BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7255

Length=952
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592675.1|  PREDICTED: uncharacterized protein LOC104089...    285   6e-85   Nicotiana tomentosiformis
ref|XP_009592672.1|  PREDICTED: uncharacterized protein LOC104089...    285   2e-84   Nicotiana tomentosiformis
ref|XP_009592673.1|  PREDICTED: uncharacterized protein LOC104089...    285   2e-84   Nicotiana tomentosiformis
ref|XP_009770291.1|  PREDICTED: uncharacterized protein LOC104221...    280   5e-83   Nicotiana sylvestris
ref|XP_009770284.1|  PREDICTED: uncharacterized protein LOC104221...    280   2e-82   Nicotiana sylvestris
ref|XP_009770277.1|  PREDICTED: uncharacterized protein LOC104221...    280   2e-82   Nicotiana sylvestris
ref|XP_009780629.1|  PREDICTED: uncharacterized protein LOC104229...    272   4e-80   Nicotiana sylvestris
ref|XP_009780628.1|  PREDICTED: uncharacterized protein LOC104229...    272   4e-80   Nicotiana sylvestris
ref|XP_009780624.1|  PREDICTED: uncharacterized protein LOC104229...    273   6e-80   Nicotiana sylvestris
ref|XP_009780627.1|  PREDICTED: uncharacterized protein LOC104229...    273   7e-80   Nicotiana sylvestris
ref|XP_009589098.1|  PREDICTED: uncharacterized protein LOC104086...    271   1e-79   Nicotiana tomentosiformis
ref|XP_009589097.1|  PREDICTED: uncharacterized protein LOC104086...    271   2e-79   Nicotiana tomentosiformis
ref|XP_009589093.1|  PREDICTED: uncharacterized protein LOC104086...    271   2e-79   Nicotiana tomentosiformis
ref|XP_006350289.1|  PREDICTED: uncharacterized protein LOC102583747    259   3e-75   Solanum tuberosum [potatoes]
ref|XP_008235543.1|  PREDICTED: uncharacterized protein LOC103334363    258   2e-74   Prunus mume [ume]
ref|XP_006352720.1|  PREDICTED: uncharacterized protein LOC102578...    255   1e-73   
ref|XP_006352716.1|  PREDICTED: uncharacterized protein LOC102578...    256   1e-73   Solanum tuberosum [potatoes]
ref|XP_006352719.1|  PREDICTED: uncharacterized protein LOC102578...    256   1e-73   Solanum tuberosum [potatoes]
ref|XP_006352718.1|  PREDICTED: uncharacterized protein LOC102578...    256   1e-73   
ref|XP_006352717.1|  PREDICTED: uncharacterized protein LOC102578...    256   1e-73   Solanum tuberosum [potatoes]
ref|XP_010323077.1|  PREDICTED: uncharacterized protein LOC101266...    255   1e-73   Solanum lycopersicum
ref|XP_010323073.1|  PREDICTED: uncharacterized protein LOC101266...    255   2e-73   
ref|XP_010323074.1|  PREDICTED: uncharacterized protein LOC101266...    255   2e-73   
ref|XP_010323076.1|  PREDICTED: uncharacterized protein LOC101266...    251   2e-72   
ref|XP_010323075.1|  PREDICTED: uncharacterized protein LOC101266...    251   2e-72   
ref|XP_007199004.1|  hypothetical protein PRUPE_ppa000852mg             250   9e-72   Prunus persica
ref|XP_009371001.1|  PREDICTED: uncharacterized protein LOC103960...    247   8e-71   Pyrus x bretschneideri [bai li]
ref|XP_009371010.1|  PREDICTED: uncharacterized protein LOC103960...    247   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_010326332.1|  PREDICTED: uncharacterized protein LOC101266...    241   9e-69   
ref|XP_004247114.1|  PREDICTED: uncharacterized protein LOC101266...    241   2e-68   Solanum lycopersicum
ref|XP_002521158.1|  conserved hypothetical protein                     240   3e-68   
ref|XP_011080145.1|  PREDICTED: uncharacterized protein LOC105163485    238   9e-68   Sesamum indicum [beniseed]
ref|XP_004292261.1|  PREDICTED: uncharacterized protein LOC101294433    235   2e-66   Fragaria vesca subsp. vesca
emb|CDP03827.1|  unnamed protein product                                234   2e-66   Coffea canephora [robusta coffee]
gb|KHG22481.1|  Viral inhibitor of RIP activation                       234   3e-66   Gossypium arboreum [tree cotton]
gb|KJB10993.1|  hypothetical protein B456_001G235600                    234   3e-66   Gossypium raimondii
gb|KJB10995.1|  hypothetical protein B456_001G235600                    234   4e-66   Gossypium raimondii
gb|KJB10997.1|  hypothetical protein B456_001G235600                    234   4e-66   Gossypium raimondii
ref|XP_002303096.2|  hypothetical protein POPTR_0002s25490g             231   4e-65   
ref|XP_006386899.1|  hypothetical protein POPTR_0002s25490g             231   4e-65   
ref|XP_002267519.1|  PREDICTED: uncharacterized protein LOC100241...    230   9e-65   Vitis vinifera
ref|XP_010652446.1|  PREDICTED: uncharacterized protein LOC100241...    230   9e-65   Vitis vinifera
ref|XP_008382666.1|  PREDICTED: uncharacterized protein LOC103445438    229   2e-64   
ref|XP_008372424.1|  PREDICTED: uncharacterized protein LOC103435...    228   7e-64   
ref|XP_008372423.1|  PREDICTED: uncharacterized protein LOC103435...    227   9e-64   
emb|CAN81514.1|  hypothetical protein VITISV_012030                     227   2e-63   Vitis vinifera
ref|XP_011024531.1|  PREDICTED: uncharacterized protein LOC105125...    221   1e-61   Populus euphratica
ref|XP_011024529.1|  PREDICTED: uncharacterized protein LOC105125...    221   1e-61   Populus euphratica
ref|XP_011024528.1|  PREDICTED: uncharacterized protein LOC105125...    221   1e-61   Populus euphratica
ref|XP_011083092.1|  PREDICTED: uncharacterized protein LOC105165697    221   1e-61   Sesamum indicum [beniseed]
ref|XP_007050071.1|  Uncharacterized protein isoform 3                  221   1e-61   
ref|XP_011024525.1|  PREDICTED: uncharacterized protein LOC105125...    221   1e-61   Populus euphratica
ref|XP_007050069.1|  Uncharacterized protein isoform 1                  221   2e-61   
ref|XP_007050070.1|  Uncharacterized protein isoform 2                  221   2e-61   
gb|KDO65806.1|  hypothetical protein CISIN_1g001807mg                   219   6e-61   Citrus sinensis [apfelsine]
gb|KDO65805.1|  hypothetical protein CISIN_1g001807mg                   219   8e-61   Citrus sinensis [apfelsine]
gb|KDO65804.1|  hypothetical protein CISIN_1g001807mg                   219   9e-61   Citrus sinensis [apfelsine]
gb|KDO65803.1|  hypothetical protein CISIN_1g001807mg                   219   9e-61   Citrus sinensis [apfelsine]
ref|XP_006375643.1|  hypothetical protein POPTR_0014s18540g             218   2e-60   
ref|XP_012085179.1|  PREDICTED: uncharacterized protein LOC105644441    216   6e-60   Jatropha curcas
ref|XP_006443684.1|  hypothetical protein CICLE_v10018694mg             216   1e-59   Citrus clementina [clementine]
ref|XP_010684824.1|  PREDICTED: uncharacterized protein LOC104899...    213   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010684822.1|  PREDICTED: uncharacterized protein LOC104899...    213   2e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010091854.1|  hypothetical protein L484_015923                   212   3e-58   Morus notabilis
ref|XP_004493852.1|  PREDICTED: uro-adherence factor A-like isofo...    210   2e-57   Cicer arietinum [garbanzo]
ref|XP_010243643.1|  PREDICTED: uncharacterized protein LOC104587...    209   4e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010243642.1|  PREDICTED: uncharacterized protein LOC104587...    209   4e-57   Nelumbo nucifera [Indian lotus]
ref|XP_010243641.1|  PREDICTED: uncharacterized protein LOC104587...    209   4e-57   Nelumbo nucifera [Indian lotus]
ref|XP_007162644.1|  hypothetical protein PHAVU_001G168100g             208   5e-57   Phaseolus vulgaris [French bean]
emb|CBI37234.3|  unnamed protein product                                207   5e-57   Vitis vinifera
gb|KEH23986.1|  DUF3741 family protein                                  204   8e-56   Medicago truncatula
ref|XP_003625464.1|  hypothetical protein MTR_7g099410                  204   2e-55   Medicago truncatula
ref|XP_006576977.1|  PREDICTED: uncharacterized protein LOC100793360    201   2e-54   Glycine max [soybeans]
gb|KHN09408.1|  hypothetical protein glysoja_016507                     199   7e-54   Glycine soja [wild soybean]
gb|EYU17962.1|  hypothetical protein MIMGU_mgv1a0013541mg               189   8e-54   Erythranthe guttata [common monkey flower]
ref|XP_006604525.1|  PREDICTED: uncharacterized protein LOC100816...    198   2e-53   Glycine max [soybeans]
gb|KJB26069.1|  hypothetical protein B456_004G223300                    194   3e-52   Gossypium raimondii
gb|KJB26067.1|  hypothetical protein B456_004G223300                    194   6e-52   Gossypium raimondii
gb|KJB26068.1|  hypothetical protein B456_004G223300                    194   7e-52   Gossypium raimondii
gb|KJB26065.1|  hypothetical protein B456_004G223300                    194   7e-52   Gossypium raimondii
gb|EYU46370.1|  hypothetical protein MIMGU_mgv1a000965mg                193   8e-52   Erythranthe guttata [common monkey flower]
gb|KHG04276.1|  Methyl-coenzyme M reductase II subunit gamma            194   9e-52   Gossypium arboreum [tree cotton]
ref|XP_010263991.1|  PREDICTED: uncharacterized protein LOC104602...    194   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010263990.1|  PREDICTED: uncharacterized protein LOC104602...    194   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010263989.1|  PREDICTED: uncharacterized protein LOC104602...    193   2e-51   
gb|KJB10996.1|  hypothetical protein B456_001G235600                    191   8e-51   Gossypium raimondii
ref|XP_010038329.1|  PREDICTED: uncharacterized protein LOC104426860    176   1e-45   Eucalyptus grandis [rose gum]
ref|XP_003541385.2|  PREDICTED: uncharacterized protein LOC100787955    171   8e-44   Glycine max [soybeans]
gb|KHN48970.1|  hypothetical protein glysoja_025347                     171   1e-43   Glycine soja [wild soybean]
ref|XP_011011589.1|  PREDICTED: uncharacterized protein LOC105116094    158   2e-42   Populus euphratica
ref|XP_008461986.1|  PREDICTED: uncharacterized protein LOC103500466    166   5e-42   Cucumis melo [Oriental melon]
gb|KEH42420.1|  DUF3741 family protein                                  162   5e-41   Medicago truncatula
ref|XP_010438386.1|  PREDICTED: uncharacterized protein LOC104721...    162   7e-41   Camelina sativa [gold-of-pleasure]
gb|KHN05903.1|  hypothetical protein glysoja_026491                     159   1e-40   Glycine soja [wild soybean]
ref|XP_010438384.1|  PREDICTED: uncharacterized protein LOC104721...    162   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010436357.1|  PREDICTED: uncharacterized protein LOC104720083    152   1e-40   
ref|XP_002869475.1|  hypothetical protein ARALYDRAFT_491881             161   3e-40   
ref|XP_007144434.1|  hypothetical protein PHAVU_007G155800g             160   5e-40   Phaseolus vulgaris [French bean]
ref|XP_004139729.1|  PREDICTED: uncharacterized protein LOC101207165    160   5e-40   Cucumis sativus [cucumbers]
ref|XP_010433166.1|  PREDICTED: uncharacterized protein LOC104717...    159   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_003537148.1|  PREDICTED: uncharacterized protein LOC100814...    159   7e-40   Glycine max [soybeans]
ref|XP_010433164.1|  PREDICTED: uncharacterized protein LOC104717...    159   1e-39   Camelina sativa [gold-of-pleasure]
dbj|BAD94795.1|  hypothetical protein                                   151   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069683.1|  PREDICTED: uncharacterized protein LOC104456566    159   2e-39   Eucalyptus grandis [rose gum]
ref|XP_010540954.1|  PREDICTED: uncharacterized protein LOC104814...    157   4e-39   Tarenaya hassleriana [spider flower]
ref|XP_006284953.1|  hypothetical protein CARUB_v10006255mg             157   4e-39   Capsella rubella
ref|XP_010540953.1|  PREDICTED: uncharacterized protein LOC104814...    157   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_006412913.1|  hypothetical protein EUTSA_v10024350mg             157   5e-39   Eutrema salsugineum [saltwater cress]
ref|XP_010540945.1|  PREDICTED: uncharacterized protein LOC104814...    157   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_008809665.1|  PREDICTED: uncharacterized protein LOC103721...    155   2e-38   Phoenix dactylifera
ref|XP_010447918.1|  PREDICTED: uncharacterized protein LOC104730...    155   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_008809662.1|  PREDICTED: uncharacterized protein LOC103721...    155   2e-38   Phoenix dactylifera
ref|XP_008809661.1|  PREDICTED: uncharacterized protein LOC103721...    155   3e-38   Phoenix dactylifera
dbj|BAF01823.1|  hypothetical protein                                   153   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008809664.1|  PREDICTED: uncharacterized protein LOC103721...    155   3e-38   
ref|XP_008809663.1|  PREDICTED: uncharacterized protein LOC103721...    155   3e-38   Phoenix dactylifera
ref|XP_010447916.1|  PREDICTED: uncharacterized protein LOC104730...    155   3e-38   Camelina sativa [gold-of-pleasure]
emb|CAA22976.1|  putative protein                                       154   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567819.1|  uncharacterized protein                               153   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495031.1|  PREDICTED: uro-adherence factor A-like isofo...    153   1e-37   Cicer arietinum [garbanzo]
dbj|BAH19995.1|  AT4G28760                                              153   1e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31985.1|  BnaA07g00100D                                          145   6e-35   Brassica napus [oilseed rape]
emb|CDY65848.1|  BnaCnng48860D                                          144   7e-35   Brassica napus [oilseed rape]
ref|XP_010526475.1|  PREDICTED: uncharacterized protein LOC104804...    145   8e-35   
ref|XP_010526471.1|  PREDICTED: uncharacterized protein LOC104804...    145   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_010918845.1|  PREDICTED: uncharacterized protein LOC105043126    144   2e-34   Elaeis guineensis
emb|CDY06873.1|  BnaC01g09720D                                          143   3e-34   
ref|XP_010933203.1|  PREDICTED: uncharacterized protein LOC105053...    144   3e-34   Elaeis guineensis
ref|XP_010933204.1|  PREDICTED: uncharacterized protein LOC105053...    144   3e-34   Elaeis guineensis
ref|XP_004152072.2|  PREDICTED: uncharacterized protein LOC101204012    144   3e-34   Cucumis sativus [cucumbers]
ref|XP_010933202.1|  PREDICTED: uncharacterized protein LOC105053...    143   4e-34   
ref|XP_008447347.1|  PREDICTED: uncharacterized protein LOC103489819    141   2e-33   Cucumis melo [Oriental melon]
ref|XP_008789490.1|  PREDICTED: uncharacterized protein LOC103706...    136   1e-31   Phoenix dactylifera
ref|XP_008789489.1|  PREDICTED: uncharacterized protein LOC103706...    136   1e-31   Phoenix dactylifera
ref|XP_008789491.1|  PREDICTED: uncharacterized protein LOC103706...    136   1e-31   Phoenix dactylifera
ref|XP_009129280.1|  PREDICTED: uncharacterized protein LOC103854122    135   2e-31   Brassica rapa
ref|XP_010940679.1|  PREDICTED: uncharacterized protein LOC105059...    135   2e-31   Elaeis guineensis
ref|XP_010940678.1|  PREDICTED: uncharacterized protein LOC105059...    135   2e-31   Elaeis guineensis
emb|CDY35217.1|  BnaA01g08140D                                          134   3e-31   Brassica napus [oilseed rape]
ref|XP_006408939.1|  hypothetical protein EUTSA_v10001917mg             133   7e-31   Eutrema salsugineum [saltwater cress]
ref|NP_179614.1|  uncharacterized protein                               133   7e-31   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43822.1|  unknown protein                                        133   7e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883937.1|  hypothetical protein ARALYDRAFT_319541             132   8e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_008812928.1|  PREDICTED: uncharacterized protein LOC103723702    128   2e-29   
dbj|BAK01535.1|  predicted protein                                      127   5e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006296647.1|  hypothetical protein CARUB_v10015415mg             127   6e-29   Capsella rubella
ref|XP_010489077.1|  PREDICTED: uncharacterized protein LOC104766813    126   1e-28   Camelina sativa [gold-of-pleasure]
dbj|BAJ95378.1|  predicted protein                                      127   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010495916.1|  PREDICTED: probable GPI-anchored adhesin-lik...    123   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009411376.1|  PREDICTED: uncharacterized protein LOC103993144    123   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT32262.1|  hypothetical protein F775_21072                         122   5e-27   
ref|XP_010556872.1|  PREDICTED: uncharacterized protein LOC104826058    120   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_010416091.1|  PREDICTED: uncharacterized protein LOC104701996    119   3e-26   
gb|EMS51091.1|  hypothetical protein TRIUR3_23853                       118   1e-25   Triticum urartu
gb|EAZ23822.1|  hypothetical protein OsJ_07535                          114   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009382189.1|  PREDICTED: uncharacterized protein LOC103970...    114   2e-24   
ref|XP_009382176.1|  PREDICTED: uncharacterized protein LOC103970...    114   2e-24   
ref|XP_008796409.1|  PREDICTED: uncharacterized protein LOC103711875    114   3e-24   Phoenix dactylifera
ref|XP_009382188.1|  PREDICTED: uncharacterized protein LOC103970...    114   3e-24   
gb|EAY86700.1|  hypothetical protein OsI_08082                          113   6e-24   Oryza sativa Indica Group [Indian rice]
dbj|BAK04299.1|  predicted protein                                      112   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006649387.1|  PREDICTED: uncharacterized protein LOC102700033    112   2e-23   Oryza brachyantha
gb|AAO37163.1|  hypothetical protein                                    111   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004985732.1|  PREDICTED: uncharacterized protein LOC101771...    111   3e-23   
ref|XP_004985731.1|  PREDICTED: uncharacterized protein LOC101771...    111   3e-23   Setaria italica
gb|EMT13565.1|  hypothetical protein F775_11179                         111   4e-23   
ref|XP_006647519.1|  PREDICTED: uncharacterized serine-rich prote...    107   6e-23   
ref|XP_004953111.1|  PREDICTED: uncharacterized protein LOC101762...    110   7e-23   Setaria italica
ref|XP_004953110.1|  PREDICTED: uncharacterized protein LOC101762...    109   1e-22   Setaria italica
ref|XP_002448137.1|  hypothetical protein SORBIDRAFT_06g021940          109   1e-22   Sorghum bicolor [broomcorn]
ref|XP_009410963.1|  PREDICTED: uncharacterized protein LOC103992...    109   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047438.1|  Os02g0617100                                       102   2e-22   
ref|XP_009410914.1|  PREDICTED: uncharacterized protein LOC103992...    108   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006651030.1|  PREDICTED: uncharacterized protein LOC102706550    108   3e-22   
ref|XP_008666975.1|  PREDICTED: uncharacterized protein LOC100272...    107   6e-22   Zea mays [maize]
ref|NP_001053260.1|  Os04g0506900                                       107   6e-22   
ref|NP_001140716.1|  uncharacterized protein LOC100272791               105   6e-22   
ref|XP_008666987.1|  PREDICTED: uncharacterized protein LOC100272...    107   6e-22   Zea mays [maize]
ref|XP_008666979.1|  PREDICTED: uncharacterized protein LOC100272...    107   7e-22   Zea mays [maize]
gb|ACN35840.1|  unknown                                                 107   7e-22   Zea mays [maize]
emb|CAE04715.1|  OSJNBa0043L24.3                                        107   7e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EMS67579.1|  hypothetical protein TRIUR3_06787                       106   1e-21   Triticum urartu
emb|CAH67333.1|  OSIGBa0157A06.2                                        106   1e-21   Oryza sativa [red rice]
gb|EEC77598.1|  hypothetical protein OsI_16564                          106   1e-21   Oryza sativa Indica Group [Indian rice]
gb|EEE61300.1|  hypothetical protein OsJ_15391                          106   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048940.1|  Os03g0143700                                       105   2e-21   
ref|XP_010240106.1|  PREDICTED: uncharacterized protein LOC100830...    105   2e-21   
ref|XP_010240102.1|  PREDICTED: uncharacterized protein LOC100830...    105   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_010240105.1|  PREDICTED: uncharacterized protein LOC100830...    105   2e-21   
ref|XP_002454174.1|  hypothetical protein SORBIDRAFT_04g026030          105   2e-21   Sorghum bicolor [broomcorn]
ref|XP_009418765.1|  PREDICTED: uncharacterized protein LOC103998...    105   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418989.1|  PREDICTED: uncharacterized protein LOC103998...    104   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY88501.1|  hypothetical protein OsI_09972                          104   5e-21   Oryza sativa Indica Group [Indian rice]
tpg|DAA37015.1|  TPA: hypothetical protein ZEAMMB73_770868            99.4    5e-21   
gb|EMT10669.1|  hypothetical protein F775_15662                         103   1e-20   
gb|AFW72333.1|  hypothetical protein ZEAMMB73_984204                    103   1e-20   
ref|XP_008643431.1|  PREDICTED: uncharacterized protein LOC100278...    103   1e-20   
ref|XP_010911761.1|  PREDICTED: uncharacterized protein LOC105037843  94.0    1e-19   
ref|XP_006652489.1|  PREDICTED: uncharacterized protein LOC102722...  99.4    2e-19   Oryza brachyantha
ref|XP_006652490.1|  PREDICTED: uncharacterized protein LOC102722...  99.4    2e-19   Oryza brachyantha
ref|XP_009407163.1|  PREDICTED: uncharacterized protein LOC103989929  97.8    8e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006279983.1|  hypothetical protein CARUB_v10025855mg           95.1    4e-18   Capsella rubella
ref|XP_006279984.1|  hypothetical protein CARUB_v10025855mg           95.1    6e-18   
ref|XP_003558830.1|  PREDICTED: uncharacterized protein LOC100833211  94.0    1e-17   Brachypodium distachyon [annual false brome]
ref|NP_001145529.1|  uncharacterized protein LOC100278954             88.2    2e-17   
ref|XP_004976162.1|  PREDICTED: uncharacterized protein LOC101760...  93.2    2e-17   Setaria italica
ref|NP_199201.1|  uncharacterized protein                             92.8    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481809.1|  PREDICTED: uncharacterized protein LOC104760...  92.8    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010494373.1|  PREDICTED: uncharacterized protein LOC104771...  92.4    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010494375.1|  PREDICTED: uncharacterized protein LOC104771...  92.4    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010481813.1|  PREDICTED: uncharacterized protein LOC104760...  92.4    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010235705.1|  PREDICTED: uncharacterized protein LOC100838495  92.0    5e-17   Brachypodium distachyon [annual false brome]
ref|XP_002863627.1|  hypothetical protein ARALYDRAFT_494617           92.0    5e-17   
ref|XP_009405681.1|  PREDICTED: uncharacterized protein LOC103988772  91.3    9e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010441972.1|  PREDICTED: uncharacterized protein LOC104725...  86.7    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010441970.1|  PREDICTED: uncharacterized protein LOC104725...  86.7    2e-15   Camelina sativa [gold-of-pleasure]
gb|EEC74239.1|  hypothetical protein OsI_09439                        76.3    6e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_009113974.1|  PREDICTED: uncharacterized protein LOC103839223  75.5    1e-11   Brassica rapa
gb|EPS72229.1|  hypothetical protein M569_02537                       71.2    1e-11   Genlisea aurea
ref|XP_006648110.1|  PREDICTED: uncharacterized protein LOC102717592  74.7    2e-11   Oryza brachyantha
ref|XP_003570390.1|  PREDICTED: uncharacterized protein LOC100830114  73.6    4e-11   Brachypodium distachyon [annual false brome]
ref|NP_001048512.1|  Os02g0816400                                     72.4    1e-10   
gb|EMS54382.1|  hypothetical protein TRIUR3_15055                     71.6    2e-10   Triticum urartu
emb|CDY32928.1|  BnaA09g16650D                                        71.2    3e-10   Brassica napus [oilseed rape]
ref|XP_006854321.1|  PREDICTED: uncharacterized protein LOC18444081   70.5    5e-10   Amborella trichopoda
ref|XP_006403169.1|  hypothetical protein EUTSA_v10003146mg           70.5    6e-10   Eutrema salsugineum [saltwater cress]
ref|XP_004954364.1|  PREDICTED: uncharacterized protein LOC101771...  70.5    6e-10   Setaria italica
emb|CDY22327.1|  BnaA06g36490D                                        66.6    1e-09   Brassica napus [oilseed rape]
emb|CDY50812.1|  BnaCnng19760D                                        67.4    5e-09   Brassica napus [oilseed rape]
ref|XP_008646431.1|  PREDICTED: uncharacterized protein LOC103627...  65.9    2e-08   Zea mays [maize]
ref|XP_008646424.1|  PREDICTED: uncharacterized protein LOC103627...  65.5    2e-08   Zea mays [maize]
gb|EMT03099.1|  hypothetical protein F775_52439                       63.5    1e-07   
ref|XP_008646430.1|  PREDICTED: uncharacterized protein LOC103627...  63.5    1e-07   Zea mays [maize]
gb|EMS57338.1|  hypothetical protein TRIUR3_10172                     62.8    2e-07   Triticum urartu
emb|CDX94731.1|  BnaC07g17400D                                        59.7    2e-06   
ref|XP_008679174.1|  PREDICTED: uncharacterized protein LOC103654...  59.3    3e-06   Zea mays [maize]
ref|XP_008679172.1|  PREDICTED: uncharacterized protein LOC103654...  58.9    3e-06   
ref|XP_008679165.1|  PREDICTED: uncharacterized protein LOC103654...  58.9    3e-06   Zea mays [maize]
ref|XP_008679173.1|  PREDICTED: uncharacterized protein LOC103654...  58.9    3e-06   Zea mays [maize]
ref|XP_008679171.1|  PREDICTED: uncharacterized protein LOC103654...  58.9    3e-06   
ref|XP_006307114.1|  hypothetical protein CARUB_v10008702mg           58.2    5e-06   
ref|XP_006307115.1|  hypothetical protein CARUB_v10008702mg           58.2    5e-06   Capsella rubella
ref|XP_011101155.1|  PREDICTED: uncharacterized protein LOC105179...  56.6    2e-05   Sesamum indicum [beniseed]
ref|XP_010317454.1|  PREDICTED: uncharacterized protein LOC101266997  56.6    2e-05   Solanum lycopersicum
ref|XP_011101154.1|  PREDICTED: uncharacterized protein LOC105179...  56.6    2e-05   Sesamum indicum [beniseed]
emb|CDY57257.1|  BnaC08g47610D                                        56.2    2e-05   Brassica napus [oilseed rape]
ref|XP_006362707.1|  PREDICTED: protein LONGIFOLIA 1-like             55.1    5e-05   
emb|CDX95141.1|  BnaC05g05300D                                        54.7    6e-05   
dbj|BAD42902.1|  putative GTP-binding protein                         53.5    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172241.2|  GTPase OBGM                                         53.5    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118948.1|  PREDICTED: protein TRM32-like                    53.1    2e-04   Brassica rapa
gb|AAF75096.1|AC007583_32  It is a member of GTP1/OBG family PF|0...  53.5    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398053.1|  PREDICTED: uncharacterized protein LOC103982764  53.1    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAY78688.1|  hypothetical protein At2g20240                        52.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDY06717.1|  BnaA10g04960D                                        52.0    4e-04   
ref|XP_011094799.1|  PREDICTED: uncharacterized protein LOC105174...  52.0    5e-04   Sesamum indicum [beniseed]
ref|XP_011094798.1|  PREDICTED: uncharacterized protein LOC105174...  52.0    6e-04   



>ref|XP_009592675.1| PREDICTED: uncharacterized protein LOC104089467 isoform X3 [Nicotiana 
tomentosiformis]
Length=885

 Score =   285 bits (729),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 175/239 (73%), Gaps = 7/239 (3%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G      P    LIDKSPPIGS+ARTLSWDDSC DTA SS  + P  S QRTEE EREW 
Sbjct  646  GTELSLHPVRSNLIDKSPPIGSIARTLSWDDSCADTA-SSACVRPSSSTQRTEEVEREWF  704

Query  753  FFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTR  574
             F+QTLL+MAGLDEVQS + S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+
Sbjct  705  SFVQTLLTMAGLDEVQSVAFSTMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQ  764

Query  573  KLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAG  409
            KLVFDCVNAAL+DI     D C + I + G HN  P+G+ +I  D+VW R+KEWF S   
Sbjct  765  KLVFDCVNAALLDIAGYGPDNCQRAIPYIGVHNNQPEGTRLILVDQVWDRMKEWFSSEVK  824

Query  408  CLSDDGVDDNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             LS D  D N+L  E MV +E +GK W +  RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  825  YLSCDAEDINSLVMEGMVTKEVMGKRWLKSFRLELDNVGMEIEGKLLEELVHESVIELA  883



>ref|XP_009592672.1| PREDICTED: uncharacterized protein LOC104089467 isoform X1 [Nicotiana 
tomentosiformis]
Length=975

 Score =   285 bits (729),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 175/239 (73%), Gaps = 7/239 (3%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G      P    LIDKSPPIGS+ARTLSWDDSC DTA SS  + P  S QRTEE EREW 
Sbjct  736  GTELSLHPVRSNLIDKSPPIGSIARTLSWDDSCADTA-SSACVRPSSSTQRTEEVEREWF  794

Query  753  FFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTR  574
             F+QTLL+MAGLDEVQS + S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+
Sbjct  795  SFVQTLLTMAGLDEVQSVAFSTMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQ  854

Query  573  KLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAG  409
            KLVFDCVNAAL+DI     D C + I + G HN  P+G+ +I  D+VW R+KEWF S   
Sbjct  855  KLVFDCVNAALLDIAGYGPDNCQRAIPYIGVHNNQPEGTRLILVDQVWDRMKEWFSSEVK  914

Query  408  CLSDDGVDDNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             LS D  D N+L  E MV +E +GK W +  RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  915  YLSCDAEDINSLVMEGMVTKEVMGKRWLKSFRLELDNVGMEIEGKLLEELVHESVIELA  973



>ref|XP_009592673.1| PREDICTED: uncharacterized protein LOC104089467 isoform X2 [Nicotiana 
tomentosiformis]
Length=974

 Score =   285 bits (728),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 175/239 (73%), Gaps = 7/239 (3%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G      P    LIDKSPPIGS+ARTLSWDDSC DTA SS  + P  S QRTEE EREW 
Sbjct  735  GTELSLHPVRSNLIDKSPPIGSIARTLSWDDSCADTA-SSACVRPSSSTQRTEEVEREWF  793

Query  753  FFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTR  574
             F+QTLL+MAGLDEVQS + S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+
Sbjct  794  SFVQTLLTMAGLDEVQSVAFSTMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQ  853

Query  573  KLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAG  409
            KLVFDCVNAAL+DI     D C + I + G HN  P+G+ +I  D+VW R+KEWF S   
Sbjct  854  KLVFDCVNAALLDIAGYGPDNCQRAIPYIGVHNNQPEGTRLILVDQVWDRMKEWFSSEVK  913

Query  408  CLSDDGVDDNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             LS D  D N+L  E MV +E +GK W +  RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  914  YLSCDAEDINSLVMEGMVTKEVMGKRWLKSFRLELDNVGMEIEGKLLEELVHESVIELA  972



>ref|XP_009770291.1| PREDICTED: uncharacterized protein LOC104221001 isoform X3 [Nicotiana 
sylvestris]
Length=907

 Score =   280 bits (717),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 172/239 (72%), Gaps = 7/239 (3%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G      P    LIDKSPPIGS+ARTLSWDDSC DTA SS  + P  S Q TEE EREW 
Sbjct  667  GTELSLHPIRSNLIDKSPPIGSIARTLSWDDSCADTA-SSACVRPSSSTQWTEEVEREWF  725

Query  753  FFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTR  574
             F+QTLL+MAGLDEVQSD+ S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+
Sbjct  726  SFVQTLLTMAGLDEVQSDAFSTMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQ  785

Query  573  KLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAG  409
            KLVFDCVNA L+DI     D C +   + G HN  P G+S+I  D+VW R+KEWF S   
Sbjct  786  KLVFDCVNAVLLDIAGYGPDNCQRARPYVGVHNNQPQGTSLILVDQVWDRMKEWFSSEVK  845

Query  408  CLSDDGVDDNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             LS D  D N+L  E MV +E +GK W    RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  846  YLSCDAEDINSLVMEGMVTKEVMGKRWLASFRLELDNLGMEIEGKLLEELVHESVIELA  904



>ref|XP_009770284.1| PREDICTED: uncharacterized protein LOC104221001 isoform X2 [Nicotiana 
sylvestris]
Length=975

 Score =   280 bits (716),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 172/239 (72%), Gaps = 7/239 (3%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G      P    LIDKSPPIGS+ARTLSWDDSC DTA SS  + P  S Q TEE EREW 
Sbjct  735  GTELSLHPIRSNLIDKSPPIGSIARTLSWDDSCADTA-SSACVRPSSSTQWTEEVEREWF  793

Query  753  FFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTR  574
             F+QTLL+MAGLDEVQSD+ S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+
Sbjct  794  SFVQTLLTMAGLDEVQSDAFSTMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQ  853

Query  573  KLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAG  409
            KLVFDCVNA L+DI     D C +   + G HN  P G+S+I  D+VW R+KEWF S   
Sbjct  854  KLVFDCVNAVLLDIAGYGPDNCQRARPYVGVHNNQPQGTSLILVDQVWDRMKEWFSSEVK  913

Query  408  CLSDDGVDDNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             LS D  D N+L  E MV +E +GK W    RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  914  YLSCDAEDINSLVMEGMVTKEVMGKRWLASFRLELDNLGMEIEGKLLEELVHESVIELA  972



>ref|XP_009770277.1| PREDICTED: uncharacterized protein LOC104221001 isoform X1 [Nicotiana 
sylvestris]
Length=976

 Score =   280 bits (715),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 172/239 (72%), Gaps = 7/239 (3%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G      P    LIDKSPPIGS+ARTLSWDDSC DTA SS  + P  S Q TEE EREW 
Sbjct  736  GTELSLHPIRSNLIDKSPPIGSIARTLSWDDSCADTA-SSACVRPSSSTQWTEEVEREWF  794

Query  753  FFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTR  574
             F+QTLL+MAGLDEVQSD+ S+ WHSP+SPLDP LR+KYI+LNEKET+HEAKRRQRRST+
Sbjct  795  SFVQTLLTMAGLDEVQSDAFSTMWHSPESPLDPSLREKYIDLNEKETLHEAKRRQRRSTQ  854

Query  573  KLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAG  409
            KLVFDCVNA L+DI     D C +   + G HN  P G+S+I  D+VW R+KEWF S   
Sbjct  855  KLVFDCVNAVLLDIAGYGPDNCQRARPYVGVHNNQPQGTSLILVDQVWDRMKEWFSSEVK  914

Query  408  CLSDDGVDDNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             LS D  D N+L  E MV +E +GK W    RLE +++G EIEGKLLEE+V ++V+ LA
Sbjct  915  YLSCDAEDINSLVMEGMVTKEVMGKRWLASFRLELDNLGMEIEGKLLEELVHESVIELA  973



>ref|XP_009780629.1| PREDICTED: uncharacterized protein LOC104229654 isoform X4 [Nicotiana 
sylvestris]
Length=904

 Score =   272 bits (696),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 180/227 (79%), Gaps = 7/227 (3%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSW+DSCVDTA SS  L    S+QRTEEEE+EW  F+QTLL++AGL
Sbjct  676  LIDKSPPIGSIARTLSWNDSCVDTA-SSVCLRSSASIQRTEEEEKEWFSFVQTLLTVAGL  734

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            +EVQSD+    WHSP+SPLDP LR+K ++LNEK+ +HEA+RRQRRSTRKLVFDCVNAAL+
Sbjct  735  NEVQSDAFLLMWHSPESPLDPSLREKCVDLNEKDVLHEARRRQRRSTRKLVFDCVNAALM  794

Query  537  DI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            +I     DTC + I +SG  N +P+G+ +I  D+VW R+KEWF S A CL+DDG D N+L
Sbjct  795  EIAGYGPDTCQRAIPYSGVSNNLPEGAKLILVDQVWTRMKEWFSSEAKCLTDDGGDGNSL  854

Query  372  -TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
              + MVR+E VGKGW +YLRLE +++G EIE KLLEE+V +++V L 
Sbjct  855  VVDGMVRKEVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVELT  901



>ref|XP_009780628.1| PREDICTED: uncharacterized protein LOC104229654 isoform X3 [Nicotiana 
sylvestris]
Length=909

 Score =   272 bits (696),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 180/227 (79%), Gaps = 7/227 (3%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSW+DSCVDTA SS  L    S+QRTEEEE+EW  F+QTLL++AGL
Sbjct  681  LIDKSPPIGSIARTLSWNDSCVDTA-SSVCLRSSASIQRTEEEEKEWFSFVQTLLTVAGL  739

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            +EVQSD+    WHSP+SPLDP LR+K ++LNEK+ +HEA+RRQRRSTRKLVFDCVNAAL+
Sbjct  740  NEVQSDAFLLMWHSPESPLDPSLREKCVDLNEKDVLHEARRRQRRSTRKLVFDCVNAALM  799

Query  537  DI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            +I     DTC + I +SG  N +P+G+ +I  D+VW R+KEWF S A CL+DDG D N+L
Sbjct  800  EIAGYGPDTCQRAIPYSGVSNNLPEGAKLILVDQVWTRMKEWFSSEAKCLTDDGGDGNSL  859

Query  372  -TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
              + MVR+E VGKGW +YLRLE +++G EIE KLLEE+V +++V L 
Sbjct  860  VVDGMVRKEVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVELT  906



