BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7305

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011096601.1|  PREDICTED: F-box protein At4g18380-like            155   8e-41   Sesamum indicum [beniseed]
ref|XP_009774076.1|  PREDICTED: F-box protein At4g18380-like            151   2e-39   Nicotiana sylvestris
ref|XP_009607720.1|  PREDICTED: F-box protein At4g18380-like            150   5e-39   Nicotiana tomentosiformis
gb|EYU33385.1|  hypothetical protein MIMGU_mgv1a008110mg                147   5e-38   Erythranthe guttata [common monkey flower]
ref|XP_009625759.1|  PREDICTED: F-box protein At5g46170-like            144   1e-36   Nicotiana tomentosiformis
ref|XP_009758227.1|  PREDICTED: F-box protein At4g18380-like            144   1e-36   Nicotiana sylvestris
gb|EPS70457.1|  hypothetical protein M569_04296                         140   3e-35   Genlisea aurea
ref|XP_004244968.1|  PREDICTED: F-box protein At5g46170-like            138   1e-34   Solanum lycopersicum
ref|XP_006355407.1|  PREDICTED: F-box protein At5g46170-like            137   4e-34   Solanum tuberosum [potatoes]
ref|XP_011085237.1|  PREDICTED: F-box protein At4g18380-like            136   6e-34   Sesamum indicum [beniseed]
ref|XP_006352970.1|  PREDICTED: F-box protein At5g46170-like            130   5e-32   Solanum tuberosum [potatoes]
gb|EYU43254.1|  hypothetical protein MIMGU_mgv1a008300mg                126   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_002278480.1|  PREDICTED: F-box protein At5g46170                 125   7e-30   Vitis vinifera
emb|CAN73778.1|  hypothetical protein VITISV_042179                     125   8e-30   Vitis vinifera
ref|XP_004233124.1|  PREDICTED: F-box protein At5g46170-like            124   1e-29   Solanum lycopersicum
gb|KJB57218.1|  hypothetical protein B456_009G154000                    123   2e-29   Gossypium raimondii
gb|KJB57216.1|  hypothetical protein B456_009G154000                    124   3e-29   Gossypium raimondii
gb|KHG20859.1|  hypothetical protein F383_03969                         123   3e-29   Gossypium arboreum [tree cotton]
emb|CBI30928.3|  unnamed protein product                                123   5e-29   Vitis vinifera
ref|XP_010247412.1|  PREDICTED: F-box protein At5g46170                 123   5e-29   Nelumbo nucifera [Indian lotus]
ref|XP_003542943.1|  PREDICTED: F-box protein At5g46170-like isof...    122   9e-29   Glycine max [soybeans]
ref|XP_008444512.1|  PREDICTED: F-box protein At5g46170-like            122   9e-29   Cucumis melo [Oriental melon]
ref|XP_004137366.1|  PREDICTED: F-box protein At5g46170-like            122   1e-28   Cucumis sativus [cucumbers]
ref|XP_007025034.1|  F-box family protein                               121   2e-28   
ref|XP_003546077.1|  PREDICTED: F-box protein At5g46170-like            120   3e-28   Glycine max [soybeans]
ref|XP_007147928.1|  hypothetical protein PHAVU_006G166500g             120   3e-28   Phaseolus vulgaris [French bean]
ref|XP_010518768.1|  PREDICTED: F-box protein At5g46170                 120   3e-28   Tarenaya hassleriana [spider flower]
ref|XP_010538543.1|  PREDICTED: F-box protein At5g46170-like            119   7e-28   Tarenaya hassleriana [spider flower]
ref|XP_010086997.1|  hypothetical protein L484_005892                   119   1e-27   Morus notabilis
ref|XP_006449020.1|  hypothetical protein CICLE_v10015378mg             119   2e-27   Citrus clementina [clementine]
ref|XP_006468035.1|  PREDICTED: F-box protein At5g46170-like isof...    119   2e-27   Citrus sinensis [apfelsine]
gb|KJB69848.1|  hypothetical protein B456_011G045900                    117   6e-27   Gossypium raimondii
gb|KHG27594.1|  hypothetical protein F383_11279                         116   1e-26   Gossypium arboreum [tree cotton]
ref|XP_009360916.1|  PREDICTED: F-box protein At5g46170-like            115   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_011460217.1|  PREDICTED: F-box protein At5g46170                 115   3e-26   Fragaria vesca subsp. vesca
gb|KJB68311.1|  hypothetical protein B456_010G238100                    113   9e-26   Gossypium raimondii
gb|KHG06780.1|  hypothetical protein F383_00742                         111   6e-25   Gossypium arboreum [tree cotton]
gb|AEX97082.1|  F-box family protein                                    110   9e-25   Malus domestica [apple tree]
ref|XP_008371620.1|  PREDICTED: F-box protein At5g46170-like            110   1e-24   
ref|XP_002519646.1|  conserved hypothetical protein                     109   4e-24   Ricinus communis
ref|XP_003593894.1|  F-box family protein                               107   1e-23   Medicago truncatula
ref|XP_008371786.1|  PREDICTED: F-box protein At5g46170-like            107   1e-23   Malus domestica [apple tree]
emb|CDY33458.1|  BnaA06g36150D                                          107   1e-23   Brassica napus [oilseed rape]
ref|XP_006414111.1|  hypothetical protein EUTSA_v10025383mg             106   2e-23   Eutrema salsugineum [saltwater cress]
ref|XP_011007418.1|  PREDICTED: F-box protein At5g46170-like            106   4e-23   Populus euphratica
ref|XP_012072137.1|  PREDICTED: F-box protein At5g46170-like            105   5e-23   Jatropha curcas
ref|XP_010441616.1|  PREDICTED: F-box protein At5g46170-like            105   5e-23   Camelina sativa [gold-of-pleasure]
gb|KHG16115.1|  hypothetical protein F383_22310                         105   5e-23   Gossypium arboreum [tree cotton]
ref|XP_009101540.1|  PREDICTED: F-box protein At5g46170                 105   8e-23   Brassica rapa
ref|XP_007212265.1|  hypothetical protein PRUPE_ppa006658mg             105   9e-23   Prunus persica
ref|XP_008225507.1|  PREDICTED: F-box protein At5g46170-like            105   1e-22   Prunus mume [ume]
ref|XP_006279647.1|  hypothetical protein CARUB_v10026571mg             103   2e-22   Capsella rubella
ref|XP_002317281.1|  F-box family protein                               103   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_002863421.1|  F-box family protein                               103   3e-22   
ref|XP_010494785.1|  PREDICTED: F-box protein At5g46170-like            103   3e-22   Camelina sativa [gold-of-pleasure]
emb|CDX99890.1|  BnaC05g23120D                                          102   6e-22   
ref|XP_010481487.1|  PREDICTED: F-box protein At5g46170                 102   7e-22   Camelina sativa [gold-of-pleasure]
gb|KJB66946.1|  hypothetical protein B456_010G167400                    102   8e-22   Gossypium raimondii
ref|XP_011035442.1|  PREDICTED: F-box protein At5g46170-like            101   1e-21   Populus euphratica
ref|XP_009115183.1|  PREDICTED: F-box protein At1g30200                 101   1e-21   Brassica rapa
ref|XP_010687117.1|  PREDICTED: F-box protein At4g18380                 100   5e-21   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP21114.1|  unnamed protein product                                100   5e-21   Coffea canephora [robusta coffee]
emb|CDX77641.1|  BnaC07g18950D                                        99.4    7e-21   
ref|XP_006283811.1|  hypothetical protein CARUB_v10004910mg           99.4    1e-20   
ref|XP_002305042.1|  hypothetical protein POPTR_0004s06450g           99.0    1e-20   
ref|XP_004486009.1|  PREDICTED: F-box protein At5g46170-like          95.1    2e-20   Cicer arietinum [garbanzo]
ref|NP_199429.1|  F-box protein                                       98.2    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398302.1|  hypothetical protein EUTSA_v10000919mg           97.4    4e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010517545.1|  PREDICTED: F-box protein At4g18380               97.4    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010538256.1|  PREDICTED: F-box protein At1g30200-like          97.4    4e-20   Tarenaya hassleriana [spider flower]
ref|XP_004134599.1|  PREDICTED: F-box protein At5g46170-like          97.4    4e-20   Cucumis sativus [cucumbers]
ref|XP_008439618.1|  PREDICTED: F-box protein At5g46170-like          97.4    5e-20   Cucumis melo [Oriental melon]
ref|XP_009131656.1|  PREDICTED: F-box protein At4g18380               93.2    2e-19   Brassica rapa
gb|KHN06964.1|  F-box protein                                         91.7    4e-19   Glycine soja [wild soybean]
ref|XP_010052048.1|  PREDICTED: F-box protein At5g46170               94.0    9e-19   Eucalyptus grandis [rose gum]
ref|NP_193573.1|  F-box protein                                       92.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923814.1|  PREDICTED: F-box protein At5g46170-like          92.0    4e-18   Elaeis guineensis
ref|XP_002870048.1|  F-box family protein                             90.5    1e-17   Arabidopsis lyrata subsp. lyrata
emb|CDX87738.1|  BnaC02g32110D                                        89.4    3e-17   
ref|XP_008794503.1|  PREDICTED: F-box protein At5g46170               87.8    1e-16   Phoenix dactylifera
ref|XP_009397406.1|  PREDICTED: F-box protein At5g46170-like          87.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010434544.1|  PREDICTED: F-box protein At4g18380-like          86.3    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010052049.1|  PREDICTED: F-box protein At5g46170-like          80.1    2e-15   Eucalyptus grandis [rose gum]
ref|XP_009398331.1|  PREDICTED: F-box protein At5g46170-like          84.0    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010439863.1|  PREDICTED: F-box protein At4g18380-like          82.0    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009399020.1|  PREDICTED: F-box protein At5g46170-like          83.2    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009128847.1|  PREDICTED: F-box protein At5g46170-like          81.6    1e-14   Brassica rapa
ref|XP_010499543.1|  PREDICTED: F-box protein At1g30200-like isof...  77.4    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010478400.1|  PREDICTED: F-box protein At1g30200-like          77.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002992968.1|  hypothetical protein SELMODRAFT_136272           80.5    3e-14   
ref|XP_010460807.1|  PREDICTED: F-box protein At1g30200               76.6    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009408533.1|  PREDICTED: F-box protein At5g46170               80.9    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001770045.1|  predicted protein                                79.7    4e-14   
gb|ADE76154.1|  unknown                                               79.7    5e-14   Picea sitchensis
ref|XP_006836365.1|  PREDICTED: F-box protein At5g46170               79.7    5e-14   Amborella trichopoda
ref|XP_009407719.1|  PREDICTED: F-box protein At5g46170-like          79.3    7e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010518863.1|  PREDICTED: F-box protein At5g46170-like          76.3    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_010940976.1|  PREDICTED: F-box protein At5g46170-like          78.6    2e-13   Elaeis guineensis
ref|XP_006307474.1|  hypothetical protein CARUB_v10009099mg           72.8    4e-13   
gb|AFW82429.1|  F-box domain containing protein                       77.4    5e-13   
ref|XP_004961549.1|  PREDICTED: F-box protein At5g46170-like          77.4    5e-13   Setaria italica
emb|CDY43956.1|  BnaA02g24340D                                        77.0    5e-13   Brassica napus [oilseed rape]
ref|XP_009388498.1|  PREDICTED: F-box protein At5g46170-like          74.7    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002440052.1|  hypothetical protein SORBIDRAFT_09g025120        74.3    5e-12   
dbj|BAK06381.1|  predicted protein                                    73.9    7e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006415502.1|  hypothetical protein EUTSA_v10007915mg           70.1    8e-12   Eutrema salsugineum [saltwater cress]
ref|XP_002969001.1|  hypothetical protein SELMODRAFT_90428            73.6    8e-12   
ref|XP_009381298.1|  PREDICTED: F-box protein At5g46170-like          73.2    1e-11   
ref|XP_003569912.1|  PREDICTED: F-box protein At4g18380-like          73.2    1e-11   Brachypodium distachyon [annual false brome]
emb|CDX99469.1|  BnaC01g10830D                                        71.2    1e-11   
ref|NP_001151246.1|  F-box domain containing protein                  73.2    2e-11   Zea mays [maize]
emb|CDX78847.1|  BnaA01g09140D                                        70.9    2e-11   
ref|XP_001761459.1|  predicted protein                                71.6    2e-11   
ref|XP_002890858.1|  F-box family protein                             69.3    3e-11   
ref|XP_008649848.1|  PREDICTED: F-box protein At5g46170-like          71.6    4e-11   Zea mays [maize]
ref|XP_010549497.1|  PREDICTED: F-box protein At1g30200               71.6    5e-11   Tarenaya hassleriana [spider flower]
gb|EAY98656.1|  hypothetical protein OsI_20579                        70.5    1e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001056009.1|  Os05g0510400                                     70.5    1e-10   
gb|ABK24885.1|  unknown                                               69.7    2e-10   Picea sitchensis
gb|AES87540.2|  F-box plant-like protein, putative                    66.2    3e-10   Medicago truncatula
ref|XP_006836201.1|  PREDICTED: F-box protein At4g18380               68.6    5e-10   Amborella trichopoda
ref|XP_006654629.1|  PREDICTED: F-box protein At5g46170-like          68.2    7e-10   
tpg|DAA41006.1|  TPA: hypothetical protein ZEAMMB73_999134            68.2    8e-10   
ref|XP_003605343.1|  F-box protein                                    65.5    1e-09   
ref|XP_003568140.1|  PREDICTED: F-box protein At5g46170-like          65.9    4e-09   Brachypodium distachyon [annual false brome]
ref|NP_564350.1|  F-box protein                                       65.1    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381361.1|  PREDICTED: F-box protein At4g18380-like          64.3    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410458.1|  PREDICTED: F-box protein At5g46170-like          63.9    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393903.1|  PREDICTED: F-box protein At4g18380-like          63.9    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001151107.1|  F-box domain containing protein                  63.9    2e-08   Zea mays [maize]
ref|XP_010907825.1|  PREDICTED: F-box protein At4g18380-like          63.5    2e-08   Elaeis guineensis
gb|EEC71551.1|  hypothetical protein OsI_03898                        63.5    3e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001044377.1|  Os01g0770400                                     63.5    3e-08   
ref|XP_008777014.1|  PREDICTED: F-box protein At4g18380-like          63.2    3e-08   Phoenix dactylifera
ref|XP_008784858.1|  PREDICTED: F-box protein At5g46170-like          59.3    3e-08   Phoenix dactylifera
dbj|BAJ95685.1|  predicted protein                                    63.2    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008804990.1|  PREDICTED: F-box protein At4g18380-like isof...  62.8    4e-08   Phoenix dactylifera
ref|XP_008804989.1|  PREDICTED: F-box protein At4g18380-like isof...  62.8    4e-08   Phoenix dactylifera
ref|XP_010907539.1|  PREDICTED: F-box protein At4g18380-like          62.4    5e-08   Elaeis guineensis
ref|XP_004984553.1|  PREDICTED: F-box protein At5g46170-like          62.0    7e-08   Setaria italica
ref|XP_010922958.1|  PREDICTED: F-box protein At4g18380-like          62.0    7e-08   Elaeis guineensis
ref|NP_001049959.1|  Os03g0321300                                     61.6    1e-07   
gb|EEC75147.1|  hypothetical protein OsI_11347                        61.6    1e-07   Oryza sativa Indica Group [Indian rice]
gb|EEE58967.1|  hypothetical protein OsJ_10655                        61.6    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651329.1|  PREDICTED: F-box protein At5g46170-like          61.2    1e-07   
ref|XP_002307387.1|  F-box family protein                             60.1    3e-07   
ref|XP_009404692.1|  PREDICTED: F-box protein At4g18380-like          60.1    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011043565.1|  PREDICTED: F-box protein At1g22220-like          60.1    3e-07   Populus euphratica
gb|AFW88518.1|  hypothetical protein ZEAMMB73_307153                  60.1    3e-07   
ref|XP_008672792.1|  PREDICTED: F-box domain containing protein i...  60.1    4e-07   
gb|AAT69637.1|  unknown protein, contains f-box domain                59.7    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467943.1|  hypothetical protein SORBIDRAFT_01g036900        59.7    4e-07   Sorghum bicolor [broomcorn]
ref|XP_006654574.1|  PREDICTED: F-box protein At4g18380-like          59.7    5e-07   Oryza brachyantha
ref|XP_008792446.1|  PREDICTED: F-box protein At4g18380-like          59.7    5e-07   Phoenix dactylifera
ref|NP_001055899.2|  Os05g0490300                                     59.7    5e-07   
ref|XP_008676229.1|  PREDICTED: F-box protein At5g46170-like          58.9    6e-07   Zea mays [maize]
ref|XP_010904742.1|  PREDICTED: F-box protein At4g18380-like          59.3    6e-07   Elaeis guineensis
ref|XP_006854457.1|  PREDICTED: F-box protein At5g46170               58.9    9e-07   Amborella trichopoda
ref|XP_004970106.1|  PREDICTED: F-box protein At5g46170-like          58.9    1e-06   Setaria italica
ref|XP_008786757.1|  PREDICTED: F-box protein At4g18380-like          58.5    1e-06   Phoenix dactylifera
ref|NP_001146920.1|  F-box domain containing protein                  58.5    1e-06   
ref|XP_002458563.1|  hypothetical protein SORBIDRAFT_03g035810        58.5    1e-06   Sorghum bicolor [broomcorn]
ref|NP_001132514.1|  uncharacterized protein LOC100193974             58.2    1e-06   
gb|ACG40631.1|  F-box domain containing protein                       58.2    1e-06   Zea mays [maize]
ref|XP_002455973.1|  hypothetical protein SORBIDRAFT_03g028320        57.8    2e-06   Sorghum bicolor [broomcorn]
ref|XP_009420961.1|  PREDICTED: F-box protein At4g18380-like          57.4    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012067843.1|  PREDICTED: F-box protein At1g22220               57.0    4e-06   Jatropha curcas
ref|XP_004150662.2|  PREDICTED: F-box protein At1g22220               57.0    4e-06   Cucumis sativus [cucumbers]
gb|ACG24953.1|  F-box domain containing protein                       56.6    5e-06   Zea mays [maize]
ref|XP_002456519.1|  hypothetical protein SORBIDRAFT_03g037710        55.8    8e-06   Sorghum bicolor [broomcorn]
ref|NP_001130615.1|  uncharacterized LOC100191714                     55.8    9e-06   Zea mays [maize]
gb|ACG44263.1|  F-box domain containing protein                       55.8    9e-06   Zea mays [maize]
ref|XP_009406821.1|  PREDICTED: F-box protein At5g46170-like          55.8    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006355980.1|  PREDICTED: uncharacterized protein LOC102590130  45.4    1e-05   
ref|XP_006434013.1|  hypothetical protein CICLE_v10001889mg           55.5    1e-05   Citrus clementina [clementine]
gb|KDO80923.1|  hypothetical protein CISIN_1g041814mg                 55.1    1e-05   Citrus sinensis [apfelsine]
gb|KJB64313.1|  hypothetical protein B456_010G042500                  55.1    2e-05   Gossypium raimondii
ref|XP_004961674.1|  PREDICTED: F-box protein At4g18380-like          54.7    2e-05   Setaria italica
ref|XP_002313372.1|  hypothetical protein POPTR_0009s05230g           54.7    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_003568215.1|  PREDICTED: F-box protein At5g46170-like          54.7    2e-05   Brachypodium distachyon [annual false brome]
ref|XP_007015207.1|  F-box family protein, putative                   54.7    2e-05   
ref|XP_002279458.1|  PREDICTED: F-box protein At5g46170-like          54.3    3e-05   Vitis vinifera
ref|XP_010277597.1|  PREDICTED: F-box protein At4g18380-like          54.3    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_008654796.1|  PREDICTED: uncharacterized protein LOC100279...  54.3    3e-05   Zea mays [maize]
gb|ACG36557.1|  F-box domain containing protein                       54.3    3e-05   Zea mays [maize]
gb|ACR36872.1|  unknown                                               54.3    3e-05   Zea mays [maize]
ref|XP_008445343.1|  PREDICTED: F-box protein At1g22220               54.3    3e-05   Cucumis melo [Oriental melon]
ref|XP_002441291.1|  hypothetical protein SORBIDRAFT_09g023970        54.3    3e-05   Sorghum bicolor [broomcorn]
ref|XP_003564454.1|  PREDICTED: F-box protein At5g46170-like          52.4    3e-05   Brachypodium distachyon [annual false brome]
ref|XP_003558028.1|  PREDICTED: F-box protein At5g46170-like          53.9    4e-05   Brachypodium distachyon [annual false brome]
ref|XP_007227716.1|  hypothetical protein PRUPE_ppa009011mg           53.5    5e-05   
ref|NP_001145883.1|  uncharacterized protein LOC100279399             53.5    6e-05   Zea mays [maize]
ref|XP_011016269.1|  PREDICTED: F-box protein At1g22220               53.1    6e-05   Populus euphratica
ref|XP_006386402.1|  hypothetical protein POPTR_0002s09520g           53.1    6e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002284195.1|  PREDICTED: F-box protein At1g22220               53.1    7e-05   Vitis vinifera
ref|NP_001182880.1|  hypothetical protein                             52.8    9e-05   Zea mays [maize]
ref|XP_004970320.1|  PREDICTED: F-box protein At1g30200-like          52.8    1e-04   Setaria italica
ref|XP_007018808.1|  F-box family protein, putative                   52.4    1e-04   
ref|XP_008219667.1|  PREDICTED: F-box protein At1g22220               52.4    1e-04   Prunus mume [ume]
ref|XP_008374968.1|  PREDICTED: F-box protein At1g22220-like          52.4    1e-04   
ref|XP_009369664.1|  PREDICTED: F-box protein At1g22220               52.0    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_002513900.1|  conserved hypothetical protein                   52.0    2e-04   Ricinus communis
dbj|BAB90386.1|  P0432B10.4                                           52.0    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009786216.1|  PREDICTED: F-box protein At1g78100               52.0    2e-04   Nicotiana sylvestris
ref|XP_009600740.1|  PREDICTED: F-box protein At1g78100               52.0    2e-04   Nicotiana tomentosiformis
dbj|BAJ85411.1|  predicted protein                                    51.6    2e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006353995.1|  PREDICTED: F-box protein At1g78100-like isof...  51.6    3e-04   Solanum tuberosum [potatoes]
ref|XP_010269221.1|  PREDICTED: F-box protein At1g22220-like          51.6    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_004237895.1|  PREDICTED: F-box protein At1g78100               51.6    3e-04   Solanum lycopersicum
ref|XP_010270680.1|  PREDICTED: F-box protein At4g18380-like          51.2    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010246617.1|  PREDICTED: F-box protein At4g18380-like          51.2    3e-04   
ref|XP_010105899.1|  F-box protein                                    51.2    3e-04   Morus notabilis
ref|XP_011032098.1|  PREDICTED: F-box protein At4g18380-like          51.2    4e-04   Populus euphratica
ref|NP_001044594.1|  Os01g0812200                                     51.2    4e-04   
gb|EAY76237.1|  hypothetical protein OsI_04173                        50.8    4e-04   Oryza sativa Indica Group [Indian rice]
dbj|BAJ87191.1|  predicted protein                                    50.1    9e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]



