRQGEK  559



>ref|XP_006342978.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin CPN60-like 2, mitochondrial-like 
[Solanum tuberosum]
Length=573

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L  L TAN  QK GV++I+NALK P +TIASNAG +GA+VVGKLLEQD+ +LGYDAA
Sbjct  453  TKCLKGLQTANDGQKRGVEIIENALKAPTFTIASNAGADGALVVGKLLEQDDLNLGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            KG Y+ MVKAGIIDP+KV+RTALVDAASVS LLTT EA IV+   E+
Sbjct  513  KGTYLHMVKAGIIDPVKVVRTALVDAASVSLLLTTAEAAIVDRQXEK  559



>ref|XP_011659644.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Cucumis sativus]
 gb|KGN45525.1| hypothetical protein Csa_7G451310 [Cucumis sativus]
Length=570

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALL+A
Sbjct  389  EKAQERLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLHA  448

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD+L   N DQK G++++Q+AL+ P   I SNAG +GA+VVGKLLEQD+ + G+DAA
Sbjct  449  TKVLDELQAQNEDQKRGIEIVQHALRAPTSAIVSNAGYDGALVVGKLLEQDDRNFGFDAA  508

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            +GEYVDMVKAGI+DPLKV+RTALVDA+SVS LLTT EA IVE P    + P+
Sbjct  509  QGEYVDMVKAGIVDPLKVVRTALVDASSVSLLLTTAEAAIVEHPNNTNKLPS  560



>ref|XP_010062630.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Eucalyptus 
grandis]
Length=573

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ + T N D++ GVQ+IQNALK P   I SNAG +G +++GKLLEQDN ++G+DAA
Sbjct  453  TKVLENVQTQNEDERRGVQIIQNALKAPSLAILSNAGFDGVLILGKLLEQDNFNMGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KG+YVDMVKAGI+DPLKV+RTALVDAASVS LL TTE  IVE    EK+ P+    M  M
Sbjct  513  KGDYVDMVKAGILDPLKVVRTALVDAASVSLLLATTEVAIVERAN-EKKPPSRMPNMDDM  571

Query  289  DY  284
            DY
Sbjct  572  DY  573



>ref|XP_006296696.1| hypothetical protein CARUB_v10013333mg [Capsella rubella]
 gb|EOA29594.1| hypothetical protein CARUB_v10013333mg [Capsella rubella]
Length=572

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 145/171 (85%), Gaps = 2/171 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGASETEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N DQ+ GVQ++QNALK P  TIA NAG +G++VVGKLLEQD+ + G+DAA
Sbjct  453  TKALDNLQTQNEDQRRGVQIVQNALKAPAMTIAENAGYDGSLVVGKLLEQDDSNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KG YVDMVKAGIIDP+KVI+TAL DAASVS LLTTTEA +  L K +  TP
Sbjct  513  KGTYVDMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKADVNTP  561



>ref|XP_010487162.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Camelina sativa]
Length=572

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGASETEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ L T N DQ+ GVQ++QNALK PV TIA NAG +G++VVGKLLEQD+ + G+DAA
Sbjct  453  TKALENLQTQNEDQRRGVQIVQNALKAPVVTIAENAGYDGSLVVGKLLEQDDFNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KG YVDMVKAGIIDP+KVI+TAL DAASVS LLTTTEA +  L K ++ TP
Sbjct  513  KGTYVDMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKADENTP  561



>gb|KFK38736.1| hypothetical protein AALP_AA3G153700 [Arabis alpina]
Length=572

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAE+GE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGQSEAEMGERKDRVTDALNATRAAVEEGIIPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ L T N DQ+ GVQ++QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DAA
Sbjct  453  TKALENLQTQNEDQRRGVQIVQNALKAPAVTIAANAGYDGSLVVGKLLEQDDFNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            KG YVDMVKAGIIDP+KVI+TAL DAAS+S LLTTTEA +  L K ++ETP
Sbjct  513  KGTYVDMVKAGIIDPVKVIKTALTDAASISLLLTTTEATV--LVKADEETP  561