>ref|XP_009780624.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009780625.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009780626.1| PREDICTED: uncharacterized protein LOC104229654 isoform X1 [Nicotiana 
sylvestris]
Length=976

 Score =   273 bits (697),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 180/227 (79%), Gaps = 7/227 (3%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSW+DSCVDTA SS  L    S+QRTEEEE+EW  F+QTLL++AGL
Sbjct  748  LIDKSPPIGSIARTLSWNDSCVDTA-SSVCLRSSASIQRTEEEEKEWFSFVQTLLTVAGL  806

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            +EVQSD+    WHSP+SPLDP LR+K ++LNEK+ +HEA+RRQRRSTRKLVFDCVNAAL+
Sbjct  807  NEVQSDAFLLMWHSPESPLDPSLREKCVDLNEKDVLHEARRRQRRSTRKLVFDCVNAALM  866

Query  537  DI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            +I     DTC + I +SG  N +P+G+ +I  D+VW R+KEWF S A CL+DDG D N+L
Sbjct  867  EIAGYGPDTCQRAIPYSGVSNNLPEGAKLILVDQVWTRMKEWFSSEAKCLTDDGGDGNSL  926

Query  372  -TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
              + MVR+E VGKGW +YLRLE +++G EIE KLLEE+V +++V L 
Sbjct  927  VVDGMVRKEVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVELT  973



>ref|XP_009780627.1| PREDICTED: uncharacterized protein LOC104229654 isoform X2 [Nicotiana 
sylvestris]
Length=975

 Score =   273 bits (697),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 180/227 (79%), Gaps = 7/227 (3%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSW+DSCVDTA SS  L    S+QRTEEEE+EW  F+QTLL++AGL
Sbjct  747  LIDKSPPIGSIARTLSWNDSCVDTA-SSVCLRSSASIQRTEEEEKEWFSFVQTLLTVAGL  805

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            +EVQSD+    WHSP+SPLDP LR+K ++LNEK+ +HEA+RRQRRSTRKLVFDCVNAAL+
Sbjct  806  NEVQSDAFLLMWHSPESPLDPSLREKCVDLNEKDVLHEARRRQRRSTRKLVFDCVNAALM  865

Query  537  DI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            +I     DTC + I +SG  N +P+G+ +I  D+VW R+KEWF S A CL+DDG D N+L
Sbjct  866  EIAGYGPDTCQRAIPYSGVSNNLPEGAKLILVDQVWTRMKEWFSSEAKCLTDDGGDGNSL  925

Query  372  -TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
              + MVR+E VGKGW +YLRLE +++G EIE KLLEE+V +++V L 
Sbjct  926  VVDGMVRKEVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVELT  972



>ref|XP_009589098.1| PREDICTED: uncharacterized protein LOC104086523 isoform X3 [Nicotiana 
tomentosiformis]
Length=972

 Score =   271 bits (694),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 178/228 (78%), Gaps = 8/228 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSW+DSCVDTA SS  L P  S+QRTEEEE+EW  F+QTLL+ AGL
Sbjct  743  LIDKSPPIGSIARTLSWNDSCVDTA-SSVCLRPSASIQRTEEEEKEWFSFVQTLLTAAGL  801

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            +EVQSD+    WHSP+SPLDP LR+KY++LNE++ +HEA+RR+RRS RKLVFDCVNAAL+
Sbjct  802  NEVQSDAFLLMWHSPESPLDPSLREKYVDLNEQDVLHEARRRRRRSIRKLVFDCVNAALM  861

Query  537  DI-----DTCHKTIAFSGAHNTIPDGSS-IISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            +I     DTC + I +SG  N +P+G + +I  D+VW R+KEWF S    LSDDG D N+
Sbjct  862  EIAGYGPDTCQRAIPYSGVSNNLPEGGAKLILVDQVWTRMKEWFSSEVKYLSDDGGDGNS  921

Query  375  L-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            L  + MVR+E VGKGW +YLRLE +++G EIE KLLEE+V +++V L 
Sbjct  922  LVVDGMVRKEVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVELT  969



>ref|XP_009589097.1| PREDICTED: uncharacterized protein LOC104086523 isoform X2 [Nicotiana 
tomentosiformis]
Length=976

 Score =   271 bits (694),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 178/228 (78%), Gaps = 8/228 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSW+DSCVDTA SS  L P  S+QRTEEEE+EW  F+QTLL+ AGL
Sbjct  747  LIDKSPPIGSIARTLSWNDSCVDTA-SSVCLRPSASIQRTEEEEKEWFSFVQTLLTAAGL  805

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            +EVQSD+    WHSP+SPLDP LR+KY++LNE++ +HEA+RR+RRS RKLVFDCVNAAL+
Sbjct  806  NEVQSDAFLLMWHSPESPLDPSLREKYVDLNEQDVLHEARRRRRRSIRKLVFDCVNAALM  865

Query  537  DI-----DTCHKTIAFSGAHNTIPDGSS-IISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            +I     DTC + I +SG  N +P+G + +I  D+VW R+KEWF S    LSDDG D N+
Sbjct  866  EIAGYGPDTCQRAIPYSGVSNNLPEGGAKLILVDQVWTRMKEWFSSEVKYLSDDGGDGNS  925

Query  375  L-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            L  + MVR+E VGKGW +YLRLE +++G EIE KLLEE+V +++V L 
Sbjct  926  LVVDGMVRKEVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVELT  973



>ref|XP_009589093.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009589095.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009589096.1| PREDICTED: uncharacterized protein LOC104086523 isoform X1 [Nicotiana 
tomentosiformis]
Length=977

 Score =   271 bits (694),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 178/228 (78%), Gaps = 8/228 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSW+DSCVDTA SS  L P  S+QRTEEEE+EW  F+QTLL+ AGL
Sbjct  748  LIDKSPPIGSIARTLSWNDSCVDTA-SSVCLRPSASIQRTEEEEKEWFSFVQTLLTAAGL  806

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            +EVQSD+    WHSP+SPLDP LR+KY++LNE++ +HEA+RR+RRS RKLVFDCVNAAL+
Sbjct  807  NEVQSDAFLLMWHSPESPLDPSLREKYVDLNEQDVLHEARRRRRRSIRKLVFDCVNAALM  866

Query  537  DI-----DTCHKTIAFSGAHNTIPDGSS-IISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            +I     DTC + I +SG  N +P+G + +I  D+VW R+KEWF S    LSDDG D N+
Sbjct  867  EIAGYGPDTCQRAIPYSGVSNNLPEGGAKLILVDQVWTRMKEWFSSEVKYLSDDGGDGNS  926

Query  375  L-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            L  + MVR+E VGKGW +YLRLE +++G EIE KLLEE+V +++V L 
Sbjct  927  LVVDGMVRKEVVGKGWLQYLRLELDNVGMEIERKLLEELVHESIVELT  974



>ref|XP_006350289.1| PREDICTED: uncharacterized protein LOC102583747 [Solanum tuberosum]
Length=975

 Score =   259 bits (663),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 174/230 (76%), Gaps = 7/230 (3%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWDDSC DTA SS  + P  S QRTEE EREW  F+QTLL++AGL
Sbjct  747  LIDKSPPIGSIARTLSWDDSCADTA-SSVCVRPSSSTQRTEEVEREWFSFVQTLLTVAGL  805

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            DEVQ D+ S+ WHSP+SPLDP LR+KYI+LNEKET+HE+KRRQRRST+KLVFDCVNAAL+
Sbjct  806  DEVQPDAFSTMWHSPESPLDPSLREKYIDLNEKETLHESKRRQRRSTQKLVFDCVNAALL  865

Query  537  DI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            +I     D   K I + G HN +P G+ ++  ++VW R+KEWF S    LS DG D N+L
Sbjct  866  EIAEYGADNFQKAIPYMGVHNNLPQGTRLVLLEQVWDRMKEWFSSEVKYLSTDGGDLNSL  925

Query  372  -TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
              E MV +E +GK W E LRLE +++G EIE KLLEE+V ++VV LA  M
Sbjct  926  VVEEMVGKEVMGKMWLENLRLELDNVGVEIEEKLLEELVNESVVELAGKM  975



>ref|XP_008235543.1| PREDICTED: uncharacterized protein LOC103334363 [Prunus mume]
 ref|XP_008235544.1| PREDICTED: uncharacterized protein LOC103334363 [Prunus mume]
Length=981

 Score =   258 bits (658),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 176/229 (77%), Gaps = 10/229 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWDDSC +TAT     +P VS   TEEEE++W   +QTLLS AGL
Sbjct  754  LIDKSPPIGSIARTLSWDDSCAETATPYLLKSPSVS---TEEEEQDWHAIVQTLLSAAGL  810

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D EVQ DS  +RWHS ++PLDP LRDKY N+N+KE +HEAKRRQ RS+RKLVFDCVNAAL
Sbjct  811  DGEVQCDSFFTRWHSLETPLDPSLRDKYANINDKEPLHEAKRRQWRSSRKLVFDCVNAAL  870

Query  540  IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            +DI     D+  +T++ SGAH+   +G S + ADRVWGR++EWF S   C S +G D N+
Sbjct  871  VDITGYGSDSSTRTMSCSGAHDRFSEGDSSLLADRVWGRVREWFASEVRCASGEGGDSNS  930

Query  375  L-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  232
            L  ER+VR+E VGKGW E++RLE +++G EIEGKLLEE+V++AVV L +
Sbjct  931  LVVERVVRKEVVGKGWSEHMRLEIDNLGMEIEGKLLEELVEEAVVDLTE  979



>ref|XP_006352720.1| PREDICTED: uncharacterized protein LOC102578662 isoform X5 [Solanum 
tuberosum]
Length=963

 Score =   255 bits (652),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 173/228 (76%), Gaps = 8/228 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSW+DSCVDTA SS  L P +S  RTEEEE+EW   +QTLL++AGL
Sbjct  734  LIDKSPPIGSIARTLSWNDSCVDTA-SSVPLRPSLSTWRTEEEEKEWFSSVQTLLTVAGL  792

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            DEVQSD+    WHS +SPLDP LR+KY++LNEK T+HEA+RRQRRSTRKLVFDCVNAAL+
Sbjct  793  DEVQSDAFLLMWHSTESPLDPSLREKYVDLNEKNTLHEARRRQRRSTRKLVFDCVNAALM  852

Query  537  DI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-  376
            +I     DTC + I   G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N 
Sbjct  853  EISGYGPDTCQRAIPHIGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNS  912

Query  375  -LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             + + MVR+E VGKGW +YLRLE +++G EIE +LL E+V ++V+ L 
Sbjct  913  LVVDGMVRKEVVGKGWLQYLRLEIDNVGTEIERELLAELVHESVIELT  960



>ref|XP_006352716.1| PREDICTED: uncharacterized protein LOC102578662 isoform X1 [Solanum 
tuberosum]
Length=1089

 Score =   256 bits (653),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 173/228 (76%), Gaps = 8/228 (4%)
 Frame = -2

Query  897   LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
             LIDKSPPIGS+ARTLSW+DSCVDTA SS  L P +S  RTEEEE+EW   +QTLL++AGL
Sbjct  860   LIDKSPPIGSIARTLSWNDSCVDTA-SSVPLRPSLSTWRTEEEEKEWFSSVQTLLTVAGL  918

Query  717   DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
             DEVQSD+    WHS +SPLDP LR+KY++LNEK T+HEA+RRQRRSTRKLVFDCVNAAL+
Sbjct  919   DEVQSDAFLLMWHSTESPLDPSLREKYVDLNEKNTLHEARRRQRRSTRKLVFDCVNAALM  978

Query  537   DI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-  376
             +I     DTC + I   G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N 
Sbjct  979   EISGYGPDTCQRAIPHIGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNS  1038

Query  375   -LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
              + + MVR+E VGKGW +YLRLE +++G EIE +LL E+V ++V+ L 
Sbjct  1039  LVVDGMVRKEVVGKGWLQYLRLEIDNVGTEIERELLAELVHESVIELT  1086



>ref|XP_006352719.1| PREDICTED: uncharacterized protein LOC102578662 isoform X4 [Solanum 
tuberosum]
Length=1087

 Score =   256 bits (653),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 173/228 (76%), Gaps = 8/228 (4%)
 Frame = -2

Query  897   LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
             LIDKSPPIGS+ARTLSW+DSCVDTA SS  L P +S  RTEEEE+EW   +QTLL++AGL
Sbjct  858   LIDKSPPIGSIARTLSWNDSCVDTA-SSVPLRPSLSTWRTEEEEKEWFSSVQTLLTVAGL  916

Query  717   DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
             DEVQSD+    WHS +SPLDP LR+KY++LNEK T+HEA+RRQRRSTRKLVFDCVNAAL+
Sbjct  917   DEVQSDAFLLMWHSTESPLDPSLREKYVDLNEKNTLHEARRRQRRSTRKLVFDCVNAALM  976

Query  537   DI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-  376
             +I     DTC + I   G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N 
Sbjct  977   EISGYGPDTCQRAIPHIGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNS  1036

Query  375   -LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
              + + MVR+E VGKGW +YLRLE +++G EIE +LL E+V ++V+ L 
Sbjct  1037  LVVDGMVRKEVVGKGWLQYLRLEIDNVGTEIERELLAELVHESVIELT  1084



>ref|XP_006352718.1| PREDICTED: uncharacterized protein LOC102578662 isoform X3 [Solanum 
tuberosum]
Length=1088

 Score =   256 bits (653),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 173/228 (76%), Gaps = 8/228 (4%)
 Frame = -2

Query  897   LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
             LIDKSPPIGS+ARTLSW+DSCVDTA SS  L P +S  RTEEEE+EW   +QTLL++AGL
Sbjct  859   LIDKSPPIGSIARTLSWNDSCVDTA-SSVPLRPSLSTWRTEEEEKEWFSSVQTLLTVAGL  917

Query  717   DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
             DEVQSD+    WHS +SPLDP LR+KY++LNEK T+HEA+RRQRRSTRKLVFDCVNAAL+
Sbjct  918   DEVQSDAFLLMWHSTESPLDPSLREKYVDLNEKNTLHEARRRQRRSTRKLVFDCVNAALM  977

Query  537   DI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-  376
             +I     DTC + I   G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N 
Sbjct  978   EISGYGPDTCQRAIPHIGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNS  1037

Query  375   -LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
              + + MVR+E VGKGW +YLRLE +++G EIE +LL E+V ++V+ L 
Sbjct  1038  LVVDGMVRKEVVGKGWLQYLRLEIDNVGTEIERELLAELVHESVIELT  1085



>ref|XP_006352717.1| PREDICTED: uncharacterized protein LOC102578662 isoform X2 [Solanum 
tuberosum]
Length=1088

 Score =   256 bits (653),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 173/228 (76%), Gaps = 8/228 (4%)
 Frame = -2

Query  897   LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
             LIDKSPPIGS+ARTLSW+DSCVDTA SS  L P +S  RTEEEE+EW   +QTLL++AGL
Sbjct  859   LIDKSPPIGSIARTLSWNDSCVDTA-SSVPLRPSLSTWRTEEEEKEWFSSVQTLLTVAGL  917

Query  717   DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
             DEVQSD+    WHS +SPLDP LR+KY++LNEK T+HEA+RRQRRSTRKLVFDCVNAAL+
Sbjct  918   DEVQSDAFLLMWHSTESPLDPSLREKYVDLNEKNTLHEARRRQRRSTRKLVFDCVNAALM  977

Query  537   DI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN-  376
             +I     DTC + I   G  N +P+G+ +I  D+VW R+KEWF S   CLS D  +D N 
Sbjct  978   EISGYGPDTCQRAIPHIGVSNNLPEGAKLILVDQVWTRMKEWFSSEVKCLSGDDDEDGNS  1037

Query  375   -LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
              + + MVR+E VGKGW +YLRLE +++G EIE +LL E+V ++V+ L 
Sbjct  1038  LVVDGMVRKEVVGKGWLQYLRLEIDNVGTEIERELLAELVHESVIELT  1085



>ref|XP_010323077.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
 ref|XP_010323078.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
 ref|XP_010323079.1| PREDICTED: uncharacterized protein LOC101266733 isoform X5 [Solanum 
lycopersicum]
Length=963

 Score =   255 bits (651),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/249 (56%), Positives = 182/249 (73%), Gaps = 11/249 (4%)
 Frame = -2

Query  951  KAXPSWGESCLFSPXGPI---LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQR  781
            +  P  G+SC      PI   LIDKSPPIGS+ARTLSW+DSC+DTA SS  L P +S  R
Sbjct  713  RTKPDHGKSCGELSVDPIRCNLIDKSPPIGSIARTLSWNDSCIDTA-SSVPLRPFLSTWR  771

Query  780  TEEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEA  601
            TEEEE+EW  F+QTLL++AGLDEVQSD+    WHS +SPLDP LR+KY++L+EK T+HEA
Sbjct  772  TEEEEKEWFSFVQTLLTVAGLDEVQSDAFLLMWHSTESPLDPSLREKYVDLHEKNTLHEA  831

Query  600  KRRQRRSTRKLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRI  436
            +RRQRRSTRKLVFDCVNAAL++I     DTC + I  +G  N +P+G+ +I  D+VW R+
Sbjct  832  RRRQRRSTRKLVFDCVNAALMEIAGYGPDTCQRAIPHNGVSNNLPEGAKLILVDQVWTRM  891

Query  435  KEWFPSAAGCLSDDGVDDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEI  262
            KEWF S   CLS D  +D N  + + +V +E VGKGW ++LRLE +++G EIE +LL E+
Sbjct  892  KEWFSSEVKCLSGDDDEDGNSLVVDGLVMKEVVGKGWLQHLRLEIDNVGTEIERELLAEL  951

Query  261  VQDAVVGLA  235
            V ++V+ L 
Sbjct  952  VHESVIELT  960



>ref|XP_010323073.1| PREDICTED: uncharacterized protein LOC101266733 isoform X1 [Solanum 
lycopersicum]
Length=988

 Score =   255 bits (651),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/249 (56%), Positives = 182/249 (73%), Gaps = 11/249 (4%)
 Frame = -2

Query  951  KAXPSWGESCLFSPXGPI---LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQR  781
            +  P  G+SC      PI   LIDKSPPIGS+ARTLSW+DSC+DTA SS  L P +S  R
Sbjct  738  RTKPDHGKSCGELSVDPIRCNLIDKSPPIGSIARTLSWNDSCIDTA-SSVPLRPFLSTWR  796

Query  780  TEEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEA  601
            TEEEE+EW  F+QTLL++AGLDEVQSD+    WHS +SPLDP LR+KY++L+EK T+HEA
Sbjct  797  TEEEEKEWFSFVQTLLTVAGLDEVQSDAFLLMWHSTESPLDPSLREKYVDLHEKNTLHEA  856

Query  600  KRRQRRSTRKLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRI  436
            +RRQRRSTRKLVFDCVNAAL++I     DTC + I  +G  N +P+G+ +I  D+VW R+
Sbjct  857  RRRQRRSTRKLVFDCVNAALMEIAGYGPDTCQRAIPHNGVSNNLPEGAKLILVDQVWTRM  916

Query  435  KEWFPSAAGCLSDDGVDDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEI  262
            KEWF S   CLS D  +D N  + + +V +E VGKGW ++LRLE +++G EIE +LL E+
Sbjct  917  KEWFSSEVKCLSGDDDEDGNSLVVDGLVMKEVVGKGWLQHLRLEIDNVGTEIERELLAEL  976

Query  261  VQDAVVGLA  235
            V ++V+ L 
Sbjct  977  VHESVIELT  985



>ref|XP_010323074.1| PREDICTED: uncharacterized protein LOC101266733 isoform X2 [Solanum 
lycopersicum]
Length=987

 Score =   255 bits (651),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/249 (56%), Positives = 182/249 (73%), Gaps = 11/249 (4%)
 Frame = -2

Query  951  KAXPSWGESCLFSPXGPI---LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQR  781
            +  P  G+SC      PI   LIDKSPPIGS+ARTLSW+DSC+DTA SS  L P +S  R
Sbjct  737  RTKPDHGKSCGELSVDPIRCNLIDKSPPIGSIARTLSWNDSCIDTA-SSVPLRPFLSTWR  795

Query  780  TEEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEA  601
            TEEEE+EW  F+QTLL++AGLDEVQSD+    WHS +SPLDP LR+KY++L+EK T+HEA
Sbjct  796  TEEEEKEWFSFVQTLLTVAGLDEVQSDAFLLMWHSTESPLDPSLREKYVDLHEKNTLHEA  855

Query  600  KRRQRRSTRKLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRI  436
            +RRQRRSTRKLVFDCVNAAL++I     DTC + I  +G  N +P+G+ +I  D+VW R+
Sbjct  856  RRRQRRSTRKLVFDCVNAALMEIAGYGPDTCQRAIPHNGVSNNLPEGAKLILVDQVWTRM  915

Query  435  KEWFPSAAGCLSDDGVDDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEI  262
            KEWF S   CLS D  +D N  + + +V +E VGKGW ++LRLE +++G EIE +LL E+
Sbjct  916  KEWFSSEVKCLSGDDDEDGNSLVVDGLVMKEVVGKGWLQHLRLEIDNVGTEIERELLAEL  975

Query  261  VQDAVVGLA  235
            V ++V+ L 
Sbjct  976  VHESVIELT  984



>ref|XP_010323076.1| PREDICTED: uncharacterized protein LOC101266733 isoform X4 [Solanum 
lycopersicum]
Length=984

 Score =   251 bits (642),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 178/246 (72%), Gaps = 8/246 (3%)
 Frame = -2

Query  951  KAXPSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEE  772
            +  P  G      P    LIDKSPPIGS+ARTLSW+DSC+DTA SS  L P +S  RTEE
Sbjct  737  RTKPDHGGELSVDPIRCNLIDKSPPIGSIARTLSWNDSCIDTA-SSVPLRPFLSTWRTEE  795

Query  771  EEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRR  592
            EE+EW  F+QTLL++AGLDEVQSD+    WHS +SPLDP LR+KY++L+EK T+HEA+RR
Sbjct  796  EEKEWFSFVQTLLTVAGLDEVQSDAFLLMWHSTESPLDPSLREKYVDLHEKNTLHEARRR  855

Query  591  QRRSTRKLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEW  427
            QRRSTRKLVFDCVNAAL++I     DTC + I  +G  N +P+G+ +I  D+VW R+KEW
Sbjct  856  QRRSTRKLVFDCVNAALMEIAGYGPDTCQRAIPHNGVSNNLPEGAKLILVDQVWTRMKEW  915

Query  426  FPSAAGCLSDDGVDDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQD  253
            F S   CLS D  +D N  + + +V +E VGKGW ++LRLE +++G EIE +LL E+V +
Sbjct  916  FSSEVKCLSGDDDEDGNSLVVDGLVMKEVVGKGWLQHLRLEIDNVGTEIERELLAELVHE  975

Query  252  AVVGLA  235
            +V+ L 
Sbjct  976  SVIELT  981



>ref|XP_010323075.1| PREDICTED: uncharacterized protein LOC101266733 isoform X3 [Solanum 
lycopersicum]
Length=985

 Score =   251 bits (642),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 178/246 (72%), Gaps = 8/246 (3%)
 Frame = -2

Query  951  KAXPSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEE  772
            +  P  G      P    LIDKSPPIGS+ARTLSW+DSC+DTA SS  L P +S  RTEE
Sbjct  738  RTKPDHGGELSVDPIRCNLIDKSPPIGSIARTLSWNDSCIDTA-SSVPLRPFLSTWRTEE  796

Query  771  EEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRR  592
            EE+EW  F+QTLL++AGLDEVQSD+    WHS +SPLDP LR+KY++L+EK T+HEA+RR
Sbjct  797  EEKEWFSFVQTLLTVAGLDEVQSDAFLLMWHSTESPLDPSLREKYVDLHEKNTLHEARRR  856

Query  591  QRRSTRKLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEW  427
            QRRSTRKLVFDCVNAAL++I     DTC + I  +G  N +P+G+ +I  D+VW R+KEW
Sbjct  857  QRRSTRKLVFDCVNAALMEIAGYGPDTCQRAIPHNGVSNNLPEGAKLILVDQVWTRMKEW  916

Query  426  FPSAAGCLSDDGVDDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQD  253
            F S   CLS D  +D N  + + +V +E VGKGW ++LRLE +++G EIE +LL E+V +
Sbjct  917  FSSEVKCLSGDDDEDGNSLVVDGLVMKEVVGKGWLQHLRLEIDNVGTEIERELLAELVHE  976

Query  252  AVVGLA  235
            +V+ L 
Sbjct  977  SVIELT  982



>ref|XP_007199004.1| hypothetical protein PRUPE_ppa000852mg [Prunus persica]
 gb|EMJ00203.1| hypothetical protein PRUPE_ppa000852mg [Prunus persica]
Length=981

 Score =   250 bits (638),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 173/228 (76%), Gaps = 10/228 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWDDSC +TAT     +P VS    EEEE++W   +QTLLS AGL
Sbjct  754  LIDKSPPIGSIARTLSWDDSCAETATPYLLKSPSVS---AEEEEQDWHAIVQTLLSAAGL  810

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            + EVQ DS  +RWHS +SPLDP LRDKY NLN+KE +HEAKRRQ RS+RKLVFDCVNAAL
Sbjct  811  NGEVQCDSFFTRWHSLESPLDPSLRDKYANLNDKEPLHEAKRRQWRSSRKLVFDCVNAAL  870

Query  540  IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            +DI     D+  +T++ SGA +   +G S + ADRVWG+++EWF S   C S +  D N+
Sbjct  871  VDITGYGSDSGTRTMSCSGARDRFSEGDSSLLADRVWGQVREWFASEVRCASGEAGDSNS  930

Query  375  L-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            L  ER+VR+E VGKGW E++RLE +++GKEIEGKLLEE+V++AVV L 
Sbjct  931  LVVERVVRKEVVGKGWSEHMRLEIDNLGKEIEGKLLEELVEEAVVDLT  978



>ref|XP_009371001.1| PREDICTED: uncharacterized protein LOC103960277 isoform X1 [Pyrus 
x bretschneideri]
Length=988

 Score =   247 bits (631),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 172/231 (74%), Gaps = 14/231 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWD+SC +TAT     +P VS   TEEEE++W   +QTLLS AGL
Sbjct  757  LIDKSPPIGSIARTLSWDESCAETATPYLLKSPSVS---TEEEEQDWHATVQTLLSAAGL  813

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D EVQ DS  + WHS DSPLDP LRDKY NL++KE +HEAKRR+ RS++KLVFDCVNAAL
Sbjct  814  DGEVQCDSFFAIWHSLDSPLDPSLRDKYSNLSDKEPLHEAKRRRLRSSQKLVFDCVNAAL  873

Query  540  IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            +DI     D+C +T + SGAH+   +G S + AD VW R+KEWF     C+SD G D N 
Sbjct  874  MDITGHGSDSCSRTTSCSGAHDRFVEGDSPLLADHVWARMKEWFSDEVRCVSDGGGDING  933

Query  375  L-----TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            L      ER+V++E VGKGW E++RLE +++G+ IEGKLLEE+V++AVVGL
Sbjct  934  LVVERVVERVVKKEVVGKGWSEHMRLEIDNLGRGIEGKLLEELVEEAVVGL  984



>ref|XP_009371010.1| PREDICTED: uncharacterized protein LOC103960277 isoform X2 [Pyrus 
x bretschneideri]
Length=985

 Score =   247 bits (631),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 172/231 (74%), Gaps = 14/231 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWD+SC +TAT     +P VS   TEEEE++W   +QTLLS AGL
Sbjct  754  LIDKSPPIGSIARTLSWDESCAETATPYLLKSPSVS---TEEEEQDWHATVQTLLSAAGL  810

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D EVQ DS  + WHS DSPLDP LRDKY NL++KE +HEAKRR+ RS++KLVFDCVNAAL
Sbjct  811  DGEVQCDSFFAIWHSLDSPLDPSLRDKYSNLSDKEPLHEAKRRRLRSSQKLVFDCVNAAL  870

Query  540  IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            +DI     D+C +T + SGAH+   +G S + AD VW R+KEWF     C+SD G D N 
Sbjct  871  MDITGHGSDSCSRTTSCSGAHDRFVEGDSPLLADHVWARMKEWFSDEVRCVSDGGGDING  930

Query  375  L-----TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            L      ER+V++E VGKGW E++RLE +++G+ IEGKLLEE+V++AVVGL
Sbjct  931  LVVERVVERVVKKEVVGKGWSEHMRLEIDNLGRGIEGKLLEELVEEAVVGL  981



>ref|XP_010326332.1| PREDICTED: uncharacterized protein LOC101266067 isoform X2 [Solanum 
lycopersicum]
Length=894

 Score =   241 bits (615),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 173/233 (74%), Gaps = 10/233 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWDD+C DTA SS  + P  S QRTEE EREW  F+QTLL++AGL
Sbjct  663  LIDKSPPIGSIARTLSWDDTCADTA-SSVCVRPSSSTQRTEEVEREWFSFVQTLLTVAGL  721

Query  717  DEVQSDSLSS--RWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            DEVQ D+ S+  +WHSP+SPLDP LR+KYI+LNEKET+HE+KRRQRRST+KLVFDCVNAA
Sbjct  722  DEVQPDAFSTMWQWHSPESPLDPSLREKYIDLNEKETLHESKRRQRRSTQKLVFDCVNAA  781

Query  543  LIDI-----DTCHKTIAFSGAHNTIPDGSS-IISADRVWGRIKEWFPSAAGCLSDDGVDD  382
            L++I     D   K I + G HN +P G++ ++  ++VW  +KEWF S    LS DG D 
Sbjct  782  LLEIAEYGADNFQKAIPYMGVHNNLPQGTTRLVLLEQVWDWMKEWFSSEMKYLSTDGGDL  841

Query  381  NNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
            N+L  E MV +E +GK W   LR+E +++G EIE KLLEE+V ++VV L   M
Sbjct  842  NSLVVEEMVGKEVMGKMWLGNLRIELDNVGVEIEEKLLEELVNESVVELTGKM  894



>ref|XP_004247114.1| PREDICTED: uncharacterized protein LOC101266067 isoform X1 [Solanum 
lycopersicum]
Length=981

 Score =   241 bits (614),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 173/233 (74%), Gaps = 10/233 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWDD+C DTA SS  + P  S QRTEE EREW  F+QTLL++AGL
Sbjct  750  LIDKSPPIGSIARTLSWDDTCADTA-SSVCVRPSSSTQRTEEVEREWFSFVQTLLTVAGL  808

Query  717  DEVQSDSLSS--RWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            DEVQ D+ S+  +WHSP+SPLDP LR+KYI+LNEKET+HE+KRRQRRST+KLVFDCVNAA
Sbjct  809  DEVQPDAFSTMWQWHSPESPLDPSLREKYIDLNEKETLHESKRRQRRSTQKLVFDCVNAA  868

Query  543  LIDI-----DTCHKTIAFSGAHNTIPDGSS-IISADRVWGRIKEWFPSAAGCLSDDGVDD  382
            L++I     D   K I + G HN +P G++ ++  ++VW  +KEWF S    LS DG D 
Sbjct  869  LLEIAEYGADNFQKAIPYMGVHNNLPQGTTRLVLLEQVWDWMKEWFSSEMKYLSTDGGDL  928

Query  381  NNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
            N+L  E MV +E +GK W   LR+E +++G EIE KLLEE+V ++VV L   M
Sbjct  929  NSLVVEEMVGKEVMGKMWLGNLRIELDNVGVEIEEKLLEELVNESVVELTGKM  981



>ref|XP_002521158.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41309.1| conserved hypothetical protein [Ricinus communis]
Length=990

 Score =   240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 166/228 (73%), Gaps = 8/228 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSCV+TAT  YSL P       ++EE++W FFI+TLLS AGL
Sbjct  761  LIDKSPPIESIARTLSWDDSCVETATP-YSLKPSSISTCPQDEEQDWPFFIRTLLSAAGL  819

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D  +  DS SSRWHSP+SPLDP LR+KY+NLN+KE +HEAKRRQRRSTRKLVFD VNAAL
Sbjct  820  DVNMHLDSFSSRWHSPESPLDPALRNKYVNLNDKELLHEAKRRQRRSTRKLVFDSVNAAL  879

Query  540  IDIDTCHK-----TIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            ++I  C        +   GAHN    G+S +  D VW ++KEWF S   C  +D  D ++
Sbjct  880  VEITGCGHDRSTTVVPCKGAHNWFIQGTSPMLVDHVWAQMKEWFCSEVKCTFEDSEDRSS  939

Query  375  L-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            L  ER+VR+E VGKGW + +R+E +++GKEIE KLL EIV+D VV LA
Sbjct  940  LVVERVVRKEVVGKGWADNMRVELDNLGKEIEDKLLSEIVEDVVVDLA  987



>ref|XP_011080145.1| PREDICTED: uncharacterized protein LOC105163485 [Sesamum indicum]
 ref|XP_011080146.1| PREDICTED: uncharacterized protein LOC105163485 [Sesamum indicum]
Length=957

 Score =   238 bits (608),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 153/211 (73%), Gaps = 8/211 (4%)
 Frame = -2

Query  906  GPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSM  727
            G  LIDKSPPIGS+ARTLSWDDSC+DTA SS+     +  + T+E+E+    +++TLLS+
Sbjct  721  GSNLIDKSPPIGSIARTLSWDDSCIDTA-SSHPAKECLITEETDEDEQNLYTYVKTLLSV  779

Query  726  AGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
            AGL  EVQSDS  +RWHSP+SPLDP LRDKYI+L +KET+HEAKRRQRRS RKLVFDCVN
Sbjct  780  AGLQGEVQSDSFLARWHSPESPLDPSLRDKYIDLKDKETLHEAKRRQRRSMRKLVFDCVN  839

Query  549  AALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
             AL+DI     D   + +   GA+N   D +S+   D+VWGRI  WF     C+SDD  D
Sbjct  840  TALVDIAGYGSDLGQRALPCIGANNHTSDSASLTMVDKVWGRINVWFSIKVKCVSDDSGD  899

Query  384  DNNL-TERMVRQEAVGKGWHEYLRLEAESIG  295
            +NNL  ER+VR E  GKGW ++LRLE +++G
Sbjct  900  ENNLVVERLVRNEVAGKGWMDHLRLEIDNLG  930



>ref|XP_004292261.1| PREDICTED: uncharacterized protein LOC101294433 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458059.1| PREDICTED: uncharacterized protein LOC101294433 [Fragaria vesca 
subsp. vesca]
Length=987

 Score =   235 bits (599),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 168/231 (73%), Gaps = 11/231 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTAT--SSYSLNPPVSMQRTEEEEREWLFFIQTLLSMA  724
            LIDKSPPIGS+ARTLSW +SC + AT    Y +  P     TEEEE++W   +QTLLS A
Sbjct  753  LIDKSPPIGSIARTLSWGESCAEPATPYGPYLVKSPSVSTSTEEEEQDWHAVVQTLLSAA  812

Query  723  GLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNA  547
            GLD E+Q DS   +WHS +SPLDP LRDKY N N+KE +HEAKRR+ RS+RKLVFDCVNA
Sbjct  813  GLDGELQCDSFFGKWHSLESPLDPSLRDKYANPNDKEPLHEAKRRKWRSSRKLVFDCVNA  872

Query  546  ALIDI-------DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV  388
            AL+DI        +  + ++ SGAH+   +G S++ ADRVW R+KEWF S   C+S+DG 
Sbjct  873  ALVDITGYGSSDSSSVRIVSCSGAHDRFLEGDSLLLADRVWSRVKEWFLSDVRCVSEDGG  932

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            D N+L  ER+V++E VG+GW E +R E + +GKEIEGKLL+E+V++AVV L
Sbjct  933  DINSLVVERVVKKEVVGRGWPEQMRCEIDIVGKEIEGKLLQELVEEAVVDL  983



>emb|CDP03827.1| unnamed protein product [Coffea canephora]
Length=962

 Score =   234 bits (598),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 163/228 (71%), Gaps = 28/228 (12%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMA  724
            P LIDKSPPIGS+ARTLSW +SCVDTATS Y L P  S Q  EE E EW FF+Q LLS+A
Sbjct  749  PNLIDKSPPIGSIARTLSWGESCVDTATS-YPLKPSSSPQGAEEGEGEWFFFVQALLSVA  807

Query  723  GLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNA  547
            GLD EV+SD+L +RWHS +SPLDP LRDKYINLN+K+T+ EA+RRQ  STRKLVFDCVNA
Sbjct  808  GLDGEVRSDALLARWHSSESPLDPSLRDKYINLNDKDTLREARRRQWWSTRKLVFDCVNA  867

Query  546  ALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDD  382
            AL++I      TC + I F                   W R+KEWF     C++ D V D
Sbjct  868  ALVEIAGYGSGTCQRAIPF-------------------WARMKEWFSGEERCVTGDCVVD  908

Query  381  NN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
            NN  + ER+VR+E VGKGW ++LRLE +++GKEIE KLL+EIVQ+AVV
Sbjct  909  NNSVVVERVVRKEVVGKGWLDHLRLEMDNLGKEIEQKLLDEIVQEAVV  956



>gb|KHG22481.1| Viral inhibitor of RIP activation [Gossypium arboreum]
Length=1004

 Score =   234 bits (598),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 161/231 (70%), Gaps = 7/231 (3%)
 Frame = -2

Query  897   LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
             LIDKSPPI S+ARTLSWDDSC +TAT  Y           +EEE++W  F+Q LLS AGL
Sbjct  773   LIDKSPPIESIARTLSWDDSCSETATLLYPSKLSSVSPGAKEEEQDWFLFVQLLLSAAGL  832

Query  717   D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
             + EVQ DS  +RWHS +SPLDP LRDKY NLN+KE +HEAKRRQ RS RKL+FDCVNAAL
Sbjct  833   NGEVQLDSFFARWHSAESPLDPCLRDKYANLNDKEPLHEAKRRQWRSNRKLIFDCVNAAL  892

Query  540   IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDN  379
             ++I     D C K ++F  A   + +G+S +  D VW ++KEWF     CL  DDG  D+
Sbjct  893   LEISGYGSDRCMKAMSFGRAQMIVKEGASPMLVDHVWAQMKEWFSGEVKCLGCDDGDSDS  952