>ref|XP_011096601.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=392

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS+R DL  R++PEP+DHFDRLPDS+ILL+FN IGDVKALGRCCVVS+RFHSLVPQVDN
Sbjct  1    MGSIRADLGSRIHPEPIDHFDRLPDSVILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            V+VRVDCVISDED S+ SSS+AAA+AASDKSRHPISS+ R++F+GL KP QSLSQ IS S
Sbjct  61   VIVRVDCVISDEDPSATSSSSAAASAASDKSRHPISSLFRILFSGLFKPLQSLSQLISPS  120

Query  598  prrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             RR+ + S   D E +Q+SVTHHSPTQVLK
Sbjct  121  SRRIPSLSEDFDFETEQNSVTHHSPTQVLK  150



>ref|XP_009774076.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris]
Length=392

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M S+R DL  R+YPEPVDHFDR+PDS++LLVFN IGDVKALGRCC+VSKRF+SLVP VD+
Sbjct  1    MESIRSDLRGRIYPEPVDHFDRIPDSVLLLVFNNIGDVKALGRCCLVSKRFNSLVPLVDS  60

Query  418  vvvrvd-cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            V+VRVD  +  D+  S  +S+A  +A  SDKSRHPISS+ RLVF+GLLKPFQS+SQFIS 
Sbjct  61   VIVRVDCVISDDDSSSPSTSNAVTSAVTSDKSRHPISSLFRLVFSGLLKPFQSISQFISV  120

Query  595  sprrvaassaLE--DGEFDQSSVTHHSPTQVLK  687
            S R   AS++ +  DG+FD + VTHHSPTQVLK
Sbjct  121  SSRHAGASASADDVDGDFDHTFVTHHSPTQVLK  153



>ref|XP_009607720.1| PREDICTED: F-box protein At4g18380-like [Nicotiana tomentosiformis]
Length=392

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M S R DL  R+YPEPVDHFDR+PDS++LLVFN IGDVKALGRCC+VSKRF+SLVP VD+
Sbjct  1    MESFRSDLRGRIYPEPVDHFDRIPDSVLLLVFNNIGDVKALGRCCLVSKRFNSLVPLVDS  60

Query  418  vvvrvd-cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            V+VRVD  +  D+  S  +S+A  +A  SDKSRHPISS+ RLVF+GLLKPFQS+SQFIS 
Sbjct  61   VIVRVDCVISDDDSSSPSASNAVTSAVTSDKSRHPISSLFRLVFSGLLKPFQSISQFISV  120

Query  595  sprrvaassaLE--DGEFDQSSVTHHSPTQVLK  687
            S R   AS++ +  DG+FD + VTHHSPTQVLK
Sbjct  121  SSRHAGASASADDVDGDFDHTFVTHHSPTQVLK  153



>gb|EYU33385.1| hypothetical protein MIMGU_mgv1a008110mg [Erythranthe guttata]
Length=384

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS+R DL  +++PEP+DHFDRLPDSLILL+FN IGDVKALGRCCVVSKRFHSLVPQVDN
Sbjct  1    MGSIRADLGRKIHPEPIDHFDRLPDSLILLIFNQIGDVKALGRCCVVSKRFHSLVPQVDN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            V+VRVDCVISD+D S+ SSS++A +AASDK RHPISS+ R VF+GL KP QSLSQ I  S
Sbjct  61   VIVRVDCVISDDDPSATSSSSSATSAASDKLRHPISSLFRFVFSGLFKPLQSLSQLIVPS  120

Query  598  prrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             RR+  S    DGE +Q++VTHHSPTQVLK
Sbjct  121  TRRLPLSEDF-DGETEQNTVTHHSPTQVLK  149



>ref|XP_009625759.1| PREDICTED: F-box protein At5g46170-like [Nicotiana tomentosiformis]
Length=385

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 4/152 (3%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS + DL   +YPEPVDHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVDN
Sbjct  1    MGSSKSDLRSTIYPEPVDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDN  60

Query  418  vvvrvdcvisdED--GsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIs  591
            V+VRVDCVISDED   SS  +++AA A ++ KSRHPISS+LR +F GL+KP QSL+Q I 
Sbjct  61   VIVRVDCVISDEDGGSSSSGATSAAGAGSTSKSRHPISSLLRFLFLGLVKPIQSLTQLI-  119

Query  592  asprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            +   R +A S+L+DG +DQ+ VTHHSPTQVLK
Sbjct  120  SISSRRSAGSSLDDG-YDQNDVTHHSPTQVLK  150



>ref|XP_009758227.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris]
Length=396

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 127/152 (84%), Gaps = 4/152 (3%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS + DL   +YPEPVDHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVDN
Sbjct  1    MGSSKSDLRSTIYPEPVDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDN  60

Query  418  vvvrvdcvisdED--GsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIs  591
            V+VRVDCVISDED   SS  +++AA A +++KSRHPISS+LR +F GL+KP QSL+Q I 
Sbjct  61   VIVRVDCVISDEDGGSSSSGATSAAGAGSTNKSRHPISSLLRFLFLGLVKPIQSLTQLI-  119

Query  592  asprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            +   R +A S+L+DG ++Q+ VTHHSPTQVLK
Sbjct  120  SISSRRSAGSSLDDG-YEQNDVTHHSPTQVLK  150



>gb|EPS70457.1| hypothetical protein M569_04296 [Genlisea aurea]
Length=381

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS+RPDL  R++P+ +DH DRLPDSLILL+FN IGDVKALGRCCVVS+RFHSLVPQVD+
Sbjct  1    MGSIRPDLGGRLHPDAIDHLDRLPDSLILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDH  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            V+VRVDCVISD++ S+ SSS+A++A+A+ KSRHPISS+ R+ F+G+ KP QSLSQ I+ S
Sbjct  61   VIVRVDCVISDDEPSATSSSSASSASAAHKSRHPISSLFRIFFSGIFKPLQSLSQIIAPS  120

Query  598  prrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             RR++ S    + E DQ+ VTHHSPTQVLK
Sbjct  121  HRRLSLSEEF-NVEADQNIVTHHSPTQVLK  149



>ref|XP_004244968.1| PREDICTED: F-box protein At5g46170-like [Solanum lycopersicum]
Length=384

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS + DL   +YPEPVDHF++LPD ++LL+FN IGDVK LGRCC V +RFHSLVPQVDN
Sbjct  1    MGSSKSDLRSTIYPEPVDHFNQLPDPVLLLIFNKIGDVKTLGRCCGVCRRFHSLVPQVDN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            VVVRVDCVISD+D +S SSS+++AAA+SDKSRHPISS+ RLVF GL+KPFQSL+Q IS S
Sbjct  61   VVVRVDCVISDDDDASSSSSSSSAAASSDKSRHPISSLFRLVFLGLVKPFQSLTQLISIS  120

Query  598  prrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             RR  ASS+L D +F++ SVTHHSPTQVLK
Sbjct  121  SRRCTASSSLVDDDFEKYSVTHHSPTQVLK  150



>ref|XP_006355407.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum]
Length=389

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 122/152 (80%), Gaps = 2/152 (1%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS + DL   +YPEPVDHFD+LPD ++LL+FN IGDVK LGRCC V  RFHSLVPQVDN
Sbjct  1    MGSSKSDLRSTIYPEPVDHFDQLPDPVLLLIFNKIGDVKTLGRCCGVCSRFHSLVPQVDN  60

Query  418  vvvrv--dcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIs  591
            VVVRV       D+  SS SSS++++AA+SDKSRHPISS+ RLVF GL+KPFQSL+Q IS
Sbjct  61   VVVRVDCVISDDDDASSSSSSSSSSSAASSDKSRHPISSLFRLVFLGLVKPFQSLTQLIS  120

Query  592  asprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             S RR  ASS+L D +F+Q+SVTHHSPTQVLK
Sbjct  121  ISSRRCTASSSLVDDDFEQNSVTHHSPTQVLK  152



>ref|XP_011085237.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=388

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 127/150 (85%), Gaps = 2/150 (1%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS+R DL CR++PE +DHFDRLPDSLILL+FN IGDVKALGRCCVVS+RFHSLVPQVD+
Sbjct  1    MGSIRVDLGCRIHPETIDHFDRLPDSLILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDD  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            V+VRVDCVISD+   S  +S+++A+AASDKSR+PISS+ R+ F+G+ +P QSL+Q I+ S
Sbjct  61   VIVRVDCVISDD--DSSGTSSSSASAASDKSRYPISSLFRIFFSGIFRPLQSLTQLITPS  118

Query  598  prrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             RR+ + +   D E +Q+SVTHHSPTQVLK
Sbjct  119  SRRLPSLNDDVDSETEQNSVTHHSPTQVLK  148



>ref|XP_006352970.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum]
Length=367

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 118/141 (84%), Gaps = 5/141 (4%)
 Frame = +1

Query  271  VYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisd  450
            +YPEP+DHFDRLPDS++L +FN IGDVKALGRC VVS+RF+SLVP+VDNV+VRVDCVISD
Sbjct  2    IYPEPIDHFDRLPDSILLFIFNKIGDVKALGRCSVVSRRFNSLVPEVDNVLVRVDCVISD  61

Query  451  EDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas--prrvaassa  624
            +     SS +++   +SDKSRHPISS+ RLVF+GLLKPFQS++QFIS S      ++++ 
Sbjct  62   D---ESSSPSSSTGYSSDKSRHPISSLFRLVFSGLLKPFQSITQFISISPRRAASSSAAV  118

Query  625  LEDGEFDQSSVTHHSPTQVLK  687
            ++  +F+++SVTHHSPTQVL+
Sbjct  119  VDGDDFEKNSVTHHSPTQVLR  139



>gb|EYU43254.1| hypothetical protein MIMGU_mgv1a008300mg [Erythranthe guttata]
Length=378

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            MGS+R DL  R++PEP+DHFD LPDS+ILL+FN IGDVKALGRCCVVS+RFHSLVPQVD+
Sbjct  1    MGSIRADLGSRIHPEPIDHFDHLPDSVILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDD  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            V+VRVDCVISD+    PS++++A++AASDK RHPISS+LR +F+GL KP QSL+Q I+ S
Sbjct  61   VIVRVDCVISDD---DPSAASSASSAASDKFRHPISSLLR-IFSGLFKPLQSLTQLITPS  116

Query  598  prrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             RR+ + S   D + DQSSVTHHSPTQVLK
Sbjct  117  ARRLPSHSTDFDSDSDQSSVTHHSPTQVLK  146



>ref|XP_002278480.1| PREDICTED: F-box protein At5g46170 [Vitis vinifera]
Length=399

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 110/170 (65%), Gaps = 29/170 (17%)
 Frame = +1

Query  244  SVRPDLSCRVYPEP-------------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSK  384
            S+RPD S R++PEP             +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+
Sbjct  4    SMRPDPSTRIWPEPQNSPPPVMMMAEAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSR  63

Query  385  RFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKP  564
            RFH+LVPQV+NVVVRV       D       +++AA + +KSR P S + RLVF G++KP
Sbjct  64   RFHTLVPQVENVVVRV-------DCVISDDESSSAAGSLEKSRGPFSHLFRLVFGGIVKP  116

Query  565  FQSLSQFIsasprrvaassaL-------EDGEFDQSS--VTHHSPTQVLK  687
             Q+L QF+         SS+L       EDG+ D  +  VTHHSPTQVLK
Sbjct  117  LQALGQFLGPKRSAPTTSSSLAVGGGSEEDGDVDHQTGGVTHHSPTQVLK  166



>emb|CAN73778.1| hypothetical protein VITISV_042179 [Vitis vinifera]
Length=399

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 110/170 (65%), Gaps = 29/170 (17%)
 Frame = +1

Query  244  SVRPDLSCRVYPEP-------------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSK  384
            S+RPD S R++PEP             +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+
Sbjct  4    SMRPDPSTRIWPEPQNSPPPVMMMAEAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSR  63

Query  385  RFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKP  564
            RFH+LVPQV+NVVVRV       D       +++AA + +KSR P S + RLVF G++KP
Sbjct  64   RFHTLVPQVENVVVRV-------DCVISDDESSSAAGSLEKSRGPFSHLFRLVFGGIVKP  116

Query  565  FQSLSQFIsasprrvaassaL-------EDGEFDQSS--VTHHSPTQVLK  687
             Q+L QF+         SS+L       EDG+ D  +  VTHHSPTQVLK
Sbjct  117  LQALGQFLGPKRSAPTTSSSLAVGGGSEEDGDVDHQTGGVTHHSPTQVLK  166



>ref|XP_004233124.1| PREDICTED: F-box protein At5g46170-like [Solanum lycopersicum]
Length=369

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 123/141 (87%), Gaps = 3/141 (2%)
 Frame = +1

Query  271  VYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisd  450
            +YPEP+DHFDRLPDS++L +FN IGDVKALGRC VVS+RF+SLVP+VDNV+VRVDCVISD
Sbjct  2    IYPEPMDHFDRLPDSILLFIFNKIGDVKALGRCSVVSRRFNSLVPEVDNVLVRVDCVISD  61

Query  451  EDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas--prrvaassa  624
            ++ SSP SS++++  +SDKSRHPISS+ RLVF+GLLKPFQS++QFIS S      ++++ 
Sbjct  62   DE-SSPPSSSSSSGYSSDKSRHPISSLFRLVFSGLLKPFQSITQFISISPRRAASSSAAV  120

Query  625  LEDGEFDQSSVTHHSPTQVLK  687
            ++  +F+++SVTHHSPTQVLK
Sbjct  121  VDGDDFEKNSVTHHSPTQVLK  141



>gb|KJB57218.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
Length=369

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 103/163 (63%), Gaps = 20/163 (12%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SV  D     +PEP+DHFDRLPDSL+LLVFNMIGDVKALGRCCVVS+RFH+LVPQV+N
Sbjct  1    MSSVYSDPIHGTHPEPIDHFDRLPDSLLLLVFNMIGDVKALGRCCVVSRRFHALVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI---  588
            VVVRV       D        + +++   ++  P S++ RLVF G++KP Q+L QF+   
Sbjct  61   VVVRV-------DCVISDDDCSPSSSVKSRAAGPFSTLFRLVFGGIVKPLQALGQFLGPE  113

Query  589  ----------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                      S+S          EDGE DQ  VTHHSPTQVL+
Sbjct  114  RPSLNKTLNTSSSSSLSVGLGGGEDGEMDQGGVTHHSPTQVLR  156



>gb|KJB57216.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
 gb|KJB57217.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
Length=391

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 103/163 (63%), Gaps = 20/163 (12%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SV  D     +PEP+DHFDRLPDSL+LLVFNMIGDVKALGRCCVVS+RFH+LVPQV+N
Sbjct  1    MSSVYSDPIHGTHPEPIDHFDRLPDSLLLLVFNMIGDVKALGRCCVVSRRFHALVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI---  588
            VVVRV       D        + +++   ++  P S++ RLVF G++KP Q+L QF+   
Sbjct  61   VVVRV-------DCVISDDDCSPSSSVKSRAAGPFSTLFRLVFGGIVKPLQALGQFLGPE  113

Query  589  ----------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                      S+S          EDGE DQ  VTHHSPTQVL+
Sbjct  114  RPSLNKTLNTSSSSSLSVGLGGGEDGEMDQGGVTHHSPTQVLR  156



>gb|KHG20859.1| hypothetical protein F383_03969 [Gossypium arboreum]
Length=391

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 103/163 (63%), Gaps = 20/163 (12%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SV  D     +PEP+DHFDRLPDSL+LLVFNMIGDVKALGRCCVVS+RFHSLVPQV+N
Sbjct  1    MSSVYSDPIHGTHPEPIDHFDRLPDSLLLLVFNMIGDVKALGRCCVVSRRFHSLVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI---  588
            VVVRV       D        + +++   ++  P S++ RLVF G++KP Q+L QF+   
Sbjct  61   VVVRV-------DCVISDDDCSPSSSVKSRADGPFSTLFRLVFGGIVKPLQALGQFLGPE  113

Query  589  ----------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                      S+S          EDGE DQ  VTHHSPTQVL+
Sbjct  114  RPSLNKTLNTSSSSSLSVGLGGGEDGEMDQGGVTHHSPTQVLR  156



>emb|CBI30928.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 105/163 (64%), Gaps = 36/163 (22%)
 Frame = +1

Query  244  SVRPDLSCRVYPEP-------------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSK  384
            S+RPD S R++PEP             +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+
Sbjct  36   SMRPDPSTRIWPEPQNSPPPVMMMAEAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSR  95

Query  385  RFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKP  564
            RFH+LVPQV+NVVVRV       D       +++AA + +KSR P S + RLVF G++KP
Sbjct  96   RFHTLVPQVENVVVRV-------DCVISDDESSSAAGSLEKSRGPFSHLFRLVFGGIVKP  148

Query  565  FQSLSQFIsasprrvaassaLEDGEFDQSS--VTHHSPTQVLK  687
             Q+L QF+              DG+ D  +  VTHHSPTQVLK
Sbjct  149  LQALGQFL--------------DGDVDHQTGGVTHHSPTQVLK  177



>ref|XP_010247412.1| PREDICTED: F-box protein At5g46170 [Nelumbo nucifera]
Length=398

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 112/169 (66%), Gaps = 26/169 (15%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHS  396
            M S RPDL+ +++PEP       +DHFDRLPDSL+L+VFN IGDVKALGRCCVVS+RFH 
Sbjct  1    MASHRPDLNGKIWPEPSTAEVAEIDHFDRLPDSLLLIVFNKIGDVKALGRCCVVSRRFHG  60

Query  397  LvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            LVPQVDNVVVRVDCVISD+D        ++  AASDK+R   S+++RLVF G++KP Q+L
Sbjct  61   LVPQVDNVVVRVDCVISDDDA-------SSGTAASDKTRGVFSNLVRLVFGGIVKPLQAL  113

Query  577  SQFI------------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             QF+              S          +D E +   VTHHSPTQVLK
Sbjct  114  GQFLGPKKSSSASSLNGGSGGGGGGGGVGDDEEMEAGGVTHHSPTQVLK  162



>ref|XP_003542943.1| PREDICTED: F-box protein At5g46170-like isoform X1 [Glycine max]
 ref|XP_006594509.1| PREDICTED: F-box protein At5g46170-like isoform X2 [Glycine max]
Length=387

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 113/165 (68%), Gaps = 22/165 (13%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp  405
            M S R DL+CR++PEP    +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVP
Sbjct  1    MSSQRADLACRIFPEPDASEIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVP  60

Query  406  qvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            QV+NVVVRV       D       ++++AAASDKSR P  ++LRLVF G++KP Q+L QF
Sbjct  61   QVENVVVRV-------DCVISDDDSSSSAAASDKSRGPFWNLLRLVFGGIVKPIQTLGQF  113

Query  586  I---------sasprrvaassaLEDGEFDQS--SVTHHSPTQVLK  687
            +           SP    +SS L  G  D S   VTHHSPTQVLK
Sbjct  114  LGPKRPSSSSVTSPSSTTSSSPLAVGTDDDSDAGVTHHSPTQVLK  158



>ref|XP_008444512.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
 ref|XP_008444520.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
Length=406

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 111/177 (63%), Gaps = 34/177 (19%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-----------------VDHFDRLPDSLILLVFNMIGDVKALGR  366
            M S+R DL+ ++YPEP                 +DHFDRLPDSL+LL+FN IGDVKALGR
Sbjct  1    MSSLRLDLTSKIYPEPDSLFSFNSASISTTSCCIDHFDRLPDSLLLLIFNKIGDVKALGR  60

Query  367  CCVVSKRFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVF  546
            CCVVS+RFH LVPQV+NVVVRV       D       +++++++S KSR P  +I R VF
Sbjct  61   CCVVSRRFHCLVPQVENVVVRV-------DCVISDDESSSSSSSSGKSRGPFFNIFRFVF  113

Query  547  TGLLKPFQSLSQFIsasprrvaassaL----------EDGEFDQSSVTHHSPTQVLK  687
             G++KP Q+L QF+  +    + +S+           EDGE DQ  VTHHSPTQVLK
Sbjct  114  GGIVKPLQALGQFLGQTRASSSLASSSSTSSLAVGTDEDGEIDQGGVTHHSPTQVLK  170



>ref|XP_004137366.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 ref|XP_011649352.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 gb|KGN63909.1| hypothetical protein Csa_1G025900 [Cucumis sativus]
Length=406

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 110/177 (62%), Gaps = 34/177 (19%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-----------------VDHFDRLPDSLILLVFNMIGDVKALGR  366
            M S+R DL+ ++YPEP                 +DHFDRLPDSL+LL+FN IGDVKALGR
Sbjct  1    MSSLRLDLTSKIYPEPDSLFSFNSSSISSTSCCIDHFDRLPDSLLLLIFNKIGDVKALGR  60

Query  367  CCVVSKRFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVF  546
            CCVVS+RFH LVPQV+NVVVRV       D       +++++++S KSR P  +I R VF
Sbjct  61   CCVVSRRFHCLVPQVENVVVRV-------DCVISDDESSSSSSSSGKSRGPFFNIFRFVF  113

Query  547  TGLLKPFQSLSQFIsasprrvaassaL----------EDGEFDQSSVTHHSPTQVLK  687
             G++KP Q+L QF+  +      +S+           EDGE DQ  VTHHSPTQVLK
Sbjct  114  GGIVKPLQALGQFLGQTRASSTLASSSSTSSLAVGTDEDGEIDQGGVTHHSPTQVLK  170



>ref|XP_007025034.1| F-box family protein [Theobroma cacao]
 gb|EOY27656.1| F-box family protein [Theobroma cacao]
Length=397

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 112/163 (69%), Gaps = 18/163 (11%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SVR D   R++PEP+DH DRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVPQV+N
Sbjct  1    MSSVRSDPIHRIHPEPIDHVDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            VVVRVDCVISD+       S++++++   ++  P S++ RLVF G++KP Q+L QF+   
Sbjct  61   VVVRVDCVISDD-----DCSSSSSSSDKSRATGPFSNLFRLVFGGIVKPLQALGQFLGPK  115

Query  598  prrvaassaL-------------EDGEFDQSSVTHHSPTQVLK  687
               +  +                +DGE DQ  VTHHSPTQVL+
Sbjct  116  RPTLNETLNTPSSSSLSVGPGGDDDGEMDQGGVTHHSPTQVLR  158



>ref|XP_003546077.1| PREDICTED: F-box protein At5g46170-like [Glycine max]
Length=385

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 111/165 (67%), Gaps = 22/165 (13%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            M S R DL CR++PEP +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVPQV+
Sbjct  1    MSSQRADLECRIFPEPEIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVE  60

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI--  588
            NVVVRV       D       +++++AASDKSR P  ++LRLVF G++KP Q+L QF+  
Sbjct  61   NVVVRV-------DCVISDDDSSSSSAASDKSRGPFWNLLRLVFGGIVKPIQTLGQFLGP  113

Query  589  ------------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                        +A+     +S A+   E     VTHHSPTQVLK
Sbjct  114  KRPSSSAAATATAATSPSSTSSLAVGSDEDSDGGVTHHSPTQVLK  158



>ref|XP_007147928.1| hypothetical protein PHAVU_006G166500g [Phaseolus vulgaris]
 gb|ESW19922.1| hypothetical protein PHAVU_006G166500g [Phaseolus vulgaris]
Length=379