>ref|XP_006466018.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Citrus 
sinensis]
Length=574

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KL+GGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLTGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ L T N DQ+ G+ +IQNALK P  TIASNAG +G+ ++GKLLEQD+ + G+DAA
Sbjct  453  TKALENLKTENEDQRRGIHIIQNALKAPTLTIASNAGFDGSTIIGKLLEQDDVNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKV+RTAL DAASVS L TTTEA ++    ++ + P+
Sbjct  513  KGEYVDMVKAGIIDPLKVVRTALADAASVSLLFTTTEATVLVNSDDKNKPPS  564



>ref|XP_006426562.1| hypothetical protein CICLE_v10025257mg [Citrus clementina]
 gb|ESR39802.1| hypothetical protein CICLE_v10025257mg [Citrus clementina]
Length=574

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KL+GGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLTGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ L T N DQ+ G+ +IQNALK P  TIASNAG +G+ ++GKLLEQD+ + G+DAA
Sbjct  453  TKALENLKTENEDQRRGIHIIQNALKAPTLTIASNAGFDGSTIIGKLLEQDDVNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KGEYVDMVKAGIIDPLKV+RTAL DAASVS L TTTEA ++    ++ + P+
Sbjct  513  KGEYVDMVKAGIIDPLKVVRTALADAASVSLLFTTTEATVLVNSDDKNKPPS  564



>gb|KDP40768.1| hypothetical protein JCGZ_24767 [Jatropha curcas]
Length=1295

 Score =   255 bits (651),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  393  EKAQERLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ L   N DQK G+Q+IQNALK P YTI SNAG +  VV+GKLLEQD+ + GYDAA
Sbjct  453  NKALEDLQAQNEDQKRGIQIIQNALKAPTYTIVSNAGFDAPVVLGKLLEQDDHNFGYDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVEL  341
            KGEYV+MVKAGIIDPLKVIRTALVDAASVS LLTTTEA IV +
Sbjct  513  KGEYVNMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAIVRV  555



>ref|XP_008462350.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Cucumis melo]
Length=576

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALL+A
Sbjct  395  EKAQERLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLHA  454

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD+L   N DQK G++++Q+AL+ P   I SNAG +GA+VVGKLLEQD+ +LG+DAA
Sbjct  455  TKVLDELQAQNEDQKRGIEIVQHALRAPTSAIVSNAGYDGALVVGKLLEQDDRNLGFDAA  514

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            KG YVDMVKAGI+DPLKV+RTALVDA+SVS LL T EA IVE P +  + P+
Sbjct  515  KGVYVDMVKAGIVDPLKVVRTALVDASSVSLLLATAEAAIVEHPNKTNKLPS  566



>gb|KCW69759.1| hypothetical protein EUGRSUZ_F03134 [Eucalyptus grandis]
Length=653

 Score =   247 bits (631),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 151/182 (83%), Gaps = 1/182 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA
Sbjct  473  EKAQERLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYA  532

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K L+ + T N D++ GVQ+IQNALK P   I SNAG +G +++GKLLEQDN ++G+DAA
Sbjct  533  TKVLENVQTQNEDERRGVQIIQNALKAPSLAILSNAGFDGVLILGKLLEQDNFNMGFDAA  592

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPAmgggmggM  290
            KG+YVDMVKAGI+DPLKV+RTALVDAASVS LL TTE  IVE    EK+ P+    M  M
Sbjct  593  KGDYVDMVKAGILDPLKVVRTALVDAASVSLLLATTEVAIVERAN-EKKPPSRMPNMDDM  651

Query  289  DY  284
            DY
Sbjct  652  DY  653



>gb|ABX76300.1| heat shock protein 60 [Ageratina adenophora]
Length=526

 Score =   244 bits (622),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/129 (94%), Positives = 126/129 (98%), Gaps = 0/129 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            +KLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  DKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALK PV+TIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLQTANFDQKIGVQIIQNALKAPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  513