Query  378   NLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
              + ER++++E VGKGW + ++ EA+++ +EIE +LLEE+V++AV  L   +
Sbjct  953   LVVERVLQKEVVGKGWIDQMQWEADNLEREIEWRLLEELVEEAVTDLTGKL  1003



>gb|KJB10993.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=930

 Score =   234 bits (597),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 162/231 (70%), Gaps = 7/231 (3%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LI+KSPPI S+ARTLSWDDSC +TAT  Y     +     +EEE++W  F+Q LLS AGL
Sbjct  699  LIEKSPPIESIARTLSWDDSCSETATLLYPSKLSLVSPGAKEEEQDWFLFVQLLLSAAGL  758

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            + EVQ DS  +RWHS +SPLDP LR+KY NLN+KE +HEAKRRQ RS RKL+FDCVNAAL
Sbjct  759  NGEVQLDSFFARWHSAESPLDPCLREKYANLNDKEPLHEAKRRQWRSNRKLIFDCVNAAL  818

Query  540  IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDN  379
            ++I     D C K ++F  A     +G+S +  D VW ++KEWF     CL  DDG  D+
Sbjct  819  LEISGYGSDRCMKAMSFGRAQMIGKEGASPMLVDHVWAQMKEWFSGEVKCLGCDDGDSDS  878

Query  378  NLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             + ER+V++E VGKGW + ++ EA+++G+EIE +LLEE+V++AV  +   +
Sbjct  879  LVVERVVQKEVVGKGWIDQMKWEADNLGREIEWRLLEELVEEAVTDITGKL  929



>gb|KJB10995.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
 gb|KJB10998.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=988

 Score =   234 bits (597),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 162/231 (70%), Gaps = 7/231 (3%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LI+KSPPI S+ARTLSWDDSC +TAT  Y     +     +EEE++W  F+Q LLS AGL
Sbjct  757  LIEKSPPIESIARTLSWDDSCSETATLLYPSKLSLVSPGAKEEEQDWFLFVQLLLSAAGL  816

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            + EVQ DS  +RWHS +SPLDP LR+KY NLN+KE +HEAKRRQ RS RKL+FDCVNAAL
Sbjct  817  NGEVQLDSFFARWHSAESPLDPCLREKYANLNDKEPLHEAKRRQWRSNRKLIFDCVNAAL  876

Query  540  IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDN  379
            ++I     D C K ++F  A     +G+S +  D VW ++KEWF     CL  DDG  D+
Sbjct  877  LEISGYGSDRCMKAMSFGRAQMIGKEGASPMLVDHVWAQMKEWFSGEVKCLGCDDGDSDS  936

Query  378  NLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             + ER+V++E VGKGW + ++ EA+++G+EIE +LLEE+V++AV  +   +
Sbjct  937  LVVERVVQKEVVGKGWIDQMKWEADNLGREIEWRLLEELVEEAVTDITGKL  987



>gb|KJB10997.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=999

 Score =   234 bits (597),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 162/231 (70%), Gaps = 7/231 (3%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LI+KSPPI S+ARTLSWDDSC +TAT  Y     +     +EEE++W  F+Q LLS AGL
Sbjct  768  LIEKSPPIESIARTLSWDDSCSETATLLYPSKLSLVSPGAKEEEQDWFLFVQLLLSAAGL  827

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            + EVQ DS  +RWHS +SPLDP LR+KY NLN+KE +HEAKRRQ RS RKL+FDCVNAAL
Sbjct  828  NGEVQLDSFFARWHSAESPLDPCLREKYANLNDKEPLHEAKRRQWRSNRKLIFDCVNAAL  887

Query  540  IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDN  379
            ++I     D C K ++F  A     +G+S +  D VW ++KEWF     CL  DDG  D+
Sbjct  888  LEISGYGSDRCMKAMSFGRAQMIGKEGASPMLVDHVWAQMKEWFSGEVKCLGCDDGDSDS  947

Query  378  NLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             + ER+V++E VGKGW + ++ EA+++G+EIE +LLEE+V++AV  +   +
Sbjct  948  LVVERVVQKEVVGKGWIDQMKWEADNLGREIEWRLLEELVEEAVTDITGKL  998



>ref|XP_002303096.2| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
 gb|EEE82369.2| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
Length=940

 Score =   231 bits (589),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 159/230 (69%), Gaps = 18/230 (8%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSM  727
            LI KSPPI SVARTL+WD+SC +TA SSY L P   PVS+   EE+E+ W  F+Q LL+ 
Sbjct  723  LIGKSPPIESVARTLTWDNSCAETA-SSYPLKPTPSPVSLG-AEEDEKYWFSFVQALLTA  780

Query  726  AGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
            AGLD EVQ DS  SRWHSP+SPLDP LRDKY N N+KE +HEAKRRQRRS +KLVFDCVN
Sbjct  781  AGLDCEVQLDSFFSRWHSPESPLDPSLRDKYANPNDKELLHEAKRRQRRSNQKLVFDCVN  840

Query  549  AALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--  376
            AAL++I            H +     ++ S + VW ++KEWF S   C S DG  D+N  
Sbjct  841  AALVEIT----------GHGSDRSTRAMTSTEYVWAQMKEWFCSDVRCASGDGGGDSNSL  890

Query  375  LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
            + E +VR+E VGKGW + +R+E +++  EIEGKLL+E+V++ VV  A  M
Sbjct  891  VVEMVVRKEVVGKGWIDKMRVELDTLQNEIEGKLLDELVEETVVDFAGRM  940



>ref|XP_006386899.1| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
 gb|ERP64696.1| hypothetical protein POPTR_0002s25490g [Populus trichocarpa]
Length=968

 Score =   231 bits (589),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 159/230 (69%), Gaps = 18/230 (8%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSM  727
            LI KSPPI SVARTL+WD+SC +TA SSY L P   PVS+   EE+E+ W  F+Q LL+ 
Sbjct  751  LIGKSPPIESVARTLTWDNSCAETA-SSYPLKPTPSPVSLG-AEEDEKYWFSFVQALLTA  808

Query  726  AGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
            AGLD EVQ DS  SRWHSP+SPLDP LRDKY N N+KE +HEAKRRQRRS +KLVFDCVN
Sbjct  809  AGLDCEVQLDSFFSRWHSPESPLDPSLRDKYANPNDKELLHEAKRRQRRSNQKLVFDCVN  868

Query  549  AALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN--  376
            AAL++I            H +     ++ S + VW ++KEWF S   C S DG  D+N  
Sbjct  869  AALVEIT----------GHGSDRSTRAMTSTEYVWAQMKEWFCSDVRCASGDGGGDSNSL  918

Query  375  LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
            + E +VR+E VGKGW + +R+E +++  EIEGKLL+E+V++ VV  A  M
Sbjct  919  VVEMVVRKEVVGKGWIDKMRVELDTLQNEIEGKLLDELVEETVVDFAGRM  968



>ref|XP_002267519.1| PREDICTED: uncharacterized protein LOC100241277 isoform X1 [Vitis 
vinifera]
Length=991

 Score =   230 bits (587),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 160/222 (72%), Gaps = 9/222 (4%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G   L  P    LIDKSP I S+ARTLSWDDSC +TAT  Y L P ++  R EE+E++WL
Sbjct  749  GTQVLVHPLKSNLIDKSPRIESIARTLSWDDSCTETATP-YPLKPSLASSRAEEDEQDWL  807

Query  753  FFIQTLLSMAGLDE-VQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRST  577
            FF+QTLLS AG D+ VQ+D+  SRWHSP++PLDP LRDKY  LN+KE +HEAKRRQRRS 
Sbjct  808  FFVQTLLSAAGFDDNVQTDTFFSRWHSPETPLDPALRDKYAELNDKEILHEAKRRQRRSN  867

Query  576  RKLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDG--SSIISADRVWGRIKEWFPS  418
            RKLV+DCVNAAL+DI     D   +    SGA+NT  +G  SS I  +RVWGR+KEWF  
Sbjct  868  RKLVYDCVNAALVDITDYGPDCTQRARRCSGAYNTGVEGGSSSPILVERVWGRMKEWFSG  927

Query  417  AAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGK  292
               C+  +G D++ + ER+VR+E VGKGW E++RL+ ++IGK
Sbjct  928  EVRCVWGEGGDNDLVVERVVRKEVVGKGWVEHMRLQVDNIGK  969



>ref|XP_010652446.1| PREDICTED: uncharacterized protein LOC100241277 isoform X2 [Vitis 
vinifera]
Length=986

 Score =   230 bits (587),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 160/222 (72%), Gaps = 9/222 (4%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G   L  P    LIDKSP I S+ARTLSWDDSC +TAT  Y L P ++  R EE+E++WL
Sbjct  744  GTQVLVHPLKSNLIDKSPRIESIARTLSWDDSCTETATP-YPLKPSLASSRAEEDEQDWL  802

Query  753  FFIQTLLSMAGLDE-VQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRST  577
            FF+QTLLS AG D+ VQ+D+  SRWHSP++PLDP LRDKY  LN+KE +HEAKRRQRRS 
Sbjct  803  FFVQTLLSAAGFDDNVQTDTFFSRWHSPETPLDPALRDKYAELNDKEILHEAKRRQRRSN  862

Query  576  RKLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDG--SSIISADRVWGRIKEWFPS  418
            RKLV+DCVNAAL+DI     D   +    SGA+NT  +G  SS I  +RVWGR+KEWF  
Sbjct  863  RKLVYDCVNAALVDITDYGPDCTQRARRCSGAYNTGVEGGSSSPILVERVWGRMKEWFSG  922

Query  417  AAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGK  292
               C+  +G D++ + ER+VR+E VGKGW E++RL+ ++IGK
Sbjct  923  EVRCVWGEGGDNDLVVERVVRKEVVGKGWVEHMRLQVDNIGK  964



>ref|XP_008382666.1| PREDICTED: uncharacterized protein LOC103445438 [Malus domestica]
Length=983

 Score =   229 bits (585),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 167/227 (74%), Gaps = 10/227 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS++RTLSWD+SC +TA+     +P VS   TE EE++W   +QTLLS AGL
Sbjct  756  LIDKSPPIGSISRTLSWDESCAETASPYLLKSPSVS---TEGEEQDWHAIVQTLLSTAGL  812

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D  V+ DS  +RWHS +SPLDP LR+K  NL++KE +HEAKRR+ RS+RKLVFDCVNAAL
Sbjct  813  DGXVKCDSFFARWHSLESPLDPSLREKXANLSDKEPLHEAKRRRFRSSRKLVFDCVNAAL  872

Query  540  IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            +DI     D+C +T   SGAH+   +G S + AD VW R+ EWF     C+ +DG D N+
Sbjct  873  VDITGYGSDSCTRTTPCSGAHDRFLEGDSPLLADHVWARMPEWFSDEVRCVLEDGXDIND  932

Query  375  -LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
             + ER++++E VGKGW E +RLE ++ GKEIEGKLLEE+V++AVV L
Sbjct  933  VVVERVLKKEVVGKGWSENMRLEIDNFGKEIEGKLLEELVEEAVVDL  979



>ref|XP_008372424.1| PREDICTED: uncharacterized protein LOC103435787 isoform X2 [Malus 
domestica]
Length=985

 Score =   228 bits (580),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 172/231 (74%), Gaps = 14/231 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWD+SC +TAT     +P VS   TEEEE++W   +QTLLS AGL
Sbjct  754  LIDKSPPIGSIARTLSWDESCAETATPYLLKSPSVS---TEEEEQDWHATVQTLLSAAGL  810

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D EVQ DS  + WHS +SPLDP LRDKY N ++KE +HEAKRR+ RS+RKLVFDCVNAAL
Sbjct  811  DGEVQCDSFFTIWHSLESPLDPSLRDKYANQSDKEPLHEAKRRRLRSSRKLVFDCVNAAL  870

Query  540  ID-----IDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            +D      D+C +T + SGAH+   +G S + ADR+W R+K+WF     C+S+DG D N 
Sbjct  871  VDNTGYGSDSCTRTTSCSGAHDRFVEGDSPLLADRLWARMKDWFSDEVRCVSEDGGDING  930

Query  375  L-----TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            L      ERMV++E VGKGW E++RLE +++G++IEGKLLEE+V+++VV L
Sbjct  931  LVVERVVERMVKKEVVGKGWSEHMRLEIDNLGRDIEGKLLEELVEESVVDL  981



>ref|XP_008372423.1| PREDICTED: uncharacterized protein LOC103435787 isoform X1 [Malus 
domestica]
Length=988

 Score =   227 bits (579),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 172/231 (74%), Gaps = 14/231 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWD+SC +TAT     +P VS   TEEEE++W   +QTLLS AGL
Sbjct  757  LIDKSPPIGSIARTLSWDESCAETATPYLLKSPSVS---TEEEEQDWHATVQTLLSAAGL  813

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D EVQ DS  + WHS +SPLDP LRDKY N ++KE +HEAKRR+ RS+RKLVFDCVNAAL
Sbjct  814  DGEVQCDSFFTIWHSLESPLDPSLRDKYANQSDKEPLHEAKRRRLRSSRKLVFDCVNAAL  873

Query  540  ID-----IDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            +D      D+C +T + SGAH+   +G S + ADR+W R+K+WF     C+S+DG D N 
Sbjct  874  VDNTGYGSDSCTRTTSCSGAHDRFVEGDSPLLADRLWARMKDWFSDEVRCVSEDGGDING  933

Query  375  L-----TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            L      ERMV++E VGKGW E++RLE +++G++IEGKLLEE+V+++VV L
Sbjct  934  LVVERVVERMVKKEVVGKGWSEHMRLEIDNLGRDIEGKLLEELVEESVVDL  984



>emb|CAN81514.1| hypothetical protein VITISV_012030 [Vitis vinifera]
Length=1081

 Score =   227 bits (578),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 159/222 (72%), Gaps = 9/222 (4%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G   L  P    LIDKSP I S+ARTLSWDDSC +TAT  Y L P ++  R EE+E++WL
Sbjct  752  GTQVLVHPLKSNLIDKSPRIESIARTLSWDDSCTETATP-YPLKPSLASSRAEEDEQDWL  810

Query  753  FFIQTLLSMAGLDE-VQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRST  577
            FF+QTLLS AG D+ VQ+D+  SRWHSP++PLDP LRDKY  LN+KE +HEAKRRQRRS 
Sbjct  811  FFVQTLLSAAGFDDNVQTDTFFSRWHSPETPLDPALRDKYAELNDKEILHEAKRRQRRSN  870

Query  576  RKLVFDCVNAALIDI-----DTCHKTIAFSGAHNTIPDG--SSIISADRVWGRIKEWFPS  418
            RKLV+DCVNAAL+DI     D   +    SGA+NT  +G  SS I  +RVW R+KEWF  
Sbjct  871  RKLVYDCVNAALVDITDYGPDCTQRARRCSGAYNTGVEGGSSSPILVERVWXRMKEWFSG  930

Query  417  AAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGK  292
               C+  +G D++ + ER+VR+E VGKGW E++RL+ ++IGK
Sbjct  931  EVRCVWGEGGDNDLVVERVVRKEVVGKGWVEHMRLQVDNIGK  972



>ref|XP_011024531.1| PREDICTED: uncharacterized protein LOC105125670 isoform X4 [Populus 
euphratica]
 ref|XP_011024532.1| PREDICTED: uncharacterized protein LOC105125670 isoform X4 [Populus 
euphratica]
Length=932

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 163/235 (69%), Gaps = 14/235 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSM  727
            LI KSPPI SVARTL+WD+SCV+TA SSY L P   P+++   EE+E+ W  F+Q LL+ 
Sbjct  701  LIGKSPPIESVARTLTWDNSCVETA-SSYPLKPSPSPIALG-AEEDEKYWFSFVQALLTA  758

Query  726  AGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
            AGLD EVQ DS  SRWHSP+SPLDP LRDKY NLN+KE +HEAKRRQRRS +KLVFDCVN
Sbjct  759  AGLDCEVQLDSFFSRWHSPESPLDPSLRDKYTNLNDKELLHEAKRRQRRSNQKLVFDCVN  818

Query  549  AALIDIDTCHKT-----IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            AAL++I T H +        SG  N + + +  + A+ VW ++KEWF S   C S DG  
Sbjct  819  AALVEI-TGHGSDRSSRATCSGVQNRLQEDAQPMVAEYVWAQMKEWFCSDVRCASGDGGG  877

Query  384  DNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             +N  + E +VR+E VGKGW + + +E ++   EIEGKLL+E+V++ V+     M
Sbjct  878  GSNSLVVEMVVRKEVVGKGWIDKMSVELDTFRNEIEGKLLDELVEETVIDFTGRM  932



>ref|XP_011024529.1| PREDICTED: uncharacterized protein LOC105125670 isoform X3 [Populus 
euphratica]
 ref|XP_011024530.1| PREDICTED: uncharacterized protein LOC105125670 isoform X3 [Populus 
euphratica]
Length=937

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 163/235 (69%), Gaps = 14/235 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSM  727
            LI KSPPI SVARTL+WD+SCV+TA SSY L P   P+++   EE+E+ W  F+Q LL+ 
Sbjct  706  LIGKSPPIESVARTLTWDNSCVETA-SSYPLKPSPSPIALG-AEEDEKYWFSFVQALLTA  763

Query  726  AGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
            AGLD EVQ DS  SRWHSP+SPLDP LRDKY NLN+KE +HEAKRRQRRS +KLVFDCVN
Sbjct  764  AGLDCEVQLDSFFSRWHSPESPLDPSLRDKYTNLNDKELLHEAKRRQRRSNQKLVFDCVN  823

Query  549  AALIDIDTCHKT-----IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            AAL++I T H +        SG  N + + +  + A+ VW ++KEWF S   C S DG  
Sbjct  824  AALVEI-TGHGSDRSSRATCSGVQNRLQEDAQPMVAEYVWAQMKEWFCSDVRCASGDGGG  882

Query  384  DNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             +N  + E +VR+E VGKGW + + +E ++   EIEGKLL+E+V++ V+     M
Sbjct  883  GSNSLVVEMVVRKEVVGKGWIDKMSVELDTFRNEIEGKLLDELVEETVIDFTGRM  937



>ref|XP_011024528.1| PREDICTED: uncharacterized protein LOC105125670 isoform X2 [Populus 
euphratica]
Length=991

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 163/235 (69%), Gaps = 14/235 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSM  727
            LI KSPPI SVARTL+WD+SCV+TA SSY L P   P+++   EE+E+ W  F+Q LL+ 
Sbjct  760  LIGKSPPIESVARTLTWDNSCVETA-SSYPLKPSPSPIALG-AEEDEKYWFSFVQALLTA  817

Query  726  AGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
            AGLD EVQ DS  SRWHSP+SPLDP LRDKY NLN+KE +HEAKRRQRRS +KLVFDCVN
Sbjct  818  AGLDCEVQLDSFFSRWHSPESPLDPSLRDKYTNLNDKELLHEAKRRQRRSNQKLVFDCVN  877

Query  549  AALIDIDTCHKT-----IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            AAL++I T H +        SG  N + + +  + A+ VW ++KEWF S   C S DG  
Sbjct  878  AALVEI-TGHGSDRSSRATCSGVQNRLQEDAQPMVAEYVWAQMKEWFCSDVRCASGDGGG  936

Query  384  DNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             +N  + E +VR+E VGKGW + + +E ++   EIEGKLL+E+V++ V+     M
Sbjct  937  GSNSLVVEMVVRKEVVGKGWIDKMSVELDTFRNEIEGKLLDELVEETVIDFTGRM  991



>ref|XP_011083092.1| PREDICTED: uncharacterized protein LOC105165697 [Sesamum indicum]
Length=958

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 165/225 (73%), Gaps = 15/225 (7%)
 Frame = -2

Query  912  PXGPI---LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQ  742
            P  PI   LIDKSPPIGS+ARTLSWDDSC+DTA SSY +   ++ Q T EE+ EW FF++
Sbjct  719  PLNPICSNLIDKSPPIGSIARTLSWDDSCMDTA-SSYPIKESLTTQGTGEEQ-EWFFFVK  776

Query  741  TLLSMAGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLV  565
            TL+S+AGL  EV+S+S  +RWHS +SPLDP LRDKYI+LNEKET HEAKRRQ+RS +KLV
Sbjct  777  TLVSVAGLQGEVRSNSFLARWHSLESPLDPSLRDKYIDLNEKETQHEAKRRQKRSLQKLV  836

Query  564  FDCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISA---DRVWGRIKEWFPSAAG  409
            FDCVNAAL+DI     D+  + I     ++++ + +S  S+   D VW R+ EWF    G
Sbjct  837  FDCVNAALVDIVGYESDSGRRAIPCVETNSSVLENASTSSSTVLDEVWARLNEWFSGEVG  896

Query  408  CLSDDGVDDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGK  277
            C+  +  D+N+L  ER+VR+E VGKGW E LRLE +++GKEIEGK
Sbjct  897  CVWGECGDENSLVVERVVRKEVVGKGWTENLRLEMDNLGKEIEGK  941



>ref|XP_007050071.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX94228.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=894

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 160/229 (70%), Gaps = 9/229 (4%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLL  733
            P    LIDKSPPI S+ARTLSWDDSC +T T   S +  VS     +EE++W+F +Q+LL
Sbjct  668  PPKSNLIDKSPPIESIARTLSWDDSCSETVTLYPSKHSSVSP--GAKEEQDWVFSVQSLL  725

Query  732  SMAGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  556
            S AGL  EV+ +S   RWHSP+SPL+P LRDKY NLN+KE VH AKRR+ RS RKLVFDC
Sbjct  726  SAAGLSGEVRLESFIGRWHSPESPLEPSLRDKYGNLNDKEPVHAAKRREWRSNRKLVFDC  785

Query  555  VNAALIDIDTCHKTIAFSG-AHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDN  379
            VNAAL++I         SG A   + +G+S    D VWGR+KEWF S   CL  D  D N
Sbjct  786  VNAALLEI----TGYGSSGRAQMRVMEGASGTLVDHVWGRMKEWFSSEVKCLVGDDGDSN  841

Query  378  NL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            +L  +R+V++E VGKGW + ++LE +++G+ IE KLLEE+V++AVV L+
Sbjct  842  SLVVDRVVQKEVVGKGWADRMKLEVDNLGRVIEVKLLEELVEEAVVDLS  890



>ref|XP_011024525.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
 ref|XP_011024526.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
 ref|XP_011024527.1| PREDICTED: uncharacterized protein LOC105125670 isoform X1 [Populus 
euphratica]
Length=996

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 163/235 (69%), Gaps = 14/235 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNP---PVSMQRTEEEEREWLFFIQTLLSM  727
            LI KSPPI SVARTL+WD+SCV+TA SSY L P   P+++   EE+E+ W  F+Q LL+ 
Sbjct  765  LIGKSPPIESVARTLTWDNSCVETA-SSYPLKPSPSPIALG-AEEDEKYWFSFVQALLTA  822

Query  726  AGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
            AGLD EVQ DS  SRWHSP+SPLDP LRDKY NLN+KE +HEAKRRQRRS +KLVFDCVN
Sbjct  823  AGLDCEVQLDSFFSRWHSPESPLDPSLRDKYTNLNDKELLHEAKRRQRRSNQKLVFDCVN  882

Query  549  AALIDIDTCHKT-----IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            AAL++I T H +        SG  N + + +  + A+ VW ++KEWF S   C S DG  
Sbjct  883  AALVEI-TGHGSDRSSRATCSGVQNRLQEDAQPMVAEYVWAQMKEWFCSDVRCASGDGGG  941

Query  384  DNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             +N  + E +VR+E VGKGW + + +E ++   EIEGKLL+E+V++ V+     M
Sbjct  942  GSNSLVVEMVVRKEVVGKGWIDKMSVELDTFRNEIEGKLLDELVEETVIDFTGRM  996



>ref|XP_007050069.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94226.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=984

 Score =   221 bits (562),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 159/224 (71%), Gaps = 9/224 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSC +T T   S +  VS     +EE++W+F +Q+LLS AGL
Sbjct  763  LIDKSPPIESIARTLSWDDSCSETVTLYPSKHSSVSP--GAKEEQDWVFSVQSLLSAAGL  820

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
              EV+ +S   RWHSP+SPL+P LRDKY NLN+KE VH AKRR+ RS RKLVFDCVNAAL
Sbjct  821  SGEVRLESFIGRWHSPESPLEPSLRDKYGNLNDKEPVHAAKRREWRSNRKLVFDCVNAAL  880

Query  540  IDIDTCHKTIAFSG-AHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TE  367
            ++I         SG A   + +G+S    D VWGR+KEWF S   CL  D  D N+L  +
Sbjct  881  LEI----TGYGSSGRAQMRVMEGASGTLVDHVWGRMKEWFSSEVKCLVGDDGDSNSLVVD  936

Query  366  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            R+V++E VGKGW + ++LE +++G+ IE KLLEE+V++AVV L+
Sbjct  937  RVVQKEVVGKGWADRMKLEVDNLGRVIEVKLLEELVEEAVVDLS  980



>ref|XP_007050070.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94227.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=988

 Score =   221 bits (562),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 159/224 (71%), Gaps = 9/224 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSC +T T   S +  VS     +EE++W+F +Q+LLS AGL
Sbjct  763  LIDKSPPIESIARTLSWDDSCSETVTLYPSKHSSVSP--GAKEEQDWVFSVQSLLSAAGL  820

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
              EV+ +S   RWHSP+SPL+P LRDKY NLN+KE VH AKRR+ RS RKLVFDCVNAAL
Sbjct  821  SGEVRLESFIGRWHSPESPLEPSLRDKYGNLNDKEPVHAAKRREWRSNRKLVFDCVNAAL  880

Query  540  IDIDTCHKTIAFSG-AHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-TE  367
            ++I         SG A   + +G+S    D VWGR+KEWF S   CL  D  D N+L  +
Sbjct  881  LEI----TGYGSSGRAQMRVMEGASGTLVDHVWGRMKEWFSSEVKCLVGDDGDSNSLVVD  936

Query  366  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            R+V++E VGKGW + ++LE +++G+ IE KLLEE+V++AVV L+
Sbjct  937  RVVQKEVVGKGWADRMKLEVDNLGRVIEVKLLEELVEEAVVDLS  980



>gb|KDO65806.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=952

 Score =   219 bits (558),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 158/229 (69%), Gaps = 12/229 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWDDSC +T  S Y L    S+    EEE++WL  +QTL+  AGL
Sbjct  722  LIDKSPPIGSIARTLSWDDSCAETV-SPYPLKS-SSVSPGAEEEQDWLLLVQTLIQSAGL  779

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D  VQSD   +RWHSP+SPLDP LRDKY   NEKE +HEAKRRQRRS RKLVFDCVNAAL
Sbjct  780  DGRVQSDIFFTRWHSPESPLDPSLRDKYTG-NEKEPLHEAKRRQRRSNRKLVFDCVNAAL  838

Query  540  IDI-------DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDD  382
            ++I       D   + ++ SGA +   +G   +  D VW R+KEWF   AG    DG D 
Sbjct  839  VEITGYGSESDRSMRAMSCSGAQDMHLEGELPMLVDHVWARMKEWFSGEAGWFWVDGGDS  898

Query  381  NN-LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            N+ + ER+VR E VGKGW + +R+E +S+GKEIE  LLEE+V +AVV L
Sbjct  899  NSPVVERVVRNEVVGKGWSDQMRMELDSLGKEIEVNLLEELVDEAVVDL  947



>gb|KDO65805.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1000

 Score =   219 bits (558),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 158/230 (69%), Gaps = 12/230 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWDDSC +T  S Y L    S+    EEE++WL  +QTL+  AGL
Sbjct  770  LIDKSPPIGSIARTLSWDDSCAETV-SPYPLKS-SSVSPGAEEEQDWLLLVQTLIQSAGL  827

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D  VQSD   +RWHSP+SPLDP LRDKY   NEKE +HEAKRRQRRS RKLVFDCVNAAL
Sbjct  828  DGRVQSDIFFTRWHSPESPLDPSLRDKYTG-NEKEPLHEAKRRQRRSNRKLVFDCVNAAL  886

Query  540  IDI-------DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDD  382
            ++I       D   + ++ SGA +   +G   +  D VW R+KEWF   AG    DG D 
Sbjct  887  VEITGYGSESDRSMRAMSCSGAQDMHLEGELPMLVDHVWARMKEWFSGEAGWFWVDGGDS  946

Query  381  NN-LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            N+ + ER+VR E VGKGW + +R+E +S+GKEIE  LLEE+V +AVV L 
Sbjct  947  NSPVVERVVRNEVVGKGWSDQMRMELDSLGKEIEVNLLEELVDEAVVDLT  996



>gb|KDO65804.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1002

 Score =   219 bits (558),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 158/230 (69%), Gaps = 12/230 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWDDSC +T  S Y L    S+    EEE++WL  +QTL+  AGL
Sbjct  772  LIDKSPPIGSIARTLSWDDSCAETV-SPYPLKS-SSVSPGAEEEQDWLLLVQTLIQSAGL  829

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D  VQSD   +RWHSP+SPLDP LRDKY   NEKE +HEAKRRQRRS RKLVFDCVNAAL
Sbjct  830  DGRVQSDIFFTRWHSPESPLDPSLRDKYTG-NEKEPLHEAKRRQRRSNRKLVFDCVNAAL  888

Query  540  IDI-------DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDD  382
            ++I       D   + ++ SGA +   +G   +  D VW R+KEWF   AG    DG D 
Sbjct  889  VEITGYGSESDRSMRAMSCSGAQDMHLEGELPMLVDHVWARMKEWFSGEAGWFWVDGGDS  948

Query  381  NN-LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            N+ + ER+VR E VGKGW + +R+E +S+GKEIE  LLEE+V +AVV L 
Sbjct  949  NSPVVERVVRNEVVGKGWSDQMRMELDSLGKEIEVNLLEELVDEAVVDLT  998



>gb|KDO65803.1| hypothetical protein CISIN_1g001807mg [Citrus sinensis]
Length=1010

 Score =   219 bits (558),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 158/230 (69%), Gaps = 12/230 (5%)
 Frame = -2

Query  897   LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
             LIDKSPPIGS+ARTLSWDDSC +T  S Y L    S+    EEE++WL  +QTL+  AGL
Sbjct  780   LIDKSPPIGSIARTLSWDDSCAETV-SPYPLKSS-SVSPGAEEEQDWLLLVQTLIQSAGL  837

Query  717   D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
             D  VQSD   +RWHSP+SPLDP LRDKY   NEKE +HEAKRRQRRS RKLVFDCVNAAL
Sbjct  838   DGRVQSDIFFTRWHSPESPLDPSLRDKYTG-NEKEPLHEAKRRQRRSNRKLVFDCVNAAL  896

Query  540   IDI-------DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDD  382
             ++I       D   + ++ SGA +   +G   +  D VW R+KEWF   AG    DG D 
Sbjct  897   VEITGYGSESDRSMRAMSCSGAQDMHLEGELPMLVDHVWARMKEWFSGEAGWFWVDGGDS  956

Query  381   NN-LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             N+ + ER+VR E VGKGW + +R+E +S+GKEIE  LLEE+V +AVV L 
Sbjct  957   NSPVVERVVRNEVVGKGWSDQMRMELDSLGKEIEVNLLEELVDEAVVDLT  1006



>ref|XP_006375643.1| hypothetical protein POPTR_0014s18540g [Populus trichocarpa]
 gb|ERP53440.1| hypothetical protein POPTR_0014s18540g [Populus trichocarpa]
Length=951

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 153/233 (66%), Gaps = 13/233 (6%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSL--NPPVSMQRTEEEEREWLFFIQT  739
            P    LIDKSPPI SVAR LSWDDS  +TA S Y L  +P  +    EE+E++W F +QT
Sbjct  720  PLKSNLIDKSPPIESVARNLSWDDSRAETA-SPYPLKSSPSPAPSGAEEDEKDWFFLVQT  778

Query  738  LLSMAGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVF  562
            LL+ AGLD ++Q DS  +RWHSP SPLDP LRDKY NLN+KE + EAKRRQRRS RKLVF
Sbjct  779  LLTTAGLDSDLQLDSFFARWHSPGSPLDPSLRDKYANLNDKELLLEAKRRQRRSNRKLVF  838

Query  561  DCVNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSD  397
            D VNAAL++I     D   K +  SG  N + +G+     D +W ++K W  S   C   
Sbjct  839  DSVNAALVEITGHGSDRSTKAVTCSGVQNWLVEGAQPQIVDYLWAQLKSWLCSDVRCTFG  898

Query  396  DGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            DG D N L   MV    VGKGW + +R+E +S+G EIEGKLL+E+V++AV  L
Sbjct  899  DGGDSNGLVVEMV----VGKGWVDKMRVELDSLGNEIEGKLLDELVEEAVFDL  947



>ref|XP_012085179.1| PREDICTED: uncharacterized protein LOC105644441 [Jatropha curcas]
 ref|XP_012085180.1| PREDICTED: uncharacterized protein LOC105644441 [Jatropha curcas]
 gb|KDP26434.1| hypothetical protein JCGZ_17592 [Jatropha curcas]
Length=965

 Score =   216 bits (551),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 157/227 (69%), Gaps = 8/227 (4%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLL  733
            P    LIDKSPPI S+ARTLSWDDSC +TAT+ YSL         EEEE++  FFIQTLL
Sbjct  741  PLKSNLIDKSPPIESIARTLSWDDSCAETATT-YSLKASSISSCPEEEEQDMRFFIQTLL  799

Query  732  SMAGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  556
            S AG+D     DS+ +RWHSP+SPLDP LRDKY NLN+KE +HEAKRRQRRS +KLVFDC
Sbjct  800  SAAGIDGSTPLDSIFARWHSPESPLDPALRDKYANLNDKELLHEAKRRQRRSNQKLVFDC  859

Query  555  VNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            VNAAL++I  C    +      T P        + +W ++KEWF S   C  +D  D ++
Sbjct  860  VNAALVEITGCGSDRSIRVIQGTPP-----TLVEHIWAQMKEWFCSEVRCTFEDSGDSSS  914

Query  375  L-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            L  ER+VR+E VGKGW + +R+E +++GKEIE KLL ++V+DAV+ L
Sbjct  915  LVVERVVRKEVVGKGWIDNMRVELDNLGKEIEDKLLADLVEDAVIDL  961



>ref|XP_006443684.1| hypothetical protein CICLE_v10018694mg [Citrus clementina]
 ref|XP_006480168.1| PREDICTED: uncharacterized protein LOC102618918 [Citrus sinensis]
 gb|ESR56924.1| hypothetical protein CICLE_v10018694mg [Citrus clementina]
Length=991

 Score =   216 bits (550),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 157/230 (68%), Gaps = 12/230 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSC +T  S Y L    S+    EEE++WL  +QTL+  AGL
Sbjct  761  LIDKSPPIESIARTLSWDDSCAETV-SPYPLKSS-SVSSGAEEEQDWLLLVQTLIQSAGL  818

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D  VQSD   +RWHSP+SPLDP LRDKY   NEKE +HEAKRRQRRS RKLVFDCVNAAL
Sbjct  819  DGRVQSDIFFTRWHSPESPLDPSLRDKYTG-NEKEPLHEAKRRQRRSNRKLVFDCVNAAL  877

Query  540  IDI-------DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDD  382
            ++I       D   + ++ SGA +   +G   +  D VW R+KEWF   AG    DG D 
Sbjct  878  VEITGYGSESDRSMRAMSCSGAQDMHLEGELPMLVDHVWARMKEWFSGEAGWFWVDGGDS  937

Query  381  NN-LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            N+ + ER+VR E VGKGW + +R+E +S+GKEIE  LLEE+V +AVV L 
Sbjct  938  NSPVVERVVRNEVVGKGWSDQMRMELDSLGKEIEVNLLEELVDEAVVDLT  987



>ref|XP_010684824.1| PREDICTED: uncharacterized protein LOC104899346 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=981

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 150/214 (70%), Gaps = 8/214 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSW++S  +TAT+ Y+LN P       E+E E+++ +Q+LL+MAGL
Sbjct  754  LIDKSPPIGSIARTLSWEESFAETATN-YALNSPFVSPGAGEDEVEYVYLVQSLLTMAGL  812

Query  717  -DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
             DE Q  S  +RWHS +SPLDPLLRDKYI+L  KE +HEAKRRQ RS+RKLVFDCVNAAL
Sbjct  813  SDEGQVGSNLARWHSTESPLDPLLRDKYIDLTAKEPLHEAKRRQLRSSRKLVFDCVNAAL  872

Query  540  IDIDTCHKTIA-----FSGAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDN  379
            +DI     T +     + G  N  +  G  +  AD+V   +KE  P      S DG D++
Sbjct  873  VDITGFGTTTSRWGGPYVGLSNGYLESGPGMGLADKVLAWMKELMPGEVKYYSIDGGDNH  932

Query  378  NLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGK  277
            +L ER+VR+E +GKGW E +RL+ +++GKEIEGK
Sbjct  933  SLVERLVRKEVIGKGWCEQIRLQVDNLGKEIEGK  966



>ref|XP_010684822.1| PREDICTED: uncharacterized protein LOC104899346 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=993

 Score =   213 bits (541),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 150/214 (70%), Gaps = 8/214 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSW++S  +TAT+ Y+LN P       E+E E+++ +Q+LL+MAGL
Sbjct  766  LIDKSPPIGSIARTLSWEESFAETATN-YALNSPFVSPGAGEDEVEYVYLVQSLLTMAGL  824

Query  717  -DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
             DE Q  S  +RWHS +SPLDPLLRDKYI+L  KE +HEAKRRQ RS+RKLVFDCVNAAL
Sbjct  825  SDEGQVGSNLARWHSTESPLDPLLRDKYIDLTAKEPLHEAKRRQLRSSRKLVFDCVNAAL  884

Query  540  IDIDTCHKTIA-----FSGAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDN  379
            +DI     T +     + G  N  +  G  +  AD+V   +KE  P      S DG D++
Sbjct  885  VDITGFGTTTSRWGGPYVGLSNGYLESGPGMGLADKVLAWMKELMPGEVKYYSIDGGDNH  944

Query  378  NLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGK  277
            +L ER+VR+E +GKGW E +RL+ +++GKEIEGK
Sbjct  945  SLVERLVRKEVIGKGWCEQIRLQVDNLGKEIEGK  978