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 113/159 (71%), Gaps = 16/159 (10%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp  405
            M S R DL+CR++PEP    +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVP
Sbjct  1    MSSQRADLACRIFPEPDAYQIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVP  60

Query  406  qvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            QV+NVVVRV       D       +++++A+SDKSR P  ++LRLVF G++KP Q+L QF
Sbjct  61   QVENVVVRV-------DCVISDDDSSSSSASSDKSRGPFWNLLRLVFGGIVKPIQTLGQF  113

Query  586  I---sasprrvaassaLEDGEFDQS--SVTHHSPTQVLK  687
            +     S    + SS+L  G  D S   VTHHSPTQVLK
Sbjct  114  LGPKRPSSSSPSPSSSLAVGTDDDSDAGVTHHSPTQVLK  152



>ref|XP_010518768.1| PREDICTED: F-box protein At5g46170 [Tarenaya hassleriana]
Length=385

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 116/157 (74%), Gaps = 12/157 (8%)
 Frame = +1

Query  247  VRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            +RPD   R++PEP    +DHFDRLPDS+ LLVFN IGDVKALGRCCVVSKRFHSLVPQVD
Sbjct  5    LRPDPPSRIHPEPQTLDIDHFDRLPDSIFLLVFNKIGDVKALGRCCVVSKRFHSLVPQVD  64

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            NVVVRVDCVISD+D SSPSS    +AAA   S  P S+I RLVF G++KP Q+L QF+  
Sbjct  65   NVVVRVDCVISDDDSSSPSSDKPRSAAAV--SAGPFSAIFRLVFGGIVKPLQALGQFLGT  122

Query  595  sprrvaassaL------EDGEFDQSSVTHHSPTQVLK  687
                 +ASS+       +DGE +Q  VTHHSPTQVLK
Sbjct  123  KRSCASASSSYLSISGDDDGEIEQGGVTHHSPTQVLK  159



>ref|XP_010538543.1| PREDICTED: F-box protein At5g46170-like [Tarenaya hassleriana]
Length=378

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 113/157 (72%), Gaps = 12/157 (8%)
 Frame = +1

Query  247  VRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            +R D   R+YPEP    +DHFDRLPD+++LLVFN IGDVKALGRCCVVSKRFHSLVPQVD
Sbjct  5    LRSDPPSRIYPEPETLEIDHFDRLPDAILLLVFNKIGDVKALGRCCVVSKRFHSLVPQVD  64

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            NVVVRVDCVISD+D SSPSS    +  A   +  P+S+I RLVF G++KP Q+L QF+  
Sbjct  65   NVVVRVDCVISDDDSSSPSSDKRRSVTAV--AAGPVSAIFRLVFGGIVKPIQALGQFLGT  122

Query  595  sprrvaassaL------EDGEFDQSSVTHHSPTQVLK  687
                  ASS+       +DGE  Q  VTHHSPTQVLK
Sbjct  123  KRSCATASSSSLSISGDDDGEIAQGGVTHHSPTQVLK  159



>ref|XP_010086997.1| hypothetical protein L484_005892 [Morus notabilis]
 gb|EXB25437.1| hypothetical protein L484_005892 [Morus notabilis]
Length=410

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 111/178 (62%), Gaps = 35/178 (20%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp  405
            M S+R DL+ RVYPEP    +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFH+LVP
Sbjct  1    MSSMRVDLTSRVYPEPDAMEIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHALVP  60

Query  406  qvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            QV+NVVVRV       D       +A+++++SDKSR   S++ RLV  G++KP Q+L QF
Sbjct  61   QVENVVVRV-------DCVISDDDSASSSSSSDKSRGSFSNLFRLVVGGIVKPLQALGQF  113

Query  586  Is------------------------asprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            ++                               A  +  DGEFDQ  VTHHSPTQVLK
Sbjct  114  LTPKRGSSSFSSSSSSSSSSSSGFGGGFGSSSLAVGSEADGEFDQGGVTHHSPTQVLK  171



>ref|XP_006449020.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 ref|XP_006449021.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 gb|ESR62260.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 gb|ESR62261.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
Length=418

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 114/179 (64%), Gaps = 39/179 (22%)
 Frame = +1

Query  241  GSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
            G VR D   RV+PEP+DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVDNV
Sbjct  3    GVVRVDPPSRVFPEPIDHFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNV  62

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasp  600
            VVRVDCVISD+          +++++S+KSR P S++ R VF G++KPFQ+L Q + A  
Sbjct  63   VVRVDCVISDD---------DSSSSSSEKSRSPFSNLFRYVFGGIVKPFQALGQLLGAKR  113

Query  601  rr------------------------------vaassaLEDGEFDQSSVTHHSPTQVLK  687
             +                                 SS+ +D E DQ  VTHHSPTQVLK
Sbjct  114  TQFHHNNQHLTTSGHAPAAFCASSSSGSGTTLSVGSSSADDEEMDQGGVTHHSPTQVLK  172



>ref|XP_006468035.1| PREDICTED: F-box protein At5g46170-like isoform X1 [Citrus sinensis]
 ref|XP_006468036.1| PREDICTED: F-box protein At5g46170-like isoform X2 [Citrus sinensis]
 gb|KDO75441.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
 gb|KDO75442.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
 gb|KDO75443.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
Length=417

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 114/179 (64%), Gaps = 39/179 (22%)
 Frame = +1

Query  241  GSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
            G VR D   RV+PEP+DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVDNV
Sbjct  3    GVVRVDPPSRVFPEPIDHFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNV  62

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasp  600
            VVRVDCVISD+          +++++S+KSR P S++ R VF G++KPFQ+L Q + A  
Sbjct  63   VVRVDCVISDD---------DSSSSSSEKSRSPFSNLFRYVFGGIVKPFQALGQLLGAKR  113

Query  601  rr------------------------------vaassaLEDGEFDQSSVTHHSPTQVLK  687
             +                                 SS+ +D E DQ  VTHHSPTQVLK
Sbjct  114  TQFHHNNQHLTTSGHAPAAFCASSSSGSGTTLSVGSSSADDEEMDQGGVTHHSPTQVLK  172



>gb|KJB69848.1| hypothetical protein B456_011G045900 [Gossypium raimondii]
 gb|KJB69849.1| hypothetical protein B456_011G045900 [Gossypium raimondii]
Length=399

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 108/167 (65%), Gaps = 24/167 (14%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M S+R D   R++PEP+DHFDRLPDSL+ LVFN IGDVKALGRCCVVS+RF SLVPQV+N
Sbjct  1    MSSLRSDPVHRIHPEPIDHFDRLPDSLLPLVFNKIGDVKALGRCCVVSRRFRSLVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRH--PISSILRLVFTGLLKPFQSLSQFI-  588
            VVVRV       D        + ++++ DKSR   PIS++LR++  G+ KPFQ+L QF+ 
Sbjct  61   VVVRV-------DCVISDDDCSPSSSSYDKSRAAGPISNLLRILLGGIAKPFQALVQFLG  113

Query  589  --------------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                           +S   V   + + DGE +Q  VTHHSPTQVL+
Sbjct  114  PKRPVINETLNTHPVSSSLSVGPGADVNDGEMEQGGVTHHSPTQVLR  160



>gb|KHG27594.1| hypothetical protein F383_11279 [Gossypium arboreum]
Length=411

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 108/167 (65%), Gaps = 24/167 (14%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M S+R D   R++PEP+DHFDRLPDSL+ LVFN IGDVKALGRCCVVS+RF SLVPQV+N
Sbjct  1    MSSLRSDPVYRIHPEPIDHFDRLPDSLLPLVFNKIGDVKALGRCCVVSRRFRSLVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRH--PISSILRLVFTGLLKPFQSLSQFI-  588
            VVVRV       D        + ++++ DKSR   PIS++LR++  G++KPFQ+L QF+ 
Sbjct  61   VVVRV-------DCVISDDDCSPSSSSYDKSRAAGPISNLLRILLGGIVKPFQALVQFLG  113

Query  589  --------------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                           +S   V   + +  GE +Q  VTHHSPTQVL+
Sbjct  114  PKRPVINETLNTHPVSSSLSVGPGADVNGGEMEQGGVTHHSPTQVLR  160



>ref|XP_009360916.1| PREDICTED: F-box protein At5g46170-like [Pyrus x bretschneideri]
 ref|XP_009360917.1| PREDICTED: F-box protein At5g46170-like [Pyrus x bretschneideri]
Length=436

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 119/168 (71%), Gaps = 21/168 (13%)
 Frame = +1

Query  238  MGSVRPDL--SCRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHS  396
            M SVR DL  S RVYPEP      DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHS
Sbjct  34   MSSVRSDLTFSSRVYPEPYSSVDDDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHS  93

Query  397  LvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            LVPQVDNVVVRVDCVISD+     S S+A+++++SDKSR P S++ RLV  G++KP Q+L
Sbjct  94   LVPQVDNVVVRVDCVISDD---DSSPSSASSSSSSDKSRAPFSALFRLVLGGIVKPLQAL  150

Query  577  SQFI-----------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             QF+           SA       SSA +    DQS VTHHSPTQVLK
Sbjct  151  GQFLGPNRRSPNGSHSALSVDDPDSSAADSNSLDQSGVTHHSPTQVLK  198



>ref|XP_011460217.1| PREDICTED: F-box protein At5g46170 [Fragaria vesca subsp. vesca]
Length=402

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 115/158 (73%), Gaps = 12/158 (8%)
 Frame = +1

Query  244  SVRPDLSC------RVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp  405
            S  PDL+       RVYPEP DHFDRLPDSL+LLVFN I DVKALGRCCVVS+RFHSLVP
Sbjct  14   SFYPDLTSSSSSSSRVYPEPSDHFDRLPDSLLLLVFNKIADVKALGRCCVVSRRFHSLVP  73

Query  406  qvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            QVD V+VRVDCVISD+   S SSS++++ ++SDKSR P SS++RLV  G++KP Q+L QF
Sbjct  74   QVDTVLVRVDCVISDD--DSTSSSSSSSPSSSDKSRAPFSSLVRLVLGGIVKPLQALGQF  131

Query  586  IsasprrvaassaLED---GEFDQS-SVTHHSPTQVLK  687
            +       + +    D    E DQ+  VTHHSPTQVLK
Sbjct  132  LGPRRSSSSLAVGTADETAAETDQAGGVTHHSPTQVLK  169



>gb|KJB68311.1| hypothetical protein B456_010G238100 [Gossypium raimondii]
Length=378

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 110/163 (67%), Gaps = 20/163 (12%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SV PD   R  PEPVDHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQV+N
Sbjct  1    MSSVYPD---RDQPEPVDHFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVEN  57

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            VVVRVDCVISD+D SS SSS+  + A       P S++ RLVF G++KP Q+L QF+   
Sbjct  58   VVVRVDCVISDDDCSSSSSSSDKSRALVG----PFSNLFRLVFGGIVKPLQALGQFLGPK  113

Query  598  prrvaassaL-------------EDGEFDQSSVTHHSPTQVLK  687
               +  +                +DGE D   VTHHSPTQVL+
Sbjct  114  RSVLNETLNSLSSSSLFVAPGVGDDGEMDHGGVTHHSPTQVLR  156



>gb|KHG06780.1| hypothetical protein F383_00742 [Gossypium arboreum]
Length=378

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 109/163 (67%), Gaps = 20/163 (12%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M SV PD      PEPVDHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQV+N
Sbjct  1    MSSVYPDPD---QPEPVDHFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVEN  57

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            VVVRVDCVISD+D SS SSS+  + A       P S++ RLVF G++KP Q+L QF+   
Sbjct  58   VVVRVDCVISDDDCSSSSSSSDKSRALVG----PFSNLFRLVFGGIVKPLQALGQFLGPK  113

Query  598  prrvaassaL-------------EDGEFDQSSVTHHSPTQVLK  687
               +  +                +DGE D   VTHHSPTQVL+
Sbjct  114  RSVLNETLNSLSSSSLFVAPGVGDDGEMDHGGVTHHSPTQVLR  156



>gb|AEX97082.1| F-box family protein [Malus domestica]
Length=403

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 117/168 (70%), Gaps = 21/168 (13%)
 Frame = +1

Query  238  MGSVRPDL--SCRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHS  396
            M SVR DL  S  VYPEP      DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHS
Sbjct  1    MSSVRSDLTFSSTVYPEPYSSVDDDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHS  60

Query  397  LvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            LVPQVDNVVVRVDCVISD+     S S+A+++++SDKSR P S++ RLV  G++KP Q+L
Sbjct  61   LVPQVDNVVVRVDCVISDD---DSSPSSASSSSSSDKSRAPFSALFRLVLGGIVKPLQAL  117

Query  577  SQFI-----------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             Q +           SA       SSA +    DQS VTHHSPTQVLK
Sbjct  118  GQLLGPNRRSPNGSHSALSVDDPDSSATDSNSLDQSGVTHHSPTQVLK  165



>ref|XP_008371620.1| PREDICTED: F-box protein At5g46170-like [Malus domestica]
Length=403

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 117/168 (70%), Gaps = 21/168 (13%)
 Frame = +1

Query  238  MGSVRPDL--SCRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHS  396
            M SVR DL  S  VYPEP      DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHS
Sbjct  1    MSSVRSDLTFSSTVYPEPYSSVDDDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHS  60

Query  397  LvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            LVPQVDNVVVRVDCVISD+     S S+A+++++SDKSR P S++ RLV  G++KP Q+L
Sbjct  61   LVPQVDNVVVRVDCVISDD---DSSPSSASSSSSSDKSRAPFSALFRLVLGGIVKPLQAL  117

Query  577  SQFI-----------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             Q +           SA       SSA +    DQS VTHHSPTQVLK
Sbjct  118  GQLLGPNRRSPNGSHSALSVDDPDSSATDSNSLDQSGVTHHSPTQVLK  165



>ref|XP_002519646.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42619.1| conserved hypothetical protein [Ricinus communis]
Length=414

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 109/178 (61%), Gaps = 28/178 (16%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLv  402
            M S R D + R+YPEP     +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLV
Sbjct  1    MTSFRSDPASRIYPEPQSLSAIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLV  60

Query  403  pqvdnvvv----rvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQ  570
            PQVDNVVV     +    +    SS  S ++ ++++S  S    SSI RLVF G++KPFQ
Sbjct  61   PQVDNVVVRVDCVISDDDTSPSSSSDKSRSSGSSSSSSSSSAGFSSIFRLVFGGIVKPFQ  120

Query  571  SLSQFI-----------------sasprrvaassaLED--GEFDQSSVTHHSPTQVLK  687
            +L QF+                   S    A S   ED  GE DQ  VTHHSPTQVLK
Sbjct  121  ALGQFLGPTRRDMLNPYPSSRNGLLSSSSSALSVGNEDDVGELDQGGVTHHSPTQVLK  178



>ref|XP_003593894.1| F-box family protein [Medicago truncatula]
 gb|AES64145.1| F-box plant-like protein [Medicago truncatula]
Length=389

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 106/167 (63%), Gaps = 27/167 (16%)
 Frame = +1

Query  238  MGSVRPDLS-CRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            M S+R D    R+YPEP     +DHFDR+PDSL+LLVFN IGDVKALGRCCVVS+RFHSL
Sbjct  1    MCSIRADQQPNRIYPEPSYFPQIDHFDRIPDSLLLLVFNKIGDVKALGRCCVVSRRFHSL  60

Query  400  vpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLS  579
            VPQV+NVVVRV       D       + ++  +SDKSR P  ++LRLVF G+ KP Q+L 
Sbjct  61   VPQVENVVVRV-------DCVISDDDSNSSVNSSDKSRGPFWNLLRLVFGGIAKPIQTLG  113

Query  580  QFIsasprrvaassaL-----------EDGEFDQSSVTHHSPTQVLK  687
            QF+       ++ ++            EDG+     VTHHSPTQVLK
Sbjct  114  QFLGPKRGSNSSVNSGSGSSPLAVGSEEDGD---GGVTHHSPTQVLK  157



>ref|XP_008371786.1| PREDICTED: F-box protein At5g46170-like [Malus domestica]
Length=402

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 118/168 (70%), Gaps = 22/168 (13%)
 Frame = +1

Query  238  MGSVRPDL--SCRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHS  396
            M S+R DL  S RVYPEP      D FD +PDSL+LLVFN IGDVKALGRCCVVS+RFHS
Sbjct  1    MSSLRSDLTFSSRVYPEPYSSVDDDLFDLIPDSLLLLVFNKIGDVKALGRCCVVSRRFHS  60

Query  397  LvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            LVPQV+NVVVRVDCVISD+     SS +A+++++SDKSR P S++ RLV +G++KP Q+L
Sbjct  61   LVPQVENVVVRVDCVISDD----DSSPSASSSSSSDKSRTPFSALFRLVLSGIVKPLQAL  116

Query  577  SQFI-----------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             QF+           SA       SSA +    DQS VTHHSPTQVLK
Sbjct  117  GQFLGPNRRSPNGSHSALAVDDPDSSAADSNSLDQSGVTHHSPTQVLK  164



>emb|CDY33458.1| BnaA06g36150D [Brassica napus]
Length=360

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 101/149 (68%), Gaps = 13/149 (9%)
 Frame = +1

Query  247  VRPDLSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
             R D   R++PEP   DHFD LPDS++LLVFN I DVK+LGRCCVVS+RFHSLV QV+NV
Sbjct  2    ARSDPPSRIHPEPRQTDHFDHLPDSILLLVFNKISDVKSLGRCCVVSRRFHSLVTQVENV  61

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasp  600
            ++RVDCVISD+      +S+ ++  +   +  P S++ RLV  G++KP Q+L QF+ A  
Sbjct  62   LIRVDCVISDD-----DNSSLSSIKSRSAASAPFSNLFRLVVGGIVKPLQALGQFLGARR  116

Query  601  rrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                     E GE +Q  VTHHSPTQVLK
Sbjct  117  SGD------EGGEIEQGGVTHHSPTQVLK  139



>ref|XP_006414111.1| hypothetical protein EUTSA_v10025383mg [Eutrema salsugineum]
 gb|ESQ55564.1| hypothetical protein EUTSA_v10025383mg [Eutrema salsugineum]
Length=397

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 102/168 (61%), Gaps = 28/168 (17%)
 Frame = +1

Query  247  VRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            +R D   R++PEP    +DHFD LPDS++LLVFN IGDVKALGRCCVVSKRFHSLVPQV+
Sbjct  5    LRSDPLSRIHPEPQTLEIDHFDHLPDSILLLVFNKIGDVKALGRCCVVSKRFHSLVPQVE  64

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKS--RHPISSILRLVFTGLLKPFQSLSQFI  588
            NVVVRV       D       +++ +    +S    P S+I RLVF G+ KP Q+L Q +
Sbjct  65   NVVVRV-------DCVISDDDSSSLSPDKPRSAVSGPFSAIFRLVFGGIFKPLQALGQLL  117

Query  589  sasprrvaassaL---------------EDGEFDQSSVTHHSPTQVLK  687
             +     A+SSA                EDGE +   VTHHSPTQVLK
Sbjct  118  GSKRSSSASSSASSSSSSSSSSLLISGGEDGEIEHGGVTHHSPTQVLK  165



>ref|XP_011007418.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
Length=405

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 114/171 (67%), Gaps = 24/171 (14%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKR  387
            M S+RPD + R++PEP          +DHFDRLPDSL+LLVFN IGDVKALGRCCVV  R
Sbjct  1    MSSLRPDPTSRIHPEPEPTTTTSSLSIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVCHR  60

Query  388  FHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPF  567
            FHSLVPQVDNVVVRVDCVISD+     SSS+++  + S  S    SSI RLVF G++KPF
Sbjct  61   FHSLVPQVDNVVVRVDCVISDD---DTSSSSSSTKSHSPSSSSGFSSIFRLVFGGIVKPF  117

Query  568  QSLSQ-----------FIsasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            Q+L Q           F ++S      ++  +D E DQ  VTHHSPTQVLK
Sbjct  118  QALGQLLGPKVNSRNGFFNSSLSVGTTTTTDDDTEADQGGVTHHSPTQVLK  168



>ref|XP_012072137.1| PREDICTED: F-box protein At5g46170-like [Jatropha curcas]
 gb|KDP37998.1| hypothetical protein JCGZ_04641 [Jatropha curcas]
Length=429

 Score =   105 bits (263),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 113/186 (61%), Gaps = 39/186 (21%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp  405
            M S R D + R+YPEP    +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVP
Sbjct  1    MTSFRSDPTSRIYPEPESLSIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVP  60

Query  406  qvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
            QVDNVVVRVDCVISD+     S S+++  + S  S    SS+ RLVF G++KPFQ+L Q 
Sbjct  61   QVDNVVVRVDCVISDD---DSSPSSSSEKSRSSGSSSGFSSLFRLVFGGIVKPFQALGQL  117

Query  586  IsasprrvaassaL--------------------------------EDGEFDQSSVTHHS  669
            +      + + S+                                 +DGE DQ  VTHHS
Sbjct  118  LGPRREMLNSYSSRNSLFSSSSSYSSSSFSSTSAASSSSSLFVGNEDDGEMDQGGVTHHS  177

Query  670  PTQVLK  687
            PTQVLK
Sbjct  178  PTQVLK  183


 Score = 29.3 bits (64),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++FNEI+ LRIELPS
Sbjct  178  PTQVLKNFNEIRFLRIELPS  197



>ref|XP_010441616.1| PREDICTED: F-box protein At5g46170-like [Camelina sativa]
Length=389

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 106/160 (66%), Gaps = 18/160 (11%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            NVVVRVDCVISD+     SSS  +  + S  S    S+I RLVF G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVISDD----DSSSLLSIKSRSAASSGSFSAIFRLVFGGIVKPLQALGQFLGT  122

Query  595  sprrvaassaL---------EDGEFDQSSVTHHSPTQVLK  687
                   S +          E GE +Q  VTHHSPTQVLK
Sbjct  123  KRPSCGGSGSSSLSISGGDDEGGEIEQGGVTHHSPTQVLK  162



>gb|KHG16115.1| hypothetical protein F383_22310 [Gossypium arboreum]
Length=432

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 112/163 (69%), Gaps = 18/163 (11%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M  VR D   R +P P+DHFDRLPDSL+LL+FN IGDVKALGRCC+VS+RFHSLVPQV+N
Sbjct  1    MCPVRSDPIHRFHPLPLDHFDRLPDSLLLLIFNKIGDVKALGRCCLVSRRFHSLVPQVEN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIs--  591
            V+VRVDCVISD+D S  SSS+  +  A      P S++LRLVF G++KP Q+L QF+   
Sbjct  61   VLVRVDCVISDDDSSPSSSSSDKSCPAG-----PFSNLLRLVFGGIVKPLQALGQFLGPK  115

Query  592  -----------asprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                       ++   V  ++  +D E  Q+ VTHHSPTQVL+
Sbjct  116  RSLLDETLSAPSTSSSVGRAADDDDPEMGQTGVTHHSPTQVLR  158



>ref|XP_009101540.1| PREDICTED: F-box protein At5g46170 [Brassica rapa]
Length=374

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 107/157 (68%), Gaps = 15/157 (10%)
 Frame = +1