Query  469  KGEYVDMVK  443
            KG+YVDMVK
Sbjct  514  KGQYVDMVK  522



>ref|XP_002881304.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57563.1| predicted protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 139/169 (82%), Gaps = 24/169 (14%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL+ERLAKLSGGV VLKIGGA                      VEEGIVPGG VALLYA
Sbjct  15   EKLKERLAKLSGGVDVLKIGGA---------------------VVEEGIVPGG-VALLYA  52

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKEL+KL TANFDQKIGVQ+IQNALKT VYTIASNAGVEGAV+VGKLLEQDNPDLGYDAA
Sbjct  53   SKELEKLSTANFDQKIGVQIIQNALKTHVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAA  112

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            K EYVDMVK+GIIDPLKVIRTALVDAA VSSLLTTTEAV+ E+P +EKE
Sbjct  113  K-EYVDMVKSGIIDPLKVIRTALVDAA-VSSLLTTTEAVVTEIPTKEKE  159



>gb|EPS57724.1| hypothetical protein M569_17093, partial [Genlisea aurea]
Length=188

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  65   EKLQERLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  124

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKL TANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKL E DNPDLGYDAA
Sbjct  125  SKELDKLATANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLWESDNPDLGYDAA  184

Query  469  KGEY  458
            KG Y
Sbjct  185  KGTY  188



>ref|XP_006407158.1| hypothetical protein EUTSA_v10020386mg [Eutrema salsugineum]
 gb|ESQ48611.1| hypothetical protein EUTSA_v10020386mg [Eutrema salsugineum]
Length=572

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK QERL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA
Sbjct  393  EKTQERLSKLSGGVAVFKVGGASETEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYA  452

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            +K LD L T N DQ+ GV+++QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DAA
Sbjct  453  TKALDNLQTQNEDQRRGVEIVQNALKAPALTIAANAGYDGSLVVGKLLEQDDCNFGFDAA  512

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIV  347
            KG YVDMVKAGIIDP+KVI+TAL DAAS S LLTTTEA +V
Sbjct  513  KGSYVDMVKAGIIDPVKVIKTALTDAASGSLLLTTTEASVV  553



>emb|CDY37741.1| BnaA04g19270D [Brassica napus]
Length=611

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 146/181 (81%), Gaps = 12/181 (7%)
 Frame = -3

Query  823  LQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASK  644
            LQ+RLAKLSG +AV+KIGG SE EV EK DRV +ALNATKAA+EEGIVPGGGVALLYASK
Sbjct  420  LQDRLAKLSGSIAVIKIGGTSEREVSEKIDRVNNALNATKAALEEGIVPGGGVALLYASK  479

Query  643  ELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKG  464
            EL+KL T    QK GVQ+IQNALK PVYTIAS AGV+G V+V KLLE +NPD+GYDAAKG
Sbjct  480  ELEKLSTNYTSQKDGVQIIQNALKIPVYTIASKAGVDGKVIVDKLLESNNPDIGYDAAKG  539

Query  463  EYVDMVKAGIIDPLKVIRTALVDAAS------------VSSLLTTTEAVIVELPKEEKET  320
            EYVDMVK+GIIDP+K+IRTALVDAA             VS LLTTTEAV+ E+P +E  +
Sbjct  540  EYVDMVKSGIIDPVKMIRTALVDAARDSNGLKIYCHFFVSLLLTTTEAVVTEIPTKEDAS  599

Query  319  P  317
            P
Sbjct  600  P  600



>ref|XP_007034505.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
 ref|XP_007034506.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
 gb|EOY05431.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
 gb|EOY05432.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
Length=516

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA
Sbjct  394  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  453

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            SKELDKLPTANFDQKIGVQ+IQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA
Sbjct  454  SKELDKLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  513