>ref|XP_010091854.1| hypothetical protein L484_015923 [Morus notabilis]
 gb|EXB46062.1| hypothetical protein L484_015923 [Morus notabilis]
Length=981

 Score =   212 bits (539),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 169/234 (72%), Gaps = 12/234 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSCV+ AT   SL P       EE+ER+WL F+QTLLS AG 
Sbjct  750  LIDKSPPIESIARTLSWDDSCVEMATPC-SLKPSSVPTVAEEDERDWLAFVQTLLSAAGF  808

Query  717  D-EVQSDS---LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
            + E + DS   + SRW SP++PLDP LRDKY N+++KE + E++RRQ RSTRKLVFDCVN
Sbjct  809  NGETRCDSCELVFSRWPSPEAPLDPSLRDKYANIDDKEPLLESRRRQLRSTRKLVFDCVN  868

Query  549  AALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            A+L+DI     D   +TI   GAH+++ +G + +  DRVWGR++EWF     CL +DG D
Sbjct  869  ASLVDISGYGSDRSLRTIC-GGAHDSLMEGDTPLLVDRVWGRMQEWFSGEVRCLWEDGGD  927

Query  384  DNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             N+L  +RM R+E VG GW E +R+E +++G E+EGKLLEE+V++AVV L + +
Sbjct  928  ANSLVVDRMGRKEVVGGGWTELMRIEIDNLGNELEGKLLEELVEEAVVDLTERI  981



>ref|XP_004493852.1| PREDICTED: uro-adherence factor A-like isoform X1 [Cicer arietinum]
 ref|XP_004493853.1| PREDICTED: uro-adherence factor A-like isoform X2 [Cicer arietinum]
Length=984

 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 155/232 (67%), Gaps = 12/232 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSC + A S+  L P +    T+ E ++ L F+Q LLS AGL
Sbjct  751  LIDKSPPIESIARTLSWDDSCAELANSN-PLKPSLVSLDTKLENQDMLVFVQKLLSAAGL  809

Query  717  -DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKE--TVHEAKRRQRRSTRKLVFDCVNA  547
             D+VQSDS  SRWHS +SPLDPLLRDKYINLN+KE   +HEAKRRQRRS +KLVFDCVN 
Sbjct  810  DDQVQSDSFYSRWHSLESPLDPLLRDKYINLNDKEPQPLHEAKRRQRRSIQKLVFDCVNV  869

Query  546  ALIDIDTCHKTIAF-----SGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV  388
            ALI+I       +      SG H    +  G+  +  D +  ++KE   S    +  D V
Sbjct  870  ALIEITGYRSENSLMGRLWSGGHRRLQVSKGAPPLLVDLIVAQMKELTSSGMRSVWGDCV  929

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            D N+L  E +VR+E VGKGW E + L+ + + KE+EGKLLEE+V+DAVV L 
Sbjct  930  DSNSLVVETVVRKEVVGKGWVELMGLDIDILVKEVEGKLLEELVEDAVVDLT  981



>ref|XP_010243643.1| PREDICTED: uncharacterized protein LOC104587645 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010243644.1| PREDICTED: uncharacterized protein LOC104587645 isoform X3 [Nelumbo 
nucifera]
Length=992

 Score =   209 bits (531),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 163/230 (71%), Gaps = 12/230 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-EEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+ARTLSWDD C+  A    SL+  +S   TE EEE+E   F+Q LLS AG
Sbjct  762  LIDKSPPIGSIARTLSWDDPCL-IAARPNSLH--LSRFATEAEEEQERFLFVQVLLSTAG  818

Query  720  LD-EVQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNA  547
            LD E QSD + SRWHS +SPLDP L +KY++L ++KE +HEAKRRQ RS R+L+FDCVNA
Sbjct  819  LDYEEQSDVIFSRWHSEESPLDPSLIEKYLSLKDDKEQLHEAKRRQWRSNRRLLFDCVNA  878

Query  546  ALIDID-TCHKTIAFSGAHNTIPDG---SSIISADRVWGRIKEWFPSAAG-CLSDDGVDD  382
            AL+DI     K   +    +T+       S+++ D+VW  +KEW+ ++ G C SD+  D 
Sbjct  879  ALMDITGYSSKANPWVKVSSTVQSKILVDSVVTLDKVWSCVKEWYSNSEGRCYSDESGDR  938

Query  381  NNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            N+L  ERMVR+E  GKGW + +RLE +++GK+IEG++L+++V+DA+V L 
Sbjct  939  NSLVVERMVRKEVAGKGWEDLMRLEIDTLGKQIEGEILQQLVEDAIVELT  988



>ref|XP_010243642.1| PREDICTED: uncharacterized protein LOC104587645 isoform X2 [Nelumbo 
nucifera]
Length=996

 Score =   209 bits (531),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 163/230 (71%), Gaps = 12/230 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-EEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+ARTLSWDD C+  A    SL+  +S   TE EEE+E   F+Q LLS AG
Sbjct  766  LIDKSPPIGSIARTLSWDDPCL-IAARPNSLH--LSRFATEAEEEQERFLFVQVLLSTAG  822

Query  720  LD-EVQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNA  547
            LD E QSD + SRWHS +SPLDP L +KY++L ++KE +HEAKRRQ RS R+L+FDCVNA
Sbjct  823  LDYEEQSDVIFSRWHSEESPLDPSLIEKYLSLKDDKEQLHEAKRRQWRSNRRLLFDCVNA  882

Query  546  ALIDID-TCHKTIAFSGAHNTIPDG---SSIISADRVWGRIKEWFPSAAG-CLSDDGVDD  382
            AL+DI     K   +    +T+       S+++ D+VW  +KEW+ ++ G C SD+  D 
Sbjct  883  ALMDITGYSSKANPWVKVSSTVQSKILVDSVVTLDKVWSCVKEWYSNSEGRCYSDESGDR  942

Query  381  NNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            N+L  ERMVR+E  GKGW + +RLE +++GK+IEG++L+++V+DA+V L 
Sbjct  943  NSLVVERMVRKEVAGKGWEDLMRLEIDTLGKQIEGEILQQLVEDAIVELT  992



>ref|XP_010243641.1| PREDICTED: uncharacterized protein LOC104587645 isoform X1 [Nelumbo 
nucifera]
Length=997

 Score =   209 bits (531),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 163/230 (71%), Gaps = 12/230 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTE-EEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+ARTLSWDD C+  A    SL+  +S   TE EEE+E   F+Q LLS AG
Sbjct  767  LIDKSPPIGSIARTLSWDDPCL-IAARPNSLH--LSRFATEAEEEQERFLFVQVLLSTAG  823

Query  720  LD-EVQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVNA  547
            LD E QSD + SRWHS +SPLDP L +KY++L ++KE +HEAKRRQ RS R+L+FDCVNA
Sbjct  824  LDYEEQSDVIFSRWHSEESPLDPSLIEKYLSLKDDKEQLHEAKRRQWRSNRRLLFDCVNA  883

Query  546  ALIDID-TCHKTIAFSGAHNTIPDG---SSIISADRVWGRIKEWFPSAAG-CLSDDGVDD  382
            AL+DI     K   +    +T+       S+++ D+VW  +KEW+ ++ G C SD+  D 
Sbjct  884  ALMDITGYSSKANPWVKVSSTVQSKILVDSVVTLDKVWSCVKEWYSNSEGRCYSDESGDR  943

Query  381  NNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            N+L  ERMVR+E  GKGW + +RLE +++GK+IEG++L+++V+DA+V L 
Sbjct  944  NSLVVERMVRKEVAGKGWEDLMRLEIDTLGKQIEGEILQQLVEDAIVELT  993



>ref|XP_007162644.1| hypothetical protein PHAVU_001G168100g [Phaseolus vulgaris]
 gb|ESW34638.1| hypothetical protein PHAVU_001G168100g [Phaseolus vulgaris]
Length=971

 Score =   208 bits (530),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 160/232 (69%), Gaps = 14/232 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSC + A + Y L P +    T+ E+++WL F++ LLS AG+
Sbjct  740  LIDKSPPIESIARTLSWDDSCAEVA-NPYQLKPSLGSLDTKVEDQDWLVFVEKLLSAAGI  798

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKE--TVHEAKRRQRRSTRKLVFDCVNA  547
            D +VQSDS  SRWHS +SPLDP LRD Y NLN+KE   +HEAKRRQRRS +KLVF+CVN 
Sbjct  799  DDQVQSDSFYSRWHSLESPLDPSLRDNYANLNDKEPQQLHEAKRRQRRSNQKLVFECVNL  858

Query  546  ALIDIDTCHKTIAF------SGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
            +LI+I T + + ++      SG+H+   +P+G+     D V  ++KE    A   +  D 
Sbjct  859  SLIEI-TGYGSQSYLMGRLWSGSHSRFQVPEGAPPPLVDLVVAQMKELISGAVRSVWGDC  917

Query  390  VDDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
             D N+L  E +VR+E VGKGW E + LE + + KE+EGKLLEE+V+DAVV L
Sbjct  918  GDSNSLGVESVVRKEVVGKGWVELMALEMDILVKEVEGKLLEELVEDAVVDL  969



>emb|CBI37234.3| unnamed protein product [Vitis vinifera]
Length=809

 Score =   207 bits (528),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 137/215 (64%), Gaps = 41/215 (19%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G   L  P    LIDKSP I S+ARTLSWDDSC +TAT  Y L P ++  R EE+E++WL
Sbjct  613  GTQVLVHPLKSNLIDKSPRIESIARTLSWDDSCTETATP-YPLKPSLASSRAEEDEQDWL  671

Query  753  FFIQTLLSMAGLDE-VQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRST  577
            FF+QTLLS AG D+ VQ+D+  SRWHSP++PLDP LRDKY  LN+KE +HEAKRRQRRS 
Sbjct  672  FFVQTLLSAAGFDDNVQTDTFFSRWHSPETPLDPALRDKYAELNDKEILHEAKRRQRRSN  731

Query  576  RKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSD  397
            RKLV+DCVNAAL+DI             +  PD       +RVWGR+KEWF         
Sbjct  732  RKLVYDCVNAALVDIT------------DYGPD------LERVWGRMKEWFSG-------  766

Query  396  DGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGK  292
                          +E VGKGW E++RL+ ++IGK
Sbjct  767  --------------EEVVGKGWVEHMRLQVDNIGK  787



>gb|KEH23986.1| DUF3741 family protein [Medicago truncatula]
Length=901

 Score =   204 bits (520),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 153/231 (66%), Gaps = 11/231 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWDDSC + A S Y L P ++   T+ E+++ L F+  LLS AGL
Sbjct  669  LIDKSPPIGSIARTLSWDDSCAEVA-SPYQLKPSLASLDTKVEDQDLLVFVHKLLSAAGL  727

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKE--TVHEAKRRQRRSTRKLVFDCVNAA  544
            D+ +SD   SRWHS +SPLDP LRDKY NLN+KE   +HEAKRRQRRS +KL+FDCVN A
Sbjct  728  DDQESDLFYSRWHSLESPLDPTLRDKYANLNDKEPQPLHEAKRRQRRSNQKLIFDCVNVA  787

Query  543  LIDI-----DTCHKTIAFSGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            L++I     ++      +SG H    + +G+  +  D +   +KE   S    +  D  D
Sbjct  788  LMEITGYGLESSLMGRLWSGGHRRLQVSEGAPSLLVDLIVSHMKELTSSGMRSVWGDCGD  847

Query  384  DNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             N+L  E +VR+E VGKGW E + LE +   KE+EGKLLEE+V+DAVV L 
Sbjct  848  SNSLVVETVVRKEVVGKGWVELMGLEVDIWVKEVEGKLLEELVEDAVVDLT  898



>ref|XP_003625464.1| hypothetical protein MTR_7g099410 [Medicago truncatula]
 gb|AES81682.1| DUF3741 family protein [Medicago truncatula]
Length=982

 Score =   204 bits (519),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 153/231 (66%), Gaps = 11/231 (5%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+ARTLSWDDSC + A S Y L P ++   T+ E+++ L F+  LLS AGL
Sbjct  750  LIDKSPPIGSIARTLSWDDSCAEVA-SPYQLKPSLASLDTKVEDQDLLVFVHKLLSAAGL  808

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKE--TVHEAKRRQRRSTRKLVFDCVNAA  544
            D+ +SD   SRWHS +SPLDP LRDKY NLN+KE   +HEAKRRQRRS +KL+FDCVN A
Sbjct  809  DDQESDLFYSRWHSLESPLDPTLRDKYANLNDKEPQPLHEAKRRQRRSNQKLIFDCVNVA  868

Query  543  LIDI-----DTCHKTIAFSGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            L++I     ++      +SG H    + +G+  +  D +   +KE   S    +  D  D
Sbjct  869  LMEITGYGLESSLMGRLWSGGHRRLQVSEGAPSLLVDLIVSHMKELTSSGMRSVWGDCGD  928

Query  384  DNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             N+L  E +VR+E VGKGW E + LE +   KE+EGKLLEE+V+DAVV L 
Sbjct  929  SNSLVVETVVRKEVVGKGWVELMGLEVDIWVKEVEGKLLEELVEDAVVDLT  979



>ref|XP_006576977.1| PREDICTED: uncharacterized protein LOC100793360 [Glycine max]
Length=979

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 155/236 (66%), Gaps = 19/236 (8%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSC + A S Y L P  +   T+++   WL F++ LLS AG+
Sbjct  745  LIDKSPPIESIARTLSWDDSCAEVA-SPYPLRPSSASLDTKQD---WLVFVKKLLSAAGI  800

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKE---TVHEAKRRQRRSTRKLVFDCVN  550
            D +VQ  S  SRWHS +SPLDP LRDKY NLN+KE    +HEAKRRQRRS +KLVFDCVN
Sbjct  801  DDQVQPGSFYSRWHSLESPLDPSLRDKYANLNDKEPQQQLHEAKRRQRRSNQKLVFDCVN  860

Query  549  AALIDIDTCHKTIAF-------SGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCL--  403
             +LI+I        +       SG+H+   +P+ +S    D +  ++KE   SA   +  
Sbjct  861  VSLIEITGYGSEKNYLMGSRLCSGSHSRVQVPEAASPPLVDLIVAQMKELISSAMSSVWV  920

Query  402  SDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             D G  ++ + E +VR+E VGKGW E +RLE + + KE+EGKLLEE+V+DAVV L 
Sbjct  921  VDCGDSNSLVVESVVRKEVVGKGWVELMRLEMDILVKEVEGKLLEELVEDAVVDLT  976



>gb|KHN09408.1| hypothetical protein glysoja_016507 [Glycine soja]
Length=979

 Score =   199 bits (507),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 156/236 (66%), Gaps = 19/236 (8%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSC + A S Y L P  +   T+++   WL F++ LLS AG+
Sbjct  745  LIDKSPPIESIARTLSWDDSCAEVA-SPYPLRPSSASLDTKQD---WLVFVKKLLSAAGI  800

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKE---TVHEAKRRQRRSTRKLVFDCVN  550
            D +VQ  S  SRWHS +SPLDP LRDKY NLN+KE    +HEAKRRQRRS +KLVFDCVN
Sbjct  801  DDQVQPGSFYSRWHSLESPLDPSLRDKYANLNDKEPQQQLHEAKRRQRRSNQKLVFDCVN  860

Query  549  AALIDI-------DTCHKTIAFSGAHN--TIPDGSSIISADRVWGRIKEWFPSAAGCL--  403
             +LI+I       +    ++  SG+H+   +P+ +S    D +  ++KE   SA   +  
Sbjct  861  VSLIEITGYGSEKNYLMGSMLCSGSHSRVQVPEAASPPLVDLIVAQMKELISSAMSSVWV  920

Query  402  SDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             D G  ++ + E +VR+E VGKGW E + LE + + KE+EGKLLEE+V+DAVV L 
Sbjct  921  VDCGDSNSLVVESVVRKEVVGKGWVELMGLEMDILVKEVEGKLLEELVEDAVVDLT  976



>gb|EYU17962.1| hypothetical protein MIMGU_mgv1a0013541mg, partial [Erythranthe 
guttata]
Length=276

 Score =   189 bits (479),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 137/209 (66%), Gaps = 17/209 (8%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPP--VSMQRTEEEEREWLFFIQTLLSMA  724
            LIDKSPPIGS+ARTLSW+DSCVDTA+S    N    ++ + T+EEEREW FF++TLLS A
Sbjct  60   LIDKSPPIGSIARTLSWEDSCVDTASSYAVANESSLINARGTDEEEREWFFFVKTLLSAA  119

Query  723  GLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKET--VHEAKRRQRRSTRKLVFDCV  553
            GL  E+QS S ++RWHSP  PLDP LRDKYI+LN+K T   HEAKRRQ+RS +KLVFDCV
Sbjct  120  GLHGELQSSSFTARWHSPGIPLDPSLRDKYIDLNDKATNYTHEAKRRQKRSLQKLVFDCV  179

Query  552  NAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            NA L++I   +  I  +  +N +         D VWGR+  W      C + D  D   +
Sbjct  180  NAVLVEIGGENGLIKSNSNNNIV---------DEVWGRMNAWMNE---CGARDSNDSLAV  227

Query  372  TERMVRQEAVGKGWHEYLRLEAESIGKEI  286
               + ++   GK W E LR+E + +GKEI
Sbjct  228  ERVVRKEVVGGKWWVENLRMEVDYLGKEI  256



>ref|XP_006604525.1| PREDICTED: uncharacterized protein LOC100816611 isoform X1 [Glycine 
max]
 ref|XP_006604526.1| PREDICTED: uncharacterized protein LOC100816611 isoform X2 [Glycine 
max]
 gb|KHN02438.1| hypothetical protein glysoja_002462 [Glycine soja]
Length=982

 Score =   198 bits (504),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 154/234 (66%), Gaps = 14/234 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSC + A S Y L P ++   T+ E+++W  F++ LLS AG+
Sbjct  747  LIDKSPPIESIARTLSWDDSCAEVA-SPYPLKPSLASLDTKVEDQDWFVFVEKLLSAAGI  805

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLN--EKETVHEAKRRQRRSTRKLVFDCVNA  547
            D +VQ DS  +RWHS +SPLDP LRDKY NL+  E + +HEAKRRQRRS +KLVFDCVN 
Sbjct  806  DDQVQPDSFYARWHSLESPLDPSLRDKYANLDDTEPQQLHEAKRRQRRSNQKLVFDCVNI  865

Query  546  ALIDIDTCHKTIAF------SGAHN--TIPDGSSIIS-ADRVWGRIKEWFPSAAGCLSDD  394
            ALI+I        +      SG+H+   +P+ +      D +  ++KE   SA   +  D
Sbjct  866  ALIEITGYGSEKNYLMGRLCSGSHSRVQVPEAAPPPPLVDLIVAQMKELISSAMRSVWVD  925

Query  393  GVDDNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
              D N+L  E +VR+E VGKGW E + LE + + KE EGKLLEE+V+DAVV L 
Sbjct  926  CGDSNSLVVESVVRKEIVGKGWVELMGLEMDFLVKEFEGKLLEELVEDAVVDLT  979



>gb|KJB26069.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=898

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 155/238 (65%), Gaps = 11/238 (5%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLL  733
            P    LIDKSPPIGS+ARTLSWDD C DTAT + S    VS    +EEE +W+  +QTLL
Sbjct  662  PPKSNLIDKSPPIGSIARTLSWDDLCSDTATLNSSKPSKVS-PGAKEEEHDWVLSVQTLL  720

Query  732  SMAGLDEVQS-DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  556
            S AGL++ +  +S    WHSP+SPLDP LRDKY NLN+KE +HEAKRRQ RS +KLVFDC
Sbjct  721  SSAGLNDKEYFESFIDGWHSPESPLDPSLRDKYANLNDKEPLHEAKRRQWRSNKKLVFDC  780

Query  555  VNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
            VNAA+++I     +     ++   +H    + +S    D V  +IKEW    +  + D+ 
Sbjct  781  VNAAIVEITGYGSNNRMNEMSLCRSHIRDMESASPTLVDHVCAQIKEWVSGDSNHVVDND  840

Query  390  VDDNN---LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             D +    + E+ VR+E VGKGW +  + E +++G EIEGKLL+E+V++AVV L  TM
Sbjct  841  DDWDTDSLVVEKAVRKE-VGKGWVDQTKTETDNLGNEIEGKLLQELVEEAVVDLTGTM  897



>gb|KJB26067.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=992

 Score =   194 bits (494),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 155/238 (65%), Gaps = 11/238 (5%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLL  733
            P    LIDKSPPIGS+ARTLSWDD C DTAT + S    VS    +EEE +W+  +QTLL
Sbjct  756  PPKSNLIDKSPPIGSIARTLSWDDLCSDTATLNSSKPSKVS-PGAKEEEHDWVLSVQTLL  814

Query  732  SMAGLDEVQS-DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  556
            S AGL++ +  +S    WHSP+SPLDP LRDKY NLN+KE +HEAKRRQ RS +KLVFDC
Sbjct  815  SSAGLNDKEYFESFIDGWHSPESPLDPSLRDKYANLNDKEPLHEAKRRQWRSNKKLVFDC  874

Query  555  VNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
            VNAA+++I     +     ++   +H    + +S    D V  +IKEW    +  + D+ 
Sbjct  875  VNAAIVEITGYGSNNRMNEMSLCRSHIRDMESASPTLVDHVCAQIKEWVSGDSNHVVDND  934

Query  390  VDDNN---LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             D +    + E+ VR+E VGKGW +  + E +++G EIEGKLL+E+V++AVV L  TM
Sbjct  935  DDWDTDSLVVEKAVRKE-VGKGWVDQTKTETDNLGNEIEGKLLQELVEEAVVDLTGTM  991



>gb|KJB26068.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=998

 Score =   194 bits (494),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 155/238 (65%), Gaps = 11/238 (5%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLL  733
            P    LIDKSPPIGS+ARTLSWDD C DTAT + S    VS    +EEE +W+  +QTLL
Sbjct  762  PPKSNLIDKSPPIGSIARTLSWDDLCSDTATLNSSKPSKVS-PGAKEEEHDWVLSVQTLL  820

Query  732  SMAGLDEVQS-DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  556
            S AGL++ +  +S    WHSP+SPLDP LRDKY NLN+KE +HEAKRRQ RS +KLVFDC
Sbjct  821  SSAGLNDKEYFESFIDGWHSPESPLDPSLRDKYANLNDKEPLHEAKRRQWRSNKKLVFDC  880

Query  555  VNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
            VNAA+++I     +     ++   +H    + +S    D V  +IKEW    +  + D+ 
Sbjct  881  VNAAIVEITGYGSNNRMNEMSLCRSHIRDMESASPTLVDHVCAQIKEWVSGDSNHVVDND  940

Query  390  VDDNN---LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
             D +    + E+ VR+E VGKGW +  + E +++G EIEGKLL+E+V++AVV L  TM
Sbjct  941  DDWDTDSLVVEKAVRKE-VGKGWVDQTKTETDNLGNEIEGKLLQELVEEAVVDLTGTM  997



>gb|KJB26065.1| hypothetical protein B456_004G223300 [Gossypium raimondii]
Length=1002

 Score =   194 bits (493),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 155/238 (65%), Gaps = 11/238 (5%)
 Frame = -2

Query  912   PXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLL  733
             P    LIDKSPPIGS+ARTLSWDD C DTAT + S    VS    +EEE +W+  +QTLL
Sbjct  766   PPKSNLIDKSPPIGSIARTLSWDDLCSDTATLNSSKPSKVS-PGAKEEEHDWVLSVQTLL  824

Query  732   SMAGLDEVQS-DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  556
             S AGL++ +  +S    WHSP+SPLDP LRDKY NLN+KE +HEAKRRQ RS +KLVFDC
Sbjct  825   SSAGLNDKEYFESFIDGWHSPESPLDPSLRDKYANLNDKEPLHEAKRRQWRSNKKLVFDC  884

Query  555   VNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
             VNAA+++I     +     ++   +H    + +S    D V  +IKEW    +  + D+ 
Sbjct  885   VNAAIVEITGYGSNNRMNEMSLCRSHIRDMESASPTLVDHVCAQIKEWVSGDSNHVVDND  944

Query  390   VDDNN---LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
              D +    + E+ VR+E VGKGW +  + E +++G EIEGKLL+E+V++AVV L  TM
Sbjct  945   DDWDTDSLVVEKAVRKE-VGKGWVDQTKTETDNLGNEIEGKLLQELVEEAVVDLTGTM  1001



>gb|EYU46370.1| hypothetical protein MIMGU_mgv1a000965mg [Erythranthe guttata]
Length=929

 Score =   193 bits (491),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 148/223 (66%), Gaps = 18/223 (8%)
 Frame = -2

Query  906  GPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSM  727
            G  LIDKSPPIGS+ARTLSWDDSC++TATS  +     +      E +EW FF +TLLS+
Sbjct  720  GSNLIDKSPPIGSIARTLSWDDSCINTATSHPTEESLTTTHDETNENQEWSFFFKTLLSV  779

Query  726  AGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
            +GL+ E+QS S  ++WHS +SPLDP LRDKY++L  +  +HEAK+RQ RS ++LVFDCVN
Sbjct  780  SGLECEMQSTSFLAKWHSLESPLDPSLRDKYVDLQNENKLHEAKQRQGRSIQRLVFDCVN  839

Query  549  AALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-  373
            +ALI+I        +       P G      D VW  +  WF        DD  DD  L 
Sbjct  840  SALIEI------TGYGSDSGQKPIG------DEVWALMNAWFSEDV----DDCGDDTCLM  883

Query  372  TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
             ER+VR+E VGKGW+ + RLE +++GKEIEGKLLEE+VQ+A+V
Sbjct  884  VERVVRKEVVGKGWNRHFRLEIDNLGKEIEGKLLEELVQEALV  926



>gb|KHG04276.1| Methyl-coenzyme M reductase II subunit gamma [Gossypium arboreum]
Length=1005

 Score =   194 bits (492),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 154/238 (65%), Gaps = 11/238 (5%)
 Frame = -2

Query  912   PXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLL  733
             P    LIDKSPPIGS+ARTLSWDD C DTAT + S    VS    +EEE +W+  +QTLL
Sbjct  769   PPKSNLIDKSPPIGSIARTLSWDDLCSDTATLNSSKPSKVS-PGAKEEEHDWVLSVQTLL  827

Query  732   SMAGLDEVQS-DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  556
             S AGL++ +  +S    WHSP+SPLDP LRDKY NLN+KE +HEAKRRQ RS + LVFDC
Sbjct  828   SSAGLNDKEYFESFIDGWHSPESPLDPSLRDKYANLNDKEPLHEAKRRQWRSNKTLVFDC  887

Query  555   VNAALIDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
             VNAA+++I     +     ++   +H    + +S    D V  +IKEW       + D+ 
Sbjct  888   VNAAIVEITGYGSNNRMNEMSLRRSHMRDMESASPTLVDHVCAQIKEWVSGDGNHVVDND  947

Query  390   VDDNN---LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADTM  226
              D ++   + E+ VR+E VGKGW +  + E E++G EIEGKLL+E+V++AVV L  TM
Sbjct  948   DDWDSDSLVVEKAVRKE-VGKGWVDQTKTETENLGNEIEGKLLQELVEEAVVDLTGTM  1004



>ref|XP_010263991.1| PREDICTED: uncharacterized protein LOC104602116 isoform X3 [Nelumbo 
nucifera]
Length=993

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 162/241 (67%), Gaps = 10/241 (4%)
 Frame = -2

Query  933  GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
            G S  F P    LIDKSPPIGSVARTLSWDDSC+  A+   SLN    +   EEE+ ++L
Sbjct  752  GPSVNFHPLRSNLIDKSPPIGSVARTLSWDDSCL-IASRPNSLNFSRFLSEAEEEQDQFL  810

Query  753  FFIQTLLSMAGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRS  580
            FF Q LLS AGLD E Q+D + SRWHSP+SPLDP L +K I+L N+KE +HEAK RQRRS
Sbjct  811  FF-QALLSTAGLDHEEQADMIISRWHSPESPLDPSLIEKCISLHNDKEILHEAKHRQRRS  869

Query  579  TRKLVFDCVNAALIDIDTCHKTIA-FSGAHNTIPDGSSI---ISADRVWGRIKEWFPSAA  412
             ++L+FDCVNAAL+D+      ++ +    +T    +S+   ++ D+VW  +K+ + S+ 
Sbjct  870  NKRLLFDCVNAALVDMMGYSSEVSPWVRMCSTFQSRASVDAPVTVDKVWSCVKKLYNSSE  929

Query  411  G-CLSDDGVDDNNLTERMVRQEA-VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            G C S +  D  +L    V ++   G+GW + +RLE ++IGK+IEG++LE++VQ+A+V L
Sbjct  930  GRCYSAETGDSTSLVVEKVVRKEVAGRGWEDVMRLEVDTIGKQIEGEMLEQLVQEALVEL  989

Query  237  A  235
             
Sbjct  990  T  990



>ref|XP_010263990.1| PREDICTED: uncharacterized protein LOC104602116 isoform X2 [Nelumbo 
nucifera]
Length=1013

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 162/241 (67%), Gaps = 10/241 (4%)
 Frame = -2

Query  933   GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
             G S  F P    LIDKSPPIGSVARTLSWDDSC+  A+   SLN    +   EEE+ ++L
Sbjct  772   GPSVNFHPLRSNLIDKSPPIGSVARTLSWDDSCL-IASRPNSLNFSRFLSEAEEEQDQFL  830

Query  753   FFIQTLLSMAGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRS  580
             FF Q LLS AGLD E Q+D + SRWHSP+SPLDP L +K I+L N+KE +HEAK RQRRS
Sbjct  831   FF-QALLSTAGLDHEEQADMIISRWHSPESPLDPSLIEKCISLHNDKEILHEAKHRQRRS  889

Query  579   TRKLVFDCVNAALIDIDTCHKTIA-FSGAHNTIPDGSSI---ISADRVWGRIKEWFPSAA  412
              ++L+FDCVNAAL+D+      ++ +    +T    +S+   ++ D+VW  +K+ + S+ 
Sbjct  890   NKRLLFDCVNAALVDMMGYSSEVSPWVRMCSTFQSRASVDAPVTVDKVWSCVKKLYNSSE  949

Query  411   G-CLSDDGVDDNNLTERMVRQEA-VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
             G C S +  D  +L    V ++   G+GW + +RLE ++IGK+IEG++LE++VQ+A+V L
Sbjct  950   GRCYSAETGDSTSLVVEKVVRKEVAGRGWEDVMRLEVDTIGKQIEGEMLEQLVQEALVEL  1009

Query  237   A  235
              
Sbjct  1010  T  1010



>ref|XP_010263989.1| PREDICTED: uncharacterized protein LOC104602116 isoform X1 [Nelumbo 
nucifera]
Length=1017

 Score =   193 bits (491),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 162/241 (67%), Gaps = 10/241 (4%)
 Frame = -2

Query  933   GESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWL  754
             G S  F P    LIDKSPPIGSVARTLSWDDSC+  A+   SLN    +   EEE+ ++L
Sbjct  776   GPSVNFHPLRSNLIDKSPPIGSVARTLSWDDSCL-IASRPNSLNFSRFLSEAEEEQDQFL  834

Query  753   FFIQTLLSMAGLD-EVQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRS  580
             FF Q LLS AGLD E Q+D + SRWHSP+SPLDP L +K I+L N+KE +HEAK RQRRS
Sbjct  835   FF-QALLSTAGLDHEEQADMIISRWHSPESPLDPSLIEKCISLHNDKEILHEAKHRQRRS  893

Query  579   TRKLVFDCVNAALIDIDTCHKTIA-FSGAHNTIPDGSSI---ISADRVWGRIKEWFPSAA  412
              ++L+FDCVNAAL+D+      ++ +    +T    +S+   ++ D+VW  +K+ + S+ 
Sbjct  894   NKRLLFDCVNAALVDMMGYSSEVSPWVRMCSTFQSRASVDAPVTVDKVWSCVKKLYNSSE  953

Query  411   G-CLSDDGVDDNNLTERMVRQEA-VGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
             G C S +  D  +L    V ++   G+GW + +RLE ++IGK+IEG++LE++VQ+A+V L
Sbjct  954   GRCYSAETGDSTSLVVEKVVRKEVAGRGWEDVMRLEVDTIGKQIEGEMLEQLVQEALVEL  1013

Query  237   A  235
              
Sbjct  1014  T  1014



>gb|KJB10996.1| hypothetical protein B456_001G235600 [Gossypium raimondii]
Length=962

 Score =   191 bits (485),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 127/186 (68%), Gaps = 7/186 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LI+KSPPI S+ARTLSWDDSC +TAT  Y     +     +EEE++W  F+Q LLS AGL
Sbjct  757  LIEKSPPIESIARTLSWDDSCSETATLLYPSKLSLVSPGAKEEEQDWFLFVQLLLSAAGL  816

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            + EVQ DS  +RWHS +SPLDP LR+KY NLN+KE +HEAKRRQ RS RKL+FDCVNAAL
Sbjct  817  NGEVQLDSFFARWHSAESPLDPCLREKYANLNDKEPLHEAKRRQWRSNRKLIFDCVNAAL  876

Query  540  IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDDN  379
            ++I     D C K ++F  A     +G+S +  D VW ++KEWF     CL  DDG  D+
Sbjct  877  LEISGYGSDRCMKAMSFGRAQMIGKEGASPMLVDHVWAQMKEWFSGEVKCLGCDDGDSDS  936

Query  378  NLTERM  361
             + ER+
Sbjct  937  LVVERV  942



>ref|XP_010038329.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038330.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038331.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038332.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038333.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 ref|XP_010038334.1| PREDICTED: uncharacterized protein LOC104426860 [Eucalyptus grandis]
 gb|KCW50152.1| hypothetical protein EUGRSUZ_K03587 [Eucalyptus grandis]
Length=974

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 155/229 (68%), Gaps = 10/229 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+ARTLSWDDSC +  ++SYS+  P+     EEE  +WL F++T+LS AG 
Sbjct  744  LIDKSPPIESIARTLSWDDSCFER-SASYSIRSPMVCSNVEEE-LDWLVFVRTVLSAAGF  801

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNE-KETVHEAKRRQRRSTRKLVFDCVNAA  544
            D EVQ ++  SRWH+P+SPLDP LR+K+ N  + KE + EA+RRQRRS RKLVFDCVN A
Sbjct  802  DSEVQPETFFSRWHTPESPLDPSLREKFANTKDVKEPMPEARRRQRRSERKLVFDCVNEA  861

Query  543  LIDIDTCHKT---IAFSG--AHNTIPDGSSIISADRVWGRIKEWFPSAAGCLS-DDGVDD  382
            LID      +   I++ G  A +  P+ +  IS DRVW R+ EWFP    C+S  DG   
Sbjct  862  LIDSTGYGPSLGPISWPGCKAPDGTPEQTLSISVDRVWARMTEWFPDEVRCVSRGDGGSS  921

Query  381  NNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            + + ER+VR E VGKGW E L LE  S+ K+IE  LL+E+V +AVV L 
Sbjct  922  SLVVERVVRNEVVGKGWIEQLSLEMHSLRKDIEWTLLDELVDEAVVELT  970



>ref|XP_003541385.2| PREDICTED: uncharacterized protein LOC100787955 [Glycine max]
Length=900

 Score =   171 bits (433),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 150/241 (62%), Gaps = 16/241 (7%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNP-PVSMQRTEEEEREWLFFIQTL  736
            P    LIDKSPPI S+ARTLSWD S  + A SSY+L P  VS   ++ E++EWL  +  L
Sbjct  653  PLKSNLIDKSPPIESIARTLSWDGSSAEVA-SSYALKPLMVSSLDSKVEDQEWLLLVHKL  711

Query  735  LSMAGL-DEVQSDSLSSRWHSPDSPLDPLLRDK-YINLNEKE---TVHEAKRRQRRSTRK  571
            LS AGL D+ Q DS  +RWHS +SPLDP LRD  Y NLNEKE    +HE +RR+ RS  K
Sbjct  712  LSAAGLDDQHQHDSSYTRWHSLESPLDPSLRDALYANLNEKEPQPIMHERRRRKMRSNHK  771

Query  570  LVFDCVNAALIDI--DTCHKTIAFSGAHN--TIPDGSSIISA----DRVWGRIKEWFPSA  415
            LVFD VNAAL+++      K +  S +H    + +G+S  ++    D +  ++KE   S 
Sbjct  772  LVFDYVNAALLELVGYGSEKCLKRSKSHYRVQVQEGASAAASPLLVDHIVAQMKELIASG  831

Query  414  AGCLSDDGVDDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
              C  ++G    +L  E +VR+E V  GW E + LE + +GKEIEG L++E+V++AVV L
Sbjct  832  VRCEWENGGASTSLVVENVVRKEVVQIGWVELMELEIDILGKEIEGDLIQELVENAVVDL  891

Query  237  A  235
             
Sbjct  892  T  892



>gb|KHN48970.1| hypothetical protein glysoja_025347 [Glycine soja]
Length=900

 Score =   171 bits (432),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 150/241 (62%), Gaps = 16/241 (7%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNP-PVSMQRTEEEEREWLFFIQTL  736
            P    LIDKSPPI S+ARTLSWD S  + A SSY+L P  VS   ++ E++EWL  +  L
Sbjct  653  PLKSNLIDKSPPIESIARTLSWDGSSAEVA-SSYALKPLMVSSLDSKVEDQEWLLLVHKL  711

Query  735  LSMAGL-DEVQSDSLSSRWHSPDSPLDPLLRDK-YINLNEKE---TVHEAKRRQRRSTRK  571
            LS AGL D+ Q DS  +RWHS +SPLDP LRD  Y NLNEKE    +HE +RR+ RS  K
Sbjct  712  LSAAGLDDQHQHDSSYTRWHSLESPLDPSLRDALYANLNEKEPQPIMHERRRRKMRSNHK  771

Query  570  LVFDCVNAALIDI--DTCHKTIAFSGAH--NTIPDGSSIISA----DRVWGRIKEWFPSA  415
            LVFD VNAAL+++      K +  S +H    + +G+S  ++    D +  ++KE   S 
Sbjct  772  LVFDYVNAALLELVGYGSEKCLKRSKSHCRVQVQEGASAAASPLLVDHIVAQMKELIASG  831