Query  247  VRPDLSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
             R D   R++PEP  +DHFD LPDS++LLVFN I DVK+LGRCCVVS+RFHSLV QV+NV
Sbjct  2    ARSDPPSRIHPEPQRIDHFDHLPDSILLLVFNKISDVKSLGRCCVVSRRFHSLVTQVENV  61

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasp  600
            ++RVDCVISD+      +S+ ++  +   +  P S++ RLV  G++KP Q+L QF+ A  
Sbjct  62   LIRVDCVISDD-----DNSSLSSIKSRSAASGPFSNLFRLVVGGIVKPLQALGQFLGARR  116

Query  601  rrvaassaL--------EDGEFDQSSVTHHSPTQVLK  687
               ++SS+         E GE +Q  VTHHSPTQVLK
Sbjct  117  SCGSSSSSSSSLSISGDEGGEIEQGGVTHHSPTQVLK  153



>ref|XP_007212265.1| hypothetical protein PRUPE_ppa006658mg [Prunus persica]
 gb|EMJ13464.1| hypothetical protein PRUPE_ppa006658mg [Prunus persica]
Length=401

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 118/166 (71%), Gaps = 19/166 (11%)
 Frame = +1

Query  238  MGSVRPDL-SCRVYPEPV----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLv  402
            M S+R DL S RVYPEP     D FDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLV
Sbjct  1    MSSLRSDLTSSRVYPEPSYMDDDLFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLV  60

Query  403  pqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQ  582
            PQV+NVVVRVDCVISD+     S S+A+++++SDKSR P S++ RLV  G++KP Q+L Q
Sbjct  61   PQVENVVVRVDCVISDD---ESSPSSASSSSSSDKSRTPFSALFRLVIGGIVKPLQALGQ  117

Query  583  FIs-----------asprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            F+            A       SSA +   FDQS VTHHSPTQVLK
Sbjct  118  FLGPTRRSTNGAHPALAVDDPDSSAADSSSFDQSGVTHHSPTQVLK  163



>ref|XP_008225507.1| PREDICTED: F-box protein At5g46170-like [Prunus mume]
Length=402

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 119/167 (71%), Gaps = 20/167 (12%)
 Frame = +1

Query  238  MGSVRPDL--SCRVYPEPV----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            M S+R DL  S RVYPEP     D FDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSL
Sbjct  1    MSSLRSDLTTSSRVYPEPSYMDDDLFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSL  60

Query  400  vpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLS  579
            VPQV+NVVVRVDCVISD+     S S+A+++++SDKSR P S++ RLV  G++KP Q+L 
Sbjct  61   VPQVENVVVRVDCVISDD---ESSPSSASSSSSSDKSRTPFSALFRLVLGGIVKPLQALG  117

Query  580  QFI-----------sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            QF+           SA       SSA +   FDQS VTHHSPTQVLK
Sbjct  118  QFLGPTRRSTNGSHSALAVDDPDSSAADSSSFDQSGVTHHSPTQVLK  164



>ref|XP_006279647.1| hypothetical protein CARUB_v10026571mg [Capsella rubella]
 gb|EOA12545.1| hypothetical protein CARUB_v10026571mg [Capsella rubella]
Length=388

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 106/159 (67%), Gaps = 17/159 (11%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            NVVVRVDCVISD+     SSS ++  + S  S    S+I RLV  G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVISDD----DSSSLSSIKSRSAASAGSFSAIFRLVVGGIVKPLQALGQFLGT  122

Query  595  sprrvaassaL--------EDGEFDQSSVTHHSPTQVLK  687
                   S +         E GE +Q  VTHHSPTQVLK
Sbjct  123  KRSSCGGSGSSSLSISGDDEGGEIEQGGVTHHSPTQVLK  161



>ref|XP_002317281.1| F-box family protein [Populus trichocarpa]
 gb|EEE97893.1| F-box family protein [Populus trichocarpa]
Length=405

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 114/171 (67%), Gaps = 24/171 (14%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP----------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKR  387
            M S+RPD + R++PEP          +DHFDRLPDSL+LLVFN IGDVKALGRCCVV  R
Sbjct  1    MSSLRPDPTSRIHPEPEPTTTTSSPSIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVCLR  60

Query  388  FHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPF  567
            FHSLVPQVDNVVVRVDCVISD+     SSS+++  + S  S    SSI RLVF G++KPF
Sbjct  61   FHSLVPQVDNVVVRVDCVISDD---DTSSSSSSTKSHSPSSSSGFSSIFRLVFGGIVKPF  117

Query  568  QSLSQ-----------FIsasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            Q L Q           F+++S      +S  +D E DQ  VTHHSPTQVLK
Sbjct  118  QVLGQLLGPKVNSRNGFLNSSLSVGTTTSTDDDTEPDQGGVTHHSPTQVLK  168



>ref|XP_002863421.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39680.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 106/160 (66%), Gaps = 18/160 (11%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            NVVVRVDCVISD+     SSS ++  + S  S    S+I RLV  G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVISDD----DSSSLSSIKSRSGSSAGSFSAIFRLVVGGIVKPLQALGQFLGT  122

Query  595  sprrvaassaL---------EDGEFDQSSVTHHSPTQVLK  687
                   S +          E GE +Q  VTHHSPTQVLK
Sbjct  123  KRSSCGGSGSSSSLSISGDDEGGEIEQGGVTHHSPTQVLK  162



>ref|XP_010494785.1| PREDICTED: F-box protein At5g46170-like [Camelina sativa]
Length=389

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 106/160 (66%), Gaps = 18/160 (11%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            NVVVRVDCVISD+     SSS ++  + S  S    S+I RLV  G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVISDD----DSSSLSSIKSRSAASSGSFSAIFRLVVGGIVKPLQALGQFLGT  122

Query  595  sprrvaassaL---------EDGEFDQSSVTHHSPTQVLK  687
                   S +          E GE +Q  VTHHSPTQVLK
Sbjct  123  KRSSCGGSGSSSLSISGGDDEGGEIEQGGVTHHSPTQVLK  162



>emb|CDX99890.1| BnaC05g23120D [Brassica napus]
Length=367

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 106/152 (70%), Gaps = 12/152 (8%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R +   R++PEP     +DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRSEPVSRIHPEPQPLDDIDHFDHLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIs  591
            +NV+VRVDCVISD+D    S + A+ + A   +    S++ RLVF  + KPFQ+L QF+ 
Sbjct  65   ENVLVRVDCVISDDDDRRFSLNTASISDA--SAGGSFSALFRLVFAPIFKPFQALGQFL-  121

Query  592  asprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                   + S+LED E DQS VTHHSPTQVLK
Sbjct  122  ---GPRRSLSSLED-ETDQSGVTHHSPTQVLK  149



>ref|XP_010481487.1| PREDICTED: F-box protein At5g46170 [Camelina sativa]
Length=388

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 106/159 (67%), Gaps = 17/159 (11%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFDRLPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            NVVVRVDCVISD+     SSS ++  + S  S    S+I RLV  G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVISDD----DSSSLSSIKSRSAASSGSFSAIFRLVVGGIVKPLQALGQFLGT  122

Query  595  sprrvaassaL--------EDGEFDQSSVTHHSPTQVLK  687
                   S +         + GE +Q  VTHHSPTQVLK
Sbjct  123  KRSSCGGSGSSSLSISGDDDGGEIEQGGVTHHSPTQVLK  161



>gb|KJB66946.1| hypothetical protein B456_010G167400 [Gossypium raimondii]
 gb|KJB66947.1| hypothetical protein B456_010G167400 [Gossypium raimondii]
Length=392

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 107/163 (66%), Gaps = 18/163 (11%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            M  VR D   R +  P+DHFDRLPDSL+LL+FN IGDVKALGRCC+VS+RFHSLVPQVDN
Sbjct  1    MCPVRSDPIHRFHSLPLDHFDRLPDSLLLLIFNKIGDVKALGRCCLVSRRFHSLVPQVDN  60

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            V+VRVDCVISD+      SS +++++   +   P S++LRLVF  ++KP Q+L QF+   
Sbjct  61   VLVRVDCVISDD-----DSSPSSSSSDKSRPAGPFSNLLRLVFGCIVKPLQALGQFLGPK  115

Query  598  prrvaassaL-------------EDGEFDQSSVTHHSPTQVLK  687
               +  +                +D E  Q+ VTHHSPTQVL+
Sbjct  116  RSLLNETVNAPSSSSSVGGGADDDDAEMGQAGVTHHSPTQVLR  158



>ref|XP_011035442.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
 ref|XP_011035443.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
Length=394

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 101/148 (68%), Gaps = 9/148 (6%)
 Frame = +1

Query  262  SCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcv  441
            SC      +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS+RFHSLVPQVDNVVVRVDCV
Sbjct  22   SCFCSSSKIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVVVRVDCV  81

Query  442  isdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprr-----  606
            ISD+      SS+++  + S  S    SSI RLVF G+ KPFQ+LSQ             
Sbjct  82   ISDD---DTPSSSSSIKSHSSSSSSGFSSIFRLVFGGISKPFQALSQMFGPKVNSRNGNG  138

Query  607  -vaassaLEDGEFDQSSVTHHSPTQVLK  687
               + +  +D E DQ+ VTHHSPTQVLK
Sbjct  139  PSLSVATDDDMELDQAGVTHHSPTQVLK  166



>ref|XP_009115183.1| PREDICTED: F-box protein At1g30200 [Brassica rapa]
 emb|CDY26286.1| BnaA09g26370D [Brassica napus]
Length=374

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 97/157 (62%), Gaps = 15/157 (10%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +RPD   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRPDPVSRIHPEPQPSDDTDHFDHLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvv-----vrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            +NV+     V  D   S         S   A+ +   +    S++ RLVF  + KPFQ+L
Sbjct  65   ENVLVRVDCVISDDDSSASGDDDRRFSLNTASISDASAGGSFSALFRLVFAPIFKPFQAL  124

Query  577  SQFIsasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             QF+        +SS+LED E DQS VTHHSPTQVLK
Sbjct  125  GQFL----GPRRSSSSLED-EVDQSGVTHHSPTQVLK  156



>ref|XP_010687117.1| PREDICTED: F-box protein At4g18380 [Beta vulgaris subsp. vulgaris]
 ref|XP_010687118.1| PREDICTED: F-box protein At4g18380 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 111/186 (60%), Gaps = 43/186 (23%)
 Frame = +1

Query  238  MGSVRPDLS--CRVYPEP-------------------VDHFDRLPDSLILLVFNMIGDVK  354
            M S R DL+   R+YPEP                   VDHFDRLPDS++LLVFN IGDVK
Sbjct  1    MSSFRADLTTTARIYPEPFLDYSSSSSSNNNNSVIDGVDHFDRLPDSVLLLVFNKIGDVK  60

Query  355  ALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSIL  534
            ALGRCCVVS+RF +LVPQV+NVVVRV       D       +++AA+++DKSR P ++++
Sbjct  61   ALGRCCVVSRRFQTLVPQVENVVVRV-------DCVISDDDSSSAASSADKSRSPFANLV  113

Query  535  RLVFTGLLKPFQSLSQFI---------------sasprrvaassaLEDGEFDQSSVTHHS  669
            RL+F  + KP Q+L  F+               S+S   +   + ++D E +Q  VTHHS
Sbjct  114  RLIFGNIFKPLQALGHFLGPKRSGPGAALVTGPSSSSASLLVGNGVDDEEGEQGGVTHHS  173

Query  670  PTQVLK  687
            PTQVLK
Sbjct  174  PTQVLK  179



>emb|CDP21114.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            MGS+R DLS +++PEPVDHFDRLPDSL+LLVFN IGDVKALGRCC+VS+RFH+L
Sbjct  1    MGSIRADLSTKIFPEPVDHFDRLPDSLLLLVFNKIGDVKALGRCCLVSRRFHTL  54



>emb|CDX77641.1| BnaC07g18950D [Brassica napus]
Length=362

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 95/150 (63%), Gaps = 25/150 (17%)
 Frame = +1

Query  250  RPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            R D   R++PEP    +DHFD LPDS++LLVFN I DVK+LGRCCVVS+RFHSLV QV+N
Sbjct  6    RSDPPSRIHPEPQTLGIDHFDHLPDSILLLVFNKISDVKSLGRCCVVSRRFHSLVTQVEN  65

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            V++RVDCVI     S   +S+ ++  +   +  P SSI RLV  G++KP Q+        
Sbjct  66   VLIRVDCVI-----SDDDNSSLSSIKSRSSASGPFSSIFRLVVGGIVKPLQAGD------  114

Query  598  prrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                      E GE +Q  VTHHSPTQVLK
Sbjct  115  ----------EGGEIEQGGVTHHSPTQVLK  134



>ref|XP_006283811.1| hypothetical protein CARUB_v10004910mg, partial [Capsella rubella]
 gb|EOA16709.1| hypothetical protein CARUB_v10004910mg, partial [Capsella rubella]
Length=418

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 108/165 (65%), Gaps = 31/165 (19%)
 Frame = +1

Query  268  RVYPEP------VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvr  429
            R++PEP      +DHFD LPDS++LL+FN IGDVK+LGRCCVVSKRFHSL+PQV+NVVVR
Sbjct  34   RIHPEPEPLKQQIDHFDHLPDSILLLIFNNIGDVKSLGRCCVVSKRFHSLIPQVENVVVR  93

Query  430  vdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrv  609
            VDCVISD+DGSS  S    + A+   +  P S++ RL    ++KP Q+L QF+  S    
Sbjct  94   VDCVISDDDGSSIVSDKPRSVASVAAT--PFSALYRL----MIKPLQALGQFLKRSGSAS  147

Query  610  aassaL-------------------EDGEFDQSSVTHHSPTQVLK  687
            ++SS+                    +DGE +Q  VTHHSPTQVLK
Sbjct  148  SSSSSSSSSSASSSSPSSLLISGGGDDGEIEQGGVTHHSPTQVLK  192



>ref|XP_002305042.1| hypothetical protein POPTR_0004s06450g [Populus trichocarpa]
 ref|XP_006384083.1| F-box family protein [Populus trichocarpa]
 gb|EEE85553.1| hypothetical protein POPTR_0004s06450g [Populus trichocarpa]
 gb|ERP61880.1| F-box family protein [Populus trichocarpa]
Length=398

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 102/148 (69%), Gaps = 10/148 (7%)
 Frame = +1

Query  262  SCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcv  441
            SC      +DHFDRLPDSL+L VFN IGDVKALGRCCVVS+RFHSLVPQVDNVVVRVDCV
Sbjct  24   SCFCSSSKIDHFDRLPDSLLLFVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVVVRVDCV  83

Query  442  isdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprr-----  606
            ISD+     +SS++++  +   S    SSI RLVF G+ KPFQ+LSQ             
Sbjct  84   ISDD----DTSSSSSSIKSHSSSSSGFSSIFRLVFGGISKPFQALSQMFGTKVNSRNGNG  139

Query  607  -vaassaLEDGEFDQSSVTHHSPTQVLK  687
               + +A +D E DQ+ VTHHSPTQVLK
Sbjct  140  PSLSVAADDDMELDQAGVTHHSPTQVLK  167



>ref|XP_004486009.1| PREDICTED: F-box protein At5g46170-like [Cicer arietinum]
Length=402

 Score = 95.1 bits (235),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 103/171 (60%), Gaps = 28/171 (16%)
 Frame = +1

Query  238  MGSVRPDLSC-----RVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRF  390
            M S+R D S      R+YPEP    +DHFDR+PDSL+LLVFN I DVKALGRCCVVS+RF
Sbjct  1    MCSLRSDQSLLSPTNRIYPEPYFPQIDHFDRIPDSLLLLVFNKIADVKALGRCCVVSRRF  60

Query  391  HSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQ  570
            HSLVPQV+NV+VRV       D       ++++ A+SDKSR P  ++LRLVF G+ KP Q
Sbjct  61   HSLVPQVENVLVRV-------DCVISDEDSSSSTASSDKSRGPFWNLLRLVFGGIAKPIQ  113

Query  571  SLSQFIsasprrvaassaLEDGEFDQSSV------------THHSPTQVLK  687
            +L QF+         +        + S +            THHSPTQVLK
Sbjct  114  TLGQFLGPKRPSSNLNLTSSSSNSNSSPLTVGTDDDGDGGVTHHSPTQVLK  164


 Score = 31.6 bits (70),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++FNEI+LLRIELPS
Sbjct  159  PTQVLKNFNEIRLLRIELPS  178



>ref|NP_199429.1| F-box protein [Arabidopsis thaliana]
 sp|Q9FNK5.1|FB285_ARATH RecName: Full=F-box protein At5g46170 [Arabidopsis thaliana]
 dbj|BAB08262.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL49842.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13195.1| unknown protein [Arabidopsis thaliana]
 gb|AED95349.1| F-box protein [Arabidopsis thaliana]
Length=395

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 105/163 (64%), Gaps = 21/163 (13%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++PEP     +DHFD LPDS++LLVFN IGDVKALGRCCVVS+RFHSLVPQVD
Sbjct  7    RSDPPSRIHPEPPQTLEIDHFDHLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVD  66

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            NVVVRVDCVISD+     SSS ++  + S  S    S+I RLV  G++KP Q+L QF+  
Sbjct  67   NVVVRVDCVISDD----DSSSLSSIKSRSGSSAGSFSAIFRLVVGGIVKPLQALGQFLGT  122

Query  595  sprrvaassaL------------EDGEFDQSSVTHHSPTQVLK  687
                 +   +             + GE +Q  VTHHSPTQVLK
Sbjct  123  KRSSSSCGGSGSSSSSLSISGDDDGGEIEQGGVTHHSPTQVLK  165



>ref|XP_006398302.1| hypothetical protein EUTSA_v10000919mg [Eutrema salsugineum]
 gb|ESQ39755.1| hypothetical protein EUTSA_v10000919mg [Eutrema salsugineum]
Length=387

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 108/160 (68%), Gaps = 18/160 (11%)
 Frame = +1

Query  250  RPDLSCRVYPEP----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn  417
            R D   R++PEP    +DHFDRLPDS++LLVFN IGDVK+LGRCCVVS+RFHSLVPQV+N
Sbjct  6    RSDPPSRIHPEPQILEIDHFDRLPDSILLLVFNKIGDVKSLGRCCVVSRRFHSLVPQVEN  65

Query  418  vvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas  597
            +VVRVDCVIS       SSS ++  + S  S    S++ RLV  G++KP Q+L QF+   
Sbjct  66   IVVRVDCVIS----DDDSSSLSSIKSRSAASAGSFSAMFRLVVGGIVKPLQALGQFLGTK  121

Query  598  prrvaassaL---------EDG-EFDQSSVTHHSPTQVLK  687
                +ASS+          E G E +QS VTHHSPTQVLK
Sbjct  122  RPCGSASSSSSSSLSISGDEGGEEIEQSGVTHHSPTQVLK  161



>ref|XP_010517545.1| PREDICTED: F-box protein At4g18380 [Camelina sativa]
Length=391

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 106/159 (67%), Gaps = 25/159 (16%)
 Frame = +1

Query  268  RVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdc  438
            R++PEP   +DHFD LPDS++LL+FN IGDVK+LGRCCVVSKRFHSL+PQV+NVVVRVDC
Sbjct  13   RIHPEPEQQIDHFDHLPDSILLLIFNNIGDVKSLGRCCVVSKRFHSLIPQVENVVVRVDC  72

Query  439  visdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaas  618
            VISD+D SS  S    + A+   +  P S+I RLV    +KP Q+L QF+  S    ++S
Sbjct  73   VISDDDSSSLVSDKPRSVASVAAT--PFSAIFRLV----IKPLQALGQFLKRSGSSSSSS  126

Query  619  saL----------------EDGEFDQSSVTHHSPTQVLK  687
            ++                  DGE +Q  VTHHSPTQVLK
Sbjct  127  ASSASSSSSSASSLLISGGSDGEIEQGGVTHHSPTQVLK  165



>ref|XP_010538256.1| PREDICTED: F-box protein At1g30200-like [Tarenaya hassleriana]
Length=384

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 95/166 (57%), Gaps = 24/166 (14%)
 Frame = +1

Query  253  PDLSCRVYPE--------PVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpq  408
            PD   R++PE         VDHFDRLPDSLILLV   I DVK LGRCC+VS+RFHSLVP 
Sbjct  7    PDHISRLHPESVQALDSAAVDHFDRLPDSLILLVLEKIADVKVLGRCCLVSRRFHSLVPL  66

Query  409  vdnv------vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQ  570
             +NV      V+  D   S ED  S +   A    +       +S++ R+VF  + KPFQ
Sbjct  67   AENVLVCVDCVISDDDSSSAEDPGSSAFGDAVVGGS-------LSALFRVVFGPIFKPFQ  119

Query  571  SLSQFIsasprrvaassaLED---GEFDQSSVTHHSPTQVLKILTK  699
            +L QF+      + +SS  ED   GE +Q  VTHHSPTQVL+   K
Sbjct  120  ALGQFLGPKRSYLRSSSFGEDNGRGEIEQGEVTHHSPTQVLRNFNK  165



>ref|XP_004134599.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 gb|KGN49409.1| hypothetical protein Csa_6G523990 [Cucumis sativus]
Length=407

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 93/147 (63%), Gaps = 21/147 (14%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPDSL+LL+FN IGDVKALGRCC VS+RFHS+V QVDNVVVRV       D    
Sbjct  34   DHFDRLPDSLLLLIFNRIGDVKALGRCCAVSRRFHSIVSQVDNVVVRV-------DCVIS  86

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaL-------  627
                ++A+++SDKSR   S++ R+V  G++KP Q+L QF+       +   +        
Sbjct  87   DDDFSSASSSSDKSRSGFSNLFRMVLGGIVKPLQALGQFLGPKRVTSSGLGSASSSLSTS  146

Query  628  -------EDGEFDQSSVTHHSPTQVLK  687
                   EDGE  QS VTHHSPTQVLK
Sbjct  147  SLAVGREEDGESGQSGVTHHSPTQVLK  173



>ref|XP_008439618.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
Length=407

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 93/147 (63%), Gaps = 21/147 (14%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPDSL+LL+FN IGDVKALGRCC VS+RFHS+V QVDNVVVRV       D    
Sbjct  34   DHFDRLPDSLLLLIFNRIGDVKALGRCCAVSRRFHSIVSQVDNVVVRV-------DCVIS  86

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaL-------  627
                ++A++ASDKSR   S++ R+V  G++KP Q+L QF+       +   +        
Sbjct  87   DDDFSSASSASDKSRSGFSNLFRMVLGGIVKPLQALGQFLGPKRVTSSGLGSASSSLSTS  146

Query  628  -------EDGEFDQSSVTHHSPTQVLK  687
                   EDGE  QS VTHHSPTQVLK
Sbjct  147  SLAVGRDEDGESGQSGVTHHSPTQVLK  173



>ref|XP_009131656.1| PREDICTED: F-box protein At4g18380 [Brassica rapa]
Length=377

 Score = 93.2 bits (230),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 101/160 (63%), Gaps = 23/160 (14%)
 Frame = +1

Query  250  RPDLSCRVYPEPVD---HFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
            R D   R++PEP+D    FD LPDS++LLVFN IGDVKALGRC VVSKRFHSLVPQV+NV
Sbjct  6    RSDPLSRIHPEPLDPPDFFDHLPDSILLLVFNRIGDVKALGRCGVVSKRFHSLVPQVENV  65