Query  469  KGE  461
            KG+
Sbjct  514  KGQ  516



>gb|EWM24608.1| Chaperonin Cpn60/TCP-1 [Nannochloropsis gaditana]
Length=575

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 151/174 (87%), Gaps = 2/174 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAV+K+GGASE EV EKKDRV DALNAT+AAVE+GIVPGGG+ALL+A
Sbjct  384  EKLQERLAKLSGGVAVIKVGGASEVEVNEKKDRVVDALNATRAAVEQGIVPGGGLALLWA  443

Query  649  SKELD--KLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            SK+L+  K   +N DQ+IGV++I+ AL  PV +IA+NAGVEGAVVVG+L+++D P+LGY+
Sbjct  444  SKQLEDVKAKVSNMDQRIGVEIIEKALIAPVKSIANNAGVEGAVVVGELMKKDKPELGYN  503

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            A  GEYVDM +AGIIDP KV+RTALVDA SV++L+ TTEA++ +LPK+E + PA
Sbjct  504  AQTGEYVDMFEAGIIDPTKVVRTALVDAQSVAALMITTEAMVADLPKDEGDAPA  557



>gb|EWM24609.1| Chaperonin Cpn60/TCP-1 [Nannochloropsis gaditana]
Length=574

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 151/174 (87%), Gaps = 2/174 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAV+K+GGASE EV EKKDRV DALNAT+AAVE+GIVPGGG+ALL+A
Sbjct  383  EKLQERLAKLSGGVAVIKVGGASEVEVNEKKDRVVDALNATRAAVEQGIVPGGGLALLWA  442

Query  649  SKELD--KLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            SK+L+  K   +N DQ+IGV++I+ AL  PV +IA+NAGVEGAVVVG+L+++D P+LGY+
Sbjct  443  SKQLEDVKAKVSNMDQRIGVEIIEKALIAPVKSIANNAGVEGAVVVGELMKKDKPELGYN  502

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            A  GEYVDM +AGIIDP KV+RTALVDA SV++L+ TTEA++ +LPK+E + PA
Sbjct  503  AQTGEYVDMFEAGIIDPTKVVRTALVDAQSVAALMITTEAMVADLPKDEGDAPA  556



>dbj|GAM29219.1| hypothetical protein SAMD00019534_123950 [Acytostelium subglobosum 
LB1]
Length=524

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = -3

Query  826  KLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS  647
            +LQERLAKL+GGVAV+++GGASE EVGEKKDR+ DALNAT+AAVEEGIVPGGG ALLY++
Sbjct  348  QLQERLAKLAGGVAVIRVGGASEVEVGEKKDRIVDALNATRAAVEEGIVPGGGTALLYST  407

Query  646  KELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAK  467
            + L ++   NFDQ IGV+++++AL  P  TIA+NAG +GAVV+GKL+ + N ++G++A K
Sbjct  408  RALRRIKMENFDQTIGVKIVRDALLVPCKTIANNAGFDGAVVIGKLMARRNVEIGFNAQK  467

Query  466  GEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            G Y +M+KAGI+DP KV+RTALVDAASV+SL+TTTEA++VELPK+E   PA
Sbjct  468  GVYTNMIKAGIVDPTKVVRTALVDAASVASLMTTTEAMVVELPKKEDPAPA  518



>dbj|BAL45644.1| heat shock protein 60 [Ulva pertusa]
Length=573

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            +KLQERLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAV+EGIVPGGG ALL+A
Sbjct  388  DKLQERLAKLSGGVAVLKIGGASEVEVGEKKDRVTDALNATKAAVDEGIVPGGGAALLHA  447

Query  649  SKELDKL--PTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            S+ L  +    +N DQ++GV+++  A++ P  T+  NAG EGAV+VGKLLE D+ + G+D
Sbjct  448  SRSLSDVLESMSNLDQRVGVEIVMRAVQMPAKTLCRNAGHEGAVIVGKLLESDDQNWGFD  507