Query  414  AGCLSDDGVDDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
              C  ++G    +L  E +VR+E V  GW E + LE + +GKEIEG L++E+V++AVV L
Sbjct  832  VRCEWENGGASTSLVVENVVRKEVVQIGWVELMELEIDILGKEIEGDLIQELVENAVVDL  891

Query  237  A  235
             
Sbjct  892  T  892



>ref|XP_011011589.1| PREDICTED: uncharacterized protein LOC105116094, partial [Populus 
euphratica]
Length=271

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 134/217 (62%), Gaps = 18/217 (8%)
 Frame = -2

Query  855  LSWDDSCVDTATSSYSL--NPPVSMQRTEEEEREWLFFIQTLLSMAGLD-EVQSDSLSSR  685
            LS DDS  +TA S Y L  +P       EE+E++W F +QTLL+ AGLD ++Q DS  + 
Sbjct  1    LSQDDSRAETA-SPYPLKSSPSPVPSGAEEDEKDWFFLVQTLLTTAGLDSDLQLDSFFAG  59

Query  684  WHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH-----  520
             HSP SPLD  LRDKY NLN+KE + EAK R   S  KLVFD VNAAL++I T H     
Sbjct  60   GHSPGSPLDSSLRDKYANLNDKELLLEAKPR---SNGKLVFDSVNAALVEI-TGHGSGRS  115

Query  519  -KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAV  343
             K +  SG  N + +G+     D VW ++K WF S       DG D N+L   MV    V
Sbjct  116  TKAVTCSGVQNWLVEGAQPRIIDYVWAQLKSWFCSDMRRTFGDGGDSNSLVVEMV----V  171

Query  342  GKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  232
            GKGW + +R+E +S+G EIEGKLL+E+V++AV+ L D
Sbjct  172  GKGWVDKMRVELDSLGNEIEGKLLDELVEEAVLDLTD  208



>ref|XP_008461986.1| PREDICTED: uncharacterized protein LOC103500466 [Cucumis melo]
 ref|XP_008461987.1| PREDICTED: uncharacterized protein LOC103500466 [Cucumis melo]
Length=970

 Score =   166 bits (420),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 129/208 (62%), Gaps = 5/208 (2%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S++RTL+WDD+ +D  T  Y   P ++ +  EEEE++WL  +Q+L S AGL
Sbjct  743  LIDKSPPIESISRTLTWDDAYLDN-TEPYLFKPTLACEDREEEEQKWLSLVQSLFSAAGL  801

Query  717  DE-VQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D+ V  +S  SRWHS   PLDP LR+ + NL++KE   EAKRRQ RS  KL+FD VNA L
Sbjct  802  DDSVHHNSFFSRWHSLKFPLDPSLRNNFANLSDKEPEQEAKRRQSRSNWKLIFDSVNAVL  861

Query  540  IDIDTCHKTI-AFSGAHNTI-PDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-T  370
            +DI      + A S + N +  D  S    D VW R+K+W      C   +  D N+L  
Sbjct  862  VDITGFRSEMSAISISSNWVHADAPSQPLVDIVWDRLKDWLSGKTQCGGCEIGDSNSLVV  921

Query  369  ERMVRQEAVGKGWHEYLRLEAESIGKEI  286
            ER V +E VGKGW + L+ E E +GKEI
Sbjct  922  ERAVGKEVVGKGWIQKLQEELEDLGKEI  949



>gb|KEH42420.1| DUF3741 family protein [Medicago truncatula]
Length=841

 Score =   162 bits (411),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 148/238 (62%), Gaps = 20/238 (8%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWD-DSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTL  736
            P    LIDKSP I SVARTLSWD DSC + A+  Y L    S+  T+ E+ EWL  +Q L
Sbjct  604  PMKSNLIDKSPHIESVARTLSWDEDSCGELASPYYPLKRACSLD-TKLEDHEWLILVQKL  662

Query  735  LSMAGLD--EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEK----ETVHEAKRRQRRSTR  574
            LS +GLD  + Q DS  +RW+S +SPLDP LRD Y+N+NE     + ++EAKRR+ RS +
Sbjct  663  LSASGLDDDQQQYDSFHTRWYSLESPLDPSLRDTYVNINENKDSTQPLNEAKRRKMRSNQ  722

Query  573  KLVFDCVNAALIDI---DTCHKTIAF-SGAHNT---IPDGSSIISADRVWGRIKEWFPSA  415
            KLVFDCVNAAL+++   D         SG H     + +GS ++  D +  ++ E    A
Sbjct  723  KLVFDCVNAALLEVVGYDGSENYFKMCSGTHRRPFFVQEGSCLM--DHIVAQMNELI--A  778

Query  414  AGCLSDDGVDDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
             G     G D ++L  E +VR+E V  G  E +R+E +++G+EIEGK++EE+V++ V+
Sbjct  779  NGMKFVWGGDSHSLVVENVVRKEVVESGLVEVMRMEIDALGREIEGKIIEELVENLVL  836



>ref|XP_010438386.1| PREDICTED: uncharacterized protein LOC104721992 isoform X2 [Camelina 
sativa]
Length=857

 Score =   162 bits (410),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 139/232 (60%), Gaps = 30/232 (13%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG
Sbjct  644  LIDKSPPIGSIARILSWNDDSCTD------NISKPAMVGVHEDED--WYFFIETLLTAAG  695

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVF  562
                  V  D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+F
Sbjct  696  FSRGCTVSHDPLISRWHFPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIF  755

Query  561  DCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIIS-ADRVWGRIKEWFPSAAGCL-SDDGV  388
            DC+N+ + +  T            ++ +GS      + VW ++K+W         S + +
Sbjct  756  DCINSIISETTTT-----------SMGNGSPCFDLMEHVWAQLKDWVLDEPSKFDSGEDM  804

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            D N+L  E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+ L 
Sbjct  805  DANSLAAESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDLT  856



>gb|KHN05903.1| hypothetical protein glysoja_026491 [Glycine soja]
Length=565

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/248 (44%), Positives = 149/248 (60%), Gaps = 24/248 (10%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWD-DSCVDTATSSYSLNP-PVSMQRTEEEEREWLFFIQT  739
            P    LIDKSPPI S+ARTLSWD DS  + A S Y+L P  VS   ++ +++EWL  +  
Sbjct  321  PLKSNLIDKSPPIESIARTLSWDIDSSAEVA-SPYALKPLMVSSLDSKVDDQEWLLLVHK  379

Query  738  LLSMAGLD-EVQSDSLSSRWHSPDSPLDPLLRDK-YINLNEKE---TVHEAKRRQRRSTR  574
            LLS AGLD + Q DS  +RWHS +SPLDP LRD  Y NLNEKE    +HE +RR+ RS  
Sbjct  380  LLSAAGLDDQHQFDSSYTRWHSLESPLDPSLRDTLYANLNEKEPQPNMHEGRRRRMRSNH  439

Query  573  KLVFDCVNAALIDI-----DTCHK-------TIAFSGAHNTIPDGSSIISADRVWGRIKE  430
            KLVFD VN AL+++     + C K        +   GA  +    SS +S D +  ++KE
Sbjct  440  KLVFDYVNDALLELVGYGSEKCLKRSGSRCRVLVQEGASASA--TSSPLSVDHIVAQMKE  497

Query  429  WFPSAAGCLSDDGVDDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQ  256
               S   C  ++G  ++   + E +VR+E V  GW E   LE + +GKEIEG L++E+V+
Sbjct  498  LRASGMRCEWENGGGNSTSLVVENIVRKEVVQIGWVELTDLEIDILGKEIEGDLIQELVE  557

Query  255  DAVVGLAD  232
            +AVV L +
Sbjct  558  NAVVDLLN  565



>ref|XP_010438384.1| PREDICTED: uncharacterized protein LOC104721992 isoform X1 [Camelina 
sativa]
 ref|XP_010438385.1| PREDICTED: uncharacterized protein LOC104721992 isoform X1 [Camelina 
sativa]
Length=916

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 139/232 (60%), Gaps = 30/232 (13%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG
Sbjct  703  LIDKSPPIGSIARILSWNDDSCTD------NISKPAMVGVHEDED--WYFFIETLLTAAG  754

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVF  562
                  V  D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+F
Sbjct  755  FSRGCTVSHDPLISRWHFPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIF  814

Query  561  DCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIIS-ADRVWGRIKEWFPSAAGCL-SDDGV  388
            DC+N+ + +  T            ++ +GS      + VW ++K+W         S + +
Sbjct  815  DCINSIISETTTT-----------SMGNGSPCFDLMEHVWAQLKDWVLDEPSKFDSGEDM  863

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            D N+L  E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+ L 
Sbjct  864  DANSLAAESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDLT  915



>ref|XP_010436357.1| PREDICTED: uncharacterized protein LOC104720083 [Camelina sativa]
Length=221

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 137/230 (60%), Gaps = 30/230 (13%)
 Frame = -2

Query  891  DKSPPIGSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD  715
            +KSPPI S+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG  
Sbjct  10   NKSPPIESIARILSWNDDSCTD------NISKPAMVGVHEDED--WYFFIETLLTAAGFS  61

Query  714  E---VQSDSLSSRWHSPDSPLDPLLRDKYIN----LNEKETVHEAKRRQRRSTRKLVFDC  556
                V  D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+FDC
Sbjct  62   RGCTVSHDPLISRWHFPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIFDC  121

Query  555  VNAALIDIDTCHKTIAFSGAHNTIPDGSSIIS-ADRVWGRIKEWFPSAAGCL-SDDGVDD  382
            +N+ + +  T            ++ +GS      + VW ++K+W         S + +D 
Sbjct  122  INSIISETTTT-----------SMGNGSPCFDLMEHVWAQLKDWVLDEPSKFDSGEDMDA  170

Query  381  NNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            N+L +E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+ L 
Sbjct  171  NSLASESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDLT  220



>ref|XP_002869475.1| hypothetical protein ARALYDRAFT_491881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45734.1| hypothetical protein ARALYDRAFT_491881 [Arabidopsis lyrata subsp. 
lyrata]
Length=924

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 140/234 (60%), Gaps = 36/234 (15%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+ARTLSWDD SC D  +      P + +     E+ +W  FI+T+L+ AG
Sbjct  713  LIDKSPPIGSIARTLSWDDDSCTDDIS-----KPAMGVH----EDEDWYLFIETILTAAG  763

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFD  559
                  V  D L SRWH P+SPLD LLRDKY N    N KE +HE KRRQ+RSTRKL+FD
Sbjct  764  FSSGCTVSHDPLMSRWHLPNSPLDSLLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFD  823

Query  558  CVNAALIDIDTCHKTIAFSGAHNTIP-DGSSIIS-ADRVWGRIKEWF---PSAAGCLSDD  394
             +N+ +++  T            T+P +GS   +  + VW  +K+W    PS     S +
Sbjct  824  RINSIILETTT------------TLPGNGSPHFNLVEHVWAHLKDWVSDEPSKRD--SGE  869

Query  393  GVDDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             +D N+L  E +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  870  DMDANSLAAESLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  923



>ref|XP_007144434.1| hypothetical protein PHAVU_007G155800g [Phaseolus vulgaris]
 gb|ESW16428.1| hypothetical protein PHAVU_007G155800g [Phaseolus vulgaris]
Length=887

 Score =   160 bits (405),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 139/228 (61%), Gaps = 13/228 (6%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDK+PPI S+ARTLSWDDS  +  +        +    ++ EE+EWL  +  LLS AGL
Sbjct  657  LIDKTPPIESIARTLSWDDSSAEVMSPHLLKRLMIPSLDSKVEEKEWLLLVHKLLSAAGL  716

Query  717  DEVQS-DSLSSRWHSPDSPLDPLLRDK-YINLNEKE--TVHEAKRRQRRSTRKLVFDCVN  550
            D+ Q  DS  ++W+S +SPLDP LRD  YINLNEKE   +HE +RR+ RS  KL+FD +N
Sbjct  717  DDQQQYDSFYTKWYSLESPLDPSLRDTLYINLNEKEPQPMHERRRRKMRSDHKLLFDYIN  776

Query  549  AALIDI--DTCHKTIAFSGAHNTI----PDGSSIISADRVWGRIKEWFPSAAGCLSDDGV  388
            A L+++      K +  SG+H  +       +S +  D +  +IKE   S   C  D   
Sbjct  777  AELLELVGHGSGKCLKGSGSHCRVLLQERASASPLLVDHIVAKIKELMASGVRCEQD---  833

Query  387  DDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
             ++ + E +VR+E V  GW E + LE + +GKEIEG L++E++++AVV
Sbjct  834  SNSLVVENVVRKEIVQIGWVELMELEIDILGKEIEGDLIQELLENAVV  881



>ref|XP_004139729.1| PREDICTED: uncharacterized protein LOC101207165 [Cucumis sativus]
 gb|KGN44553.1| hypothetical protein Csa_7G329380 [Cucumis sativus]
Length=960

 Score =   160 bits (405),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 129/214 (60%), Gaps = 17/214 (8%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S++RTL+W+D+  D  T  Y   P  + +  EEEE++WL  +++L S AGL
Sbjct  733  LIDKSPPIESISRTLTWEDAYSDN-TEPYLFKPTSACEDREEEEQKWLGLVRSLFSAAGL  791

Query  717  DE-VQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D+ V  +S  SRWHS   PLDP LR+ + NL++KE   EAKRRQ RS  KL+FD VNA L
Sbjct  792  DDSVHHNSFFSRWHSLKYPLDPSLRNNFANLSDKEPEQEAKRRQSRSNWKLIFDSVNAVL  851

Query  540  IDIDTCHKTIAFSGAHNTIPDGSSIISADR--------VWGRIKEWFPSAAGCLSDDGVD  385
            ++I        F    +TI   S+ + AD         VW R+K+W      C+  +  D
Sbjct  852  VEI------TGFRSEMSTISISSNWVHADAPSQPLVDIVWDRLKDWLSDETQCVGCEIGD  905

Query  384  DNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEI  286
             N+L  ER+V +E VGKGW   L+ E +++GKEI
Sbjct  906  SNSLVVERVVGKEVVGKGWIHQLQEELDNLGKEI  939



>ref|XP_010433166.1| PREDICTED: uncharacterized protein LOC104717316 isoform X2 [Camelina 
sativa]
Length=856

 Score =   159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 139/232 (60%), Gaps = 30/232 (13%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPI S+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG
Sbjct  643  LIDKSPPIESIARILSWNDDSCTD------NISKPAMVGVHEDED--WYFFIETLLTAAG  694

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVF  562
                  V  D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+F
Sbjct  695  FSRGCTVSHDPLISRWHFPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIF  754

Query  561  DCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIIS-ADRVWGRIKEWFPSAAGCL-SDDGV  388
            DC+N+ + +  T            ++ +GS      + VW ++K+W         S + +
Sbjct  755  DCINSIISETTTT-----------SMGNGSPCFDLMEHVWAQLKDWVLDEPSKFDSGEDM  803

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            D N+L +E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+ L 
Sbjct  804  DANSLASESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDLT  855



>ref|XP_003537148.1| PREDICTED: uncharacterized protein LOC100814302 isoform X1 [Glycine 
max]
 ref|XP_006588715.1| PREDICTED: uncharacterized protein LOC100814302 isoform X2 [Glycine 
max]
Length=898

 Score =   159 bits (403),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 109/248 (44%), Positives = 149/248 (60%), Gaps = 24/248 (10%)
 Frame = -2

Query  912  PXGPILIDKSPPIGSVARTLSWD-DSCVDTATSSYSLNP-PVSMQRTEEEEREWLFFIQT  739
            P    LIDKSPPI S+ARTLSWD DS  + A S Y+L P  VS   ++ +++EWL  +  
Sbjct  654  PLKSNLIDKSPPIESIARTLSWDIDSSAEVA-SPYALKPLMVSSLDSKVDDQEWLLLVHK  712

Query  738  LLSMAGLD-EVQSDSLSSRWHSPDSPLDPLLRDK-YINLNEKE---TVHEAKRRQRRSTR  574
            LLS AGLD + Q DS  +RWHS +SPLDP LRD  Y NLNEKE    +HE +RR+ RS  
Sbjct  713  LLSAAGLDDQHQFDSSYTRWHSLESPLDPSLRDTLYANLNEKEPQPNMHEGRRRRMRSNH  772

Query  573  KLVFDCVNAALIDI-----DTCHK-------TIAFSGAHNTIPDGSSIISADRVWGRIKE  430
            KLVFD VN AL+++     + C K        +   GA  +    SS +S D +  ++KE
Sbjct  773  KLVFDYVNDALLELVGYGSEKCLKRSGSRCRVLVQEGASASA--TSSPLSVDHIVAQMKE  830

Query  429  WFPSAAGCLSDDGVDDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQ  256
               S   C  ++G  ++   + E +VR+E V  GW E   LE + +GKEIEG L++E+V+
Sbjct  831  LRASGMRCEWENGGGNSTSLVVENIVRKEVVQIGWVELTDLEIDILGKEIEGDLIQELVE  890

Query  255  DAVVGLAD  232
            +AVV L +
Sbjct  891  NAVVDLLN  898



>ref|XP_010433164.1| PREDICTED: uncharacterized protein LOC104717316 isoform X1 [Camelina 
sativa]
 ref|XP_010433165.1| PREDICTED: uncharacterized protein LOC104717316 isoform X1 [Camelina 
sativa]
Length=915

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 139/232 (60%), Gaps = 30/232 (13%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPI S+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG
Sbjct  702  LIDKSPPIESIARILSWNDDSCTD------NISKPAMVGVHEDED--WYFFIETLLTAAG  753

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVF  562
                  V  D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+F
Sbjct  754  FSRGCTVSHDPLISRWHFPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIF  813

Query  561  DCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIIS-ADRVWGRIKEWFPSAAGCL-SDDGV  388
            DC+N+ + +  T            ++ +GS      + VW ++K+W         S + +
Sbjct  814  DCINSIISETTTT-----------SMGNGSPCFDLMEHVWAQLKDWVLDEPSKFDSGEDM  862

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            D N+L +E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+ L 
Sbjct  863  DANSLASESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDLT  914



>dbj|BAD94795.1| hypothetical protein [Arabidopsis thaliana]
Length=288

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 132/232 (57%), Gaps = 32/232 (14%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSWDD SC D         P + +     EE +W  FI+ +L+ AG
Sbjct  77   LIDKSPPIGSIARLLSWDDDSCTDNIA-----KPAMGVH----EEEDWHLFIEMILTAAG  127

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFD  559
                  V  D + SRWH P+SPLDP LRDKY N    N KE +HE KRRQ+RSTRKL+FD
Sbjct  128  FSSGCIVSHDPIMSRWHMPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFD  187

Query  558  CVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGV  388
             +N+ + +  T          H  +         + VW ++K+W    PS     S + +
Sbjct  188  RINSIVSETTTTR--TGNGSLHFDL--------VEHVWAQLKDWVSDEPSKRD--SGEDM  235

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            D N+L  E +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  236  DANSLAAESLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  287



>ref|XP_010069683.1| PREDICTED: uncharacterized protein LOC104456566 [Eucalyptus grandis]
 gb|KCW58104.1| hypothetical protein EUGRSUZ_H00827 [Eucalyptus grandis]
Length=971

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 134/226 (59%), Gaps = 10/226 (4%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGSVAR+LSW +       +   L+ P +   ++EEE +   FI+ LLS++  
Sbjct  745  LIDKSPPIGSVARSLSWGEY---PERAFLCLSKPSTTYGSKEEEEDCFVFIEKLLSISSQ  801

Query  717  D-EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            D    S S  S WHS  SPLDPLLR+KY + ++K  ++EAKRRQRRS RKL+FDCVNAA+
Sbjct  802  DGTAPSYSNVSSWHSLHSPLDPLLREKYADEDDK-PLNEAKRRQRRSNRKLIFDCVNAAI  860

Query  540  IDI-----DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
              I     + C          + + +  S I AD VW +IKEWF        DD      
Sbjct  861  AGITGFGPEECLVDRFCCRPGDLLMEEKSSIRADVVWSQIKEWFTEVRSVSGDDEDHTCL  920

Query  375  LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
              ER V++E VGK W  + RL  +++G+EIEG+LLE +V +AV  L
Sbjct  921  EVERAVKEEVVGKIWLGHFRLVVDNLGREIEGELLEALVAEAVSDL  966



>ref|XP_010540954.1| PREDICTED: uncharacterized protein LOC104814547 isoform X3 [Tarenaya 
hassleriana]
Length=804

 Score =   157 bits (397),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 134/225 (60%), Gaps = 22/225 (10%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMA  724
            P LIDKSPPIGS+ARTL WD         S   N P ++   +E++ +W FF++TLL+ A
Sbjct  596  PNLIDKSPPIGSIARTLLWDGDL------STDKNRPETV--IQEDDEDWYFFVETLLTDA  647

Query  723  GLDE-VQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVN  550
            GL   V SD    RWHSP+SPLDP LRDKY +  N K+ +HE+KRRQ+RS RKL+FD VN
Sbjct  648  GLGRSVSSDPFLVRWHSPESPLDPSLRDKYTDQDNNKDPIHESKRRQKRSNRKLIFDRVN  707

Query  549  AALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            A              +          ++   D  W ++K W   + G    + V+ N++ 
Sbjct  708  AI-------IAETTTATTMTCARTNLTLDMVDLAWSQLKGWLCGSEG----ETVEPNSVA  756

Query  369  -ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
             ER+VR + VG+ W + LRLE + +G EIEGKLL+E+V++ V+ L
Sbjct  757  AERVVRDDVVGRTWLDGLRLEMDDLGLEIEGKLLKELVEETVIDL  801



>ref|XP_006284953.1| hypothetical protein CARUB_v10006255mg [Capsella rubella]
 gb|EOA17851.1| hypothetical protein CARUB_v10006255mg [Capsella rubella]
Length=925

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 143/227 (63%), Gaps = 27/227 (12%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSW DDSC D      +++ P +M    E+E +W FFI+TLL+ AG
Sbjct  713  LIDKSPPIGSIARILSWNDDSCTD------NISKP-AMAGVHEDE-DWYFFIETLLTAAG  764

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFD  559
                  V  D L SRWH P++PLDP LR+KY N    N KE +HE KRRQ+RSTRKL+FD
Sbjct  765  FSRGCTVSHDPLISRWHLPNNPLDPSLREKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFD  824

Query  558  CVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCL-SDDGVDD  382
            C+++ +       +T A S   N+ P    +   + VW ++K+W       L S + +D 
Sbjct  825  CISSII------SETTATSMG-NSSPRFDLM---EHVWEQLKDWVLDEPSQLDSGEDMDA  874

Query  381  NNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
            N+L  E +V+ E VG+ W + L++E ++ G EIE +LL+++V++AV+
Sbjct  875  NSLAAESLVKNEIVGRTWTQSLQVEVDNFGIEIERRLLQDLVEEAVI  921



>ref|XP_010540953.1| PREDICTED: uncharacterized protein LOC104814547 isoform X2 [Tarenaya 
hassleriana]
Length=834

 Score =   157 bits (396),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 134/225 (60%), Gaps = 22/225 (10%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMA  724
            P LIDKSPPIGS+ARTL WD         S   N P ++   +E++ +W FF++TLL+ A
Sbjct  626  PNLIDKSPPIGSIARTLLWDGDL------STDKNRPETV--IQEDDEDWYFFVETLLTDA  677

Query  723  GLDE-VQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVN  550
            GL   V SD    RWHSP+SPLDP LRDKY +  N K+ +HE+KRRQ+RS RKL+FD VN
Sbjct  678  GLGRSVSSDPFLVRWHSPESPLDPSLRDKYTDQDNNKDPIHESKRRQKRSNRKLIFDRVN  737

Query  549  AALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            A              +          ++   D  W ++K W   + G    + V+ N++ 
Sbjct  738  AI-------IAETTTATTMTCARTNLTLDMVDLAWSQLKGWLCGSEG----ETVEPNSVA  786

Query  369  -ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
             ER+VR + VG+ W + LRLE + +G EIEGKLL+E+V++ V+ L
Sbjct  787  AERVVRDDVVGRTWLDGLRLEMDDLGLEIEGKLLKELVEETVIDL  831



>ref|XP_006412913.1| hypothetical protein EUTSA_v10024350mg [Eutrema salsugineum]
 gb|ESQ54366.1| hypothetical protein EUTSA_v10024350mg [Eutrema salsugineum]
Length=913

 Score =   157 bits (397),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 130/230 (57%), Gaps = 28/230 (12%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSWDD SC D  +      P V +     E+ +W   I+TLL+ AG
Sbjct  702  LIDKSPPIGSIARILSWDDESCTDNTS-----KPVVGVH----EDEDWYALIETLLTSAG  752

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFD  559
                  V  D L +RWH P+SPLDP LRDKY N+   N KE +HE KRRQ RSTRKL+FD
Sbjct  753  FSRGCTVSHDQLMTRWHLPNSPLDPSLRDKYTNVDNNNIKEFIHEGKRRQHRSTRKLIFD  812

Query  558  CVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSD-DGVDD  382
             +N+ + +  T               D       + VW ++K+W     G     + +D 
Sbjct  813  RINSIISETTTTRMG----------NDSQPFDLVEHVWAQVKDWVSDEPGKRDYVEDIDA  862

Query  381  NNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            N+L  E +V+ E VG+ W+  L++E +  G EIE  LL+E+V+DAV+ L 
Sbjct  863  NSLAAESLVKDEIVGRTWNHGLQVEIDDFGIEIERTLLQELVEDAVIDLT  912



>ref|XP_010540945.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540947.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540948.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540949.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540950.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540951.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540952.1| PREDICTED: uncharacterized protein LOC104814547 isoform X1 [Tarenaya 
hassleriana]
Length=863

 Score =   157 bits (397),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 136/225 (60%), Gaps = 22/225 (10%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMA  724
            P LIDKSPPIGS+ARTL WD         S   N P ++   +E++ +W FF++TLL+ A
Sbjct  655  PNLIDKSPPIGSIARTLLWDGDL------STDKNRPETV--IQEDDEDWYFFVETLLTDA  706

Query  723  GLDE-VQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRSTRKLVFDCVN  550
            GL   V SD    RWHSP+SPLDP LRDKY +  N K+ +HE+KRRQ+RS RKL+FD VN
Sbjct  707  GLGRSVSSDPFLVRWHSPESPLDPSLRDKYTDQDNNKDPIHESKRRQKRSNRKLIFDRVN  766

Query  549  AALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            A + +  T                  ++   D  W ++K W   + G    + V+ N++ 
Sbjct  767  AIIAETTTATTMTCAR-------TNLTLDMVDLAWSQLKGWLCGSEG----ETVEPNSVA  815

Query  369  -ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
             ER+VR + VG+ W + LRLE + +G EIEGKLL+E+V++ V+ L
Sbjct  816  AERVVRDDVVGRTWLDGLRLEMDDLGLEIEGKLLKELVEETVIDL  860



>ref|XP_008809665.1| PREDICTED: uncharacterized protein LOC103721293 isoform X5 [Phoenix 
dactylifera]
Length=915

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 141/227 (62%), Gaps = 11/227 (5%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYS-LNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            + +S P  SVAR+L+WDD+  +T T+  S LN  +S    EE+ER     +Q LLS AGL
Sbjct  693  LSRSSPFESVARSLAWDDTRQETLTTDPSKLNRALSKADNEEQER--FMLVQKLLSSAGL  750

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            +  +SD + + WHS DSPLDP+L DK+++  E+    EAK R+RRS ++L+FDCVNAAL+
Sbjct  751  NSEKSDMVFASWHSVDSPLDPILLDKFLDRKEE----EAKSRERRSNQRLLFDCVNAALL  806

Query  537  DIDTCHKTIAF--SGAHNTIPDGSSIIS--ADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            +I       A+   GA++     +S  +  A  VWG ++ WF      ++ +  + N L 
Sbjct  807  EIGRTTLLSAYPWKGAYHHAQKNTSPGTPFAVEVWGLLRNWFSGEGKHVTCEADNSNLLM  866

Query  369  ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  229
            +R++R+E  G+GW E LR E + I  EI G++LE++V+DA+V  A T
Sbjct  867  DRVLRREVEGRGWAESLRSEIDEISIEIGGEVLEDLVRDALVDFAGT  913



>ref|XP_010447918.1| PREDICTED: uncharacterized protein LOC104730452 isoform X2 [Camelina 
sativa]
Length=860

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 138/231 (60%), Gaps = 27/231 (12%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG
Sbjct  646  LIDKSPPIGSIARILSWNDDSCTD------NISKPAVVGVHEDED--WYFFIETLLTAAG  697

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVF  562
                  V  D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+F
Sbjct  698  FSRGCTVSHDPLISRWHLPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIF  757

Query  561  DCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCL-SDDGVD  385
            DC+N+ + +  T   T   S   + +         + VW ++K+W       L S + +D
Sbjct  758  DCINSIISETTTTTSTGNGSPCFDLM---------EHVWEQLKDWVLDEPSKLDSGEDMD  808

Query  384  DNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             N+L  E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+   
Sbjct  809  ANSLAAESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDFT  859



>ref|XP_008809662.1| PREDICTED: uncharacterized protein LOC103721293 isoform X2 [Phoenix 
dactylifera]
Length=1003

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 141/227 (62%), Gaps = 11/227 (5%)
 Frame = -2

Query  894   IDKSPPIGSVARTLSWDDSCVDTATSSYS-LNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
             + +S P  SVAR+L+WDD+  +T T+  S LN  +S    EE+ER     +Q LLS AGL
Sbjct  781   LSRSSPFESVARSLAWDDTRQETLTTDPSKLNRALSKADNEEQER--FMLVQKLLSSAGL  838

Query  717   DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
             +  +SD + + WHS DSPLDP+L DK+++  E+    EAK R+RRS ++L+FDCVNAAL+
Sbjct  839   NSEKSDMVFASWHSVDSPLDPILLDKFLDRKEE----EAKSRERRSNQRLLFDCVNAALL  894

Query  537   DIDTCHKTIAF--SGAHNTIPDGSSIIS--ADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
             +I       A+   GA++     +S  +  A  VWG ++ WF      ++ +  + N L 
Sbjct  895   EIGRTTLLSAYPWKGAYHHAQKNTSPGTPFAVEVWGLLRNWFSGEGKHVTCEADNSNLLM  954

Query  369   ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  229
             +R++R+E  G+GW E LR E + I  EI G++LE++V+DA+V  A T
Sbjct  955   DRVLRREVEGRGWAESLRSEIDEISIEIGGEVLEDLVRDALVDFAGT  1001



>ref|XP_008809661.1| PREDICTED: uncharacterized protein LOC103721293 isoform X1 [Phoenix 
dactylifera]
Length=1007

 Score =   155 bits (393),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 141/227 (62%), Gaps = 11/227 (5%)
 Frame = -2

Query  894   IDKSPPIGSVARTLSWDDSCVDTATSSYS-LNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
             + +S P  SVAR+L+WDD+  +T T+  S LN  +S    EE+ER     +Q LLS AGL
Sbjct  785   LSRSSPFESVARSLAWDDTRQETLTTDPSKLNRALSKADNEEQER--FMLVQKLLSSAGL  842

Query  717   DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
             +  +SD + + WHS DSPLDP+L DK+++  E+    EAK R+RRS ++L+FDCVNAAL+
Sbjct  843   NSEKSDMVFASWHSVDSPLDPILLDKFLDRKEE----EAKSRERRSNQRLLFDCVNAALL  898

Query  537   DIDTCHKTIAF--SGAHNTIPDGSSIIS--ADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
             +I       A+   GA++     +S  +  A  VWG ++ WF      ++ +  + N L 
Sbjct  899   EIGRTTLLSAYPWKGAYHHAQKNTSPGTPFAVEVWGLLRNWFSGEGKHVTCEADNSNLLM  958

Query  369   ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  229
             +R++R+E  G+GW E LR E + I  EI G++LE++V+DA+V  A T
Sbjct  959   DRVLRREVEGRGWAESLRSEIDEISIEIGGEVLEDLVRDALVDFAGT  1005



>dbj|BAF01823.1| hypothetical protein [Arabidopsis thaliana]
Length=660

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 132/232 (57%), Gaps = 32/232 (14%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSWDD SC D         P + +     EE +W  FI+ +L+ AG
Sbjct  449  LIDKSPPIGSIARLLSWDDDSCTDNIA-----KPAMGVH----EEEDWHLFIEMILTAAG  499

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFD  559
                  V  D + SRWH P+SPLDP LRDKY N    N KE +HE KRRQ+RSTRKL+FD
Sbjct  500  FSSGCIVSHDPIMSRWHMPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFD  559

Query  558  CVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGV  388
             +N+ + +  T          H  +         + VW ++K+W    PS     S + +
Sbjct  560  RINSIVSETTTTR--TGNGSLHFDL--------VEHVWAQLKDWVSDEPSKRD--SGEDM  607

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            D N+L  E +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  608  DANSLAAESLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  659



>ref|XP_008809664.1| PREDICTED: uncharacterized protein LOC103721293 isoform X4 [Phoenix 
dactylifera]
Length=986

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 141/227 (62%), Gaps = 11/227 (5%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYS-LNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            + +S P  SVAR+L+WDD+  +T T+  S LN  +S    EE+ER     +Q LLS AGL
Sbjct  764  LSRSSPFESVARSLAWDDTRQETLTTDPSKLNRALSKADNEEQER--FMLVQKLLSSAGL  821

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            +  +SD + + WHS DSPLDP+L DK+++  E+    EAK R+RRS ++L+FDCVNAAL+
Sbjct  822  NSEKSDMVFASWHSVDSPLDPILLDKFLDRKEE----EAKSRERRSNQRLLFDCVNAALL  877

Query  537  DIDTCHKTIAF--SGAHNTIPDGSSIIS--ADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            +I       A+   GA++     +S  +  A  VWG ++ WF      ++ +  + N L 
Sbjct  878  EIGRTTLLSAYPWKGAYHHAQKNTSPGTPFAVEVWGLLRNWFSGEGKHVTCEADNSNLLM  937

Query  369  ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  229
            +R++R+E  G+GW E LR E + I  EI G++LE++V+DA+V  A T
Sbjct  938  DRVLRREVEGRGWAESLRSEIDEISIEIGGEVLEDLVRDALVDFAGT  984



>ref|XP_008809663.1| PREDICTED: uncharacterized protein LOC103721293 isoform X3 [Phoenix 
dactylifera]
Length=990

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 141/227 (62%), Gaps = 11/227 (5%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYS-LNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            + +S P  SVAR+L+WDD+  +T T+  S LN  +S    EE+ER     +Q LLS AGL
Sbjct  768  LSRSSPFESVARSLAWDDTRQETLTTDPSKLNRALSKADNEEQER--FMLVQKLLSSAGL  825

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            +  +SD + + WHS DSPLDP+L DK+++  E+    EAK R+RRS ++L+FDCVNAAL+
Sbjct  826  NSEKSDMVFASWHSVDSPLDPILLDKFLDRKEE----EAKSRERRSNQRLLFDCVNAALL  881

Query  537  DIDTCHKTIAF--SGAHNTIPDGSSIIS--ADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            +I       A+   GA++     +S  +  A  VWG ++ WF      ++ +  + N L 
Sbjct  882  EIGRTTLLSAYPWKGAYHHAQKNTSPGTPFAVEVWGLLRNWFSGEGKHVTCEADNSNLLM  941

Query  369  ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  229
            +R++R+E  G+GW E LR E + I  EI G++LE++V+DA+V  A T
Sbjct  942  DRVLRREVEGRGWAESLRSEIDEISIEIGGEVLEDLVRDALVDFAGT  988



>ref|XP_010447916.1| PREDICTED: uncharacterized protein LOC104730452 isoform X1 [Camelina 
sativa]
 ref|XP_010447917.1| PREDICTED: uncharacterized protein LOC104730452 isoform X1 [Camelina 
sativa]
Length=919

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 138/231 (60%), Gaps = 27/231 (12%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSW-DDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSW DDSC D      +++ P  +   E+E+  W FFI+TLL+ AG
Sbjct  705  LIDKSPPIGSIARILSWNDDSCTD------NISKPAVVGVHEDED--WYFFIETLLTAAG  756

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVF  562
                  V  D L SRWH P+SPLDP LR+KY N     N KE +HE KRRQ+RSTRKL+F
Sbjct  757  FSRGCTVSHDPLISRWHLPNSPLDPSLREKYTNPDNNNNIKEFIHEGKRRQQRSTRKLIF  816

Query  561  DCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCL-SDDGVD  385
            DC+N+ + +  T   T   S   + +         + VW ++K+W       L S + +D
Sbjct  817  DCINSIISETTTTTSTGNGSPCFDLM---------EHVWEQLKDWVLDEPSKLDSGEDMD  867

Query  384  DNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             N+L  E +V+ E VG+ W   L++E +  G EIE +LL++++++AV+   
Sbjct  868  ANSLAAESLVKNEIVGRTWTHSLQVEIDDFGIEIERRLLQDLIEEAVIDFT  918



>emb|CAA22976.1| putative protein [Arabidopsis thaliana]
 emb|CAB81464.1| putative protein [Arabidopsis thaliana]
Length=880

 Score =   154 bits (388),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 132/232 (57%), Gaps = 32/232 (14%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSWDD SC D         P + +     EE +W  FI+ +L+ AG
Sbjct  669  LIDKSPPIGSIARLLSWDDDSCTDNIA-----KPAMGVH----EEEDWHLFIEMILTAAG  719

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFD  559
                  V  D + SRWH P+SPLDP LRDKY N    N KE +HE KRRQ+RSTRKL+FD
Sbjct  720  FSSGCIVSHDPIMSRWHMPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFD  779

Query  558  CVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGV  388
             +N+ + +  T          H  +         + VW ++K+W    PS     S + +
Sbjct  780  RINSIVSETTTTR--TGNGSLHFDL--------VEHVWAQLKDWVSDEPSKRD--SGEDM  827

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            D N+L  E +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  828  DANSLAAESLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  879



>ref|NP_567819.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974633.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK93687.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44897.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85538.1| uncharacterized protein AT4G28760 [Arabidopsis thaliana]
 gb|AEE85539.1| uncharacterized protein AT4G28760 [Arabidopsis thaliana]
Length=924

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 132/232 (57%), Gaps = 32/232 (14%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSWDD SC D         P + +     EE +W  FI+ +L+ AG
Sbjct  713  LIDKSPPIGSIARLLSWDDDSCTDNIA-----KPAMGVH----EEEDWHLFIEMILTAAG  763