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasp  600
            VVRVDCVISD+        ++ +      S  P S+I RL+F    KP  +L+Q +S   
Sbjct  66   VVRVDCVISDD-----DDPSSLSPDKPRSSASPFSAIFRLIF----KPLHALTQLLSTKR  116

Query  601  rrvaassaL-----------EDGEFDQSSVTHHSPTQVLK  687
               ++SS             EDGE +Q  VTHHSPTQVLK
Sbjct  117  SSSSSSSPSPSSSLSITGGGEDGEIEQGGVTHHSPTQVLK  156


 Score = 30.4 bits (67),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++FNEI+LLRIELP+
Sbjct  151  PTQVLKNFNEIRLLRIELPA  170



>gb|KHN06964.1| F-box protein [Glycine soja]
Length=166

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  238  MGSVRPDLSCRVYPEP-VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            M S R DL+CR++PEP +DHFDRLPDSL+LLVFN IGDVKALGRCCVVS  FHSL
Sbjct  1    MSSQRADLACRIFPEPEIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSCHFHSL  55



>ref|XP_010052048.1| PREDICTED: F-box protein At5g46170 [Eucalyptus grandis]
 gb|KCW75903.1| hypothetical protein EUGRSUZ_D00284 [Eucalyptus grandis]
 gb|KCW75904.1| hypothetical protein EUGRSUZ_D00284 [Eucalyptus grandis]
Length=407

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 94/142 (66%), Gaps = 17/142 (12%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPDSL+LL+FN + DVKALGRC  VS+RF  LVPQVD V+VRVDCVISD++    
Sbjct  44   DHFDRLPDSLLLLIFNRVADVKALGRCGAVSRRFRQLVPQVDAVLVRVDCVISDDE----  99

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLE------  630
                +A+ A SDK R P++S +R V   ++KP Q+L  F   + R  A +S+        
Sbjct  100  ----SASPALSDKGRGPLASFVRAVLGNIVKPLQALGLFSGGARRAQAGASSSSSSLAVG  155

Query  631  ---DGEFDQSSVTHHSPTQVLK  687
               DGE DQ  VTHHSPTQVLK
Sbjct  156  SECDGEADQGGVTHHSPTQVLK  177



>ref|NP_193573.1| F-box protein [Arabidopsis thaliana]
 ref|NP_001190761.1| F-box protein [Arabidopsis thaliana]
 sp|O49508.1|FB237_ARATH RecName: Full=F-box protein At4g18380 [Arabidopsis thaliana]
 emb|CAA16718.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78840.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABL66803.1| At4g18380 [Arabidopsis thaliana]
 gb|AEE84037.1| F-box protein [Arabidopsis thaliana]
 gb|AEE84038.1| F-box protein [Arabidopsis thaliana]
Length=380

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 99/154 (64%), Gaps = 19/154 (12%)
 Frame = +1

Query  259  LSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrv  432
            L  R++PEP  +DHFD LPDS++LL+FN IGDVKALGRC VVSKRFHSL+PQV+NV VRV
Sbjct  11   LLSRIHPEPQEIDHFDNLPDSILLLIFNNIGDVKALGRCSVVSKRFHSLIPQVENVFVRV  70

Query  433  dcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrva  612
            DCVIS       SSS  +    S  +  P S+I RLVF    KP Q+L QF+  S     
Sbjct  71   DCVIS----DDDSSSLLSDKPRSASAASPFSAIFRLVF----KPLQALGQFLKRSGSSSL  122

Query  613  assaL---------EDGEFDQSSVTHHSPTQVLK  687
             S +          +DGE +Q  VTHHSPTQVLK
Sbjct  123  PSGSSPSSLLISGGDDGEIEQGGVTHHSPTQVLK  156



>ref|XP_010923814.1| PREDICTED: F-box protein At5g46170-like [Elaeis guineensis]
Length=401

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +DHFDRLPDS++LLVFN IGDVK LGRCCVV +RF +L   V + VV     +  +D + 
Sbjct  38   IDHFDRLPDSVLLLVFNRIGDVKVLGRCCVVCRRFQAL-VPVVDDVVVRVDCVISDDATP  96

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFD  645
             S++AAA     DK R  +S + RLV  GL+KP Q+L Q + ++      SSA       
Sbjct  97   SSAAAAAGGCGPDKGRGVLSHLARLVLDGLVKPLQALGQMLISASGASRRSSASSASSSS  156

Query  646  QSSVTHHSPTQVLK  687
             S V+HHSPT+VLK
Sbjct  157  SSEVSHHSPTEVLK  170



>ref|XP_002870048.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46307.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=386

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 102/157 (65%), Gaps = 22/157 (14%)
 Frame = +1

Query  259  LSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrv  432
            L  R++P+P  +DHFD LPDS++LL+FN IGDVKALGRC VVSKRFHSL+PQV+NVVVRV
Sbjct  11   LLSRIHPQPQHIDHFDHLPDSILLLIFNNIGDVKALGRCSVVSKRFHSLIPQVENVVVRV  70

Query  433  dcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrva  612
            DCVISD+D SS  S    +      +  P S+I RLVF    KP Q+L QF+  S    +
Sbjct  71   DCVISDDDSSSLISDKPRSV----AAATPFSAIFRLVF----KPLQALGQFLKRSGSASS  122

Query  613  ------------assaLEDGEFDQSSVTHHSPTQVLK  687
                        +    +DGE +Q  VTHHSPTQVLK
Sbjct  123  PSGSSSPSSLLISGGGGDDGEIEQGGVTHHSPTQVLK  159



>emb|CDX87738.1| BnaC02g32110D [Brassica napus]
Length=373

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 100/149 (67%), Gaps = 11/149 (7%)
 Frame = +1

Query  256  DLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
            D + R++PEP     +DHFDRLPDS++LLV N I DVK+LGRCC VS+RFHSLVPQV+NV
Sbjct  8    DPTSRIHPEPQPLEQIDHFDRLPDSILLLVLNRIADVKSLGRCCAVSRRFHSLVPQVENV  67

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasp  600
            VVRVDCVI     S   +S+ ++      +    S++  LV  G++KP Q+L Q +  + 
Sbjct  68   VVRVDCVI-----SDDDNSSLSSVKPPSAASSSFSAVFSLVVGGIVKPLQALGQLLGTNR  122

Query  601  rrvaassaLEDGEFDQSSVTHHSPTQVLK  687
               A+S ++ +GE +Q  V HHSPTQVL+
Sbjct  123  SSSASSLSM-NGEIEQGGVKHHSPTQVLR  150



>ref|XP_008794503.1| PREDICTED: F-box protein At5g46170 [Phoenix dactylifera]
Length=396

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 93/134 (69%), Gaps = 4/134 (3%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +DHFDRLPDS++L+VFN IGDVK LGRCCVV +RF +LVP VD+VVVRVDCVISD+   S
Sbjct  39   IDHFDRLPDSVLLVVFNRIGDVKGLGRCCVVCRRFQALVPLVDDVVVRVDCVISDDATPS  98

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFD  645
              ++AA++    DK R  +S + RLV  GL+KP Q+L Q +  +      SSA       
Sbjct  99   SVAAAASSGCGLDKGRGVLSHLARLVLDGLVKPLQALGQMLIPASAAARRSSA----SSS  154

Query  646  QSSVTHHSPTQVLK  687
             S V+HHSPT+VLK
Sbjct  155  SSEVSHHSPTEVLK  168



>ref|XP_009397406.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=408

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 85/139 (61%), Gaps = 6/139 (4%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDG  459
            E +DHFDRLPDS++L++FN IGDVK LGRCC VS+RFH+L   V    V V       DG
Sbjct  32   EGIDHFDRLPDSVLLVIFNRIGDVKVLGRCCGVSRRFHAL--AVLVDDVVVRVDCVISDG  89

Query  460  sspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasp---rrvaassaLE  630
               SS  AA  A SDK R   S + RLV  GL+KP Q+LSQ +SAS        +++A +
Sbjct  90   -PSSSPGAAGGAVSDKPRGVFSHLARLVLGGLVKPLQALSQILSASSCTDATAVSAAAGK  148

Query  631  DGEFDQSSVTHHSPTQVLK  687
                  S  +HHSPT+VLK
Sbjct  149  SASASPSEASHHSPTEVLK  167



>ref|XP_010434544.1| PREDICTED: F-box protein At4g18380-like [Camelina sativa]
Length=393

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 104/161 (65%), Gaps = 27/161 (17%)
 Frame = +1

Query  268  RVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdc  438
            R++PEP   +DHFD LPDS++LL+FN IGDVK+LGRCCVVSKRFHSL+PQV+NVVVRVDC
Sbjct  13   RIHPEPEQQIDHFDHLPDSILLLIFNNIGDVKSLGRCCVVSKRFHSLIPQVENVVVRVDC  72

Query  439  visdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsas-------  597
            VISD+D SS  S    + A+   +  P S+I RLV    +KP Q+L QF+  S       
Sbjct  73   VISDDDSSSLVSDKPRSVASVAAT--PFSAIFRLV----IKPLQALGQFLKRSGSSSSSS  126

Query  598  -----------prrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                          ++     +DGE +Q  VTHHSPTQVLK
Sbjct  127  SSASSSSSSASSLLISGGIGGDDGEIEQGGVTHHSPTQVLK  167



>ref|XP_010052049.1| PREDICTED: F-box protein At5g46170-like [Eucalyptus grandis]
 gb|KCW75905.1| hypothetical protein EUGRSUZ_D00286 [Eucalyptus grandis]
Length=384

 Score = 80.1 bits (196),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 97/162 (60%), Gaps = 19/162 (12%)
 Frame = +1

Query  238  MGSVRPD-LSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpq  408
            M S+R D  S RV+P P  VDHFDRLPD L+LL+FN I DVKALGRC VVS+RF  LVPQ
Sbjct  1    MSSLRADPSSSRVHPAPLLVDHFDRLPDPLLLLIFNRIADVKALGRCGVVSRRFRQLVPQ  60

Query  409  vdnvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
            VD V+VRV       D       +A+ AA SDK+R+P +S  +     ++KP Q+L  F 
Sbjct  61   VDAVLVRV-------DCVISDDESASPAALSDKARNPFASFFQAFLGNIVKPLQALGLFS  113

Query  589  sasprr---------vaassaLEDGEFDQSSVTHHSPTQVLK  687
             A   +           A  +  DGE DQ  VTHHSPTQVLK
Sbjct  114  GAKRAQLGPSSSSSSSLAVGSERDGEMDQGGVTHHSPTQVLK  155


 Score = 29.6 bits (65),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++FNEI+ LRIELPS
Sbjct  150  PTQVLKNFNEIRFLRIELPS  169



>ref|XP_009398331.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398332.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = +1

Query  238  MGSVRPDLSCRVYP-EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            M  +RPD    V   E +DHFDRLPDS++L++FN++GDVKALGRCCVVS+RFH+L  ++ 
Sbjct  1    MDGLRPDHWDPVEEDEGIDHFDRLPDSVLLVIFNLVGDVKALGRCCVVSRRFHAL-VRLV  59

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
            + VV     +  +D S    + A  AAASDK R   S + R+V  GL+KP  +L Q +
Sbjct  60   DEVVVRVDCVISDDPSLSRVAEAGGAAASDKPRGVFSHLARIVLGGLVKPLVALGQIL  117



>ref|XP_010439863.1| PREDICTED: F-box protein At4g18380-like [Camelina sativa]
Length=419

 Score = 82.0 bits (201),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 103/158 (65%), Gaps = 24/158 (15%)
 Frame = +1

Query  268  RVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdc  438
            R++PEP   +DHFD LPDS++LL+ N IGDVK+LGRCCVVSKRFHSL+PQV+NVVVRVDC
Sbjct  35   RIHPEPKQQIDHFDHLPDSILLLILNNIGDVKSLGRCCVVSKRFHSLIPQVENVVVRVDC  94

Query  439  visdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIs---------  591
            VISD+D SS  S    + A+   +  P  +I RLV    +KP Q+L QF+          
Sbjct  95   VISDDDSSSLVSDKPRSVASVAAT--PFFAIFRLV----IKPLQALGQFLKRSGSSSSSP  148

Query  592  ------asprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
                  AS   ++     +DGE +Q  VTHHSPTQVLK
Sbjct  149  SSASSSASSLLISGGIGGDDGEIEQGGVTHHSPTQVLK  186


 Score = 26.9 bits (58),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++F+E++ LRIELPS
Sbjct  181  PTQVLKNFDELRFLRIELPS  200



>ref|XP_009399020.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=397

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 89/141 (63%), Gaps = 10/141 (7%)
 Frame = +1

Query  271  VYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisd  450
            V  E +DHFDRLPDS++L++FN IGDVK LGRCC V +RFH L P VD+VVVRVDCVISD
Sbjct  23   VEEEGIDHFDRLPDSVLLVIFNRIGDVKTLGRCCAVYRRFHDLAPLVDDVVVRVDCVISD  82

Query  451  EDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLE  630
            +       S +A     DK     S   R V  GL+KP ++L Q +S +    A +   +
Sbjct  83   D------PSPSAPGGGFDKPHSVFSHFARFVLGGLVKPLEALCQMLSPASCADALAR--K  134

Query  631  DGEFDQSS--VTHHSPTQVLK  687
             G F  SS  V+HHSPT+VLK
Sbjct  135  SGLFSSSSPEVSHHSPTEVLK  155



>ref|XP_009128847.1| PREDICTED: F-box protein At5g46170-like [Brassica rapa]
Length=371

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 104/151 (69%), Gaps = 13/151 (9%)
 Frame = +1

Query  250  RPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            R D   R++P+P      DHFDRLPDS++LLV N I DVK+LGRC  VS+RFHSLVPQV+
Sbjct  6    RSDPPSRIHPQPQPLEQTDHFDRLPDSILLLVLNRIADVKSLGRCRAVSRRFHSLVPQVE  65

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsa  594
            NVVVRVDCVISD+D SS SS    +AA+S       S++  LV  G++KP Q+L Q +  
Sbjct  66   NVVVRVDCVISDDDNSSLSSIKPPSAASSSF-----SAVFSLVVGGIVKPLQALGQLLGT  120

Query  595  sprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            + R  + S++   GE +Q  VTHHSPTQVL+
Sbjct  121  TSRSSSLSTS---GEIEQGGVTHHSPTQVLR  148



>ref|XP_010499543.1| PREDICTED: F-box protein At1g30200-like isoform X1 [Camelina 
sativa]
 ref|XP_010499544.1| PREDICTED: F-box protein At1g30200-like isoform X2 [Camelina 
sativa]
Length=383

 Score = 77.4 bits (189),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 101/160 (63%), Gaps = 16/160 (10%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRSDPVSRIHPEPQSLTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvvvrvdcvisdEDGsspsssaaaaaaasDKSR--------HPISSILRLVFTGLLKPF  567
            +NV+VRVDCVISD+D SS          + + +            S++ RLVF  + KPF
Sbjct  65   ENVLVRVDCVISDDDSSSDDDDNNNRRFSLNAASISDAVADGGSFSALFRLVFAPIFKPF  124

Query  568  QSLSQFIsasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            Q+L QF+       ++S    DGE +Q  VTHHSPTQVLK
Sbjct  125  QALGQFLGPKRSSSSSSF---DGEIEQGGVTHHSPTQVLK  161


 Score = 28.9 bits (63),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++FNEI+ LRIELP+
Sbjct  156  PTQVLKNFNEIRFLRIELPT  175



>ref|XP_010478400.1| PREDICTED: F-box protein At1g30200-like [Camelina sativa]
 ref|XP_010478401.1| PREDICTED: F-box protein At1g30200-like [Camelina sativa]
Length=383

 Score = 77.0 bits (188),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 101/161 (63%), Gaps = 14/161 (9%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRSDPVSRIHPEPQSLTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvvvrvdcvisdEDGsspsssaaaaaaasDKSR--------HPISSILRLVFTGLLKPF  567
            +NV+VRVDCVISD+D SS   +      + + +            S++ RLVF  + KPF
Sbjct  65   ENVLVRVDCVISDDDSSSSDDNNNNRRFSLNAASISDAVAVGGSFSALFRLVFAPIFKPF  124

Query  568  QSLSQFIsasprrvaassaLE-DGEFDQSSVTHHSPTQVLK  687
            Q+L QF+         +S    DGE +Q  VTHHSPTQVLK
Sbjct  125  QALGQFLGPKRSSSFDASFSSIDGEIEQGGVTHHSPTQVLK  165


 Score = 28.9 bits (63),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++FNEI+ LRIELP+
Sbjct  160  PTQVLKNFNEIRFLRIELPT  179



>ref|XP_002992968.1| hypothetical protein SELMODRAFT_136272 [Selaginella moellendorffii]
 gb|EFJ05914.1| hypothetical protein SELMODRAFT_136272 [Selaginella moellendorffii]
Length=373

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 86/133 (65%), Gaps = 13/133 (10%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHF+RLPDSL+L +FN I ++KALG+CC VSKRF+S+  QVDNVVVRVDCV+S ED    
Sbjct  32   DHFERLPDSLLLTIFNKIAEIKALGKCCAVSKRFNSVASQVDNVVVRVDCVLSGED----  87

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFDQ  648
                     +S  S+  +SS+++LV+  LL+PFQ L Q +S S     +S          
Sbjct  88   ------TNCSSKASKGLVSSLVKLVYGSLLRPFQVLQQMLSFSAGGKKSSG---SRPVSA  138

Query  649  SSVTHHSPTQVLK  687
            + V+HHSP +VL+
Sbjct  139  TEVSHHSPGEVLR  151



>ref|XP_010460807.1| PREDICTED: F-box protein At1g30200 [Camelina sativa]
Length=384

 Score = 76.6 bits (187),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 102/162 (63%), Gaps = 15/162 (9%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRTDPVSRIHPEPQSPTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvvvrvdcvisdEDGsspsssaaaaaaasDKSR--------HPISSILRLVFTGLLKPF  567
            +NV+VRVDCVISD+D SS   +      + + +            S++ RLVF  + KPF
Sbjct  65   ENVLVRVDCVISDDDSSSSDDNNNNRRFSLNAASISDAVAVGGSFSALFRLVFAPIFKPF  124

Query  568  QSLSQFIsasprrvaassaLE--DGEFDQSSVTHHSPTQVLK  687
            Q+L QF+       +  ++    DGE +Q  VTHHSPTQVLK
Sbjct  125  QALGQFLGPKRSSSSFDASFSSIDGEIEQGGVTHHSPTQVLK  166


 Score = 28.9 bits (63),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++FNEI+ LRIELP+
Sbjct  161  PTQVLKNFNEIRFLRIELPT  180



>ref|XP_009408533.1| PREDICTED: F-box protein At5g46170 [Musa acuminata subsp. malaccensis]
Length=402

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDG  459
            E +DHFDRLPDS++L+VFN +GD+KALGRCC+VS+RFH+LV  VD++VVRVDCV+SDE  
Sbjct  26   EGIDHFDRLPDSVLLVVFNRVGDIKALGRCCIVSRRFHALVRLVDDIVVRVDCVVSDEPS  85

Query  460  sspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQF  585
              P + A +AAA  DK R     + R+V  GL+KP  +L Q 
Sbjct  86   LFPDTEADSAAAGPDKPRGVFFHLARVVLGGLVKPLHALGQL  127



>ref|XP_001770045.1| predicted protein [Physcomitrella patens]
 gb|EDQ65221.1| predicted protein [Physcomitrella patens]
Length=348

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 79/134 (59%), Gaps = 24/134 (18%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
             DHFDRLPDSL+L++FN + D+K LGRCC VSKRFHSL P VDNVVV+VDCVIS E+   
Sbjct  4    TDHFDRLPDSLLLVIFNKVADIKVLGRCCAVSKRFHSLAPLVDNVVVKVDCVISGEENGL  63

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFD  645
             +           + R  IS  +R V   L+KP Q+L+  +      +            
Sbjct  64   NA-----------RGRGIISHFVRFVVGTLVKPLQALTHLLGPKKTIL------------  100

Query  646  QSSVTHHSPTQVLK  687
             + V+HHSP++VLK
Sbjct  101  -AEVSHHSPSEVLK  113



>gb|ADE76154.1| unknown [Picea sitchensis]
Length=348

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 81/134 (60%), Gaps = 24/134 (18%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +DH DR+PDSL+LL+FN + D+KALGRCC VSKRF+ LVPQV+NVVV+VDCVIS EDG  
Sbjct  4    IDHLDRIPDSLLLLIFNKVADIKALGRCCAVSKRFNFLVPQVENVVVKVDCVISGEDGGL  63

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFD  645
             +           K +  I  ++R +   ++KP Q+L  FI      +            
Sbjct  64   NA-----------KGKGIIGHLVRFMIGSIVKPLQALQHFIGPRKAIL------------  100

Query  646  QSSVTHHSPTQVLK  687
             + V+HHSP +VLK
Sbjct  101  -AEVSHHSPAEVLK  113



>ref|XP_006836365.1| PREDICTED: F-box protein At5g46170 [Amborella trichopoda]
 gb|ERM99218.1| hypothetical protein AMTR_s00092p00114580 [Amborella trichopoda]
Length=393

 Score = 79.7 bits (195),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 82/140 (59%), Gaps = 27/140 (19%)
 Frame = +1

Query  277  PEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvis  447
            P P   +DHFDRLPDSL+LLVFN IGDVKALGRCCVVSKRFH+L+PQVDNVVV+VDCVIS
Sbjct  49   PSPSSQLDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSKRFHALIPQVDNVVVKVDCVIS  108

Query  448  dEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaL  627
            +E+              S K +   SS L+       KP Q L   +      +      
Sbjct  109  NEE-----------TGISGKGKGVFSSFLKFFVCSFSKPLQVLQHLLGPRKTGL------  151

Query  628  EDGEFDQSSVTHHSPTQVLK  687
                   + V+HHSP +VLK
Sbjct  152  -------TEVSHHSPNEVLK  164


 Score = 25.0 bits (53),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P+  L++FNEI+ LRI LP 
Sbjct  159  PNEVLKNFNEIQSLRIVLPG  178



>ref|XP_009407719.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=406

 Score = 79.3 bits (194),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 98/157 (62%), Gaps = 11/157 (7%)
 Frame = +1

Query  235  DMGSVRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvd  414
            D+   R D       E +DH DRLPDS++L+VFN IGDVKALGRCCVV +RFH LVP VD
Sbjct  12   DLRQWRGDAQEEEDEEGIDHLDRLPDSVLLVVFNRIGDVKALGRCCVVCRRFHDLVPLVD  71

Query  415  nvvvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL------  576
            +V+VRVDCVISD+      S + A  A +D+SR   S + R+V  G++KP Q+L      
Sbjct  72   SVLVRVDCVISDD-----PSPSPAGGAGADRSRGVFSHLARIVIGGIVKPLQALGHILAP  126

Query  577  SQFIsasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            S  ++++ R   +S +        S ++HHSP +VLK
Sbjct  127  SAAVASNRRSSPSSPSSSPSSSRSSEISHHSPAEVLK  163


 Score = 25.4 bits (54),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++F EI+ LRIELP+
Sbjct  158  PAEVLKNFKEIRRLRIELPA  177



>ref|XP_010518863.1| PREDICTED: F-box protein At5g46170-like [Tarenaya hassleriana]
Length=166