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            AAKG++ +MV AGIIDPLKV+RTALVDAASVSSL+TT+E ++VE P +E
Sbjct  508  AAKGQFCNMVDAGIIDPLKVVRTALVDAASVSSLITTSECIVVEAPADE  556



>dbj|BAL45642.1| heat shock protein 60 [Ulva pertusa]
Length=573

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 142/169 (84%), Gaps = 2/169 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            +KLQERLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAV+EGIVPGGG ALL+A
Sbjct  388  DKLQERLAKLSGGVAVLKIGGASEVEVGEKKDRVTDALNATKAAVDEGIVPGGGAALLHA  447

Query  649  SKELDKL--PTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            S+ L  +    +N DQ++GV ++  A++ P  T+  NAG EGAV+VGKLLE D+ + G+D
Sbjct  448  SRSLSDVLESMSNLDQRVGVDIVMRAVQMPAKTLCKNAGHEGAVIVGKLLESDDQNWGFD  507

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            AAKG++ +MV AGIIDPLKV+RTALVDAASVSSL+TT+E ++VE P +E
Sbjct  508  AAKGQFCNMVDAGIIDPLKVVRTALVDAASVSSLITTSECIVVEAPADE  556



>ref|XP_008299606.1| PREDICTED: 60 kDa heat shock protein, mitochondrial isoform X2 
[Stegastes partitus]
Length=490

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL ERLAKLS GVAVLK+GG S+ EV EKKDRVTDALNAT+AAVEEGIVPGGG ALL  
Sbjct  303  EKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRC  362

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
               LD L TAN DQKIGV +I+ AL+ P  TIA NAGVEG++VV K+L Q + +LGYDA 
Sbjct  363  IPSLDALKTANSDQKIGVDIIRRALRIPAMTIAKNAGVEGSLVVEKIL-QGSAELGYDAM  421

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            +GEYV+MV+ GIIDP KV+RTAL+DAA V+SLL+T EAV+ E+PKEEKE PA
Sbjct  422  QGEYVNMVEKGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEKEMPA  473



>ref|XP_005848352.1| hypothetical protein CHLNCDRAFT_51922 [Chlorella variabilis]
 gb|EFN56250.1| hypothetical protein CHLNCDRAFT_51922 [Chlorella variabilis]
Length=496

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLK+GGASE EV EKKDR+TDALNATKAAVEEGIVPGGG AL+YA
Sbjct  311  EKLQERLAKLSGGVAVLKVGGASEVEVSEKKDRITDALNATKAAVEEGIVPGGGTALVYA  370

Query  649  SKELD--KLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQD-NPDLGY  479
            S+ L+  K    NFDQK+GV++IQ A++ P  TIA+NAG+EG V+VGKLLE++ + ++G+
Sbjct  371  SRTLEAVKDKCENFDQKVGVEIIQRAIRRPAKTIANNAGLEGDVIVGKLLEREGDENVGF  430

Query  478  DAAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            +AA G + DMV+AG+IDP+KV+RTAL+D+ASV+SLLTT E +I E PK E
Sbjct  431  NAAAGRFEDMVRAGVIDPMKVVRTALLDSASVASLLTTAECIITEAPKNE  480



>gb|KDD77186.1| TCP-1/cpn60 chaperonin [Helicosporidium sp. ATCC 50920]
Length=574

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 142/171 (83%), Gaps = 4/171 (2%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKLSGGVAVLK+GG +E EVGEKKDR+ DALNATKAAVEEGIVPGGG AL+YA
Sbjct  389  EKLQERLAKLSGGVAVLKVGGHTEVEVGEKKDRIVDALNATKAAVEEGIVPGGGTALVYA  448

Query  649  SKELD--KLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPD--LG  482
            SK L+  K   ANFDQ++GVQ++Q A++ P  TIASNAG EGAV+VGKLLE++  D  +G
Sbjct  449  SKALEAVKEAAANFDQRMGVQIVQRAIRVPTATIASNAGQEGAVIVGKLLEREEGDGNVG  508