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFD  559
                  V  D + SRWH P+SPLDP LRDKY N    N KE +HE KRRQ+RSTRKL+FD
Sbjct  764  FSSGCIVSHDPIMSRWHMPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFD  823

Query  558  CVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGV  388
             +N+ + +  T          H  +         + VW ++K+W    PS     S + +
Sbjct  824  RINSIVSETTTTR--TGNGSLHFDL--------VEHVWAQLKDWVSDEPSKRD--SGEDM  871

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            D N+L  E +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  872  DANSLAAESLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  923



>ref|XP_004495031.1| PREDICTED: uro-adherence factor A-like isoform X1 [Cicer arietinum]
 ref|XP_004495032.1| PREDICTED: uro-adherence factor A-like isoform X2 [Cicer arietinum]
Length=853

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 148/233 (64%), Gaps = 19/233 (8%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEE-EEREWLFFIQTLLSMA  724
            LIDKSPPI SVARTLSWDD SC + AT  Y   P  +     + EE EWL  +Q LLS +
Sbjct  618  LIDKSPPIESVARTLSWDDDSCGELATPYYPSKPIRATSLDNKLEENEWLLLVQKLLSAS  677

Query  723  GLDEVQS-DSLSSRWHSPDSPLDPLLRDKYINLNEKET--VHEAKRRQRRSTRKLVFDCV  553
            GLD  Q  DS  +RWHS +SPLDP LRD Y N+NEK+T  ++EAKRR+ RS +KLVFDCV
Sbjct  678  GLDNQQHYDSFHTRWHSFESPLDPSLRDTYANINEKDTQPLNEAKRRKIRSNQKLVFDCV  737

Query  552  NAALIDI-----DTCHKTIAFSGAHN--TIPDGSSIISADRVWGRIKEWFPSAAG---CL  403
            N A++++     D   K +  SG HN   + +GS ++  D +  ++KE   +  G    L
Sbjct  738  NDAILEVVGYGPDNYFKKMC-SGTHNRPLVQEGSCLV--DHIVTQMKELIIANNGMRFVL  794

Query  402  SDDGVDDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
             + G D ++L  E +VR+E V  G  E  R+E + +G+EIEG ++EEIV+DAV
Sbjct  795  EECGGDSHSLVVENVVRKEVVQLGLVEVTRMEIDVLGREIEGMIIEEIVEDAV  847



>dbj|BAH19995.1| AT4G28760 [Arabidopsis thaliana]
Length=924

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 132/232 (57%), Gaps = 32/232 (14%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSWDD SC D         P + +     EE +W  FI+ +L+ AG
Sbjct  713  LIDKSPPIGSIARLLSWDDDSCTDNIA-----KPAMGVH----EEEDWHLFIEMILTAAG  763

Query  720  LDE---VQSDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFD  559
                  V  D + SRWH P+SPLDP LRDKY N    N KE +HE KRRQ+RSTRKL+FD
Sbjct  764  FSSGCIVSHDPIMSRWHMPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFD  823

Query  558  CVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWF---PSAAGCLSDDGV  388
             +N+ + +  T          H  +         + VW ++K+W    PS     S + +
Sbjct  824  RINSIVSETTTTR--TGNGSLHFDL--------VEHVWAQLKDWVSDEPSKRD--SGEDM  871

Query  387  DDNNL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            D N+L  E +V+ E VG+ W   L++E +  G EIE +LL+E+V++AV+ L 
Sbjct  872  DANSLAAESLVKDEIVGRTWTHSLQVEIDDFGIEIEKRLLQELVEEAVIDLT  923



>emb|CDY31985.1| BnaA07g00100D [Brassica napus]
Length=758

 Score =   145 bits (365),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 126/222 (57%), Gaps = 36/222 (16%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+AR  SW+D      T      P   ++    E+ +W +FI+TLL  +G 
Sbjct  571  LIDKSPPIGSIARVFSWEDESYTDIT-----KPGNGIK----EDEDWYYFIKTLLKTSGF  621

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
                SD L +RWHSPDSPLDP LRD++ N   KE +   KRR +RS RKLVFDCVNA + 
Sbjct  622  S--GSDPLMTRWHSPDSPLDPSLRDRFAN---KEPI---KRRNQRSNRKLVFDCVNAIIT  673

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERM  361
            +  +   T A +G   T P G  ++  + VW   KEW             D N+L  E +
Sbjct  674  ETSS---TAARTGV--TTP-GFDMV--EHVWTEFKEWMVQ----------DSNSLEGESL  715

Query  360  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            VR+E VGK W   L++E  ++G EIE  LL+E+V+ AV  L 
Sbjct  716  VREEVVGKMWSHNLQVEVNNLGVEIEEMLLQELVEKAVFDLT  757



>emb|CDY65848.1| BnaCnng48860D [Brassica napus]
Length=716

 Score =   144 bits (363),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 124/222 (56%), Gaps = 37/222 (17%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+AR  SW+D      T      P   ++    E+ +W +FI+TLL  +G 
Sbjct  530  LIDKSPPIGSIARVFSWEDESYTDIT-----KPGNGIK----EDEDWYYFIKTLLKTSGF  580

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
                SD L +RWHSPDSPL+P LRD++ N   KE +   KRR +RS RKLVFDCVNA + 
Sbjct  581  S--GSDPLMTRWHSPDSPLEPSLRDRFAN---KEPI---KRRNQRSNRKLVFDCVNAIIT  632

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT-ERM  361
            +  +       + A   +  G  ++  + VW   KEW             D N+L  E +
Sbjct  633  ETTS-------TAARTGLTSGFDMV--EHVWTEFKEWVVQ----------DSNSLEGESL  673

Query  360  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            VR+E VGK W   L++E  ++G EIE  LLEE+V++AV  L 
Sbjct  674  VREEVVGKMWSHNLQVEVNNLGIEIEVMLLEELVEEAVFDLT  715



>ref|XP_010526475.1| PREDICTED: uncharacterized protein LOC104804028 isoform X2 [Tarenaya 
hassleriana]
Length=824

 Score =   145 bits (365),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 137/242 (57%), Gaps = 40/242 (17%)
 Frame = -2

Query  930  ESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEERE-WL  754
            E CL S     LIDKSP IGS+ARTLSW             L+P ++   T  +E E W 
Sbjct  612  EMCLKSN----LIDKSPLIGSIARTLSW--------DDDDDLSPDITRPVTVIQEYEDWY  659

Query  753  FFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRST  577
            FFI+TLL+   L         +RWHSPDSPLDP LRDKY +  N K+  +E+KRRQ+ S 
Sbjct  660  FFIETLLTSVSLG-------CNRWHSPDSPLDPSLRDKYPDPDNHKDLTYESKRRQQGSN  712

Query  576  RKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSD  397
            +KL+FDCVNA + +      T   S    ++P    +   D  W ++K+W  S +G  +D
Sbjct  713  QKLIFDCVNAIVAET-----TTTLSRNSLSLP----VDLVDHAWSQLKDWL-SGSGS-TD  761

Query  396  DGVD-------DNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVG  241
              +D        N+L  ER+VR E VG+ W + LR+E + +G EIEGKLL+E+V++  + 
Sbjct  762  TSLDMGETVHTTNSLAAERVVRDEVVGRTWLDGLRIEMDELGIEIEGKLLQELVEETFLD  821

Query  240  LA  235
            L 
Sbjct  822  LT  823



>ref|XP_010526471.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526472.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526473.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010526474.1| PREDICTED: uncharacterized protein LOC104804028 isoform X1 [Tarenaya 
hassleriana]
Length=882

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 137/242 (57%), Gaps = 40/242 (17%)
 Frame = -2

Query  930  ESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEERE-WL  754
            E CL S     LIDKSP IGS+ARTLSW             L+P ++   T  +E E W 
Sbjct  670  EMCLKSN----LIDKSPLIGSIARTLSW--------DDDDDLSPDITRPVTVIQEYEDWY  717

Query  753  FFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINL-NEKETVHEAKRRQRRST  577
            FFI+TLL+   L         +RWHSPDSPLDP LRDKY +  N K+  +E+KRRQ+ S 
Sbjct  718  FFIETLLTSVSLG-------CNRWHSPDSPLDPSLRDKYPDPDNHKDLTYESKRRQQGSN  770

Query  576  RKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSD  397
            +KL+FDCVNA + +      T   S    ++P    +   D  W ++K+W  S +G  +D
Sbjct  771  QKLIFDCVNAIVAET-----TTTLSRNSLSLP----VDLVDHAWSQLKDWL-SGSGS-TD  819

Query  396  DGVD-------DNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVG  241
              +D        N+L  ER+VR E VG+ W + LR+E + +G EIEGKLL+E+V++  + 
Sbjct  820  TSLDMGETVHTTNSLAAERVVRDEVVGRTWLDGLRIEMDELGIEIEGKLLQELVEETFLD  879

Query  240  LA  235
            L 
Sbjct  880  LT  881



>ref|XP_010918845.1| PREDICTED: uncharacterized protein LOC105043126 [Elaeis guineensis]
Length=993

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 132/228 (58%), Gaps = 14/228 (6%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPV---SMQRTEEEEREWLFFIQTLLSMA  724
            + +S P  SVAR+L+WDD    T   + S NP     ++ + + EE+E   F+Q LLS A
Sbjct  772  LSRSSPFESVARSLAWDD----THQEALSANPSKMYRALSKADNEEQERYMFVQKLLSSA  827

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            GLD  +SD + + WHS DSPLDP+L DK+++        EAK R+RRS +KL+FDCVNAA
Sbjct  828  GLDSEKSDMVFASWHSVDSPLDPILLDKFLD----RKGEEAKSRERRSNQKLLFDCVNAA  883

Query  543  LIDIDTCHKTIAF--SGA-HNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            L++I       A+   GA H+   + S       VWG ++ WF      +  +  + N L
Sbjct  884  LLEIGRTTLLSAYPWKGAYHHARRNTSRDTYPVEVWGLLRNWFSGEGKQVMYEADNSNLL  943

Query  372  TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  229
             +R++++E  G+GW E +R E + I  EI   +LE++V++A+V    T
Sbjct  944  MDRVLKREVEGRGWAESMRSEIDEISIEIGRDVLEDLVKEALVDFDGT  991



>emb|CDY06873.1| BnaC01g09720D [Brassica napus]
Length=845

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 131/226 (58%), Gaps = 35/226 (15%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS++R LSWDD SC D      +++ P    R   E+ +W  FI+T+L+ AG
Sbjct  643  LIDKSPPIGSISRILSWDDDSCTD------NISKPA--MRGVHEDEDWFLFIETILTAAG  694

Query  720  LDEVQSDSLSSRWHSPDSPLDPLLRDKYINL---NEKETVHEAKRRQRRSTRKLVFDCVN  550
                +  +LS     P+SPLDP LR+KY NL   N KE V+E KRRQ RSTRKL+FDC+N
Sbjct  695  FS--KGCTLSHDTVMPNSPLDPSLREKYTNLDNNNIKEFVNEGKRRQHRSTRKLIFDCIN  752

Query  549  AALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            + + +  T               D  ++   +RVW +IK+W       LSD+ V+D + +
Sbjct  753  SMVSETTTTRMG----------KDSPALDLVERVWSQIKDW-------LSDEYVEDMDAS  795

Query  369  ----ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
                E +V++E VG+ W    + E   +G  IE  LL+E+V++AV+
Sbjct  796  SVAAESLVKEEIVGRRWMNSFQGEINDLGIGIEKALLQELVEEAVL  841



>ref|XP_010933203.1| PREDICTED: uncharacterized protein LOC105053649 isoform X2 [Elaeis 
guineensis]
Length=965

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 143/234 (61%), Gaps = 26/234 (11%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPV---SMQRTEEEEREWLFFIQTLLSMA  724
            + +SP I SVAR+LSWDD   +T+    S NP +   ++ + + E +E L F+Q LLS A
Sbjct  744  VSRSPAIESVARSLSWDDIHQETS----SPNPSILCRALSKADVERQEQLMFVQKLLSSA  799

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            GLD  +SD + SRW+S DSPL+P+L +K+++  E+    EA+  +RRS ++L+FDCVNAA
Sbjct  800  GLDGEKSDMVFSRWYSVDSPLNPILLNKFLDRKEE----EAESWERRSNQRLLFDCVNAA  855

Query  543  LIDIDTCHKTIAF--SGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            L+++       A+   G +     +T PD    +    VWG ++ WF      ++    D
Sbjct  856  LLELGQATLLNAYPWKGPYHHPQKDTSPDAPCAV---EVWGLVRNWFSGERKLVAG---D  909

Query  384  DNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  229
            DN+  + +R++R+E  G+GW E ++ E + I  EI G++LE++V++A++  A T
Sbjct  910  DNSSLMVDRVLRREVEGRGWDESIKSETQEISAEIGGEILEDVVREALLEFAST  963



>ref|XP_010933204.1| PREDICTED: uncharacterized protein LOC105053649 isoform X3 [Elaeis 
guineensis]
Length=927

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 143/234 (61%), Gaps = 26/234 (11%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPV---SMQRTEEEEREWLFFIQTLLSMA  724
            + +SP I SVAR+LSWDD   +T+    S NP +   ++ + + E +E L F+Q LLS A
Sbjct  706  VSRSPAIESVARSLSWDDIHQETS----SPNPSILCRALSKADVERQEQLMFVQKLLSSA  761

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            GLD  +SD + SRW+S DSPL+P+L +K+++  E+    EA+  +RRS ++L+FDCVNAA
Sbjct  762  GLDGEKSDMVFSRWYSVDSPLNPILLNKFLDRKEE----EAESWERRSNQRLLFDCVNAA  817

Query  543  LIDIDTCHKTIAF--SGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            L+++       A+   G +     +T PD    +    VWG ++ WF      ++    D
Sbjct  818  LLELGQATLLNAYPWKGPYHHPQKDTSPDAPCAV---EVWGLVRNWFSGERKLVAG---D  871

Query  384  DNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  229
            DN+  + +R++R+E  G+GW E ++ E + I  EI G++LE++V++A++  A T
Sbjct  872  DNSSLMVDRVLRREVEGRGWDESIKSETQEISAEIGGEILEDVVREALLEFAST  925



>ref|XP_004152072.2| PREDICTED: uncharacterized protein LOC101204012 [Cucumis sativus]
 ref|XP_011651630.1| PREDICTED: uncharacterized protein LOC101204012 [Cucumis sativus]
 gb|KGN58324.1| hypothetical protein Csa_3G622430 [Cucumis sativus]
Length=963

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 134/223 (60%), Gaps = 16/223 (7%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P   E C+  P    LIDKSPPI S+AR++ WD S  D++      + PVS     EEE+
Sbjct  729  PRNQEFCM--PYKNSLIDKSPPIESIARSIFWDGSYSDSSAPCALKSAPVST--CLEEEQ  784

Query  762  EWLFFIQTLLSMAGL-DEVQSDSL-SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQ  589
             W   +Q LL+M+GL +EVQ  SL  ++WHS  +PLD  LR+KY NLN KE + EA+RRQ
Sbjct  785  NWHSLVQALLTMSGLSNEVQQCSLLFAKWHSLANPLDLSLRNKYANLNSKEPMLEAERRQ  844

Query  588  RRSTRKLVFDCVNAALIDIDTC---HKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPS  418
             RS+RKLVFDCVNAALIDI +    H+          +   +S+   D V  ++K+W   
Sbjct  845  LRSSRKLVFDCVNAALIDITSQELDHRRTEI------LAQDTSLTLLDCVMVKVKDWVCV  898

Query  417  AAGCLSDDGVDDNNLTERMVRQEAV-GKGWHEYLRLEAESIGK  292
             + C++ D  D N+L    V ++ V G+ W E+LR+E +++GK
Sbjct  899  ESRCVTGDIGDINSLVVERVVRKEVGGRNWDEHLRMEMDNLGK  941



>ref|XP_010933202.1| PREDICTED: uncharacterized protein LOC105053649 isoform X1 [Elaeis 
guineensis]
Length=963

 Score =   143 bits (361),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 143/234 (61%), Gaps = 26/234 (11%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPV---SMQRTEEEEREWLFFIQTLLSMA  724
            + +SP I SVAR+LSWDD   +T+    S NP +   ++ + + E +E L F+Q LLS A
Sbjct  742  LSRSPAIESVARSLSWDDIHQETS----SPNPSILCRALSKADVERQEQLMFVQKLLSSA  797

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            GLD  +SD + SRW+S DSPL+P+L +K+++  E+    EA+  +RRS ++L+FDCVNAA
Sbjct  798  GLDGEKSDMVFSRWYSVDSPLNPILLNKFLDRKEE----EAESWERRSNQRLLFDCVNAA  853

Query  543  LIDIDTCHKTIAF--SGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            L+++       A+   G +     +T PD    +    VWG ++ WF      ++    D
Sbjct  854  LLELGQATLLNAYPWKGPYHHPQKDTSPDAPCAV---EVWGLVRNWFSGERKLVAG---D  907

Query  384  DNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  229
            DN+  + +R++R+E  G+GW E ++ E + I  EI G++LE++V++A++  A T
Sbjct  908  DNSSLMVDRVLRREVEGRGWDESIKSETQEISAEIGGEILEDVVREALLEFAST  961



>ref|XP_008447347.1| PREDICTED: uncharacterized protein LOC103489819 [Cucumis melo]
 ref|XP_008447348.1| PREDICTED: uncharacterized protein LOC103489819 [Cucumis melo]
Length=971

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 135/223 (61%), Gaps = 16/223 (7%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P   E C+  P    LIDKSPPI S+AR++  D S   ++      +PPVS     +EE+
Sbjct  737  PRNQEFCM--PFKNSLIDKSPPIESIARSIFRDGSYSGSSAPCALKSPPVST--CLKEEQ  792

Query  762  EWLFFIQTLLSMAGL-DEVQSDSL-SSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQ  589
             W   +Q LL+M+GL +E+Q  SL  ++WHS  +PLDP LR+KY NL+ KE + EA+RRQ
Sbjct  793  NWHCLVQALLTMSGLSNEIQQCSLLFTKWHSLANPLDPSLRNKYANLSSKEPMLEAERRQ  852

Query  588  RRSTRKLVFDCVNAALIDIDTC---HKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPS  418
             RS+RKLVFDCVNAALI+I +    H+      AH+T     S+   D V  ++K+W   
Sbjct  853  LRSSRKLVFDCVNAALINITSQELDHRQTKIL-AHDT-----SLTLLDYVMVKLKDWICG  906

Query  417  AAGCLSDDGVDDNNLTERMVRQEAV-GKGWHEYLRLEAESIGK  292
             + CL+ D  D N+L    V ++ V GK W E+L +E +++GK
Sbjct  907  ESRCLTGDIGDSNSLVVERVVRKEVGGKNWDEHLLMEMDNLGK  949



>ref|XP_008789490.1| PREDICTED: uncharacterized protein LOC103706972 isoform X2 [Phoenix 
dactylifera]
Length=962

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 133/229 (58%), Gaps = 23/229 (10%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVS---MQRTEEEEREWLFFIQTLL  733
            P  + +SPPI S+AR+LS D S +        +NPP     + + EE E+E    +Q LL
Sbjct  741  PQALSRSPPIESIARSLSRDGSSLGRIL----MNPPKPSRLLPKVEEGEQERFVLVQKLL  796

Query  732  SMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCV  553
            S AG    +S  + +RWHS +SPL+P+L DKY++  E+    EAK R+RRS ++L+FDCV
Sbjct  797  SSAGFRNEKSCMIFTRWHSLESPLNPMLLDKYLDRKEE----EAKCRERRSNQRLLFDCV  852

Query  552  NAALIDIDTCHKTIAF------SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
            NAAL++I       ++       GA    P G+S+   + V   ++ W+ S    L + G
Sbjct  853  NAALLNIGQSAVLASYPWAGACCGAWKDGPAGASV--TEEVCELVRNWY-SGESVLGEPG  909

Query  390  VDDNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
                NLT ER+V++E  G+GW E++ LE     KEI G +LEE+V++A+
Sbjct  910  --GINLTVERVVKREVAGRGWAEFMWLEMYEFSKEIGGLVLEELVEEAL  956



>ref|XP_008789489.1| PREDICTED: uncharacterized protein LOC103706972 isoform X1 [Phoenix 
dactylifera]
Length=963

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 133/229 (58%), Gaps = 23/229 (10%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVS---MQRTEEEEREWLFFIQTLL  733
            P  + +SPPI S+AR+LS D S +        +NPP     + + EE E+E    +Q LL
Sbjct  742  PQALSRSPPIESIARSLSRDGSSLGRIL----MNPPKPSRLLPKVEEGEQERFVLVQKLL  797

Query  732  SMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCV  553
            S AG    +S  + +RWHS +SPL+P+L DKY++  E+    EAK R+RRS ++L+FDCV
Sbjct  798  SSAGFRNEKSCMIFTRWHSLESPLNPMLLDKYLDRKEE----EAKCRERRSNQRLLFDCV  853

Query  552  NAALIDIDTCHKTIAF------SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
            NAAL++I       ++       GA    P G+S+   + V   ++ W+ S    L + G
Sbjct  854  NAALLNIGQSAVLASYPWAGACCGAWKDGPAGASV--TEEVCELVRNWY-SGESVLGEPG  910

Query  390  VDDNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
                NLT ER+V++E  G+GW E++ LE     KEI G +LEE+V++A+
Sbjct  911  --GINLTVERVVKREVAGRGWAEFMWLEMYEFSKEIGGLVLEELVEEAL  957



>ref|XP_008789491.1| PREDICTED: uncharacterized protein LOC103706972 isoform X3 [Phoenix 
dactylifera]
Length=944

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 133/229 (58%), Gaps = 23/229 (10%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVS---MQRTEEEEREWLFFIQTLL  733
            P  + +SPPI S+AR+LS D S +        +NPP     + + EE E+E    +Q LL
Sbjct  723  PQALSRSPPIESIARSLSRDGSSLGRIL----MNPPKPSRLLPKVEEGEQERFVLVQKLL  778

Query  732  SMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCV  553
            S AG    +S  + +RWHS +SPL+P+L DKY++  E+    EAK R+RRS ++L+FDCV
Sbjct  779  SSAGFRNEKSCMIFTRWHSLESPLNPMLLDKYLDRKEE----EAKCRERRSNQRLLFDCV  834

Query  552  NAALIDIDTCHKTIAF------SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
            NAAL++I       ++       GA    P G+S+   + V   ++ W+ S    L + G
Sbjct  835  NAALLNIGQSAVLASYPWAGACCGAWKDGPAGASV--TEEVCELVRNWY-SGESVLGEPG  891

Query  390  VDDNNLT-ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
                NLT ER+V++E  G+GW E++ LE     KEI G +LEE+V++A+
Sbjct  892  --GINLTVERVVKREVAGRGWAEFMWLEMYEFSKEIGGLVLEELVEEAL  938



>ref|XP_009129280.1| PREDICTED: uncharacterized protein LOC103854122 [Brassica rapa]
 ref|XP_009129285.1| PREDICTED: uncharacterized protein LOC103854122 [Brassica rapa]
Length=837

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 127/229 (55%), Gaps = 39/229 (17%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+AR LSWDD            +   +M   +E+E +W  FI+T+L+ AG 
Sbjct  639  LIDKSPPIGSIARILSWDD------------DSKPAMGGVQEDE-DWFLFIETILTAAGF  685

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFDCVN  550
               +  + S     P+SPLDP LR+KY NL    N KE V+E KRRQ RSTRKL+FDC+N
Sbjct  686  S--KGCTFSHDTVMPNSPLDPSLREKYTNLDNNNNIKEFVNEGKRRQHRSTRKLIFDCIN  743

Query  549  AALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            + + +  T      +S   + +         + VW ++K+W       LSD+ V+D +  
Sbjct  744  SIVSETTTTRIGTDYSRPLDLV---------EHVWSQVKDW-------LSDEYVEDMDAN  787

Query  369  ----ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
                E +V++E VG+ W    + E + +G  IE  LL E++++AV+ L 
Sbjct  788  SVAAESLVKEEIVGRRWMNSFQGEVDDLGIGIESALLRELIEEAVLDLT  836



>ref|XP_010940679.1| PREDICTED: uncharacterized protein LOC105059154 isoform X2 [Elaeis 
guineensis]
Length=954

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 130/227 (57%), Gaps = 18/227 (8%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNP--PVSMQRTEEEEREWLFFIQTLLS  730
            P  + +SPPI S+AR+LS D S +        +NP  P S+    EEE+E    +Q LLS
Sbjct  732  PQALSRSPPIESIARSLSRDGSSLGRIL----MNPLKPSSLVPKVEEEQERFVLVQKLLS  787

Query  729  MAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
             AGL   +S  + +RWHS +SPL+P+L DKY++  E+    EAK R+RRS ++L+FDCVN
Sbjct  788  SAGLQNEKSYMIFTRWHSLESPLNPMLLDKYLDRKEE----EAKCRERRSNQRLLFDCVN  843

Query  549  AALIDIDTCHKTIAF------SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV  388
            AAL+ +       ++      SGA      G+S+   + V   ++ W+      L  +  
Sbjct  844  AALLSVGQSAILASYPWAGACSGAWKDGTAGASV--TEEVCELVRNWYSGEEKSLPSEPR  901

Query  387  DDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
              N + +R+V++E  G+GW E++ LE     KEI G +LEE+V++A+
Sbjct  902  SINLVVDRVVKREIAGRGWAEFMWLEMYEFSKEIGGLVLEELVEEAL  948



>ref|XP_010940678.1| PREDICTED: uncharacterized protein LOC105059154 isoform X1 [Elaeis 
guineensis]
Length=955

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 130/227 (57%), Gaps = 18/227 (8%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNP--PVSMQRTEEEEREWLFFIQTLLS  730
            P  + +SPPI S+AR+LS D S +        +NP  P S+    EEE+E    +Q LLS
Sbjct  733  PQALSRSPPIESIARSLSRDGSSLGRIL----MNPLKPSSLVPKVEEEQERFVLVQKLLS  788

Query  729  MAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
             AGL   +S  + +RWHS +SPL+P+L DKY++  E+    EAK R+RRS ++L+FDCVN
Sbjct  789  SAGLQNEKSYMIFTRWHSLESPLNPMLLDKYLDRKEE----EAKCRERRSNQRLLFDCVN  844

Query  549  AALIDIDTCHKTIAF------SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV  388
            AAL+ +       ++      SGA      G+S+   + V   ++ W+      L  +  
Sbjct  845  AALLSVGQSAILASYPWAGACSGAWKDGTAGASV--TEEVCELVRNWYSGEEKSLPSEPR  902

Query  387  DDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
              N + +R+V++E  G+GW E++ LE     KEI G +LEE+V++A+
Sbjct  903  SINLVVDRVVKREIAGRGWAEFMWLEMYEFSKEIGGLVLEELVEEAL  949



>emb|CDY35217.1| BnaA01g08140D [Brassica napus]
Length=837

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 129/233 (55%), Gaps = 45/233 (19%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+AR LSWDD            +   +M   +E+E +W  FI+T+L+ AG 
Sbjct  639  LIDKSPPIGSIARILSWDD------------DSKPAMGGVQEDE-DWFLFIETILTAAGF  685

Query  717  DE---VQSDSLSSRWHSPDSPLDPLLRDKYINL----NEKETVHEAKRRQRRSTRKLVFD  559
             +   V  D++      P+SPLDP LR+KY NL    N KE V+E KRRQ RSTRKL+FD
Sbjct  686  SKGCTVSHDTVM-----PNSPLDPSLREKYTNLDNNNNIKEFVNEGKRRQHRSTRKLIFD  740

Query  558  CVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDN  379
            C+N+ + +  T      +S   + +         + VW ++K W       LSD+ V+D 
Sbjct  741  CINSIISETTTTRMGNDYSPPLDLV---------EHVWSQVKVW-------LSDEYVEDM  784

Query  378  NLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  232
            +      E +V++E VG+ W    + E + +G  IE  LL E++++AV+ L +
Sbjct  785  DANSVAAESLVKEEIVGRRWMNSFQGEVDDLGIGIESALLRELIEEAVLDLTE  837



>ref|XP_006408939.1| hypothetical protein EUTSA_v10001917mg [Eutrema salsugineum]
 gb|ESQ50392.1| hypothetical protein EUTSA_v10001917mg [Eutrema salsugineum]
Length=735

 Score =   133 bits (334),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 121/222 (55%), Gaps = 42/222 (19%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPI S+AR  SW+D        SY   P   ++    EE +W + I+TLL  +G 
Sbjct  552  LIDKSPPIESIARVFSWEDE-------SYITKPATGIK----EEEDWYYLIKTLLKASGF  600

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
                SD L +RWHSPD PLDP LRD + N   KE V   KRR++RS RKLVFDCVNA + 
Sbjct  601  R--GSDPLMTRWHSPDCPLDPSLRDTFAN---KELV---KRRKQRSNRKLVFDCVNAIIT  652

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT--ER  364
            +      T A +GA  +   G  ++  + VW  +K           D  V D+N    E 
Sbjct  653  ET-----TSAAAGAETS---GFDML--EHVWTELK-----------DLAVQDSNSLEGES  691

Query  363  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            ++R E VGK W    + E  ++G EIE  LL+E+VQ+AV  L
Sbjct  692  VLRDEVVGKMWSRNSQAEVNNLGIEIEVMLLQELVQEAVFDL  733



>ref|NP_179614.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD21764.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06984.1| uncharacterized protein AT2G20240 [Arabidopsis thaliana]
Length=713

 Score =   133 bits (334),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 123/221 (56%), Gaps = 49/221 (22%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIG++AR L+W+D S  DT+  +  +          EE+ +W  FI+TLL+ +G
Sbjct  540  LIDKSPPIGTIARILAWEDESYTDTSKPAMGI----------EEDEDWYGFIKTLLTASG  589

Query  720  LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
                 SDSL +RWHS +SPLDP LRDK+ N   KE +   KRR++RS RKLVFDCVNA +
Sbjct  590  FS--GSDSLMTRWHSLESPLDPSLRDKFAN---KELI---KRRKQRSNRKLVFDCVNAII  641

Query  540  IDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERM  361
             +  +       + AH  +  G +++  + VW  ++EW                      
Sbjct  642  TETTS-------TLAHTGLTKGFNML--EHVWTELQEW---------------------A  671

Query  360  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            V  E  GK W   L++E  ++G EIE  LL+E+V++AV  L
Sbjct  672  VNDEVAGKMWSYGLQVEMNNLGIEIEVILLQELVEEAVFDL  712



>dbj|BAD43822.1| unknown protein [Arabidopsis thaliana]
Length=713

 Score =   133 bits (334),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 123/221 (56%), Gaps = 49/221 (22%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIG++AR L+W+D S  DT+  +  +          EE+ +W  FI+TLL+ +G
Sbjct  540  LIDKSPPIGTIARILAWEDESYTDTSKPAMGI----------EEDEDWYGFIKTLLTASG  589

Query  720  LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
                 SDSL +RWHS +SPLDP LRDK+ N   KE +   KRR++RS RKLVFDCVNA +
Sbjct  590  FS--GSDSLMTRWHSLESPLDPSLRDKFAN---KELI---KRRKQRSNRKLVFDCVNAII  641

Query  540  IDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERM  361
             +  +       + AH  +  G +++  + VW  ++EW                      
Sbjct  642  TETTS-------TLAHTGLTKGFNML--EHVWTELQEW---------------------A  671

Query  360  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            V  E  GK W   L++E  ++G EIE  LL+E+V++AV  L
Sbjct  672  VNDEVAGKMWSYGLQVEMNNLGIEIEVILLQELVEEAVFDL  712



>ref|XP_002883937.1| hypothetical protein ARALYDRAFT_319541 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60196.1| hypothetical protein ARALYDRAFT_319541 [Arabidopsis lyrata subsp. 
lyrata]
Length=697

 Score =   132 bits (333),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 120/221 (54%), Gaps = 47/221 (21%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSPPIGS+AR  SW+D      T      P + +    EE+  W  F++TLL+ +G 
Sbjct  523  LIDKSPPIGSIARVFSWEDESYTNTT-----KPAMGI----EEDENWYGFVKTLLTASGF  573

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
                SDSL +RWHSP+SPLDP LRDK+ N   KE +   KRR++RST KLVFDCVNA + 
Sbjct  574  S--GSDSLMTRWHSPESPLDPSLRDKFAN---KELI---KRRKQRSTCKLVFDCVNAIIT  625

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
            +  +       + AH  +  G +++  + VW             L D  V D        
Sbjct  626  ETTS-------TLAHTGLTKGFNMV--EHVW-----------TALQDSAVSD--------  657

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
              E VGK W   L++E  ++G EIE  LL+E+V++AV  L 
Sbjct  658  --EVVGKMWSYGLQVETNNLGIEIEVILLQELVEEAVFDLT  696



>ref|XP_008812928.1| PREDICTED: uncharacterized protein LOC103723702 [Phoenix dactylifera]
 ref|XP_008812929.1| PREDICTED: uncharacterized protein LOC103723702 [Phoenix dactylifera]
 ref|XP_008812930.1| PREDICTED: uncharacterized protein LOC103723702 [Phoenix dactylifera]
 ref|XP_008812931.1| PREDICTED: uncharacterized protein LOC103723702 [Phoenix dactylifera]
Length=713

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 136/234 (58%), Gaps = 26/234 (11%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPV---SMQRTEEEEREWLFFIQTLLSMA  724
            + +SP I SV R+LSWDD   +T+    S NP     ++ + + E +E + F+Q LLS A
Sbjct  492  LSRSPAIESVTRSLSWDDVHQETS----SPNPSKLYRALSKADVEGQELVMFVQKLLSSA  547

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            GLD  + D + SRW+S DSPL+P+L DK+++  E+    EAK R+RRS ++L+FD VNAA
Sbjct  548  GLDSEKPDMVFSRWYSVDSPLNPILLDKFLDQKEE----EAKSRERRSNQRLLFDWVNAA  603

Query  543  LIDID--TCHKTIAFSGAH-----NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            L++I   T      + G +     +T PD    +    VWG I+ WF      ++    D
Sbjct  604  LLEIGQATLLNAYPWKGPYHHPQKDTSPDTPYGV---EVWGLIRNWFSGERKLVTG---D  657

Query  384  DNNL--TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLADT  229
            DN++   + ++R+E  G+GW E ++ E + I  EI  ++LE++V++A+     T
Sbjct  658  DNSILVVDGVLRREVEGRGWAESMKSEIDEISTEIGREILEDLVREALPDFTGT  711



>dbj|BAK01535.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=705

 Score =   127 bits (320),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 122/220 (55%), Gaps = 28/220 (13%)
 Frame = -2

Query  879  PIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  700
            PIGSVARTLSWDDS  + A        P S +  +  E+E   F++ +LS AGL  V + 
Sbjct  493  PIGSVARTLSWDDSSSEEAA-------PCSSKEEDSHEQEQYEFVEKILSSAGLCSVTTS  545

Query  699  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DT  526
             + +RWHS DSPL P + D+++    +  V +AKRR+RRS ++L+ D VNAAL+DI   T
Sbjct  546  DVFARWHSLDSPLAPNVPDQFL----ERKVEDAKRRERRSGQRLLIDSVNAALLDIGQST  601

Query  525  CHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-------TE  367
                   +G    +      + AD  W  +K W       LSDD   +N L        +
Sbjct  602  LWSAYPCAGPVANVSRRDEPV-ADAAWRLVKGW-------LSDDEASNNGLPGNVGVAAD  653

Query  366  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
            R+V +E  G+GW E LRLE + + K+I G +L E+V++A+
Sbjct  654  RVVGEEIEGRGWSEMLRLEVDDMTKQICGDVLGEVVEEAL  693



>ref|XP_006296647.1| hypothetical protein CARUB_v10015415mg [Capsella rubella]
 gb|EOA29545.1| hypothetical protein CARUB_v10015415mg [Capsella rubella]
Length=717

 Score =   127 bits (319),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 117/222 (53%), Gaps = 49/222 (22%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSW+D S  DT  S+  +          EE+ +W  FI+TLL+ +G
Sbjct  543  LIDKSPPIGSIARVLSWEDESYTDTTNSTMGI----------EEDEDWYGFIKTLLTASG  592

Query  720  LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
                 SDSL +RWHSPD PLDP LRDK  N   KE +   KRR++RS  KLVFDCVN  +
Sbjct  593  FS--GSDSLMARWHSPDGPLDPSLRDKCAN---KELI---KRRKQRSNCKLVFDCVNDII  644

Query  540  IDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERM  361
                   K    + A  ++  G  ++  + VW  +++W                      
Sbjct  645  -------KVTTSTLARTSLTKGFDMM--EHVWTELQDW---------------------A  674

Query  360  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            V  E VGK W     +E  ++G EIE  LL+E+V++AV  L 
Sbjct  675  VSDEIVGKVWSYSREMEMNNLGIEIEVILLQELVEEAVFDLT  716



>ref|XP_010489077.1| PREDICTED: uncharacterized protein LOC104766813 [Camelina sativa]
Length=680

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 120/221 (54%), Gaps = 49/221 (22%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIGS+AR LSW+D S  DT   +  +          EE+ +W  FI+ LL  +G
Sbjct  506  LIDKSPPIGSIARVLSWEDESYTDTTKPAMGI----------EEDEDWYGFIKALLIASG  555

Query  720  LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
                 SDSL +RWHSPDSPLDP L+DK  N   KE +   KRR++RS RKLVFDCVN  +
Sbjct  556  FS--GSDSLMARWHSPDSPLDPSLKDKIAN---KELI---KRRKQRSNRKLVFDCVNDII  607

Query  540  IDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERM  361
             +      T+A +G    +  G  ++  + VW  +++W  S                   
Sbjct  608  RETTL---TLASTG----LTKGFDMV--EHVWTELQDWASS-------------------  639

Query  360  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
               E VGK W+   ++E  ++G EIE  LL+E+V++AV  L
Sbjct  640  --DEFVGKMWNYRQQVEMNNLGAEIEVMLLQELVEEAVFDL  678



>dbj|BAJ95378.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=896

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 122/220 (55%), Gaps = 28/220 (13%)
 Frame = -2

Query  879  PIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  700
            PIGSVARTLSWDDS  + A        P S +  +  E+E   F++ +LS AGL  V + 
Sbjct  684  PIGSVARTLSWDDSSSEEAA-------PCSSKEEDSHEQEQYEFVEKILSSAGLCSVTTS  736