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 67/116 (58%), Gaps = 19/116 (16%)
 Frame = +1

Query  247  VRPDLSCRVYPEP--VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv  420
            +R D   R++ EP  +DHFDRLPDS+++ VFN IG VKALGRC VVSKRFHSLV QVD V
Sbjct  5    LRSDPPSRIHSEPQGIDHFDRLPDSVVIFVFNKIGHVKALGRCRVVSKRFHSLVSQVDYV  64

Query  421  vvrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
            V    C  S                    +  P SSI R V   ++KP Q++ QF+
Sbjct  65   VWAAHCDCSAA-----------------AAARPFSSIFRRVVGDIVKPLQAVGQFL  103



>ref|XP_010940976.1| PREDICTED: F-box protein At5g46170-like [Elaeis guineensis]
Length=412

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrv--dcvisdE  453
            E +DHFDRLPD+L+L VFN IGDVKALGRCCVV +RFHSLVP VD VVV V         
Sbjct  29   EGIDHFDRLPDALLLDVFNRIGDVKALGRCCVVCRRFHSLVPLVDYVVVHVDCVISDDPG  88

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
              SS +       A  DK R   S + RLVF  L+KP Q+L Q +
Sbjct  89   PSSSSAPGCGGGGAGPDKGRGVFSHLARLVFGSLVKPLQALGQIL  133



>ref|XP_006307474.1| hypothetical protein CARUB_v10009099mg [Capsella rubella]
 gb|EOA40372.1| hypothetical protein CARUB_v10009099mg [Capsella rubella]
Length=453

 Score = 72.8 bits (177),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 108/165 (65%), Gaps = 18/165 (11%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  69   LRSDPVSRIHPEPQSLTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  128

Query  412  dnvvvrvdcvisdEDGsspsssaaaaaaasDKS-----RHPISSILRLVFTGLLKPFQSL  576
            +NV+VRVDCVISD+D SS   +   +  AS  S         S++ RLVF  + KPFQ+L
Sbjct  129  ENVLVRVDCVISDDDSSSSDDNRRFSLNASSISDAVGAGGSFSALFRLVFAPIFKPFQAL  188

Query  577  SQFI-----sasprrvaassaLED---GEFDQSSVTHHSPTQVLK  687
             QF+     S+S    A+ SA+ D   GE +Q  VTHHSPTQVLK
Sbjct  189  GQFLGPKRSSSSSSFDASFSAINDEIGGEIEQGGVTHHSPTQVLK  233


 Score = 28.9 bits (63),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++FNEI+ LRIELP+
Sbjct  228  PTQVLKNFNEIRFLRIELPT  247



>gb|AFW82429.1| F-box domain containing protein [Zea mays]
Length=412

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 93/145 (64%), Gaps = 8/145 (6%)
 Frame = +1

Query  277  PEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdED  456
            P   DHFDRLPD+L+L++FN IGDVKALGRC +VS RFH LVP VD+V+VRVDCVI DE 
Sbjct  25   PAGDDHFDRLPDALLLVIFNRIGDVKALGRCSLVSLRFHELVPLVDSVLVRVDCVIPDEP  84

Query  457  GsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrv--------a  612
             SS S S   +  AS ++R   S I R+V  G++KP Q+L Q +S +            +
Sbjct  85   PSSSSPSTPFSPTASVRARGVFSQIARIVLGGIVKPIQALGQILSPANSASGFPASSDSS  144

Query  613  assaLEDGEFDQSSVTHHSPTQVLK  687
             SS+        + V+HHSP++VL+
Sbjct  145  PSSSSSSLPLPLADVSHHSPSEVLR  169



>ref|XP_004961549.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=410

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 93/145 (64%), Gaps = 12/145 (8%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPD+L+L++FN IGDVKALGRC +VS+RFH L+P VD+V+VRVDCVI DE  SS 
Sbjct  29   DHFDRLPDALLLVIFNRIGDVKALGRCSIVSRRFHELIPLVDSVLVRVDCVIPDEPPSSS  88

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasp------------rrva  612
            S SA ++  AS ++R   S I R+V  G++KP Q+L Q +S +                 
Sbjct  89   SPSAPSSPTASVRARGVFSQIARIVLGGIVKPIQALGQILSPANSASGFSASSASSSSSF  148

Query  613  assaLEDGEFDQSSVTHHSPTQVLK  687
            + S+          V+HHSP++VL+
Sbjct  149  SPSSTSYSPLPPGDVSHHSPSEVLR  173



>emb|CDY43956.1| BnaA02g24340D [Brassica napus]
Length=373

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 93/136 (68%), Gaps = 8/136 (6%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDG  459
            E  DHFDRLPDS++LLV N I DVK+LGRC  VS+RFHSLVPQV+NVVVRVDCVISD+  
Sbjct  23   EQTDHFDRLPDSVLLLVLNRIADVKSLGRCRAVSRRFHSLVPQVENVVVRVDCVISDD--  80

Query  460  sspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGE  639
                +S+ ++      +    S++  LV  G++KP Q+L Q +  + R  + S++   GE
Sbjct  81   ---DNSSLSSIKPPSAASSSFSAVFSLVVGGIVKPLQALGQLLGTTSRSSSLSTS---GE  134

Query  640  FDQSSVTHHSPTQVLK  687
             +Q  VTHHSPTQVL+
Sbjct  135  IEQGGVTHHSPTQVLR  150



>ref|XP_009388498.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=404

 Score = 74.7 bits (182),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 60/101 (59%), Gaps = 8/101 (8%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +D FD+LPDSL+L VFN+IGDVK LGRCCVV++RFH L        V V       DG  
Sbjct  37   IDFFDQLPDSLVLTVFNLIGDVKDLGRCCVVTRRFHDL--VPLVDSVLVRVDCVISDG--  92

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
                 + ++   DK+R   S + R+V  GL+KP Q+L Q +
Sbjct  93   ----PSPSSPGGDKARGVFSHLARVVLGGLVKPLQALGQIL  129


 Score = 24.6 bits (52),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  681  LEDFNEIKLLRIELPS  728
            L++F EI+ LRIELP+
Sbjct  159  LKNFKEIRRLRIELPA  174



>ref|XP_002440052.1| hypothetical protein SORBIDRAFT_09g025120 [Sorghum bicolor]
 gb|EES18482.1| hypothetical protein SORBIDRAFT_09g025120 [Sorghum bicolor]
Length=398

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 93/142 (65%), Gaps = 9/142 (6%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFDRLPD+L+L++FN IGDVKALGRC +VS+RFH LVP VD+VVVRVDCVI DE  SS 
Sbjct  29   DHFDRLPDALLLVIFNRIGDVKALGRCSLVSRRFHELVPLVDSVVVRVDCVIPDEPPSSS  88

Query  469  sssaaaaaaasD-KSRHPISSILRLVFTGLLKPFQSLSQFIsasprrva--------ass  621
            SS +A ++  +  ++R   S I R+V  G++KP Q+L Q +S +              SS
Sbjct  89   SSPSAPSSPTASVRARGVFSQIARIVLGGIVKPIQALGQILSPANSASGFPASSTSSPSS  148

Query  622  aLEDGEFDQSSVTHHSPTQVLK  687
            +          V+HHSP++VL+
Sbjct  149  SSSASPLPAGDVSHHSPSEVLR  170



>dbj|BAK06381.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99725.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97479.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            D FDRLPD+++L VFN IGDVKALGRC +VS+RFH+LVP VD+V VRVDCVI DE    P
Sbjct  22   DQFDRLPDAVLLDVFNRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVIPDEPA--P  79

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaass---aLEDGE  639
            SS+ +  AAA  + R  ++ I RLV  G+++P Q+L Q +S +   V+  S         
Sbjct  80   SSAGSPQAAAPSRGRGALAHIARLVLGGIVRPIQALGQILSPTLAIVSRRSVAPPPASPP  139

Query  640  FDQSSVTHHSPTQVLK  687
                 ++HHSP++VL+
Sbjct  140  PPAGDISHHSPSEVLR  155



>ref|XP_006415502.1| hypothetical protein EUTSA_v10007915mg [Eutrema salsugineum]
 gb|ESQ33855.1| hypothetical protein EUTSA_v10007915mg [Eutrema salsugineum]
Length=382

 Score = 70.1 bits (170),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 102/153 (67%), Gaps = 13/153 (8%)
 Frame = +1

Query  268  RVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrv  432
            R++PEP      DHFD LPDSL+LL+F+ + DVK LGRC +VS+RFHSLVP V+NV+VRV
Sbjct  12   RIHPEPQSLENSDHFDLLPDSLLLLIFDKVADVKDLGRCSIVSRRFHSLVPFVENVLVRV  71

Query  433  dcvisdEDGsspsssaaaaaaasDKSRH--PISSILRLVFTGLLKPFQSLSQFI------  588
            DCVISD+D S+     +  +A+   +      S++ RLVF  + KPFQ+L QF+      
Sbjct  72   DCVISDDDSSAADRRFSLNSASITDATAGGSFSALFRLVFAPIFKPFQALGQFLGPKRSS  131

Query  589  sasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            S+S    A+ SALED    +  VTHHSPTQVLK
Sbjct  132  SSSSLFHASFSALEDEIGSEIGVTHHSPTQVLK  164


 Score = 27.3 bits (59),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++F EI+LLRIELP+
Sbjct  159  PTQVLKNFAEIRLLRIELPT  178



>ref|XP_002969001.1| hypothetical protein SELMODRAFT_90428 [Selaginella moellendorffii]
 ref|XP_002990664.1| hypothetical protein SELMODRAFT_132039 [Selaginella moellendorffii]
 gb|EFJ08296.1| hypothetical protein SELMODRAFT_132039 [Selaginella moellendorffii]
 gb|EFJ30117.1| hypothetical protein SELMODRAFT_90428 [Selaginella moellendorffii]
Length=364

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
             D FD+LPDSL++L+ N +GD+K LGRCC VSKRF +L   V++V V+VDCVIS ED   
Sbjct  30   TDCFDQLPDSLLVLILNKVGDIKVLGRCCAVSKRFQALAAHVEDVTVKVDCVISGED---  86

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFD  645
                       S KS+  +  ++RLVF   ++P Q L  F+      V            
Sbjct  87   --------CNLSGKSKGFLGQLMRLVFGSFVRPLQLLQHFLGPRKSAVL-----------  127

Query  646  QSSVTHHSPTQVLK  687
             + V+HHSP++VLK
Sbjct  128  -AEVSHHSPSEVLK  140



>ref|XP_009381298.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381299.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381300.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=406

 Score = 73.2 bits (178),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 86/138 (62%), Gaps = 9/138 (7%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +DHFDRLPDS++LLVFN +GDVK LGRCCVV  RFHSLV  VD+V+VRVDCVISD+    
Sbjct  31   IDHFDRLPDSVLLLVFNRVGDVKDLGRCCVVCSRFHSLVRLVDSVLVRVDCVISDD----  86

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrva----assaLED  633
              S + A  A  D +R   S + R+V   + +PFQ+L   ++ S    +    + S L  
Sbjct  87   -PSPSPAGVAGGDSARGVFSHLARIVLGSIARPFQALGHILAPSAGVASDRRSSPSLLSS  145

Query  634  GEFDQSSVTHHSPTQVLK  687
                 S  +HHSP +VLK
Sbjct  146  SSSPLSDFSHHSPAEVLK  163


 Score = 23.9 bits (50),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++F EI  LRIELP+
Sbjct  158  PAEVLKNFKEIHGLRIELPA  177



>ref|XP_003569912.1| PREDICTED: F-box protein At4g18380-like [Brachypodium distachyon]
 ref|XP_003569913.1| PREDICTED: F-box protein At4g18380-like [Brachypodium distachyon]
Length=396

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 90/135 (67%), Gaps = 2/135 (1%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            D FDRLPD ++L VFN IGDVKALGRC +VS+RFH LVP VD+V VRVDCVI DE  SS 
Sbjct  22   DQFDRLPDEVLLDVFNRIGDVKALGRCALVSRRFHELVPLVDSVFVRVDCVIPDEPPSSS  81

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrva--assaLEDGEF  642
            +SS  AAAAA  + R  ++ + RLV  G+++P Q+L Q +S +   V+    +       
Sbjct  82   ASSPQAAAAAPGRGRGALAHLARLVLGGIVRPIQALGQILSPTLAIVSRRPVAPPALPPP  141

Query  643  DQSSVTHHSPTQVLK  687
                ++HHSP++VL+
Sbjct  142  PAGDISHHSPSEVLR  156



>emb|CDX99469.1| BnaC01g10830D [Brassica napus]
Length=227

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 3/53 (6%)
 Frame = +1

Query  250  RPDLSCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            R D   R++PEP+   D FD LPDS++LLVFN IGDVKALGRC VVSKRFHSL
Sbjct  6    RSDPLSRIHPEPLHQPDFFDHLPDSILLLVFNRIGDVKALGRCGVVSKRFHSL  58



>ref|NP_001151246.1| F-box domain containing protein [Zea mays]
 gb|ACG42117.1| F-box domain containing protein [Zea mays]
Length=411

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 92/146 (63%), Gaps = 9/146 (6%)
 Frame = +1

Query  277  PEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdED  456
            P   DHFDRLPD+L+L++FN IGDVKALGRC +VS RFH LVP VD+V VRVDCVI DE 
Sbjct  25   PAGDDHFDRLPDALLLVIFNRIGDVKALGRCSLVSLRFHELVPLVDSVFVRVDCVIPDEP  84

Query  457  GsspsssaaaaaaasD-KSRHPISSILRLVFTGLLKPFQSLSQFIsasprrv--------  609
             SS SS +   +  +  ++R   S I R+V  G++KP Q+L Q +S +            
Sbjct  85   PSSSSSPSTPFSPTASVRARGVFSQIARIVLGGIVKPIQALGQILSPANSASGFPASSDS  144

Query  610  aassaLEDGEFDQSSVTHHSPTQVLK  687
            + SS+        + V+HHSP++VL+
Sbjct  145  SPSSSSSSSPLPPADVSHHSPSEVLR  170



>emb|CDX78847.1| BnaA01g09140D [Brassica napus]
Length=238

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 3/53 (6%)
 Frame = +1

Query  250  RPDLSCRVYPEPVD---HFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            R D   R++PEP+D    FD LPDS++LLVFN IGDVKALGRC VVSKRFHSL
Sbjct  6    RSDPLSRIHPEPLDPPDFFDHLPDSILLLVFNRIGDVKALGRCGVVSKRFHSL  58



>ref|XP_001761459.1| predicted protein [Physcomitrella patens]
 gb|EDQ73848.1| predicted protein [Physcomitrella patens]
Length=346

 Score = 71.6 bits (174),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 77/134 (57%), Gaps = 24/134 (18%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
            +DHFDRLPDS++L++FN + D+KALGRCC VS RFHSL P VDNVVV+VDCVIS ED   
Sbjct  1    MDHFDRLPDSVLLVIFNKVSDIKALGRCCAVSSRFHSLAPLVDNVVVKVDCVISGEDNGL  60

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFD  645
             +           + R  IS  +R V    +KP  +L   + +    +            
Sbjct  61   NA-----------RGRGIISHFVRFVVGTFVKPLLALQHLLGSKKTIL------------  97

Query  646  QSSVTHHSPTQVLK  687
             + V+ HSP++VLK
Sbjct  98   -AEVSDHSPSEVLK  110


 Score = 24.6 bits (52),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++F EI+ LRIELP 
Sbjct  105  PSEVLKNFKEIQNLRIELPG  124



>ref|XP_002890858.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67117.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score = 69.3 bits (168),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 94/158 (59%), Gaps = 11/158 (7%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRSDPVSRIHPEPQSLTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvv-----vrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            +NV+     V  D   S  D +   S  AA+ + +  +    S++ RLVF  + KPFQ+L
Sbjct  65   ENVLVRVDCVISDDDSSSSDENRRFSLNAASISDAAGAGGSFSALFRLVFAPIFKPFQAL  124

Query  577  SQFIsasprrvaassaLEDGEF-DQSSVTHHSPTQVLK  687
             QF+       ++S         D+  VTHHSPTQVLK
Sbjct  125  GQFLVPKRSSSSSSFDASFSAINDEIGVTHHSPTQVLK  162


 Score = 26.6 bits (57),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++F EI+ LRIELP+
Sbjct  157  PTQVLKNFGEIRFLRIELPT  176



>ref|XP_008649848.1| PREDICTED: F-box protein At5g46170-like [Zea mays]
 gb|AFW78643.1| hypothetical protein ZEAMMB73_212566 [Zea mays]
Length=412

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 93/143 (65%), Gaps = 10/143 (7%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            D FDRLPD+L+L++FN IGDVKALGRC +VS+RFH LVP VD+V+VRVDCVI DE  SS 
Sbjct  29   DQFDRLPDALLLVIFNRIGDVKALGRCSLVSRRFHELVPLVDSVLVRVDCVIPDEPPSSS  88

Query  469  sssaaaaaaasD-KSRHPISSILRLVFTGLLKPFQSLSQFIsasprrv---------aas  618
            SSS+  ++  +  ++R   S I R+V  G++KP Q+L Q +S +              +S
Sbjct  89   SSSSTPSSPTASVRARGVFSQIARIVLGGIVKPIQALGQILSPANSASGFPASAASSLSS  148

Query  619  saLEDGEFDQSSVTHHSPTQVLK  687
            S+          V+HHSP++VL+
Sbjct  149  SSSSSSPLPAGDVSHHSPSEVLR  171



>ref|XP_010549497.1| PREDICTED: F-box protein At1g30200 [Tarenaya hassleriana]
Length=398

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  247  VRPDLSCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            ++P ++       VDHFDRLPDSL+LLVF+ I D+KALGRCC+VS+RFHSL
Sbjct  13   IQPVMAQSFESAAVDHFDRLPDSLLLLVFDRISDIKALGRCCLVSRRFHSL  63


 Score = 48.1 bits (113),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +1

Query  523  SSILRLVFTGLLKPFQSLSQFIsasprrvaassaLED---GEFDQSSVTHHSPTQVLK  687
            SS+ RL F  + KPFQ+L QF+      + +S+       GE DQ  VTHHSPTQVL+
Sbjct  115  SSLFRLFFGPIFKPFQALGQFLGPKRSYLDSSAFGNGNGGGEIDQGGVTHHSPTQVLR  172


 Score = 28.9 bits (63),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L +FNEI+ LRIELPS
Sbjct  167  PTQVLRNFNEIRFLRIELPS  186



>gb|EAY98656.1| hypothetical protein OsI_20579 [Oryza sativa Indica Group]
Length=412

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 93/149 (62%), Gaps = 16/149 (11%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdE-----  453
            DHFDRLPD L+L++FN IGDVKALGRC +VS+RFH LVP VD+V+VRVDCVI D+     
Sbjct  33   DHFDRLPDPLLLVIFNRIGDVKALGRCSLVSRRFHDLVPLVDSVLVRVDCVIPDDPASSS  92

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLED  633
              SS  S+A ++  AS ++R   S I R+V  G++KP Q+L Q +S +      ++++  
Sbjct  93   SSSSSPSAAPSSPTASARARTVFSQIARIVLGGIVKPIQALGQILSPANSASVLAASVTS  152

Query  634  GEFDQ-----------SSVTHHSPTQVLK  687
                              V+HHSP++VL+
Sbjct  153  SPSSSSSSSSSSPPLPGDVSHHSPSEVLR  181



>ref|NP_001056009.1| Os05g0510400 [Oryza sativa Japonica Group]
 gb|AAT44135.1| putative F-box protein family [Oryza sativa Japonica Group]
 dbj|BAF17923.1| Os05g0510400 [Oryza sativa Japonica Group]
 dbj|BAG91029.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64319.1| hypothetical protein OsJ_19156 [Oryza sativa Japonica Group]
Length=412

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 93/149 (62%), Gaps = 16/149 (11%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdE-----  453
            DHFDRLPD L+L++FN IGDVKALGRC +VS+RFH LVP VD+V+VRVDCVI D+     
Sbjct  33   DHFDRLPDPLLLVIFNRIGDVKALGRCSLVSRRFHDLVPLVDSVLVRVDCVIPDDPASSS  92

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLED  633
              SS  S+A ++  AS ++R   S I R+V  G++KP Q+L Q +S +      ++++  
Sbjct  93   SSSSSPSAAPSSPTASARARTVFSQIARIVLGGIVKPIQALGQILSPANSASVLAASVTS  152

Query  634  GEFDQ-----------SSVTHHSPTQVLK  687
                              V+HHSP++VL+
Sbjct  153  SPSSSSSSSSSSPPLPGDVSHHSPSEVLR  181



>gb|ABK24885.1| unknown [Picea sitchensis]
 gb|ABR16398.1| unknown [Picea sitchensis]
Length=361

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 77/134 (57%), Gaps = 23/134 (17%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGss  465
             DHFDRLP+SL+L++FN +GD+KALGRC  VSKRF+ LVPQV++VVV+            
Sbjct  22   TDHFDRLPNSLVLVIFNKLGDIKALGRCSAVSKRFNCLVPQVEDVVVK----------VD  71

Query  466  psssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFD  645
               S+  + + S +SR  I   ++LV   ++KP Q+L Q +      +            
Sbjct  72   CVISSEESGSLSGRSRGFIGLFVKLVIGSIVKPLQALQQILGTKKVVL------------  119

Query  646  QSSVTHHSPTQVLK  687
             + V+HHSP +VLK
Sbjct  120  -AEVSHHSPGEVLK  132



>gb|AES87540.2| F-box plant-like protein, putative [Medicago truncatula]
Length=153

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 71/123 (58%), Gaps = 25/123 (20%)
 Frame = +1

Query  331  FNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKS  510
             N IGD KALGRCCVVS+ FHSLVPQV NVVVRV       D       + ++  +SDKS
Sbjct  17   LNKIGDFKALGRCCVVSRHFHSLVPQVANVVVRV-------DCVISDDDSNSSENSSDKS  69

Query  511  RHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFDQSSVTHHSPTQVLKI  690
            R P  ++LRLVF G+ KP Q+L +               EDG+     VTHHSPTQVLK 
Sbjct  70   RGPFWNLLRLVFGGIAKPIQNLGE---------------EDGD---GGVTHHSPTQVLKN  111

Query  691  LTK  699
              K
Sbjct  112  FNK  114



>ref|XP_006836201.1| PREDICTED: F-box protein At4g18380 [Amborella trichopoda]
 ref|XP_011620703.1| PREDICTED: F-box protein At4g18380 [Amborella trichopoda]
 gb|ERM99054.1| hypothetical protein AMTR_s00101p00078790 [Amborella trichopoda]
Length=348

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 77/138 (56%), Gaps = 21/138 (15%)
 Frame = +1

Query  274  YPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdE  453
            YP P DHFDRLPDSL+L++FN + DVK+LGRC  VSKRF+SL+P+V NV+V+ DCVIS  
Sbjct  11   YPIPEDHFDRLPDSLLLIIFNKLEDVKSLGRCFAVSKRFNSLIPEVHNVLVKFDCVISGT  70

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLED  633
            D           ++   + R+  S   +L+    LKPF SL                  +
Sbjct  71   D------DDDPNSSILPRPRNLFSHFFKLMLGAFLKPFHSLRT---------------NN  109