Query  481  YDAAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            YDAA GE+VD+V  G+IDP+KV+R AL DAASV+SLLTT E  IV+ PK E
Sbjct  509  YDAATGEFVDLVARGVIDPIKVVRVALRDAASVASLLTTAEVCIVDAPKTE  559



>emb|CBJ29791.1| conserved unknown protein [Ectocarpus siliculosus]
Length=578

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL+ERLAKL  GVAV+K+GG+SE EVGEKKDR  DALNAT+AAV EGIVPGGG ALL+A
Sbjct  385  EKLEERLAKLHSGVAVIKVGGSSEVEVGEKKDRFVDALNATRAAVSEGIVPGGGSALLWA  444

Query  649  SKELD--KLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            S++L+  K   AN DQKIGV++I+ AL+ PV+TIA NAGVEGAVVVG+LL+ ++P  G++
Sbjct  445  SRQLEATKASCANMDQKIGVEIIEKALRMPVHTIAMNAGVEGAVVVGELLKTEDPQWGHN  504

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            AA GEY DM++AGIIDP KV+RTALVDA SV++LL T EA++ +LP+EE
Sbjct  505  AATGEYCDMIQAGIIDPTKVVRTALVDAQSVAALLMTAEAMVTDLPEEE  553



>ref|XP_008299605.1| PREDICTED: 60 kDa heat shock protein, mitochondrial isoform X1 
[Stegastes partitus]
Length=575

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL ERLAKLS GVAVLK+GG S+ EV EKKDRVTDALNAT+AAVEEGIVPGGG ALL  
Sbjct  388  EKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRC  447

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
               LD L TAN DQKIGV +I+ AL+ P  TIA NAGVEG++VV K+L Q + +LGYDA 
Sbjct  448  IPSLDALKTANSDQKIGVDIIRRALRIPAMTIAKNAGVEGSLVVEKIL-QGSAELGYDAM  506

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            +GEYV+MV+ GIIDP KV+RTAL+DAA V+SLL+T EAV+ E+PKEEKE PA
Sbjct  507  QGEYVNMVEKGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEKEMPA  558



>ref|XP_008862081.1| chaperonin GroL [Aphanomyces invadans]
 gb|ETW08276.1| chaperonin GroL [Aphanomyces invadans]
Length=570

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKL GG+AV+K+GGASE EVGEKKDRV DALNAT+AAVEEGIVPGGG ALL+A
Sbjct  382  EKLQERLAKLGGGIAVIKVGGASEVEVGEKKDRVVDALNATRAAVEEGIVPGGGTALLWA  441

Query  649  SKELDKL--PTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            S+ L  L    AN DQK+G+Q+I+ A ++ V  IA NAG EGAV+VGKLLEQD+P  G++
Sbjct  442  SRNLKSLYDGVANMDQKVGIQIIERACRSTVTQIAKNAGEEGAVIVGKLLEQDSPTFGFN  501

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKE  332
            A  G+YVDMV+AGIIDP KV+RT LVDA+SV+SL+ T EA+I +LP+E
Sbjct  502  AQTGQYVDMVEAGIIDPTKVVRTGLVDASSVASLMMTAEALIADLPEE  549



>gb|EUC55864.1| TCP-1/cpn60 chaperonin family protein, partial [Rhizoctonia solani 
AG-3 Rhs1AP]
Length=210

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 4/170 (2%)
 Frame = -3

Query  826  KLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS  647
            KLQERLAKLSGGVAV+K+G +SE EVGEKKDR  DALNAT+AAVEEGIVPGGGVALL AS
Sbjct  21   KLQERLAKLSGGVAVIKVGESSEVEVGEKKDRYDDALNATRAAVEEGIVPGGGVALLKAS  80

Query  646  KEL--DKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQ--DNPDLGY  479
              L  +  PTANFDQ +GV  I+NAL+ P  TI  NAG EG+VVVG++LE+  D    GY
Sbjct  81   LALTPESAPTANFDQSLGVSAIRNALQCPARTIVENAGEEGSVVVGQILERYGDKFTWGY  140