Query  699  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DT  526
             + +RWHS DSPL P + D+++    +  V +AKRR+RRS ++L+ D VNAAL+DI   T
Sbjct  737  DVFARWHSLDSPLAPNVPDQFL----ERKVEDAKRRERRSGQRLLIDSVNAALLDIGQST  792

Query  525  CHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL-------TE  367
                   +G    +      + AD  W  +K W       LSDD   +N L        +
Sbjct  793  LWSAYPCAGPVANVSRRDEPV-ADAAWRLVKGW-------LSDDEASNNGLPGNVGVAAD  844

Query  366  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
            R+V +E  G+GW E LRLE + + K+I G +L E+V++A+
Sbjct  845  RVVGEEIEGRGWSEMLRLEVDDMTKQICGDVLGEVVEEAL  884



>ref|XP_010495916.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Camelina 
sativa]
Length=678

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 115/221 (52%), Gaps = 48/221 (22%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSP IGS+AR LSW+D S  DT   +  +          EE+ +W  FI+ +L  +G
Sbjct  503  LIDKSPSIGSIARVLSWEDESHTDTTKPAMRI----------EEDEDWYGFIKAILIASG  552

Query  720  LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
                 S SL +RWHSPDSPLDP L+DK  N   KE +   KRR++RS RKLVFDCVN   
Sbjct  553  FS--GSGSLMARWHSPDSPLDPSLKDKIAN---KELI---KRRKQRSDRKLVFDCVN---  601

Query  540  IDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERM  361
               D   +T   + A   +  G  ++  D VW  +++W                      
Sbjct  602  ---DIITETTLLTLASTGLTKGFDMV--DHVWTELQDW---------------------A  635

Query  360  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
             R E VGK W    ++E  ++G EIE  LL+E+V++AV  L
Sbjct  636  SRDEFVGKMWSYRQQVEMNNLGAEIEVMLLQELVEEAVFDL  676



>ref|XP_009411376.1| PREDICTED: uncharacterized protein LOC103993144 [Musa acuminata 
subsp. malaccensis]
Length=932

 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 135/228 (59%), Gaps = 13/228 (6%)
 Frame = -2

Query  906  GPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSM  727
            G  L+ ++ PI SVAR+LSWDD+ + T +   S N   +  + +  ++++  F+Q LL  
Sbjct  707  GQQLLSRASPIESVARSLSWDDAHLGTLSPRPS-NLYKASSKADHTDQDYFVFVQNLLYF  765

Query  726  AGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNA  547
            AGL+  +SD + + WHS DSPLDP+L DK++   E+    E +  ++ ST +L+FDCVN+
Sbjct  766  AGLE--KSDMIFTGWHSLDSPLDPMLLDKFLGWKEE----EPRCTEKSSTLRLLFDCVNS  819

Query  546  ALIDID--TCHKTIAFSGAH--NTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDN  379
            AL ++   T      ++GA   + I  G+S   ++ VW  +++W+ S  G       D+N
Sbjct  820  ALEEVSWTTLTSLYLWNGASCGSRINAGASSTLSEAVWSLMRDWY-SGNGISVFAETDNN  878

Query  378  NL-TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            +L  +R +R+E  G  W E +R+E E I  EI G++L+++V +A+  L
Sbjct  879  SLGVDRALRREVEGNKWVESIRIEVEEITGEISGEVLKDLVVEALADL  926



>gb|EMT32262.1| hypothetical protein F775_21072 [Aegilops tauschii]
Length=839

 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 125/229 (55%), Gaps = 37/229 (16%)
 Frame = -2

Query  879  PIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  700
            PIGSVARTLSWDDS  + A        P S +  +  E+E   F++ +LS AGL    + 
Sbjct  631  PIGSVARTLSWDDSSEEEAA-------PCSSKEEDSHEQEQYEFVEKILSSAGLCNGATS  683

Query  699  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCH  520
            ++ +RWHS DSPL P + D+++    +  V +AK R+RRS+++L+ D VNAAL+DI    
Sbjct  684  NVFARWHSLDSPLAPNVPDQFL----ERKVEDAKCRERRSSQRLLIDSVNAALLDIGQSK  739

Query  519  KTIAFSGAHNTIPDGSSIIS--------ADRVWGRIKEWFPSAAGCLSDD----GVDDN-  379
               A+      I     II+         D  W  +K W       LSDD    G+ DN 
Sbjct  740  LWGAYPCTAGPI-----IINVSQRDEPVGDAAWRLVKGW-------LSDDEAGNGLPDNV  787

Query  378  -NLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
                +R+V +E  G+GW E LRLE + + KEI G +L E+V++A+  LA
Sbjct  788  GTAADRVVGEEIGGRGWSEMLRLEVDDMTKEICGGVLGEVVEEALSELA  836



>ref|XP_010556872.1| PREDICTED: uncharacterized protein LOC104826058 [Tarenaya hassleriana]
Length=937

 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 122/229 (53%), Gaps = 27/229 (12%)
 Frame = -2

Query  927  SCLFSPXGP--------ILIDKSPPIGSVARTLSWDDSCVD-TATSSYSLNPPVSMQRTE  775
            S LF P  P         +I+KSPPIGS +RTLS DDS  + T  + YS    VS Q TE
Sbjct  694  SILFKPASPGPEISSKSNIINKSPPIGSFSRTLSRDDSRAEPTMATRYSSKRFVSSQDTE  753

Query  774  EEEREWLFFIQTLLSMAGLD--EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEA  601
            + E +W   + TLLS A LD  E  S++  S+WHS  SPLDP LR+KY   ++ ETV+EA
Sbjct  754  DVEEDWRLLVNTLLSTANLDGDESLSENHLSKWHSLQSPLDPSLRNKYTKTDDSETVNEA  813

Query  600  KRRQRRSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFP  421
            KR++  S+RKLVFD VN+ L+   T   T  F     T   G S+    R+W  ++EWF 
Sbjct  814  KRQRLSSSRKLVFDLVNSFLLSELT---TTGFGRGKETAL-GDSV----RIW--MQEWFS  863

Query  420  SAAGCLSDDGVD-DNNLTERMV-----RQEAVGKGWHEYLRLEAESIGK  292
                    D  D D +L+   V      + A   GW E  R E + +G+
Sbjct  864  GRRKVNCGDEEDGDGDLSSLAVDRAARAEAAEEGGWPENKRREVDGVGE  912



>ref|XP_010416091.1| PREDICTED: uncharacterized protein LOC104701996 [Camelina sativa]
Length=674

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 118/220 (54%), Gaps = 49/220 (22%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LIDKSP IGS+AR LSW+D     AT      P + +    EE+ +W  FI+ +L  +G 
Sbjct  502  LIDKSPTIGSIARVLSWEDESYTDAT-----KPAMGI----EEDEDWYGFIKAILIASGF  552

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
                SDSL +RWHSPDSPLDP L+DK  N   KE +   KRR++RS RKLVFDCVN  + 
Sbjct  553  S--GSDSLMARWHSPDSPLDPSLKDKIAN---KELI---KRRKQRSNRKLVFDCVNDIIT  604

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
            +      T+A +G    +  G  ++  + VW  +++W  S                    
Sbjct  605  ETTL---TLASTG----LTKGFDMV--EHVWTELQDWASS--------------------  635

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
              E  GK W +  ++E  ++G EIE  LL+E+V++AV  L
Sbjct  636  -DEFFGKMWSQ--QVEMNNLGAEIEVMLLQELVEEAVFDL  672



>gb|EMS51091.1| hypothetical protein TRIUR3_23853 [Triticum urartu]
Length=996

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 119/223 (53%), Gaps = 15/223 (7%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            +S  I SV R+LS    C DT + S S    ++    E+ E E    +Q +LS AGLD +
Sbjct  763  RSRAIESVPRSLS----CEDTYSHSPSHMHHLNSSNAEDNESECYALVQKILSSAGLDNL  818

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-  532
            Q   + + WHS D PLDP L DK+++  E+     AK R+RRS +KL+FDCVN AL++  
Sbjct  819  QVSMVFTGWHSADCPLDPALCDKFLDRKEE----AAKSRERRSNQKLLFDCVNMALVETG  874

Query  531  -DTCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTER  364
             D   +T  +  A       S  +S D    VW  +++W   A    +++  D   + ER
Sbjct  875  QDALLRTYPWGKA--CFGARSEALSQDLGQEVWSHVRDWLYRAERLAANECGDAAMMLER  932

Query  363  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            +V QE  G GW +  R EA+ + K+I   LL E+V +AV  LA
Sbjct  933  IVHQEVEGGGWVKSTRSEADEMTKQIADGLLVELVGEAVADLA  975



>gb|EAZ23822.1| hypothetical protein OsJ_07535 [Oryza sativa Japonica Group]
Length=931

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 122/224 (54%), Gaps = 23/224 (10%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTAT----SSYSLNPPVSMQRTEEEEREWLFFIQTLLSM  727
            + +S  I +VA +LSWDD+  ++A        S  P V     +++E E    +Q ++S 
Sbjct  716  VSRSSAIEAVACSLSWDDTTSESALPGTRGQSSFLPDV-----DDDESECHVLVQNIMSS  770

Query  726  AGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNA  547
            AGLD+ QS  L + WH PD PLDP+L +K + L           R++ S ++L+FDCVN 
Sbjct  771  AGLDDAQSSMLFTGWHLPDCPLDPILFNKVLEL-----------REQSSYQRLLFDCVNV  819

Query  546  ALIDI--DTCHKTIAFSGAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            AL++I  +T   T  +S AH+ T  D SS      VW  +K+W   A   +     +   
Sbjct  820  ALVEIGENTLLSTFPWSKAHSRTWMDASSPALGIEVWSILKDWIYGARMFVVSRRDNAGI  879

Query  375  LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
            + ER+V+QE  G GW + +R +   I ++IEG + EE+V +AV+
Sbjct  880  MIERVVKQEVEGTGWVKTMRTQLVDITEQIEGGVWEELVGEAVL  923



>ref|XP_009382189.1| PREDICTED: uncharacterized protein LOC103970221 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=899

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 127/229 (55%), Gaps = 20/229 (9%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDT---ATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSM  727
            LI ++ PI SVARTLSWDD+ ++      SS+     V++ + +  +++   F+Q LLS 
Sbjct  678  LISRASPIESVARTLSWDDTRLEMRLPEPSSFK----VALSKADGADQDHFVFVQKLLSY  733

Query  726  AGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNA  547
            AGL+  +SD + + WHSPDSPLDP+L DK + L E     E+K  ++  T +L+FDCVN+
Sbjct  734  AGLE--KSDMMFTGWHSPDSPLDPVLLDKLLGLKED----ESKCMEKTPTLRLLFDCVNS  787

Query  546  ALIDIDTCHKTIAF-----SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDD  382
            AL+++        +     S         SS +S D VWG +++W       +  +    
Sbjct  788  ALLEVSWSTLMSVYPWNRASCGAQINACASSALSED-VWGLVRDWSSGNRTVVFTENDIG  846

Query  381  NNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            + + +R++R EA G  W E  R+  E I KEI   +L+++V +A   LA
Sbjct  847  SLVVDRVLRTEAGGNRWVELNRI-VEEIAKEITSDVLKDLVGEAFSDLA  894



>ref|XP_009382176.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382177.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382178.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382179.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382180.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382181.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382182.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382183.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382184.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382185.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382186.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009382187.1| PREDICTED: uncharacterized protein LOC103970221 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=925

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 127/229 (55%), Gaps = 20/229 (9%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDT---ATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSM  727
            LI ++ PI SVARTLSWDD+ ++      SS+     V++ + +  +++   F+Q LLS 
Sbjct  704  LISRASPIESVARTLSWDDTRLEMRLPEPSSFK----VALSKADGADQDHFVFVQKLLSY  759

Query  726  AGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNA  547
            AGL+  +SD + + WHSPDSPLDP+L DK + L E E+    K  ++  T +L+FDCVN+
Sbjct  760  AGLE--KSDMMFTGWHSPDSPLDPVLLDKLLGLKEDES----KCMEKTPTLRLLFDCVNS  813

Query  546  ALIDIDTCHKTIAF-----SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDD  382
            AL+++        +     S         SS +S D VWG +++W       +  +    
Sbjct  814  ALLEVSWSTLMSVYPWNRASCGAQINACASSALSED-VWGLVRDWSSGNRTVVFTENDIG  872

Query  381  NNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            + + +R++R EA G  W E  R+  E I KEI   +L+++V +A   LA
Sbjct  873  SLVVDRVLRTEAGGNRWVELNRI-VEEIAKEITSDVLKDLVGEAFSDLA  920



>ref|XP_008796409.1| PREDICTED: uncharacterized protein LOC103711875 [Phoenix dactylifera]
Length=879

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 123/222 (55%), Gaps = 14/222 (6%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD  715
            + +SPPI S+AR+LS++ S + T  +   L P   + R EEE+ E    +Q LLS AG  
Sbjct  660  LSRSPPIESIARSLSFNCSKLGTMLAG-PLKPSRLLPRVEEEQ-ERFMLVQKLLSSAGFR  717

Query  714  EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID  535
            + +SD + +RWHS DSPL+ +L DKY  L++KE    AK R  RS ++L+FDCVNAAL+D
Sbjct  718  DEKSDMIFTRWHSLDSPLNTMLLDKY--LDKKEAA--AKCRVWRSNQRLLFDCVNAALLD  773

Query  534  IDTCHKTIAF------SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            I       ++       GA    P G  +    +V   ++ W+      +       + +
Sbjct  774  IGRTAILASYPWAGACRGAWEDGPAGDLV--TQKVCELVRNWYSGEEKSVPGGPGGVSLM  831

Query  372  TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
             +R+V++E  G+ W E + LE     K+I G +LEE+ ++A+
Sbjct  832  VDRVVKREMAGREWAELMWLEIFEFSKDIGGLVLEELFEEAL  873



>ref|XP_009382188.1| PREDICTED: uncharacterized protein LOC103970221 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=918

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 127/229 (55%), Gaps = 20/229 (9%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDT---ATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSM  727
            LI ++ PI SVARTLSWDD+ ++      SS+     V++ + +  +++   F+Q LLS 
Sbjct  697  LISRASPIESVARTLSWDDTRLEMRLPEPSSFK----VALSKADGADQDHFVFVQKLLSY  752

Query  726  AGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNA  547
            AGL+  +SD + + WHSPDSPLDP+L DK + L E E+    K  ++  T +L+FDCVN+
Sbjct  753  AGLE--KSDMMFTGWHSPDSPLDPVLLDKLLGLKEDES----KCMEKTPTLRLLFDCVNS  806

Query  546  ALIDIDTCHKTIAF-----SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDD  382
            AL+++        +     S         SS +S D VWG +++W       +  +    
Sbjct  807  ALLEVSWSTLMSVYPWNRASCGAQINACASSALSED-VWGLVRDWSSGNRTVVFTENDIG  865

Query  381  NNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            + + +R++R EA G  W E  R+  E I KEI   +L+++V +A   LA
Sbjct  866  SLVVDRVLRTEAGGNRWVELNRI-VEEIAKEITSDVLKDLVGEAFSDLA  913



>gb|EAY86700.1| hypothetical protein OsI_08082 [Oryza sativa Indica Group]
Length=931

 Score =   113 bits (282),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 122/225 (54%), Gaps = 25/225 (11%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRT-----EEEEREWLFFIQTLLS  730
            + +S  I +VA +LSWDD      T+S S  P    Q +     +++E E    +Q ++S
Sbjct  716  VSRSSAIEAVACSLSWDD------TTSESTLPGTRGQSSFLPDVDDDESECHVLVQNIMS  769

Query  729  MAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
             AGLD+ QS  L + WH PD PLDP+L +K + L           R++ S ++L+FDCVN
Sbjct  770  SAGLDDAQSSMLFTGWHLPDCPLDPILFNKVLEL-----------REQSSYQRLLFDCVN  818

Query  549  AALIDI--DTCHKTIAFSGAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDN  379
             AL++I  +T   T  +S AH+ T  D SS      VW  +K+W   A   +     +  
Sbjct  819  VALVEIGENTLLSTFPWSKAHSKTWMDASSPALGIEVWSILKDWIYGARMFVVSRRDNAG  878

Query  378  NLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
             + ER+V+QE  G GW + +R +   I ++IEG + EE++ +AV+
Sbjct  879  IMIERVVKQEVEGTGWVKTMRTQLVDITEQIEGGVWEELLGEAVL  923



>dbj|BAK04299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=922

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 111/221 (50%), Gaps = 11/221 (5%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            +SP I SV R LSW+ +   +    + LN        E+ E E    +Q ++S AGL  +
Sbjct  695  RSPAIESVPRLLSWEGTYSHSPLHMHHLNS----SNAEDNESECYALVQKIVSSAGLGNL  750

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  529
            Q   + + WH  D PLDP L DK+++  E+     AK R+RRS +KL+FDCVN AL++  
Sbjct  751  QVSMVFTGWHLADCPLDPALCDKFLDRKEEA----AKSRERRSNQKLLFDCVNMALVETG  806

Query  528  TCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
                   +          S  +S D    VW  +++W   A    +++  D   + ER+V
Sbjct  807  QEALLRTYPWGKACFGARSEALSQDLGEEVWSHVRDWLYGAERFAANEYGDAAMMLERIV  866

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             QE    GW +  R EA+ I K+I   LLE+++ +A   LA
Sbjct  867  HQEVEVGGWMKSARSEADEITKQIADGLLEQLIGEAAADLA  907



>ref|XP_006649387.1| PREDICTED: uncharacterized protein LOC102700033 [Oryza brachyantha]
Length=952

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/250 (33%), Positives = 127/250 (51%), Gaps = 36/250 (14%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P+  E+ + +   P+   +S PIGS+AR LSWDDS  +    S          + +  E+
Sbjct  722  PNSSENAITAKQEPL--SRSLPIGSIARALSWDDSSQEATLCS---------TKGDSHEQ  770

Query  762  EWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            +   FI+ ++S AG    +  ++  RWHS D PL   + D+++    +  V +AK R+RR
Sbjct  771  DQYEFIEKIISSAGFGNEKISNIFVRWHSHDFPLGATVLDQFL----EHKVEDAKCRERR  826

Query  582  STRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIIS-----ADRVWGRIKEWFPS  418
            S ++L+ D VNAAL+DI       A+      + +   + +     AD VW  +K W   
Sbjct  827  SNQRLLIDSVNAALLDIGQSKLWGAYPCTDRHVNNAQRVATGDMLVADEVWRLVKGW---  883

Query  417  AAGCLSDDG--------VDDNNLTER-MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEE  265
                LSDDG        VD+  L    +V +E  G+ W E LRLE + I KEI G++L+E
Sbjct  884  ----LSDDGGDKYMVNVVDNAGLVADWVVSKEIQGRSWPEALRLEVDEISKEICGEVLDE  939

Query  264  IVQDAVVGLA  235
            +V +A   LA
Sbjct  940  LVGEAFSELA  949



>gb|AAO37163.1| hypothetical protein [Arabidopsis thaliana]
Length=713

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 119/221 (54%), Gaps = 49/221 (22%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAG  721
            LIDKSPPIG++AR L+W+D S  DT+  +  +          EE+ +W  FI+TLL+ +G
Sbjct  540  LIDKSPPIGTIARILAWEDESYTDTSKPAMGI----------EEDEDWYGFIKTLLTASG  589

Query  720  LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
                 SDSL +RWHS +SPLDP LRDK+ N   KE +      ++RS RKLVFD VNA +
Sbjct  590  FS--GSDSLMTRWHSLESPLDPSLRDKFAN---KELIKRR---KQRSXRKLVFDXVNAII  641

Query  540  IDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERM  361
             +  +       + AH  +  G +++  + VW  ++EW                      
Sbjct  642  TETTS-------TLAHTGLTKGFNML--EHVWTELQEW---------------------A  671

Query  360  VRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
            V  E  GK W   L++E  ++G EIE  LL+E+V++AV  L
Sbjct  672  VNDEVAGKMWSYGLQVEMNNLGIEIEVILLQELVEEAVFDL  712



>ref|XP_004985732.1| PREDICTED: uncharacterized protein LOC101771093 isoform X2 [Setaria 
italica]
Length=829

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 120/225 (53%), Gaps = 17/225 (8%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD  715
            + +S PIGS+ARTLSWDD+  + +         +   + +  E+E   F++ +L+  G  
Sbjct  614  LSRSLPIGSIARTLSWDDASQEAS---------LCCTKGDSHEQEQYEFVEKILTSVGFC  664

Query  714  EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID  535
              ++  +  RWHS D PLDP++ D+ +    +  V +AK R+RRS ++L+ D VNAAL+D
Sbjct  665  NEKAQDIFVRWHSLDCPLDPVVLDQLL----ERKVEDAKCRERRSNQRLLIDSVNAALLD  720

Query  534  IDTCHKTIAF--SGAHNTIPDGSS--IISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTE  367
            I       A+  +  ++  P  ++  ++  D  W  +K W       ++  G +     +
Sbjct  721  IGQRKLWGAYPCTARYSNAPRVATCDVLVTDEAWRLVKSWLFDDENDIAGLGDNAGLAAD  780

Query  366  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  232
             +V +E  GKGW E LR E + I KEI G +L E+V +A   LAD
Sbjct  781  WVVDKEIHGKGWSEMLRSEVDEISKEICGDVLSELVGEAFSELAD  825



>ref|XP_004985731.1| PREDICTED: uncharacterized protein LOC101771093 isoform X1 [Setaria 
italica]
Length=884

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 120/225 (53%), Gaps = 17/225 (8%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD  715
            + +S PIGS+ARTLSWDD+  + +         +   + +  E+E   F++ +L+  G  
Sbjct  669  LSRSLPIGSIARTLSWDDASQEAS---------LCCTKGDSHEQEQYEFVEKILTSVGFC  719

Query  714  EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID  535
              ++  +  RWHS D PLDP++ D+ +    +  V +AK R+RRS ++L+ D VNAAL+D
Sbjct  720  NEKAQDIFVRWHSLDCPLDPVVLDQLL----ERKVEDAKCRERRSNQRLLIDSVNAALLD  775

Query  534  IDTCHKTIAF--SGAHNTIPDGSS--IISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTE  367
            I       A+  +  ++  P  ++  ++  D  W  +K W       ++  G +     +
Sbjct  776  IGQRKLWGAYPCTARYSNAPRVATCDVLVTDEAWRLVKSWLFDDENDIAGLGDNAGLAAD  835

Query  366  RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  232
             +V +E  GKGW E LR E + I KEI G +L E+V +A   LAD
Sbjct  836  WVVDKEIHGKGWSEMLRSEVDEISKEICGDVLSELVGEAFSELAD  880



>gb|EMT13565.1| hypothetical protein F775_11179 [Aegilops tauschii]
Length=1048

 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 111/220 (50%), Gaps = 11/220 (5%)
 Frame = -2

Query  888   KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
             +S  I SV  +LS +D+   +    + LN        E+ E E    +Q +LS AGLD +
Sbjct  821   RSRAIESVPCSLSCEDTYSHSPLHMHHLNS----SNAEDNESECYALVQKILSSAGLDNL  876

Query  708   QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  529
             Q   + + WHS D PLDP L DK+++  E+     AK R+RRS +KL+FDCVN AL++  
Sbjct  877   QVSMVFTGWHSADCPLDPALCDKFLDRKEE----AAKSRERRSNQKLLFDCVNMALVETG  932

Query  528   TCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
                    +          S  +S D    VW  +++W        +++  D   + ER+V
Sbjct  933   QEALLRTYPWGKACFGARSEALSQDLGEEVWNHVRDWLYGVDRLAANEYGDAAMMLERIV  992

Query  357   RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
              QE  G GW +  R EA+ I K+I   LL E+V +AV  L
Sbjct  993   HQEVEGGGWMKSARSEADEITKQIADGLLVELVGEAVADL  1032



>ref|XP_006647519.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Oryza 
brachyantha]
Length=385

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 119/227 (52%), Gaps = 24/227 (11%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRT-----EEEEREWLFFIQTLLS  730
            + +S  I SVA +LSWDD      T+S S  P    Q +     ++EE E    +Q ++S
Sbjct  172  VSRSSAIDSVACSLSWDD------TTSESPLPRTRGQSSFLPDADDEESECHILVQNIMS  225

Query  729  MAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVN  550
             AGLD+ QS  +   WH PD PLDP+L  K + L           R++ S ++L+FDCVN
Sbjct  226  SAGLDDAQSSMIFIGWHLPDCPLDPVLFSKVLEL-----------REQSSYQRLLFDCVN  274

Query  549  AALIDI--DTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
             +L++I  +T   T  +S AH+    G++      VW  +K+W       + +   +   
Sbjct  275  VSLVEIGENTLLSTFPWSKAHSRTWGGATSALGIEVWSILKDWIYGTRMFVVNRRDNAGI  334

Query  375  LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            + +R+V+QE  G GW + +  +   I ++IE  +L++++ +AV+  A
Sbjct  335  MMDRIVKQEVEGTGWVKMVTTQFVGITEQIEAGVLDDLMGEAVLDFA  381



>ref|XP_004953111.1| PREDICTED: uncharacterized protein LOC101762070 isoform X2 [Setaria 
italica]
Length=913

 Score =   110 bits (274),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 117/225 (52%), Gaps = 20/225 (9%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVS--MQRTEEEEREWLFFIQTLLSMAG  721
            I +S  I +VAR +SWDDS    A+ S  L+ P +  M   +++E E    +Q ++S AG
Sbjct  699  ISRSSAIETVARFISWDDS----ASESRLLSTPRTSLMSDVDDDESECHVLVQNIMSSAG  754

Query  720  LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            L   QS+ + + WH PD PLDP+L +K   L EK            S R+L+FDCVN AL
Sbjct  755  LGSSQSNMVFTGWHLPDYPLDPVLCNKVSELQEKS-----------SYRRLLFDCVNIAL  803

Query  540  IDIDTCHKTIAF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            I+I       AF        T  + SS      VW  +K+W   A   +     +   + 
Sbjct  804  IEIGENALLSAFPWRKRHSRTWRNTSSPDLGVEVWSILKDWIYGARMFVVSRRDNAGIML  863

Query  369  ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            +R+V+QE  G+GW   + L+   I + +EG ++EE+V++AV+  A
Sbjct  864  DRIVKQEVEGRGWVNSMMLQVVGITEHLEGGVMEELVEEAVLDFA  908



>ref|XP_004953110.1| PREDICTED: uncharacterized protein LOC101762070 isoform X1 [Setaria 
italica]
Length=914

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/225 (34%), Positives = 117/225 (52%), Gaps = 20/225 (9%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVS--MQRTEEEEREWLFFIQTLLSMAG  721
            + +S  I +VAR +SWDDS    A+ S  L+ P +  M   +++E E    +Q ++S AG
Sbjct  700  VSRSSAIETVARFISWDDS----ASESRLLSTPRTSLMSDVDDDESECHVLVQNIMSSAG  755

Query  720  LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAAL  541
            L   QS+ + + WH PD PLDP+L +K   L EK            S R+L+FDCVN AL
Sbjct  756  LGSSQSNMVFTGWHLPDYPLDPVLCNKVSELQEKS-----------SYRRLLFDCVNIAL  804

Query  540  IDIDTCHKTIAF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            I+I       AF        T  + SS      VW  +K+W   A   +     +   + 
Sbjct  805  IEIGENALLSAFPWRKRHSRTWRNTSSPDLGVEVWSILKDWIYGARMFVVSRRDNAGIML  864

Query  369  ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            +R+V+QE  G+GW   + L+   I + +EG ++EE+V++AV+  A
Sbjct  865  DRIVKQEVEGRGWVNSMMLQVVGITEHLEGGVMEELVEEAVLDFA  909



>ref|XP_002448137.1| hypothetical protein SORBIDRAFT_06g021940 [Sorghum bicolor]
 gb|EES12465.1| hypothetical protein SORBIDRAFT_06g021940 [Sorghum bicolor]
Length=940

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 124/226 (55%), Gaps = 19/226 (8%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDD-SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDE  712
            +S  I S+ R+LSW+D S         +L P  SM   + +E E + F+Q ++S AGL +
Sbjct  711  RSDAIESITRSLSWEDMSSTSPLLDLTNLTPLSSM---DNDELECVAFVQKIVSSAGLGD  767

Query  711  VQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI  532
            ++   + + W+ PD PLDP L DK ++  E+     AK R+RRS +KL+FD VN AL++I
Sbjct  768  LELGMVFTGWYLPDCPLDPALCDKLLDRKEEA----AKSRERRSNQKLLFDYVNMALVEI  823

Query  531  --DTCHKTIAFSGAHN-----TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
              DT      +  AH+     T+P        + V   +++W         ++  D  ++
Sbjct  824  GHDTLLSAYPWRQAHSMAWKETLPQAL----VEEVPQHMRDWLYGLGKFAVNENDDAGSI  879

Query  372  TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             ER+++QE  G+GW + +R E + I ++I GK+LEE+V++A   L 
Sbjct  880  LERIMQQEVEGRGWVKSMRWELDEIMEQIAGKVLEELVEEATEDLG  925



>ref|XP_009410963.1| PREDICTED: uncharacterized protein LOC103992789 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=932

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 113/213 (53%), Gaps = 14/213 (7%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMA  724
            P  + +SPPI SV R+LS   SC D A S+   N  + M    E E E L F+  L++ A
Sbjct  714  PQALSRSPPIESVVRSLSRSTSCSDAA-SAKPFNSCM-MFSEAEREHEQLVFVHELMASA  771

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            G+D  +S      WHS DSPL+PLL  +Y++++E+E     K R+RRS R+L+FD VNAA
Sbjct  772  GMDSRESVVFGG-WHSIDSPLNPLLLYEYLHVDEEE----GKCRERRSGRRLLFDAVNAA  826

Query  543  LIDIDTCHKTIAF--SGAHNTIPDGSSI--ISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            L+D+       A+  +G  +       +   +AD+VW  ++    S     ++     + 
Sbjct  827  LLDLSQAALRAAYPWNGPRHDARKNDKVGGSAADQVWAFVRNVLSSEKRVPTESA---SA  883

Query  375  LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGK  277
              ER+VR+E  G+ W E   LE     KEI GK
Sbjct  884  AVERLVRKEVAGRQWAESSWLEVCEFSKEIGGK  916



>ref|NP_001047438.1| Os02g0617100 [Oryza sativa Japonica Group]
 dbj|BAD21441.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD21647.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09352.1| Os02g0617100 [Oryza sativa Japonica Group]
Length=164

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 94/167 (56%), Gaps = 14/167 (8%)
 Frame = -2

Query  735  LSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  556
            +S AGLD+ QS  L + WH PD PLDP+L +K + L           R++ S ++L+FDC
Sbjct  1    MSSAGLDDAQSSMLFTGWHLPDCPLDPILFNKVLEL-----------REQSSYQRLLFDC  49

Query  555  VNAALIDI--DTCHKTIAFSGAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVD  385
            VN AL++I  +T   T  +S AH+ T  D SS      VW  +K+W   A   +     +
Sbjct  50   VNVALVEIGENTLLSTFPWSKAHSRTWMDASSPALGIEVWSILKDWIYGARMFVVSRRDN  109

Query  384  DNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
               + ER+V+QE  G GW + +R +   I ++IEG + EE+V +AV+
Sbjct  110  AGIMIERVVKQEVEGTGWVKTMRTQLVDITEQIEGGVWEELVGEAVL  156



>ref|XP_009410914.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410921.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410929.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410937.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410945.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410954.1| PREDICTED: uncharacterized protein LOC103992789 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=938

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 113/213 (53%), Gaps = 14/213 (7%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMA  724
            P  + +SPPI SV R+LS   SC D A S+   N  + M    E E E L F+  L++ A
Sbjct  720  PQALSRSPPIESVVRSLSRSTSCSDAA-SAKPFNSCM-MFSEAEREHEQLVFVHELMASA  777

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            G+D  +S      WHS DSPL+PLL  +Y++++E+E     K R+RRS R+L+FD VNAA
Sbjct  778  GMDSRESVVFGG-WHSIDSPLNPLLLYEYLHVDEEE----GKCRERRSGRRLLFDAVNAA  832

Query  543  LIDIDTCHKTIAF--SGAHNTIPDGSSI--ISADRVWGRIKEWFPSAAGCLSDDGVDDNN  376
            L+D+       A+  +G  +       +   +AD+VW  ++    S     ++     + 
Sbjct  833  LLDLSQAALRAAYPWNGPRHDARKNDKVGGSAADQVWAFVRNVLSSEKRVPTESA---SA  889

Query  375  LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGK  277
              ER+VR+E  G+ W E   LE     KEI GK
Sbjct  890  AVERLVRKEVAGRQWAESSWLEVCEFSKEIGGK  922



>ref|XP_006651030.1| PREDICTED: uncharacterized protein LOC102706550 [Oryza brachyantha]
Length=915

 Score =   108 bits (269),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/243 (33%), Positives = 124/243 (51%), Gaps = 22/243 (9%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P+  E+ + +   P+   +S PIGS+ARTLSWDDS  +    S          + +  E+
Sbjct  685  PNSSENAITAKQEPL--SRSLPIGSIARTLSWDDSSQEATLCS---------AKGDSCEQ  733

Query  762  EWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            +   FI+ ++S AG    +  ++  RWHS D PL   + D+++    +  V +AK R+RR
Sbjct  734  DQYEFIEKIISSAGFGNEKISNIFVRWHSHDFPLGATVLDQFL----ERKVEDAKCRERR  789

Query  582  STRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIIS-----ADRVWGRIKEWFPS  418
            S ++L+ D VNAAL+DI       A+      + +   + +     AD VW  +K W   
Sbjct  790  SNQRLLIDSVNAALLDIGQSKLWGAYPCMERHVNNAQRVATCHMLVADEVWRLVKGWLSD  849

Query  417  AAGCLSDDGVDDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
             AG      V DN   + + +V +E  G+ W E LRLE + I KEI   +L+E+V +A  
Sbjct  850  DAGNKYMVNVVDNAGLVADWVVDKEIQGRSWPEALRLEVDEISKEICRDVLDELVGEAFS  909

Query  243  GLA  235
             LA
Sbjct  910  ELA  912



>ref|XP_008666975.1| PREDICTED: uncharacterized protein LOC100272791 isoform X1 [Zea 
mays]
 ref|XP_008666976.1| PREDICTED: uncharacterized protein LOC100272791 isoform X1 [Zea 
mays]
 ref|XP_008666977.1| PREDICTED: uncharacterized protein LOC100272791 isoform X1 [Zea 
mays]
 tpg|DAA43323.1| TPA: hypothetical protein ZEAMMB73_972996 [Zea mays]
Length=899

 Score =   107 bits (267),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 121/244 (50%), Gaps = 21/244 (9%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P   ES + +   P+   +S PIGS+ARTLSWDD+       S    P  S +     E+
Sbjct  663  PISSESAITAKQEPL--SRSIPIGSIARTLSWDDA-------SQEAPPQCSTKGDSNHEQ  713

Query  762  EWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            E   F++  L+ AG    ++  + +RWHS D PLDP + ++ +    +  V +AK R+RR
Sbjct  714  EQHEFVEKTLASAGFCNEKTQDIFARWHSLDRPLDPAVVEQLL----ERKVEDAKCRERR  769

Query  582  STRKLVFDCVNAALIDIDTCH--------KTIAFSGAHNTIPDGSSIISADRVWGRIKEW  427
            S ++L+ D VNAAL+DI                +S A         ++  D  W  ++ W
Sbjct  770  SNQRLLIDSVNAALLDIGQSKVWGGAYPCTARHYSNAPGVGTCDDDVLVTDEAWRLVRSW  829

Query  426  FPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
                   ++  G +     + +V +E  GKGW E LR+E + + +EI G++L E+V +A 
Sbjct  830  LFDDENDIAGLGDNAGLAADWVVGREIHGKGWAETLRMEVDEMSREICGEVLGELVGEAF  889

Query  246  VGLA  235
              LA
Sbjct  890  SELA  893



>ref|NP_001053260.1| Os04g0506900 [Oryza sativa Japonica Group]
 dbj|BAF15174.1| Os04g0506900 [Oryza sativa Japonica Group]
Length=881

 Score =   107 bits (266),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 123/221 (56%), Gaps = 7/221 (3%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            + P I SVAR+ SW+D+   +       +  V     +++E +    +Q ++S AGL  +
Sbjct  650  RCPAIDSVARSFSWEDTNSGSPLLGGLKHSNVDDADYDDDELKCYSLVQEIVSSAGLCHL  709

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-  532
            Q   + + W+ P+SPLDP L DK+++  E++    AK R+RRS +KL+FDCVN AL++I 
Sbjct  710  QLSMVFTGWYLPESPLDPALCDKFLDRKEED----AKSRERRSHQKLIFDCVNMALVEIG  765

Query  531  -DTCHKTIAFSGA-HNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
             DT   +  +S A   T  +  S    + VW  + +W        ++   +   + ER++
Sbjct  766  QDTLLCSYPWSRACLRTWREKLSETLGEEVWNIVSDWLYGDGSFAANKDDNAGIILERIM  825

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            ++E  GKGW + L +E + I ++I  ++LE+IV D+V  L+
Sbjct  826  QEEVEGKGWIKLLTMETDEITEQIASEVLEDIVTDSVEHLS  866



>ref|NP_001140716.1| uncharacterized protein LOC100272791 [Zea mays]
 gb|ACF84447.1| unknown [Zea mays]
Length=547

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 114/228 (50%), Gaps = 19/228 (8%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD  715
            + +S PIGS+ARTLSWDD+       S    P    +     E+E   F++  L+ AG  
Sbjct  325  LSRSIPIGSIARTLSWDDA-------SQEAPPQCCTKGDNSHEQEQHEFVEKTLASAGFC  377

Query  714  EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID  535
              ++  + +RWHS D PLDP + ++ +    +  V +AK R+RRS ++L+ D VNAAL+D
Sbjct  378  NEKTQDIFARWHSLDRPLDPAVVEQLL----ERKVEDAKCRERRSNQRLLIDSVNAALLD  433