Query  634  GEFDQSSVTHHSPTQVLK  687
             +     + HHSP QVL+
Sbjct  110  NKPLFPQLAHHSPAQVLR  127



>ref|XP_006654629.1| PREDICTED: F-box protein At5g46170-like [Oryza brachyantha]
Length=420

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 75/105 (71%), Gaps = 5/105 (5%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdE-----  453
            DHFDRLPD L+L++FN IGDVKALGRC +VS+RFH LVP VD+V+VRVDCVI D+     
Sbjct  28   DHFDRLPDPLLLVIFNRIGDVKALGRCSLVSRRFHDLVPLVDSVLVRVDCVIPDDPASSA  87

Query  454  DGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
              +S S SA  +  AS ++R   S I R+V  G++KP Q+L Q +
Sbjct  88   AAASSSPSAPCSPTASARARTVFSQIARIVLGGIVKPIQALGQIL  132



>tpg|DAA41006.1| TPA: hypothetical protein ZEAMMB73_999134 [Zea mays]
Length=490

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            D FDRLPD+L+L++FN IG+VKALGRC +VS+RFH LVP VD+V+VRVDCVI DE  SS 
Sbjct  29   DQFDRLPDALLLVIFNRIGNVKALGRCSLVSRRFHELVPLVDSVLVRVDCVIPDEPPSSS  88

Query  469  sssaaaaaaasD-KSRHPISSILRLVFTGLLKPFQSLSQFI  588
            SSS+  ++  +  ++R   S I R+V  G++KP Q+L Q +
Sbjct  89   SSSSTPSSPTASVRARGVFSQIARIVLGGIVKPIQALGQIL  129



>ref|XP_003605343.1| F-box protein [Medicago truncatula]
Length=227

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 71/122 (58%), Gaps = 25/122 (20%)
 Frame = +1

Query  334  NMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGsspsssaaaaaaasDKSR  513
            N IGD KALGRCCVVS+ FHSLVPQV NVVVRV       D       + ++  +SDKSR
Sbjct  92   NKIGDFKALGRCCVVSRHFHSLVPQVANVVVRV-------DCVISDDDSNSSENSSDKSR  144

Query  514  HPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFDQSSVTHHSPTQVLKIL  693
             P  ++LRLVF G+ KP Q+L +               EDG+     VTHHSPTQVLK  
Sbjct  145  GPFWNLLRLVFGGIAKPIQNLGE---------------EDGD---GGVTHHSPTQVLKNF  186

Query  694  TK  699
             K
Sbjct  187  NK  188



>ref|XP_003568140.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=420

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 18/151 (12%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvv--------rvdcvi  444
            D FD LPD L+L++FN IGDVKALGRC +VS+RFH+LVP VD+V+V              
Sbjct  31   DRFDGLPDPLLLVIFNRIGDVKALGRCSLVSRRFHALVPLVDSVLVRVDCVIPDDASSAG  90

Query  445  sdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIs----------a  594
            +       S SA ++  AS ++R+ +S I R+V  G++KP Q+L Q +S          +
Sbjct  91   AAAAAGDFSLSAPSSPTASARARNVVSQIARMVIGGIVKPIQALGQILSHGNSDSDFPAS  150

Query  595  sprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
            S       ++L         V+HHSP++VL+
Sbjct  151  SSSASRRFASLSPSSPPSGDVSHHSPSEVLR  181



>ref|NP_564350.1| F-box protein [Arabidopsis thaliana]
 ref|NP_973940.1| F-box protein [Arabidopsis thaliana]
 sp|Q9C534.1|FB19_ARATH RecName: Full=F-box protein At1g30200 [Arabidopsis thaliana]
 gb|AAG50568.1|AC073506_10 hypothetical protein [Arabidopsis thaliana]
 gb|AAG50853.1|AC074176_2 hypothetical protein [Arabidopsis thaliana]
 gb|AAK59838.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AAL24254.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AAN18072.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AEE31190.1| F-box protein [Arabidopsis thaliana]
 gb|AEE31191.1| F-box protein [Arabidopsis thaliana]
Length=379

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 91/157 (58%), Gaps = 11/157 (7%)
 Frame = +1

Query  247  VRPDLSCRVYPEP-----VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqv  411
            +R D   R++PEP      DHFD LPDSL+LL+F+ + DVK LGRCC+VS+RFHSLVP V
Sbjct  5    LRSDPVSRIHPEPQSLTSFDHFDLLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFV  64

Query  412  dnvv-----vrvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
            +NV+     V  D   S  D +   S   A+ + +  +    S++ RLVF  + KPFQ L
Sbjct  65   ENVLVRVDCVISDDDSSSSDENHRFSLNTASISDAGGAGGSFSALFRLVFAPIFKPFQML  124

Query  577  SQFIsasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             Q +       +  ++      D+  VTHHSPTQVLK
Sbjct  125  GQILGPKRSSSSFDASFSAIN-DEIGVTHHSPTQVLK  160



>ref|XP_009381361.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=354

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             RVY +P   +D F+RLPDS++LL+FN + DV++LGRC  VSKRF+SL
Sbjct  5    ARVYADPSRDLDEFERLPDSIVLLIFNKVADVRSLGRCSAVSKRFNSL  52



>ref|XP_009410458.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009410459.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 84/147 (57%), Gaps = 21/147 (14%)
 Frame = +1

Query  265  CRVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             RVY +P   +D FDRLPDS++LL+ N + DV++LGRC  VSKRF+SLV  V +V V++D
Sbjct  5    ARVYADPSHDLDQFDRLPDSIVLLILNKLADVRSLGRCSAVSKRFNSLVFLVHDVYVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaa  615
             V++  DG S    + ++     + R+   + L+L+   LLKPF +L             
Sbjct  65   RVVTV-DGDSDDPLSQSSP----RHRNLFCNFLKLMLFTLLKPFHNLRS-----------  108

Query  616  ssaLEDGEFDQSSVTHHSPTQVLKILT  696
            ++      F Q  ++HHSP QVLK  T
Sbjct  109  TNCGNKPVFPQ--LSHHSPAQVLKNFT  133



>ref|XP_009393903.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 3/53 (6%)
 Frame = +1

Query  250  RPDLSCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            R     R++ +P    DHFDR+PDSL+LL+FN + DV++LGRC  VSKRF++L
Sbjct  9    RTQTKSRIHADPSLHQDHFDRIPDSLVLLIFNKLADVRSLGRCSAVSKRFNAL  61



>ref|NP_001151107.1| F-box domain containing protein [Zea mays]
 gb|ACG41645.1| F-box domain containing protein [Zea mays]
Length=406

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 84/146 (58%), Gaps = 9/146 (6%)
 Frame = +1

Query  277  PEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv------vvrvdc  438
            PE  DHF+RL D+++L V N IGDVKALGRC +VS+RFH+LVP VD+V      V+  D 
Sbjct  20   PEAADHFERLHDAVLLDVLNRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVIPDDP  79

Query  439  visdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaas  618
              S   G++P S    A A +   R  ++ + R +  G+ +P  +L Q +S++   V+  
Sbjct  80   PSSSSAGAAPGSPPHQAPAPTACGRGALARVARALLGGVARPIHALGQILSSAAATVSRR  139

Query  619  saLEDGEFDQSS---VTHHSPTQVLK  687
            S         +    V+HHSP++VL+
Sbjct  140  SEPLPASPPPAPVADVSHHSPSEVLR  165



>ref|XP_010907825.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = +1

Query  262  SCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            + R++ +P    DHFDR+PD L+LL+FN + DV++LGRC  VSKRF+SL
Sbjct  4    NTRIHSDPYLSEDHFDRIPDPLVLLIFNKLADVRSLGRCSAVSKRFNSL  52



>gb|EEC71551.1| hypothetical protein OsI_03898 [Oryza sativa Indica Group]
Length=396

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 93/140 (66%), Gaps = 7/140 (5%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdED----  456
            D F+RLPD ++L VF  IGDVKALGRC +VS+RFH+LVP VD+V VRVDCVISD+     
Sbjct  14   DQFERLPDEVLLDVFGRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVISDDPPPSS  73

Query  457  -GsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLED  633
             GS+ +++AA     + + R  ++ + RLV  G+++P Q+L Q +S +   V+  SA   
Sbjct  74   AGSAQAAAAAEGGPPAARGRGALAHLARLVLGGIVRPIQALGQILSPAAATVSRRSAAPP  133

Query  634  GEFDQSS--VTHHSPTQVLK  687
                 ++  V+HHSP++VL+
Sbjct  134  AAPAPAAADVSHHSPSEVLR  153



>ref|NP_001044377.1| Os01g0770400 [Oryza sativa Japonica Group]
 dbj|BAB56069.1| F-box family protein-like [Oryza sativa Japonica Group]
 dbj|BAF06291.1| Os01g0770400 [Oryza sativa Japonica Group]
 dbj|BAG88022.1| unnamed protein product [Oryza sativa Japonica Group]
Length=396

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 93/140 (66%), Gaps = 7/140 (5%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdED----  456
            D F+RLPD ++L VF  IGDVKALGRC +VS+RFH+LVP VD+V VRVDCVISD+     
Sbjct  14   DQFERLPDEVLLDVFGRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVISDDPPPSS  73

Query  457  -GsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLED  633
             GS+ +++AA     + + R  ++ + RLV  G+++P Q+L Q +S +   V+  SA   
Sbjct  74   AGSAQAAAAAEGGPPAARGRGALAHLARLVLGGIVRPIQALGQILSPAAATVSRRSAAPP  133

Query  634  GEFDQSS--VTHHSPTQVLK  687
                 ++  V+HHSP++VL+
Sbjct  134  AAPAPAAADVSHHSPSEVLR  153



>ref|XP_008777014.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 39/49 (80%), Gaps = 3/49 (6%)
 Frame = +1

Query  262  SCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            + R++ +P    DHFD++PDSL+LL+FN + DV++LGRC  VSKRF+SL
Sbjct  4    NTRIHSDPYLSEDHFDQIPDSLVLLIFNKLADVRSLGRCSAVSKRFNSL  52



>ref|XP_008784858.1| PREDICTED: F-box protein At5g46170-like [Phoenix dactylifera]
 ref|XP_008784859.1| PREDICTED: F-box protein At5g46170-like [Phoenix dactylifera]
Length=410

 Score = 59.3 bits (142),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvv----rvdcvis  447
            E +D+FDRLPD L+L VFN IGDVKALGRCCVVS RFHSLVP VD VVV     +    +
Sbjct  29   EGIDYFDRLPDLLLLDVFNRIGDVKALGRCCVVSHRFHSLVPLVDYVVVHVDCVISDDPA  88

Query  448  dEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFI  588
                S+ ++      A  DK R   S + RLVF  L+KP Q+L Q +
Sbjct  89   PSSSSTTAAGCGGGGAGPDKGRGVFSHLTRLVFGSLVKPLQALGQIL  135


 Score = 26.2 bits (56),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++F EI+ LRIELPS
Sbjct  168  PTEVLKNFKEIRRLRIELPS  187



>dbj|BAJ95685.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 69/133 (52%), Gaps = 23/133 (17%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssp  468
            DHFD +PDSL+LL+FN + D ++LGRC  VS+RF++LVP VD+  +R+D VI+ +D  + 
Sbjct  19   DHFDSVPDSLVLLIFNKLADARSLGRCSAVSRRFNALVPLVDDACLRIDRVIAADDAPAG  78

Query  469  sssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGEFDQ  648
                        + R  IS +L+ V   +LKPF         +            G    
Sbjct  79   P-----------RQRGVISGLLKTVLLAVLKPFGHCDAGARPA------------GHAPA  115

Query  649  SSVTHHSPTQVLK  687
                HHSP QVLK
Sbjct  116  KHAPHHSPAQVLK  128



>ref|XP_008804990.1| PREDICTED: F-box protein At4g18380-like isoform X2 [Phoenix dactylifera]
Length=354

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P    D+FDR+PDSL+LL+FN + DV++LGRC  VSKRF+SL
Sbjct  5    TRIHADPSLNEDYFDRIPDSLVLLIFNNLADVQSLGRCSAVSKRFNSL  52



>ref|XP_008804989.1| PREDICTED: F-box protein At4g18380-like isoform X1 [Phoenix dactylifera]
Length=421

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = +1

Query  235  DMGSVRPDLSCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            ++G  +     R++ +P    D+FDR+PDSL+LL+FN + DV++LGRC  VSKRF+SL
Sbjct  62   ELGPEKMQSKTRIHADPSLNEDYFDRIPDSLVLLIFNNLADVQSLGRCSAVSKRFNSL  119



>ref|XP_010907539.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010907541.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 83/147 (56%), Gaps = 21/147 (14%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++ +P    DHFD +PD L+LL+FN + DV++LGR   VSKRF+SLVP V +V V++D
Sbjct  5    TRIHADPSLNEDHFDWIPDPLVLLIFNKLADVRSLGRASAVSKRFNSLVPLVHDVYVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaa  615
             V++  DG        A   +S K R+ +S +L+L+F  +LKPF  L    S +   +  
Sbjct  65   RVVTV-DG----DLDEALNLSSPKPRNLLSHLLKLMFLTVLKPFHHLQNTSSGNKPLL--  117

Query  616  ssaLEDGEFDQSSVTHHSPTQVLKILT  696
                         ++HHSP QVLK  T
Sbjct  118  -----------PQLSHHSPAQVLKNFT  133



>ref|XP_004984553.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=371

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 75/136 (55%), Gaps = 15/136 (11%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDG  459
            E  DHFDR+PDSL+L++FN + D ++LGRC  VS+RF++LVP VD+  +R+D VI  + G
Sbjct  17   EGEDHFDRVPDSLVLIIFNKLADARSLGRCSAVSRRFNALVPLVDDACLRIDRVIPADGG  76

Query  460  sspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDGE  639
                +   A A    + R  +S +L+ +   +LKPF               A S    G+
Sbjct  77   DGADALGLAGAP---RPRAVLSHLLKAMLNAVLKPFAHCD-----------AKSGAHGGK  122

Query  640  FDQSSVTHHSPTQVLK  687
              Q    HHSP QVLK
Sbjct  123  HSQQQ-QHHSPAQVLK  137



>ref|XP_010922958.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922959.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922960.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922961.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922962.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 80/144 (56%), Gaps = 21/144 (15%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++  P    D FDR+PDSL+LL+ N I DV++LGRC  VSKRF+SL+P V +V V++D
Sbjct  5    TRIHAHPSLEQDQFDRIPDSLVLLILNKIADVRSLGRCSAVSKRFNSLIPLVHDVYVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaa  615
             V++  DG        A   +S K+R+  S  L+L+   LLKPF  L      +      
Sbjct  65   RVVTV-DG----DYDDAFNPSSPKARNLFSHFLKLLIFTLLKPFHHLRNTHGGNKPL---  116

Query  616  ssaLEDGEFDQSSVTHHSPTQVLK  687
                    F Q  ++HHSP QVLK
Sbjct  117  --------FPQ--LSHHSPAQVLK  130



>ref|NP_001049959.1| Os03g0321300 [Oryza sativa Japonica Group]
 gb|ABF95667.1| F-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11873.1| Os03g0321300 [Oryza sativa Japonica Group]
 dbj|BAG92352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=384

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VSKRF+SL
Sbjct  19   EGEDHFDRVPDSLVLLIFNRLADARSLGRCSAVSKRFNSL  58



>gb|EEC75147.1| hypothetical protein OsI_11347 [Oryza sativa Indica Group]
Length=384

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VSKRF+SL
Sbjct  19   EGEDHFDRVPDSLVLLIFNRLADARSLGRCSAVSKRFNSL  58



>gb|EEE58967.1| hypothetical protein OsJ_10655 [Oryza sativa Japonica Group]
Length=370

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VSKRF+SL
Sbjct  19   EGEDHFDRVPDSLVLLIFNRLADARSLGRCSAVSKRFNSL  58



>ref|XP_006651329.1| PREDICTED: F-box protein At5g46170-like [Oryza brachyantha]
Length=324

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VSKRF++L
Sbjct  18   EGEDHFDRVPDSLVLLIFNRLADARSLGRCSAVSKRFNAL  57



>ref|XP_002307387.1| F-box family protein [Populus trichocarpa]
 gb|EEE94383.1| F-box family protein [Populus trichocarpa]
Length=312

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E +D FDRLPDSLILL+FN I D+KAL RC  VSKRF+SL
Sbjct  3    EAMDGFDRLPDSLILLIFNSISDIKALIRCRSVSKRFNSL  42



>ref|XP_009404692.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404693.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=384

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 84/146 (58%), Gaps = 21/146 (14%)
 Frame = +1

Query  268  RVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdc  438
            R++ +P    DHFD++PDSL+LL+FN + D+++LGRC  VSKRF+ L PQV +V VR+  
Sbjct  36   RIHADPSLYQDHFDQIPDSLVLLIFNKVADIRSLGRCLAVSKRFNILAPQVHDVYVRIGR  95

Query  439  visdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaas  618
            V+   DG +  +   ++     K R+ ++ +L+L+   +LKPFQ L  F +     +   
Sbjct  96   VVPV-DGDAEEALTLSS----PKPRNLLAHLLKLMLFAILKPFQHLQNFSAGHKPLL---  147

Query  619  saLEDGEFDQSSVTHHSPTQVLKILT  696
                        ++HHSP QVLK  T
Sbjct  148  ----------PHLSHHSPAQVLKKFT  163



>ref|XP_011043565.1| PREDICTED: F-box protein At1g22220-like [Populus euphratica]
Length=321

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E +D FDRLPDSLILL+FN I D+KAL RC  VSKRF+SL
Sbjct  12   EEMDGFDRLPDSLILLIFNSISDIKALIRCRSVSKRFNSL  51



>gb|AFW88518.1| hypothetical protein ZEAMMB73_307153 [Zea mays]
Length=435

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VS+RF++L
Sbjct  74   EGEDHFDRVPDSLVLLIFNKVADARSLGRCSAVSRRFNAL  113



>ref|XP_008672792.1| PREDICTED: F-box domain containing protein isoform X1 [Zea mays]
 tpg|DAA57445.1| TPA: F-box domain containing protein [Zea mays]
Length=401

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 83/144 (58%), Gaps = 8/144 (6%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnv------vvrvdcv  441
            E  D F+RL D+++L V N IGDVKALGRC +VS+RFH+LVP VD+V      V+  D  
Sbjct  17   EAADQFERLHDAVLLDVLNRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVIPDDPP  76

Query  442  isdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaass  621
             S    ++P +S   A A + + R  ++ I R++  G+ +P  +L Q +S +   V+  S
Sbjct  77   PSSSSSAAPGTSPRQAPAPAARGRGALAHIARVLLGGIARPIHALGQILSPAAAAVSRRS  136

Query  622  aL--EDGEFDQSSVTHHSPTQVLK  687
                       + V+HHSP++VL+
Sbjct  137  EALPASPRAPVADVSHHSPSEVLR  160



>gb|AAT69637.1| unknown protein, contains f-box domain [Oryza sativa Japonica 
Group]
 gb|EAY98512.1| hypothetical protein OsI_20423 [Oryza sativa Indica Group]
 dbj|BAG92711.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64186.1| hypothetical protein OsJ_19018 [Oryza sativa Japonica Group]
Length=351

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   D FDRLPDSL+L++ N + DV++LGRC  VSKRF+ L
Sbjct  2    ARIHADPVLEADQFDRLPDSLVLVILNNVEDVRSLGRCSAVSKRFYGL  49



>ref|XP_002467943.1| hypothetical protein SORBIDRAFT_01g036900 [Sorghum bicolor]
 gb|EER94941.1| hypothetical protein SORBIDRAFT_01g036900 [Sorghum bicolor]
Length=380

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VS+RF++L
Sbjct  17   EGEDHFDRVPDSLVLLIFNKLADARSLGRCSAVSRRFNAL  56



>ref|XP_006654574.1| PREDICTED: F-box protein At4g18380-like [Oryza brachyantha]
Length=352

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P   VD FDRLPDSL+L++ N + DV++LGRC  VSKRF+ L
Sbjct  5    ARIHADPLLEVDQFDRLPDSLVLVILNNVEDVRSLGRCSAVSKRFYGL  52



>ref|XP_008792446.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
 ref|XP_008792447.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++  P    D FDR+PDSL+LL+ N I DV++LGRC  VSKRF+SL
Sbjct  5    TRIHAHPSLDQDQFDRIPDSLVLLILNKIADVRSLGRCSAVSKRFNSL  52



>ref|NP_001055899.2| Os05g0490300 [Oryza sativa Japonica Group]
 dbj|BAF17813.2| Os05g0490300, partial [Oryza sativa Japonica Group]
Length=450

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   D FDRLPDSL+L++ N + DV++LGRC  VSKRF+ L
Sbjct  101  ARIHADPVLEADQFDRLPDSLVLVILNNVEDVRSLGRCSAVSKRFYGL  148



>ref|XP_008676229.1| PREDICTED: F-box protein At5g46170-like [Zea mays]
Length=267

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDR+PDSL+LL+FN + D ++LGRC  VS+RF +L
Sbjct  9    EGEDHFDRVPDSLVLLIFNKLADARSLGRCSAVSRRFSAL  48



>ref|XP_010904742.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 81/147 (55%), Gaps = 21/147 (14%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++ +P    D FDR+PDSL+LL+ N I DV++LGRC  VSKRF+ LVP V +V V++D
Sbjct  5    TRIHADPSLDQDQFDRIPDSLVLLILNKIADVRSLGRCSAVSKRFNFLVPLVHDVYVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaa  615
             V++  DG S  +   ++     K R+  S  L+L+   +LKPF  L      +      
Sbjct  65   RVVTV-DGDSDDALNPSSL----KPRNFFSHFLKLMMFTILKPFHHLHNTNGGNKPL---  116

Query  616  ssaLEDGEFDQSSVTHHSPTQVLKILT  696
                    F Q  ++HHSP QVLK  T
Sbjct  117  --------FPQ--LSHHSPAQVLKNFT  133



>ref|XP_006854457.1| PREDICTED: F-box protein At5g46170 [Amborella trichopoda]
 gb|ERN15924.1| hypothetical protein AMTR_s00039p00227540 [Amborella trichopoda]
Length=354

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 80/137 (58%), Gaps = 24/137 (18%)
 Frame = +1

Query  277  PEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdED  456
            P   DHF+RLPDS++LL+FN + D+K+LG C  VSKRF SL+P V++++++VDCVI+D++
Sbjct  13   PLLADHFERLPDSVLLLIFNKVQDIKSLGLCLSVSKRFFSLIPMVEDILIKVDCVITDDE  72

Query  457  GsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaassaLEDG  636
                          + ++R  +S +L++V    +K  ++  + ++               
Sbjct  73   -----------DPINSRTRGFLSHLLKMVMGSFVKSLEAFHKLVTPQ-------------  108

Query  637  EFDQSSVTHHSPTQVLK  687
            +   S VTHHSP +VLK
Sbjct  109  KIRVSEVTHHSPVEVLK  125



>ref|XP_004970106.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=411

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 78/145 (54%), Gaps = 9/145 (6%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdn-------vvvrvdc  438
            E  D FDRL D+++L V N IGDVKALGRC +VS+RFH+LVP VD+       V+     
Sbjct  23   EAGDQFDRLHDAVLLDVLNRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVIPDDPP  82