Query  478  DAAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            DAA+GE+ DM+  GI+DPLKV+RTALVD + V+SLLTT+EA IVE P+E+
Sbjct  141  DAAQGEFTDMIARGIVDPLKVVRTALVDTSGVASLLTTSEACIVEAPEEK  190



>ref|XP_011401079.1| Chaperonin CPN60, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM28067.1| Chaperonin CPN60, mitochondrial [Auxenochlorella protothecoides]
Length=580

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL+ERLAKLSGGVAVLK+GG SE EVGE+KDR+ DALNATKAAV EGIVPGGG AL+YA
Sbjct  390  EKLEERLAKLSGGVAVLKVGGHSEFEVGERKDRIVDALNATKAAVAEGIVPGGGTALVYA  449

Query  649  SKELD--KLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQD--NPDLG  482
            S+ L+  K   ANFDQ+ GV +IQ A++ P  TIA+NAG EGAV+VGKLLE+   + D+G
Sbjct  450  SRSLESVKDACANFDQRTGVSIIQRAIRQPAATIAANAGQEGAVIVGKLLERPEADADVG  509

Query  481  YDAAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
            Y+AA GE+ D+VKAG+IDP+KV+R AL DAASV+SLLTT EAVI E PK E  +PA
Sbjct  510  YNAATGEFEDLVKAGVIDPIKVVRVALTDAASVASLLTTAEAVIAEAPKPEGASPA  565



>ref|XP_008862079.1| chaperonin GroL [Aphanomyces invadans]
 gb|ETW08274.1| chaperonin GroL [Aphanomyces invadans]
Length=589

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKL GG+AV+K+GGASE EVGEKKDRV DALNAT+AAVEEGIVPGGG ALL+A
Sbjct  401  EKLQERLAKLGGGIAVIKVGGASEVEVGEKKDRVVDALNATRAAVEEGIVPGGGTALLWA  460

Query  649  SKELDKL--PTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            S+ L  L    AN DQK+G+Q+I+ A ++ V  IA NAG EGAV+VGKLLEQD+P  G++
Sbjct  461  SRNLKSLYDGVANMDQKVGIQIIERACRSTVTQIAKNAGEEGAVIVGKLLEQDSPTFGFN  520

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKE  332
            A  G+YVDMV+AGIIDP KV+RT LVDA+SV+SL+ T EA+I +LP+E
Sbjct  521  AQTGQYVDMVEAGIIDPTKVVRTGLVDASSVASLMMTAEALIADLPEE  568



>ref|XP_003064760.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51094.1| predicted protein [Micromonas pusilla CCMP1545]
Length=544

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EK+QERLAKLSGGVAVLKIGGASE EVGEKKDRV DALNATKAAV+EGIV GGG ALL A
Sbjct  350  EKMQERLAKLSGGVAVLKIGGASEVEVGEKKDRVVDALNATKAAVDEGIVAGGGTALLAA  409

Query  649  SKELDKLPTA--NFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYD  476
            SK L  L  +  NFDQK+GVQ+I+ ALK PV TI++NAGVEG+VVV K+L Q++ + GYD
Sbjct  410  SKSLAALEASMPNFDQKVGVQIIRAALKVPVRTISANAGVEGSVVVEKVLSQNDHNWGYD  469

Query  475  AAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKE  323
            AA+GEY  M+ AG+IDPLKV+RTAL DAASVSSL+ T+E +IVE  K+  E
Sbjct  470  AARGEYGCMITAGVIDPLKVVRTALTDAASVSSLMMTSECMIVEGKKDPAE  520



>ref|XP_004359903.1| chaperonin 60 [Dictyostelium fasciculatum]
 gb|EGG22052.1| chaperonin 60 [Dictyostelium fasciculatum]
Length=558