Query  439  visdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaas  618
              +     SP        A + + R  ++ I R++  G+ +P  +L Q +S +   V+  
Sbjct  83   HPAPPAPGSPQHQQQQHQAPAARGRGALAHIARVLLGGIARPIHALGQILSPAAAAVSRR  142

Query  619  saLEDGEFDQSS--VTHHSPTQVLK  687
            S  +       +  V+HHSP++VL+
Sbjct  143  SEPQPASPPAPAADVSHHSPSEVLR  167



>ref|XP_008786757.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
 ref|XP_008786758.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDR+PDSL+LL+ N I DV++LGRC  VSKRF++L
Sbjct  16   DQFDRIPDSLVLLILNKIADVRSLGRCSAVSKRFNAL  52



>ref|NP_001146920.1| F-box domain containing protein [Zea mays]
 gb|ACG24418.1| F-box domain containing protein [Zea mays]
Length=406

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 13/149 (9%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvp-----------qvdnvvv  426
            E  D F+RL D+++L V N IGDVKALGRC +VS+RFH+LVP            + +   
Sbjct  17   EAADQFERLHDAVLLDVLNRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVIPDDPP  76

Query  427  rvdcvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprr  606
                  S    ++P +    A A + + R  ++ I+R++  G+ +P  +L Q +S +   
Sbjct  77   PSSSSSSSSSSAAPGTPPRQAPAPTARGRGALAHIVRVLLGGIARPIHALGQILSPAAAA  136

Query  607  vaassaL--EDGEFDQSSVTHHSPTQVLK  687
            V+  S           + V+HHSP++VL+
Sbjct  137  VSRRSEALPASPRAPVADVSHHSPSEVLR  165



>ref|XP_002458563.1| hypothetical protein SORBIDRAFT_03g035810 [Sorghum bicolor]
 gb|EES03683.1| hypothetical protein SORBIDRAFT_03g035810 [Sorghum bicolor]
Length=418

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  262  SCRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +C    E  D F+RL D+++L V N IGDVKALGRC +VS+RFH+L
Sbjct  24   TCGGGAEAADQFERLHDAVLLDVLNRIGDVKALGRCALVSRRFHAL  69



>ref|NP_001132514.1| uncharacterized protein LOC100193974 [Zea mays]
 gb|ACF81382.1| unknown [Zea mays]
Length=359

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            DHFDR+PDSL+LL+FN + D ++LGRC  VS+RF +L
Sbjct  22   DHFDRVPDSLVLLIFNKLADARSLGRCSAVSRRFSAL  58



>gb|ACG40631.1| F-box domain containing protein [Zea mays]
Length=358

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            DHFDR+PDSL+LL+FN + D ++LGRC  VS+RF +L
Sbjct  22   DHFDRVPDSLVLLIFNKLADARSLGRCSAVSRRFSAL  58



>ref|XP_002455973.1| hypothetical protein SORBIDRAFT_03g028320 [Sorghum bicolor]
 gb|EES01093.1| hypothetical protein SORBIDRAFT_03g028320 [Sorghum bicolor]
Length=418

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +1

Query  265  CRVYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            C    E  D F+RL D+++L V N IGDVKALGRC +VS+RFH+L
Sbjct  25   CGGGSEAADQFERLHDAVLLDVLNRIGDVKALGRCALVSRRFHAL  69



>ref|XP_009420961.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=348

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            DHFDR+PDSL+L++FN + D+++LGR   VSKRF++L
Sbjct  10   DHFDRIPDSLVLVIFNKLADIQSLGRSSTVSKRFNAL  46



>ref|XP_012067843.1| PREDICTED: F-box protein At1g22220 [Jatropha curcas]
 gb|KDP41362.1| hypothetical protein JCGZ_15769 [Jatropha curcas]
Length=324

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLILL+FN + D+K L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLILLIFNSVSDIKTLIRCLSVSKRFNSL  38



>ref|XP_004150662.2| PREDICTED: F-box protein At1g22220 [Cucumis sativus]
 gb|KGN62167.1| hypothetical protein Csa_2G307320 [Cucumis sativus]
Length=350

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  271  VYPEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +Y    D F+ LPDSLILL+FN + DVK L RC  VSKRF+SL
Sbjct  24   IYTNDADAFESLPDSLILLIFNSVSDVKTLIRCRAVSKRFNSL  66



>gb|ACG24953.1| F-box domain containing protein [Zea mays]
Length=354

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R+Y +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIYADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|XP_002456519.1| hypothetical protein SORBIDRAFT_03g037710 [Sorghum bicolor]
 gb|EES01639.1| hypothetical protein SORBIDRAFT_03g037710 [Sorghum bicolor]
Length=354

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   D FD LPDSL+LL+ N + DV++LGRC  VSKRF  L
Sbjct  5    ARIHADPVLEFDQFDGLPDSLVLLILNKLEDVRSLGRCSAVSKRFSGL  52



>ref|NP_001130615.1| uncharacterized LOC100191714 [Zea mays]
 gb|ACF78905.1| unknown [Zea mays]
 gb|ACF81071.1| unknown [Zea mays]
 gb|ACL52912.1| unknown [Zea mays]
 gb|ACR35595.1| unknown [Zea mays]
 gb|AFW78474.1| F-box domain containing protein isoform 1 [Zea mays]
 gb|AFW78475.1| F-box domain containing protein isoform 2 [Zea mays]
Length=354

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 80/147 (54%), Gaps = 21/147 (14%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   LVP V +V V++D
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGLVPLVHDVYVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaa  615
             V++  DG     +  A   +S K R+  S  L+L+   ++KPF ++             
Sbjct  65   RVVAV-DG----DAEDALNLSSPKPRNIFSHFLKLMLFTIIKPFHNMRNPNGTGRSL---  116

Query  616  ssaLEDGEFDQSSVTHHSPTQVLKILT  696
                    F Q  ++HHSP QVL+  T
Sbjct  117  --------FPQ--LSHHSPAQVLRNFT  133



>gb|ACG44263.1| F-box domain containing protein [Zea mays]
Length=354

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 79/147 (54%), Gaps = 21/147 (14%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   LVP V +V V++D
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGLVPLVHDVYVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaa  615
             V++  DG     +  A   +S K R+  S  L+L+   ++KPF ++             
Sbjct  65   RVVAV-DG----DAEDALNLSSPKPRNIFSHFLKLMLFTIIKPFHNMRN-----------  108

Query  616  ssaLEDGEFDQSSVTHHSPTQVLKILT  696
                  G      ++HHSP QVL+  T
Sbjct  109  --PNGTGRSLFPQLSHHSPAQVLRNFT  133



>ref|XP_009406821.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406822.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDR+PD LIL++FN + D ++LGRC  VS+RF SL
Sbjct  16   DQFDRIPDPLILVIFNKLADARSLGRCAAVSRRFRSL  52



>ref|XP_006355980.1| PREDICTED: uncharacterized protein LOC102590130 [Solanum tuberosum]
Length=182

 Score = 45.4 bits (106),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  553  LLKPFQSLSQFIsasprrvaassaLEDGEFDQSSVTHHSPTQVLK  687
             +KPFQSL+Q IS S RR  ASS+L D +F+Q  VTHHSPTQ+LK
Sbjct  103  FVKPFQSLTQLISISSRRCTASSSLVDDDFEQKFVTHHSPTQLLK  147


 Score = 31.2 bits (69),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%), Gaps = 0/20 (0%)
 Frame = +3

Query  669  PHSGLEDFNEIKLLRIELPS  728
            P   L++F+EIKLLRIELPS
Sbjct  142  PTQLLKNFDEIKLLRIELPS  161



>ref|XP_006434013.1| hypothetical protein CICLE_v10001889mg [Citrus clementina]
 gb|ESR47253.1| hypothetical protein CICLE_v10001889mg [Citrus clementina]
Length=316

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +DHFD+LPD+LILL+F+ + DVK L RC  VSKRF+SL
Sbjct  1    MDHFDQLPDALILLIFSSVSDVKTLIRCRSVSKRFNSL  38



>gb|KDO80923.1| hypothetical protein CISIN_1g041814mg [Citrus sinensis]
Length=316

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +DHFD+LPD+LILL+F+ + DVK L RC  VSKRF+SL
Sbjct  1    MDHFDQLPDALILLIFSSVSDVKTLIRCRSVSKRFNSL  38



>gb|KJB64313.1| hypothetical protein B456_010G042500 [Gossypium raimondii]
Length=302

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FD+LPDSLILL+FN + DVK+L RC  VSKRF+SL
Sbjct  1    MDGFDQLPDSLILLIFNSVSDVKSLIRCRSVSKRFNSL  38



>ref|XP_004961674.1| PREDICTED: F-box protein At4g18380-like [Setaria italica]
Length=354

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 21/147 (14%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++ +PV   D FD LPDSL+LL+ N + DV++LGRC  VSKRF  LV  V +V V++D
Sbjct  5    ARIHADPVLEVDQFDCLPDSLVLLILNKVEDVRSLGRCSAVSKRFCGLVSLVHDVYVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaa  615
             V+   DG     +  A   +S K R+  S  L+L+   ++KPF ++             
Sbjct  65   RVVGV-DG----DAEDALNLSSPKPRNIFSHFLKLMLFTIIKPFHNMRN-----------  108

Query  616  ssaLEDGEFDQSSVTHHSPTQVLKILT  696
                 +G    + ++ HSP QVL+  T
Sbjct  109  --PNGNGRPLFAQLSQHSPAQVLRNFT  133



>ref|XP_002313372.1| hypothetical protein POPTR_0009s05230g [Populus trichocarpa]
 gb|EEE87327.1| hypothetical protein POPTR_0009s05230g [Populus trichocarpa]
Length=361

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDRLPD+L+L++FN +GD K+L RC  VSKRF SL
Sbjct  26   DCFDRLPDALLLVIFNKVGDAKSLTRCISVSKRFASL  62



>ref|XP_003568215.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=356

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +1

Query  265  CRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV     D FD LPDSL+LL+ N + DV++LGRC   SKRF+ L
Sbjct  5    ARIHADPVLEFEVDQFDCLPDSLVLLILNKVEDVRSLGRCSAASKRFYGL  54



>ref|XP_007015207.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY32826.1| F-box family protein, putative [Theobroma cacao]
Length=354

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D+FDRLPD+L+L +FN + D K+LG C +VSKRF SL
Sbjct  12   DNFDRLPDALLLFIFNKLQDAKSLGNCLLVSKRFFSL  48



>ref|XP_002279458.1| PREDICTED: F-box protein At5g46170-like [Vitis vinifera]
Length=341

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  283  PVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            P DHFDRL D L+ L+FN + D K+L RC VVSKRF SL
Sbjct  7    PDDHFDRLSDELVTLIFNKVLDAKSLCRCSVVSKRFASL  45



>ref|XP_010277597.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=372

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E  DHFDRL DSL+ L+FN I D K LGRC  V KRF SL
Sbjct  8    EADDHFDRLHDSLLCLIFNKIQDAKTLGRCLAVCKRFSSL  47



>ref|XP_008654796.1| PREDICTED: uncharacterized protein LOC100279399 isoform X1 [Zea 
mays]
 gb|ACF85349.1| unknown [Zea mays]
 gb|AFW82355.1| F-box domain containing protein isoform 1 [Zea mays]
 gb|AFW82356.1| F-box domain containing protein isoform 2 [Zea mays]
Length=354

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>gb|ACG36557.1| F-box domain containing protein [Zea mays]
Length=354

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>gb|ACR36872.1| unknown [Zea mays]
Length=354

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|XP_008445343.1| PREDICTED: F-box protein At1g22220 [Cucumis melo]
Length=348

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FD LPDSLILL+FN + DVK L RC  VSKRF+SL
Sbjct  26   DGFDSLPDSLILLIFNSVSDVKTLIRCRAVSKRFNSL  62



>ref|XP_002441291.1| hypothetical protein SORBIDRAFT_09g023970 [Sorghum bicolor]
 gb|EES19721.1| hypothetical protein SORBIDRAFT_09g023970 [Sorghum bicolor]
Length=354

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHADPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|XP_003564454.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=354

 Score = 52.4 bits (124),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 60/107 (56%), Gaps = 8/107 (7%)
 Frame = +1

Query  265  CRVYPEP---VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++ +P   +D  D LPD+L+LL+ N + DV++LGRC  VSKRF+ L   + + V    
Sbjct  5    ARIHADPALQLDQIDCLPDALVLLILNKLEDVRSLGRCSAVSKRFNEL-VPLVHDVYVKI  63

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
              +   DG     +  A   +S K+RH  S  ++L+   ++KPF S+
Sbjct  64   DRVVTADG----DADDAFNLSSPKARHIFSHFIKLMLFTIVKPFHSM  106


 Score = 22.3 bits (46),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  681  LEDFNEIKLLRIELPS  728
            L++F+ ++ LR+ELPS
Sbjct  129  LKNFSHVRNLRVELPS  144



>ref|XP_003558028.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=372

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  292  HFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            HFD +PDSL+LL+FN + D ++LGRC  VS+RF++L
Sbjct  23   HFDSVPDSLVLLIFNKLADARSLGRCSAVSRRFNAL  58



>ref|XP_007227716.1| hypothetical protein PRUPE_ppa009011mg [Prunus persica]
 gb|EMJ28915.1| hypothetical protein PRUPE_ppa009011mg [Prunus persica]
Length=310

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLIL +F+++ DVK L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLILQIFDLVSDVKTLIRCRAVSKRFNSL  38



>ref|NP_001145883.1| uncharacterized protein LOC100279399 [Zea mays]
 gb|ACL52786.1| unknown [Zea mays]
Length=354

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   DHFD LPDSL+LL+ N + DV++LGRC  VSKR   L
Sbjct  5    ARIHVDPVREVDHFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGL  52



>ref|XP_011016269.1| PREDICTED: F-box protein At1g22220 [Populus euphratica]
Length=323

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E ++ FDRLPDSLILL+FN I D+K L  C  VSKRF+SL
Sbjct  10   EAMNGFDRLPDSLILLIFNSISDIKTLICCRSVSKRFNSL  49



>ref|XP_006386402.1| hypothetical protein POPTR_0002s09520g [Populus trichocarpa]
 gb|ERP64199.1| hypothetical protein POPTR_0002s09520g [Populus trichocarpa]
Length=323

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  280  EPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            E ++ FDRLPDSLILL+FN I D+K L  C  VSKRF+SL
Sbjct  10   EAMNGFDRLPDSLILLIFNSISDIKTLICCRSVSKRFNSL  49



>ref|XP_002284195.1| PREDICTED: F-box protein At1g22220 [Vitis vinifera]
Length=320

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDRLPD LIL++FN + D+K L RC  VSKRF+SL
Sbjct  7    DSFDRLPDPLILVIFNSVADIKTLIRCRAVSKRFNSL  43



>ref|NP_001182880.1| hypothetical protein [Zea mays]
 gb|ACR35006.1| unknown [Zea mays]
 tpg|DAA57163.1| TPA: hypothetical protein ZEAMMB73_107043 [Zea mays]
Length=350

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 76/144 (53%), Gaps = 21/144 (15%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvd  435
             R++ +PV   D FD L DSL+LL+ N + DV++LGRC  VSKRF  LV  V +V V++D
Sbjct  5    ARIHADPVHEFDQFDCLHDSLVLLILNKLEDVRSLGRCSAVSKRFSGLVLLVHDVRVKID  64

Query  436  cvisdEDGsspsssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSLSQFIsasprrvaa  615
             V++ + G     +  A   +S K  + IS + +++   + KPF  +   ISA       
Sbjct  65   HVVTVDGG-----ADDALNLSSPKPHNIISHLFKMMLFAIAKPFHDMRSPISA-------  112

Query  616  ssaLEDGEFDQSSVTHHSPTQVLK  687
                  G      ++ HSP QVLK
Sbjct  113  ------GRLLFPQLSQHSPVQVLK  130



>ref|XP_004970320.1| PREDICTED: F-box protein At1g30200-like [Setaria italica]
Length=354

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +PV   D FD LPDSL+LL+ N + DV++LGRC  VS+RF  L
Sbjct  5    ARIHADPVLEFDRFDCLPDSLVLLILNKLEDVRSLGRCSAVSRRFSCL  52



>ref|XP_007018808.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY16033.1| F-box family protein, putative [Theobroma cacao]
Length=304

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D  D+LPDSLILL+FN + DVK L RC  VSKRF+SL
Sbjct  1    MDGLDQLPDSLILLIFNSVSDVKTLIRCRSVSKRFNSL  38



>ref|XP_008219667.1| PREDICTED: F-box protein At1g22220 [Prunus mume]
Length=324

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLIL +F+ + DVK L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLILQIFDSVSDVKTLIRCRAVSKRFNSL  38



>ref|XP_008374968.1| PREDICTED: F-box protein At1g22220-like [Malus domestica]
Length=320

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLIL +F+ + D+K L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLILQIFDSVSDIKTLIRCRAVSKRFNSL  38



>ref|XP_009369664.1| PREDICTED: F-box protein At1g22220 [Pyrus x bretschneideri]
Length=323

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLIL +F+ + D+K L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLILQIFDSVSDIKTLIRCRAVSKRFNSL  38



>ref|XP_002513900.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48483.1| conserved hypothetical protein [Ricinus communis]
Length=303

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FDRLPDSLI+L+FN +  +K L RC  VSKRF+SL
Sbjct  1    MDGFDRLPDSLIVLIFNSVSHIKTLIRCRSVSKRFNSL  38



>dbj|BAB90386.1| P0432B10.4 [Oryza sativa Japonica Group]
Length=451

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = +1

Query  259  LSCRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            L  R++ +P    D FD LPD ++LL+ N + DV++LGRC  VSKRF  L
Sbjct  95   LRARIHADPAPEFDQFDCLPDPVVLLILNKLEDVRSLGRCAAVSKRFSGL  144



>ref|XP_009786216.1| PREDICTED: F-box protein At1g78100 [Nicotiana sylvestris]
Length=345

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDR+PD LI L+FN I D+K L RC  VSKRF+SL
Sbjct  9    DGFDRIPDPLINLIFNQISDIKTLIRCRSVSKRFNSL  45



>ref|XP_009600740.1| PREDICTED: F-box protein At1g78100 [Nicotiana tomentosiformis]
Length=344

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDR+PD LI L+FN I D+K L RC  VSKRF+SL
Sbjct  9    DGFDRIPDPLINLIFNQISDIKTLIRCRSVSKRFNSL  45



>dbj|BAJ85411.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +1

Query  265  CRVYPEPV-----DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P      D FD LPDS++LL+ N + DV++LGRC   SKRF+ L
Sbjct  5    ARIHADPALELEDDRFDCLPDSIVLLILNKVEDVRSLGRCSAASKRFNGL  54



>ref|XP_006353995.1| PREDICTED: F-box protein At1g78100-like isoform X1 [Solanum tuberosum]
 ref|XP_006353996.1| PREDICTED: F-box protein At1g78100-like isoform X2 [Solanum tuberosum]
 ref|XP_006353997.1| PREDICTED: F-box protein At1g78100-like isoform X3 [Solanum tuberosum]
 ref|XP_006353998.1| PREDICTED: F-box protein At1g78100-like isoform X4 [Solanum tuberosum]
Length=340

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDRLPD LI L+FN I D+K L RC  VSKRF+SL
Sbjct  9    DGFDRLPDPLIHLMFNQISDIKTLIRCRSVSKRFNSL  45



>ref|XP_010269221.1| PREDICTED: F-box protein At1g22220-like [Nelumbo nucifera]
Length=346

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDR+PD ++LL+FN + D+K+L RC  VSKRF+SL
Sbjct  9    DVFDRIPDPIVLLIFNHLSDIKSLIRCRAVSKRFNSL  45



>ref|XP_004237895.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
 ref|XP_010320162.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
 ref|XP_010320163.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
 ref|XP_010320164.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
Length=340

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDRLPD LI L+FN I D+K L RC  VSKRF+SL
Sbjct  9    DGFDRLPDPLIHLMFNQISDIKTLIRCRSVSKRFNSL  45



>ref|XP_010270680.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010270681.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=351

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 63/95 (66%), Gaps = 5/95 (5%)
 Frame = +1

Query  292  HFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSLvpqvdnvvvrvdcvisdEDGssps  471
             FD++PDS++L++ N + D+++LGRC  V KRF+SLVP V +V +++D V++        
Sbjct  19   EFDKIPDSVVLIILNKLADIRSLGRCTAVCKRFNSLVPYVHDVYIKIDEVVTING-----  73

Query  472  ssaaaaaaasDKSRHPISSILRLVFTGLLKPFQSL  576
             S  ++ ++S K R+  S++L+ +F  LLKPF  L
Sbjct  74   DSDESSYSSSHKPRNFFSNLLKYMFLNLLKPFHHL  108



>ref|XP_010246617.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246618.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246619.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246620.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246621.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=351

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 6/52 (12%)
 Frame = +1

Query  262  SCRVYPEPVD------HFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            S R+Y   +D       FD++PDS++L++ N + D+++LGRC  V KRF+SL
Sbjct  3    SNRIYYADLDDDVDQGEFDKIPDSVVLIILNKLADIRSLGRCTAVCKRFNSL  54



>ref|XP_010105899.1| F-box protein [Morus notabilis]
 gb|EXC06718.1| F-box protein [Morus notabilis]
Length=348

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  286  VDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            +D FD+LPDSLILL+FN + D+K L RC  V +RF+SL
Sbjct  1    MDGFDQLPDSLILLIFNSVSDIKTLLRCRAVCQRFNSL  38



>ref|XP_011032098.1| PREDICTED: F-box protein At4g18380-like [Populus euphratica]
Length=342

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  289  DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            D FDRLPD+L+L++FN + D K+L RC  VSKRF SL
Sbjct  7    DCFDRLPDALLLVIFNKVVDAKSLTRCISVSKRFASL  43



>ref|NP_001044594.1| Os01g0812200 [Oryza sativa Japonica Group]
 dbj|BAD68209.1| F-box protein family-like [Oryza sativa Japonica Group]
 dbj|BAF06508.1| Os01g0812200 [Oryza sativa Japonica Group]
 gb|EAZ13910.1| hypothetical protein OsJ_03835 [Oryza sativa Japonica Group]
 dbj|BAG93081.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96606.1| unnamed protein product [Oryza sativa Japonica Group]
Length=353

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P    D FD LPD ++LL+ N + DV++LGRC  VSKRF  L
Sbjct  5    ARIHADPAPEFDQFDCLPDPVVLLILNKLEDVRSLGRCAAVSKRFSGL  52



>gb|EAY76237.1| hypothetical protein OsI_04173 [Oryza sativa Indica Group]
Length=353

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +1

Query  265  CRVYPEPV---DHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
             R++ +P    D FD LPD ++LL+ N + DV++LGRC  VSKRF  L
Sbjct  5    ARIHADPAPEFDQFDCLPDPVVLLILNKLEDVRSLGRCAAVSKRFSGL  52



>dbj|BAJ87191.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +1

Query  277  PEPVDHFDRLPDSLILLVFNMIGDVKALGRCCVVSKRFHSL  399
            PEP D  D LPDSL+LL+ N + DV +LGRC  VS+RF+ L
Sbjct  14   PEP-DRMDCLPDSLVLLILNKLEDVHSLGRCSAVSRRFNEL  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1350961752362