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -3

Query  826  KLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS  647
            KL+ERLAKL  GV V+++GGASE EVGEKKDR+ DALNAT+AAV EGIVPGGG ALLY++
Sbjct  382  KLEERLAKLGSGVGVIRVGGASEVEVGEKKDRIVDALNATRAAVAEGIVPGGGTALLYSA  441

Query  646  KELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAK  467
            + L K+   NFDQ IGV+++++AL  P  TIA+NAGVEG+VVVG+LL + + + GY+AAK
Sbjct  442  QTLKKIKMDNFDQTIGVKIVRDALMVPCKTIANNAGVEGSVVVGRLLARRDNEYGYNAAK  501

Query  466  GEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            G Y +M+KAGIIDP KV+RTALVDAASV+SL+TTTEA++VELPK E+  P
Sbjct  502  GIYENMIKAGIIDPTKVVRTALVDAASVASLMTTTEAMVVELPKVEQPMP  551



>gb|KEP47507.1| heat shock protein [Rhizoctonia solani 123E]
Length=249

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 137/170 (81%), Gaps = 4/170 (2%)
 Frame = -3

Query  826  KLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS  647
            KLQERLAKLSGGVAV+K+G +SE EVGEKKDR  DALNAT+AAVEEGIVPGGGVALL AS
Sbjct  60   KLQERLAKLSGGVAVIKVGESSEVEVGEKKDRYDDALNATRAAVEEGIVPGGGVALLKAS  119

Query  646  KEL--DKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQ--DNPDLGY  479
              L  +  PTANFDQ +GV  I+NAL+ P  TI  NAG EG+VVVG++LE+  D    GY
Sbjct  120  LALTPESAPTANFDQSLGVSAIRNALQCPARTIVENAGEEGSVVVGQILERYGDKFTWGY  179

Query  478  DAAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEE  329
            DAA+GE+ DM+  GI+DPLKV+RTALVD + V+SLLTT+EA IVE P+E+
Sbjct  180  DAAQGEFTDMIARGIVDPLKVVRTALVDTSGVASLLTTSEACIVEAPEEK  229



>gb|ADM73510.1| heat shock protein [Epinephelus akaara]
Length=578

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKL ERLAKLS GVAVLKIGG S+ EV EKKDRVTDALNAT+AAVEEGIVPGGG ALL  
Sbjct  388  EKLNERLAKLSDGVAVLKIGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRC  447

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
               LD + TAN DQKIGV++I+ AL+ P  TIA NAGVEG++VV K+L Q + +LGYDA 
Sbjct  448  IPSLDAIQTANADQKIGVEIIRRALRIPAMTIAKNAGVEGSLVVEKIL-QGSAELGYDAM  506

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETP  317
            +GEYV+MV+ GIIDP KV+RTAL+DAA V+SLL+T EAV+ E+PKEEKE P
Sbjct  507  QGEYVNMVEKGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEKEMP  557



>ref|WP_025898344.1| molecular chaperone GroEL [Sneathiella glossodoripedis]
Length=543

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  829  EKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA  650
            EKLQERLAKL+GGVAV+ +GGA+E EV EKKDRV DAL+AT+AAVEEG+VPGGGVALLYA
Sbjct  363  EKLQERLAKLAGGVAVIHVGGATEVEVKEKKDRVDDALHATRAAVEEGVVPGGGVALLYA  422

Query  649  SKELDKLPTANFDQKIGVQVIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAA  470
            S+ LD + + N DQK+G+++I+ AL++PV  IA NAG +GAVV GKLL+QDN + G++A 
Sbjct  423  SRVLDGINSENNDQKVGMEIIKRALQSPVRQIAENAGYDGAVVAGKLLDQDNTNFGFNAQ  482

Query  469  KGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKEEKETPA  314
             GEY D+VKAG+IDP KV+RTAL DAASVS LL TTEA++ E+P+   ++PA
Sbjct  483  TGEYEDLVKAGVIDPTKVVRTALEDAASVSGLLITTEAMVAEIPEPPSKSPA  534



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1793589148520