Query  534  IDTCH--------KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDN  379
            I                +S A         ++  D  W  ++ W       ++  G +  
Sbjct  434  IGQSKVWGGAYPCTARHYSNAPGVGTCDDDVLVTDEAWRLVRSWLFDDENDIAGLGDNAG  493

Query  378  NLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
               + +V +E  GKGW E LR+E + + +EI G++L E+V +A   LA
Sbjct  494  LAADWVVGREIHGKGWAETLRMEVDEMSREICGEVLGELVGEAFSELA  541



>ref|XP_008666987.1| PREDICTED: uncharacterized protein LOC100272791 isoform X3 [Zea 
mays]
Length=876

 Score =   107 bits (266),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 121/244 (50%), Gaps = 21/244 (9%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P   ES + +   P+   +S PIGS+ARTLSWDD+       S    P  S +     E+
Sbjct  640  PISSESAITAKQEPL--SRSIPIGSIARTLSWDDA-------SQEAPPQCSTKGDSNHEQ  690

Query  762  EWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            E   F++  L+ AG    ++  + +RWHS D PLDP + ++ +    +  V +AK R+RR
Sbjct  691  EQHEFVEKTLASAGFCNEKTQDIFARWHSLDRPLDPAVVEQLL----ERKVEDAKCRERR  746

Query  582  STRKLVFDCVNAALIDIDTCH--------KTIAFSGAHNTIPDGSSIISADRVWGRIKEW  427
            S ++L+ D VNAAL+DI                +S A         ++  D  W  ++ W
Sbjct  747  SNQRLLIDSVNAALLDIGQSKVWGGAYPCTARHYSNAPGVGTCDDDVLVTDEAWRLVRSW  806

Query  426  FPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
                   ++  G +     + +V +E  GKGW E LR+E + + +EI G++L E+V +A 
Sbjct  807  LFDDENDIAGLGDNAGLAADWVVGREIHGKGWAETLRMEVDEMSREICGEVLGELVGEAF  866

Query  246  VGLA  235
              LA
Sbjct  867  SELA  870



>ref|XP_008666979.1| PREDICTED: uncharacterized protein LOC100272791 isoform X2 [Zea 
mays]
 ref|XP_008666982.1| PREDICTED: uncharacterized protein LOC100272791 isoform X2 [Zea 
mays]
 ref|XP_008666985.1| PREDICTED: uncharacterized protein LOC100272791 isoform X2 [Zea 
mays]
 tpg|DAA43324.1| TPA: hypothetical protein ZEAMMB73_972996 [Zea mays]
 tpg|DAA43325.1| TPA: hypothetical protein ZEAMMB73_972996 [Zea mays]
 tpg|DAA43326.1| TPA: hypothetical protein ZEAMMB73_972996 [Zea mays]
Length=893

 Score =   107 bits (266),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 121/244 (50%), Gaps = 21/244 (9%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P   ES + +   P+   +S PIGS+ARTLSWDD+       S    P  S +     E+
Sbjct  657  PISSESAITAKQEPL--SRSIPIGSIARTLSWDDA-------SQEAPPQCSTKGDSNHEQ  707

Query  762  EWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            E   F++  L+ AG    ++  + +RWHS D PLDP + ++ +    +  V +AK R+RR
Sbjct  708  EQHEFVEKTLASAGFCNEKTQDIFARWHSLDRPLDPAVVEQLL----ERKVEDAKCRERR  763

Query  582  STRKLVFDCVNAALIDIDTCH--------KTIAFSGAHNTIPDGSSIISADRVWGRIKEW  427
            S ++L+ D VNAAL+DI                +S A         ++  D  W  ++ W
Sbjct  764  SNQRLLIDSVNAALLDIGQSKVWGGAYPCTARHYSNAPGVGTCDDDVLVTDEAWRLVRSW  823

Query  426  FPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
                   ++  G +     + +V +E  GKGW E LR+E + + +EI G++L E+V +A 
Sbjct  824  LFDDENDIAGLGDNAGLAADWVVGREIHGKGWAETLRMEVDEMSREICGEVLGELVGEAF  883

Query  246  VGLA  235
              LA
Sbjct  884  SELA  887



>gb|ACN35840.1| unknown [Zea mays]
 tpg|DAA43322.1| TPA: hypothetical protein ZEAMMB73_972996 [Zea mays]
Length=892

 Score =   107 bits (266),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 121/244 (50%), Gaps = 21/244 (9%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P   ES + +   P+   +S PIGS+ARTLSWDD+       S    P  S +     E+
Sbjct  656  PISSESAITAKQEPL--SRSIPIGSIARTLSWDDA-------SQEAPPQCSTKGDSNHEQ  706

Query  762  EWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            E   F++  L+ AG    ++  + +RWHS D PLDP + ++ +    +  V +AK R+RR
Sbjct  707  EQHEFVEKTLASAGFCNEKTQDIFARWHSLDRPLDPAVVEQLL----ERKVEDAKCRERR  762

Query  582  STRKLVFDCVNAALIDIDTCH--------KTIAFSGAHNTIPDGSSIISADRVWGRIKEW  427
            S ++L+ D VNAAL+DI                +S A         ++  D  W  ++ W
Sbjct  763  SNQRLLIDSVNAALLDIGQSKVWGGAYPCTARHYSNAPGVGTCDDDVLVTDEAWRLVRSW  822

Query  426  FPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
                   ++  G +     + +V +E  GKGW E LR+E + + +EI G++L E+V +A 
Sbjct  823  LFDDENDIAGLGDNAGLAADWVVGREIHGKGWAETLRMEVDEMSREICGEVLGELVGEAF  882

Query  246  VGLA  235
              LA
Sbjct  883  SELA  886



>emb|CAE04715.1| OSJNBa0043L24.3 [Oryza sativa Japonica Group]
 emb|CAE05684.1| OSJNBb0002J11.11 [Oryza sativa Japonica Group]
Length=875

 Score =   107 bits (266),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 123/221 (56%), Gaps = 7/221 (3%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            + P I SVAR+ SW+D+   +       +  V     +++E +    +Q ++S AGL  +
Sbjct  644  RCPAIDSVARSFSWEDTNSGSPLLGGLKHSNVDDADYDDDELKCYSLVQEIVSSAGLCHL  703

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-  532
            Q   + + W+ P+SPLDP L DK+++  E++    AK R+RRS +KL+FDCVN AL++I 
Sbjct  704  QLSMVFTGWYLPESPLDPALCDKFLDRKEED----AKSRERRSHQKLIFDCVNMALVEIG  759

Query  531  -DTCHKTIAFSGA-HNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
             DT   +  +S A   T  +  S    + VW  + +W        ++   +   + ER++
Sbjct  760  QDTLLCSYPWSRACLRTWREKLSETLGEEVWNIVSDWLYGDGSFAANKDDNAGIILERIM  819

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            ++E  GKGW + L +E + I ++I  ++LE+IV D+V  L+
Sbjct  820  QEEVEGKGWIKLLTMETDEITEQIASEVLEDIVTDSVEHLS  860



>gb|EMS67579.1| hypothetical protein TRIUR3_06787 [Triticum urartu]
Length=1015

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 114/223 (51%), Gaps = 18/223 (8%)
 Frame = -2

Query  894   IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD  715
             + +S  I +VA +LSWDD    T + S  L  P      +++E E    +Q ++S +GL+
Sbjct  807   VSRSSAIEAVACSLSWDD----TTSESPLLRRPYLPSDVDDDESECHVLVQNIMSSSGLE  862

Query  714   EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID  535
             + QS  + + WH PD PLDP+L +K + L           R++RS ++L+FDCVN ALI+
Sbjct  863   DAQSSIVFAGWHLPDCPLDPVLCNKLLEL-----------REQRSYKRLLFDCVNVALIE  911

Query  534   IDTCHKTIAF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTER  364
             I       AF        T  D SS      VW  +K+W   A   +     +   + +R
Sbjct  912   IGENALLSAFPWSKARTGTWRDSSSPALGVEVWSILKDWIYGARMFMVSKRDNTGIMMDR  971

Query  363   MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             +V+QE  G GW +    +   I ++IE  +LEE+V +AV+  A
Sbjct  972   IVKQEVEGSGWVKMRMSQVVDIAEQIEWGVLEELVAEAVLDFA  1014



>emb|CAH67333.1| OSIGBa0157A06.2 [Oryza sativa Indica Group]
Length=938

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 123/221 (56%), Gaps = 7/221 (3%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            + P I SVAR+ SW+D+   +       +  V     +++E +    +Q ++S AGL  +
Sbjct  707  RCPAIDSVARSFSWEDTNSGSPLLGGLKHSNVDDADYDDDELKCYSLVQEIVSSAGLCHL  766

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-  532
            Q   + + W+ P+SPLDP L DK+++  E++    AK R+RRS +KL+FDCVN AL++I 
Sbjct  767  QLSMVFTGWYLPESPLDPALCDKFLDRKEED----AKSRERRSHQKLIFDCVNMALVEIG  822

Query  531  -DTCHKTIAFSGA-HNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
             DT   +  +S A   T  +  S    + VW  + +W        ++   +   + ER++
Sbjct  823  QDTLLCSYPWSRACLRTWREKLSETLGEEVWNIVSDWLYGDGSFAANKDDNAGIILERIM  882

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            ++E  GKGW + L +E + I ++I  ++LE+IV D+V  L+
Sbjct  883  QEEVEGKGWIKLLTMETDEITEQIASEVLEDIVTDSVEHLS  923



>gb|EEC77598.1| hypothetical protein OsI_16564 [Oryza sativa Indica Group]
Length=939

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 123/221 (56%), Gaps = 7/221 (3%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            + P I SVAR+ SW+D+   +       +  V     +++E +    +Q ++S AGL  +
Sbjct  708  RCPAIDSVARSFSWEDTNSGSPLLGGLKHSNVDDADYDDDELKCYSLVQEIVSSAGLCHL  767

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-  532
            Q   + + W+ P+SPLDP L DK+++  E++    AK R+RRS +KL+FDCVN AL++I 
Sbjct  768  QLSMVFTGWYLPESPLDPALCDKFLDRKEED----AKSRERRSHQKLIFDCVNMALVEIG  823

Query  531  -DTCHKTIAFSGA-HNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
             DT   +  +S A   T  +  S    + VW  + +W        ++   +   + ER++
Sbjct  824  QDTLLCSYPWSRACLRTWREKLSETLGEEVWNIVSDWLYGDGSFAANKDDNAGIILERIM  883

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            ++E  GKGW + L +E + I ++I  ++LE+IV D+V  L+
Sbjct  884  QEEVEGKGWIKLLTMETDEITEQIASEVLEDIVTDSVEHLS  924



>gb|EEE61300.1| hypothetical protein OsJ_15391 [Oryza sativa Japonica Group]
Length=939

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 123/221 (56%), Gaps = 7/221 (3%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            + P I SVAR+ SW+D+   +       +  V     +++E +    +Q ++S AGL  +
Sbjct  708  RCPAIDSVARSFSWEDTNSGSPLLGGLKHSNVDDADYDDDELKCYSLVQEIVSSAGLCHL  767

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-  532
            Q   + + W+ P+SPLDP L DK+++  E++    AK R+RRS +KL+FDCVN AL++I 
Sbjct  768  QLSMVFTGWYLPESPLDPALCDKFLDRKEED----AKSRERRSHQKLIFDCVNMALVEIG  823

Query  531  -DTCHKTIAFSGA-HNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
             DT   +  +S A   T  +  S    + VW  + +W        ++   +   + ER++
Sbjct  824  QDTLLCSYPWSRACLRTWREKLSETLGEEVWNIVSDWLYGDGSFAANKDDNAGIILERIM  883

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            ++E  GKGW + L +E + I ++I  ++LE+IV D+V  L+
Sbjct  884  QEEVEGKGWIKLLTMETDEITEQIASEVLEDIVTDSVEHLS  924



>ref|NP_001048940.1| Os03g0143700 [Oryza sativa Japonica Group]
 gb|ABF93931.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10854.1| Os03g0143700 [Oryza sativa Japonica Group]
 gb|EEE62228.1| hypothetical protein OsJ_17015 [Oryza sativa Japonica Group]
Length=901

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/242 (31%), Positives = 121/242 (50%), Gaps = 22/242 (9%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P+  E  + +   P+   +S PIGS+ARTLSWDDS  +    S          + +  E+
Sbjct  671  PNSSEHAIIAKQEPL--SRSLPIGSIARTLSWDDSSQEATLCS---------AKGDSHEQ  719

Query  762  EWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            +   F++ +LS  G D  ++  +  RWHS D PL   + D+++    +  V +AK R+RR
Sbjct  720  DQHEFVEKILSSVGFDNEKTSDIFVRWHSHDFPLGTGVLDQFL----ERKVEDAKCRERR  775

Query  582  STRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDG-----SSIISADRVWGRIKEWFPS  418
            S ++L+ D VNAAL+DI       A+      + +        ++  D VW  +K W   
Sbjct  776  SNQRLLIDSVNAALLDIGQSKLWGAYPCTDPQVNNARRVATGEVLVVDEVWRLVKGWLSD  835

Query  417  AAGCLSDDGVDDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
              G       +DN   + + +V +E  G+ W E LRLE + I  EI G++L+E+V +A  
Sbjct  836  DDGEKHMVNAEDNAGLVADWVVGKEIQGRSWPEALRLEVDEISTEICGEVLDELVGEAFS  895

Query  243  GL  238
             L
Sbjct  896  EL  897



>ref|XP_010240106.1| PREDICTED: uncharacterized protein LOC100830890 isoform X3 [Brachypodium 
distachyon]
Length=898

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 113/221 (51%), Gaps = 11/221 (5%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            +SP I SVAR+L W+D    T + S  L         +++E E   F++ +LS +GLD +
Sbjct  671  RSPAIESVARSLPWED----TNSRSALLGSLNFSNADDDDELECHAFVEKILSSSGLDNL  726

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  529
            Q   + + W+ PD PLDP L    ++ NE+     AK R+ RS RKL+FDCVN AL++  
Sbjct  727  QLTMVFTGWYLPDCPLDPELCHMLLDHNEEA----AKSRECRSNRKLLFDCVNMALVEAG  782

Query  528  TCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
                   +  +   +      +S D    VW  +K W   A   +++   D   + ER+V
Sbjct  783  QDALLSTYPWSKTCLGAWKEKLSQDLREEVWSHVKGWLYGAEMLVANKDGDTARMLERVV  842

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            +QE  G GW +  R   + + K I   LLE++V +AV  LA
Sbjct  843  QQEVEGGGWMKSGRSGVDEVAKLIASCLLEDLVGEAVADLA  883



>ref|XP_010240102.1| PREDICTED: uncharacterized protein LOC100830890 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010240103.1| PREDICTED: uncharacterized protein LOC100830890 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010240104.1| PREDICTED: uncharacterized protein LOC100830890 isoform X1 [Brachypodium 
distachyon]
Length=915

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 113/221 (51%), Gaps = 11/221 (5%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            +SP I SVAR+L W+D    T + S  L         +++E E   F++ +LS +GLD +
Sbjct  688  RSPAIESVARSLPWED----TNSRSALLGSLNFSNADDDDELECHAFVEKILSSSGLDNL  743

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  529
            Q   + + W+ PD PLDP L    ++ NE+     AK R+ RS RKL+FDCVN AL++  
Sbjct  744  QLTMVFTGWYLPDCPLDPELCHMLLDHNEEA----AKSRECRSNRKLLFDCVNMALVEAG  799

Query  528  TCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
                   +  +   +      +S D    VW  +K W   A   +++   D   + ER+V
Sbjct  800  QDALLSTYPWSKTCLGAWKEKLSQDLREEVWSHVKGWLYGAEMLVANKDGDTARMLERVV  859

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            +QE  G GW +  R   + + K I   LLE++V +AV  LA
Sbjct  860  QQEVEGGGWMKSGRSGVDEVAKLIASCLLEDLVGEAVADLA  900



>ref|XP_010240105.1| PREDICTED: uncharacterized protein LOC100830890 isoform X2 [Brachypodium 
distachyon]
Length=914

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 113/221 (51%), Gaps = 11/221 (5%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            +SP I SVAR+L W+D    T + S  L         +++E E   F++ +LS +GLD +
Sbjct  687  RSPAIESVARSLPWED----TNSRSALLGSLNFSNADDDDELECHAFVEKILSSSGLDNL  742

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  529
            Q   + + W+ PD PLDP L    ++ NE+     AK R+ RS RKL+FDCVN AL++  
Sbjct  743  QLTMVFTGWYLPDCPLDPELCHMLLDHNEEA----AKSRECRSNRKLLFDCVNMALVEAG  798

Query  528  TCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
                   +  +   +      +S D    VW  +K W   A   +++   D   + ER+V
Sbjct  799  QDALLSTYPWSKTCLGAWKEKLSQDLREEVWSHVKGWLYGAEMLVANKDGDTARMLERVV  858

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
            +QE  G GW +  R   + + K I   LLE++V +AV  LA
Sbjct  859  QQEVEGGGWMKSGRSGVDEVAKLIASCLLEDLVGEAVADLA  899



>ref|XP_002454174.1| hypothetical protein SORBIDRAFT_04g026030 [Sorghum bicolor]
 gb|EES07150.1| hypothetical protein SORBIDRAFT_04g026030 [Sorghum bicolor]
Length=919

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/222 (34%), Positives = 118/222 (53%), Gaps = 23/222 (10%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVS--MQRTEEEEREWLFFIQTLLSMAGLD  715
            +S  I +V R LSWDD+   T+ S    NP +S  +   +++E E    +Q ++S AGL 
Sbjct  701  RSSTIETVTRFLSWDDT---TSESQSPCNPRLSSRLPDVDDDESECHVLVQNIMSSAGLG  757

Query  714  EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID  535
              QS  + + WH PD PLDP+L +K   L EK            S R+L+FDCVN ALI+
Sbjct  758  TSQSCMVFTGWHLPDHPLDPVLCNKLSELQEKS-----------SYRRLLFDCVNVALIE  806

Query  534  I--DTCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNLT  370
            I  +T      +S  H+    G+S  S D    VW  +K+W   A   +     +   + 
Sbjct  807  IGENTLLSAFPWSKRHSRTWRGTS--SPDLGVEVWSILKDWIYGARMFVVSKRDNAGIIL  864

Query  369  ERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
            +R+V+QE   +GW + +  +   I +E+EG ++EE+V++AV+
Sbjct  865  DRIVKQEVEARGWVKLMMAQVVDITEELEGGVMEELVEEAVL  906



>ref|XP_009418765.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418843.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418912.1| PREDICTED: uncharacterized protein LOC103998847 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=922

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 83/228 (36%), Positives = 127/228 (56%), Gaps = 19/228 (8%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMA  724
            P  + +SPPIGSVAR+LSW  S +D  TS+ +L P V   + +EE  +++F +  L+S  
Sbjct  707  PQALSRSPPIGSVARSLSWSSSYLDI-TSATTLKPSVKFSKADEEHEQFVF-VNKLISSV  764

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            G+D+ +S ++   WHS DSPL+P L  + + + ++E     K R+R+S  +L+FD VNAA
Sbjct  765  GMDDNKS-TIFGGWHSLDSPLNPSLLYESLQIEDEED----KCRERQSHWRLLFDFVNAA  819

Query  543  LIDIDTCHKTIAF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            L+DI       A    +  H    D ++  S   VW  ++         LS D    N  
Sbjct  820  LLDISQSILLTACPWKTACHGPRRDDTAGTSVAEVWSLVR-------NTLSGDTKSGNGG  872

Query  372  TE--RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             E  R+V++E  G+ W E   LE   + KEI  K+LEE+V++AV GL+
Sbjct  873  IEVDRLVKEEVGGRQWTESRWLEGYELSKEISEKVLEELVEEAVSGLS  920



>ref|XP_009418989.1| PREDICTED: uncharacterized protein LOC103998847 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=900

 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 83/228 (36%), Positives = 127/228 (56%), Gaps = 19/228 (8%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMA  724
            P  + +SPPIGSVAR+LSW  S +D  TS+ +L P V   + +EE  +++F +  L+S  
Sbjct  685  PQALSRSPPIGSVARSLSWSSSYLDI-TSATTLKPSVKFSKADEEHEQFVF-VNKLISSV  742

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            G+D+ +S ++   WHS DSPL+P L  + + + ++E     K R+R+S  +L+FD VNAA
Sbjct  743  GMDDNKS-TIFGGWHSLDSPLNPSLLYESLQIEDEED----KCRERQSHWRLLFDFVNAA  797

Query  543  LIDIDTCHKTIAF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            L+DI       A    +  H    D ++  S   VW  ++         LS D    N  
Sbjct  798  LLDISQSILLTACPWKTACHGPRRDDTAGTSVAEVWSLVR-------NTLSGDTKSGNGG  850

Query  372  TE--RMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
             E  R+V++E  G+ W E   LE   + KEI  K+LEE+V++AV GL+
Sbjct  851  IEVDRLVKEEVGGRQWTESRWLEGYELSKEISEKVLEELVEEAVSGLS  898



>gb|EAY88501.1| hypothetical protein OsI_09972 [Oryza sativa Indica Group]
Length=883

 Score =   104 bits (259),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 121/242 (50%), Gaps = 22/242 (9%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P+  E  + +   P+   +S PIGS+ARTLSWDDS  +    S          + +  E+
Sbjct  653  PNSSEHAIIAKQEPL--SRSLPIGSIARTLSWDDSSQEATLCS---------AKGDSHEQ  701

Query  762  EWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            +   F++ +LS  G +  ++  +  RWHS D PL   + D+++    +  V +AK R+RR
Sbjct  702  DQHEFVEKILSSVGFNNEKTSDIFVRWHSHDFPLGTGVLDQFL----ERKVEDAKCRERR  757

Query  582  STRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDG-----SSIISADRVWGRIKEWFPS  418
            S ++L+ D VNAAL+DI       A+      + +        ++  D VW  +K W   
Sbjct  758  SNQRLLIDSVNAALLDIGQSKLWGAYPCTDPQVNNARRVATGEVLVVDEVWRLVKGWLSD  817

Query  417  AAGCLSDDGVDDNN--LTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
              G       +DN   + + +V +E  G+ W E LRLE + I  EI G++L+E+V +A  
Sbjct  818  DDGEKHMVNAEDNAGLVADWVVGKEIQGRSWPEALRLEVDEISTEICGEVLDELVGEAFS  877

Query  243  GL  238
             L
Sbjct  878  EL  879



>tpg|DAA37015.1| TPA: hypothetical protein ZEAMMB73_770868 [Zea mays]
Length=214

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 109/197 (55%), Gaps = 10/197 (5%)
 Frame = -2

Query  816  SYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKY  637
            S +L P   +   +++E E + F+Q ++S AGL +++ D + + W+ PD P+DP L DK 
Sbjct  10   STNLTP---ISSVDDDELECVAFVQKIVSSAGLGDLRLDMVFTGWYLPDCPVDPALCDKL  66

Query  636  INLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDIDTCHKTIAF---SGAHNTIPDGSSI  466
            ++  E+     AK R+RRS +KL+FD VN A+++I       A+           +  S 
Sbjct  67   LDRKEEA----AKSRERRSNQKLLFDYVNMAVVEIGHDTLLCAYPWRQACSMAWEETLSQ  122

Query  465  ISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEI  286
              A+ V   +++W   +     ++  +   L ER++RQE  G+GW + +R E + I ++I
Sbjct  123  ALAEEVPHHMRDWLHGSGKFAGNENDNAGTLLERVMRQEVEGRGWVKSMRWELDEITEQI  182

Query  285  EGKLLEEIVQDAVVGLA  235
             G +L+EIV +A+ GL 
Sbjct  183  AGNVLDEIVVEALDGLG  199



>gb|EMT10669.1| hypothetical protein F775_15662 [Aegilops tauschii]
Length=886

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 113/220 (51%), Gaps = 18/220 (8%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD  715
            + +S  I +VA +LSWDD    T + S SL  P      +++E E    +Q ++S + L+
Sbjct  678  VSRSSAIEAVACSLSWDD----TTSESPSLRRPYLPSDIDDDESECHVLVQNIMSSSRLE  733

Query  714  EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID  535
            + QS  + + WH PD PLDP+L +K + L           R++RS ++L+FDCVN ALI+
Sbjct  734  DAQSSMVFAGWHLPDCPLDPVLCNKLLEL-----------REQRSYKRLLFDCVNVALIE  782

Query  534  IDTCHKTIAF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTER  364
            I       AF        T  D SS      VW  +K+W   A   +     +   + +R
Sbjct  783  IGENALLSAFPWSKACTGTWRDSSSPALGVEVWSILKDWIYGARMFMVSKRDNTGIMMDR  842

Query  363  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
            +V+QE  G GW +    +   I ++IE  +LEE+V ++V+
Sbjct  843  IVKQEVEGGGWVKMRMSQVVDIMEQIEKGVLEELVAESVL  882



>gb|AFW72333.1| hypothetical protein ZEAMMB73_984204 [Zea mays]
Length=918

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 120/225 (53%), Gaps = 25/225 (11%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSL-NPPVS--MQRTEEEEREWLFFIQTLLSMA  724
            I +S  I +VAR LS DD    TA+ S SL NP  S  +   +++E E    +Q ++S A
Sbjct  698  ISRSSAIETVARFLSLDD----TASESQSLCNPRPSSLLPDADDDESECHVLVQNIMSSA  753

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            GL   QS  + + WH PD PLDP+LR+K   L EK            S R+L+FDCVN A
Sbjct  754  GLGTSQSRMVFAGWHLPDHPLDPVLRNKVSQLQEKS-----------SYRRLLFDCVNVA  802

Query  543  LIDI--DTCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDN  379
            LI+I  +     + +S   +    G+S  S D    VW  +K+W   A   +     +  
Sbjct  803  LIEIGENALLSALPWSKRSSRTWRGTS--SPDLGVEVWSILKDWIHGARMFVVSKRDNAG  860

Query  378  NLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
             + +R+V+QE   +GW + +  +   I +E+EG ++EE+V++AV+
Sbjct  861  IILDRIVKQEVEARGWVKLMMAQVVVITEELEGGVMEELVEEAVL  905



>ref|XP_008643431.1| PREDICTED: uncharacterized protein LOC100278954 isoform X1 [Zea 
mays]
Length=885

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 115/223 (52%), Gaps = 21/223 (9%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSL-NPPVS--MQRTEEEEREWLFFIQTLLSMA  724
            I +S  I +VAR LS DD    TA+ S SL NP  S  +   +++E E    +Q ++S A
Sbjct  665  ISRSSAIETVARFLSLDD----TASESQSLCNPRPSSLLPDADDDESECHVLVQNIMSSA  720

Query  723  GLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAA  544
            GL   QS  + + WH PD PLDP+LR+K   L EK            S R+L+FDCVN A
Sbjct  721  GLGTSQSRMVFAGWHLPDHPLDPVLRNKVSQLQEKS-----------SYRRLLFDCVNVA  769

Query  543  LIDIDTCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDGVDDNNL  373
            LI+I       A   +  +        S D    VW  +K+W   A   +     +   +
Sbjct  770  LIEIGENALLSALPWSKRSSRTWRGTSSPDLGVEVWSILKDWIHGARMFVVSKRDNAGII  829

Query  372  TERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
             +R+V+QE   +GW + +  +   I +E+EG ++EE+V++AV+
Sbjct  830  LDRIVKQEVEARGWVKLMMAQVVVITEELEGGVMEELVEEAVL  872



>ref|XP_010911761.1| PREDICTED: uncharacterized protein LOC105037843 [Elaeis guineensis]
Length=157

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 92/154 (60%), Gaps = 8/154 (5%)
 Frame = -2

Query  696  LSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI--DTC  523
            + +RWHS +SPL+P+L DKY++  E+E    AK R+RRS ++L FDCVNAAL+++     
Sbjct  2    IFTRWHSLESPLNPMLLDKYLDRKEEE----AKCRERRSNQRLPFDCVNAALLNVGQSAI  57

Query  522  HKTIAFSGA-HNTIPDGSSIISA-DRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQE  349
              +  ++GA      DG++  S  + V   ++ W+         +    N + +R+V++E
Sbjct  58   LASYPWAGACSGAWMDGTACASVTEEVCELVRNWYSGEEKSPPSEPRSINPVVDRVVKRE  117

Query  348  AVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
              G+GW E++ LE     +E+ G +LEE+V++A+
Sbjct  118  IAGRGWAEFMWLEMYEFSQEVGGLVLEELVEEAL  151



>ref|XP_006652489.1| PREDICTED: uncharacterized protein LOC102722484 isoform X1 [Oryza 
brachyantha]
Length=980

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 115/217 (53%), Gaps = 12/217 (6%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            +SP I S AR+LSW+D+      S  SL   +     + +E +    +Q ++S AGL  +
Sbjct  751  QSPAIESFARSLSWEDT-----NSCSSLLGCLKHSNDDYDELQCYSLVQEIVSSAGLGHL  805

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  529
            Q   + + W+ PDSP+DP L DK+++  E+     AK R+RRS +KL+FD V+ AL++I 
Sbjct  806  QLSIVFTGWYLPDSPIDPALCDKFLDRKEE----NAKSRERRSNQKLIFDSVSTALVEIG  861

Query  528  TCHKTIAFSGAHNTIPDGSSIIS---ADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
                   +  +   +      +S    + VW  + +W       +++   D     ER++
Sbjct  862  QDALLCTYPWSRECLGTWREKLSRTLGEEVWNIVSDWLYGDGSFVANMEDDAGTTLERIM  921

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
            ++E  GKGW + L ++ + I ++I  ++L+++V D V
Sbjct  922  QEEVEGKGWIKLLTMDTDEITEQIACEVLDDLVTDTV  958



>ref|XP_006652490.1| PREDICTED: uncharacterized protein LOC102722484 isoform X2 [Oryza 
brachyantha]
Length=979

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 115/217 (53%), Gaps = 12/217 (6%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            +SP I S AR+LSW+D+      S  SL   +     + +E +    +Q ++S AGL  +
Sbjct  750  QSPAIESFARSLSWEDT-----NSCSSLLGCLKHSNDDYDELQCYSLVQEIVSSAGLGHL  804

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDID  529
            Q   + + W+ PDSP+DP L DK+++  E+     AK R+RRS +KL+FD V+ AL++I 
Sbjct  805  QLSIVFTGWYLPDSPIDPALCDKFLDRKEE----NAKSRERRSNQKLIFDSVSTALVEIG  860

Query  528  TCHKTIAFSGAHNTIPDGSSIIS---ADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
                   +  +   +      +S    + VW  + +W       +++   D     ER++
Sbjct  861  QDALLCTYPWSRECLGTWREKLSRTLGEEVWNIVSDWLYGDGSFVANMEDDAGTTLERIM  920

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
            ++E  GKGW + L ++ + I ++I  ++L+++V D V
Sbjct  921  QEEVEGKGWIKLLTMDTDEITEQIACEVLDDLVTDTV  957



>ref|XP_009407163.1| PREDICTED: uncharacterized protein LOC103989929 [Musa acuminata 
subsp. malaccensis]
Length=943

 Score = 97.8 bits (242),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 77/235 (33%), Positives = 126/235 (54%), Gaps = 23/235 (10%)
 Frame = -2

Query  903  PILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMA  724
            P  + +SPPI SVAR+LS  DS +D   S+  L   + + + +EE  +++F +  L+S A
Sbjct  720  PQALFRSPPIESVARSLSRGDSYLDI-RSTKPLRSSMIISKVDEEHEQFVF-VHKLISSA  777

Query  723  GLDEVQSDSLSSRWHSPDSPLDP-LLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNA  547
             + + +S   S  WHS DSPL+P LL D +   +E     E K  +R+++R+L+FD VNA
Sbjct  778  QMKKNKSMKFSG-WHSLDSPLNPSLLYDSWHTDDE-----EGKHGKRQTSRRLLFDAVNA  831

Query  546  ALIDIDTCHKTIAFSGAHNTIP-------DGSSIISADRVWGRIKEWFPSAAGCLSDD--  394
            AL+DI    ++  F+    T P       D     +AD VW  I+ W  S   C+ ++  
Sbjct  832  ALLDIS---QSALFAAYPWTKPCCGPPKDDTVGTSAADEVWAIIRNWL-SGEKCVPNEST  887

Query  393  -GVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  232
                 + + + +V +E  G+ W E    E     KE+ GK+L+E++++A+  L D
Sbjct  888  SSSSSSRMVDGLVMKEVGGRQWTESRWSELCEFSKEMGGKVLDELIEEALAVLFD  942



>ref|XP_006279983.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
 gb|EOA12881.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
Length=893

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 115/221 (52%), Gaps = 45/221 (20%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LI KSPPIGS+ RT S+DDS V    SS       S   T +EE +    I TLLS A L
Sbjct  677  LIGKSPPIGSIGRTFSFDDSTVARCLSSKR-----STTSTRDEEEDLRLLINTLLSAADL  731

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            D + SD L S+WHS +SPLDP LR+ Y +  E++       R   + +KLVFD VN  L+
Sbjct  732  DAI-SDDLLSKWHSVESPLDPSLRNSYADSTEQQ-------RLGSNMKKLVFDLVNTLLL  783

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV------  388
            ++     T +F G     P    IIS    RV+   R++E       CL+ +G       
Sbjct  784  EL-----TPSFLG-----PRSPLIISGKSLRVYVINRMQE-------CLTGNGRVEDRWW  826

Query  387  -DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
             +D +L+     ++VR E    G  E LRLE +S+G+E+E 
Sbjct  827  DEDGDLSSLAVNKVVRVEVAELGSPECLRLEMDSMGEELEL  867



>ref|XP_006279984.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
 gb|EOA12882.1| hypothetical protein CARUB_v10025855mg [Capsella rubella]
Length=838

 Score = 95.1 bits (235),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 115/221 (52%), Gaps = 45/221 (20%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            LI KSPPIGS+ RT S+DDS V    SS       S   T +EE +    I TLLS A L
Sbjct  622  LIGKSPPIGSIGRTFSFDDSTVARCLSSKR-----STTSTRDEEEDLRLLINTLLSAADL  676

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            D + SD L S+WHS +SPLDP LR+ Y +  E++       R   + +KLVFD VN  L+
Sbjct  677  DAI-SDDLLSKWHSVESPLDPSLRNSYADSTEQQ-------RLGSNMKKLVFDLVNTLLL  728

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV------  388
            ++     T +F G     P    IIS    RV+   R++E       CL+ +G       
Sbjct  729  EL-----TPSFLG-----PRSPLIISGKSLRVYVINRMQE-------CLTGNGRVEDRWW  771

Query  387  -DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
             +D +L+     ++VR E    G  E LRLE +S+G+E+E 
Sbjct  772  DEDGDLSSLAVNKVVRVEVAELGSPECLRLEMDSMGEELEL  812



>ref|XP_003558830.1| PREDICTED: uncharacterized protein LOC100833211 [Brachypodium 
distachyon]
Length=885

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 79/248 (32%), Positives = 122/248 (49%), Gaps = 38/248 (15%)
 Frame = -2

Query  942  PSWGESCLFSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEER  763
            P   ES + +   P+   +  PIGSVARTLS+DDS  +    S          + +  E+
Sbjct  661  PGSSESAITAKQEPL--SRCLPIGSVARTLSFDDSSEEAVPCS---------SKEDCHEQ  709

Query  762  EWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            E   F++ +L  AG    Q++ +  +WHS D PL P + D+++    ++        +RR
Sbjct  710  EQYEFVEKILFSAGFCNKQTNDIFVQWHSLDCPLGPDVVDQFLERKVED--------ERR  761

Query  582  STRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAA---  412
            S ++L+ D VNAAL+DI       A+       P    I++A RV  R  E     A   
Sbjct  762  SNQRLLIDSVNAALLDIGQSRLWCAY-------PCTWPIVNARRVASRDDELVADEAWKL  814

Query  411  --GCLSDD------GVDDNNLTER-MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIV  259
              G L DD      G+D+  +    +V +E  G+GW + LRLE + I KEI G++L E+V
Sbjct  815  VKGWLLDDEAHMVNGLDNVGVAADWVVGREIEGRGWPKTLRLEVDEISKEICGEVLSELV  874

Query  258  QDAVVGLA  235
            ++A    A
Sbjct  875  EEAFSEFA  882



>ref|NP_001145529.1| uncharacterized protein LOC100278954 [Zea mays]
 gb|ACG48238.1| hypothetical protein [Zea mays]
Length=169

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 90/169 (53%), Gaps = 18/169 (11%)
 Frame = -2

Query  735  LSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDC  556
            +S AGL   QS  + + WH PD PLDP+LR+K   L EK            S R+L+FDC
Sbjct  1    MSSAGLGTSQSRMVFAGWHLPDHPLDPVLRNKVSQLQEKS-----------SYRRLLFDC  49

Query  555  VNAALIDI--DTCHKTIAFSGAHNTIPDGSSIISAD---RVWGRIKEWFPSAAGCLSDDG  391
            VN ALI+I  +     + +S   +    G+S  S D    VW  +K+W   A   +    
Sbjct  50   VNVALIEIGENALLSALPWSKRSSRTWRGTS--SPDLGVEVWSILKDWIHGARMFVVSKR  107

Query  390  VDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
             +   + +R+V+QE   +GW + +  +   I +E+EG ++EE+V++AV+
Sbjct  108  DNAGIILDRIVKQEVEARGWVKLMMAQVVVITEELEGGVMEELVEEAVL  156



>ref|XP_004976162.1| PREDICTED: uncharacterized protein LOC101760628 isoform X1 [Setaria 
italica]
 ref|XP_004976163.1| PREDICTED: uncharacterized protein LOC101760628 isoform X2 [Setaria 
italica]
Length=946

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 111/206 (54%), Gaps = 9/206 (4%)
 Frame = -2

Query  888  KSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEV  709
            +S  I SV R+LSW+D  + + +    +     +   + +E E + F+Q ++S +GL ++
Sbjct  717  RSDAIESVTRSLSWED--MSSPSPLLGMTKLTHLSSGDNDELECVAFVQRIVSSSGLGDL  774

Query  708  QSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-  532
            Q  ++ + WH PD PLDP L DK ++  E+     AK R+RRS +KL+FD VN  L++I 
Sbjct  775  QLGTVFTGWHLPDCPLDPALCDKLLDRKEE----AAKSRERRSNQKLLFDYVNMTLVEIG  830

Query  531  -DTCHKTIAFSGAHNTI-PDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMV  358
             DT  +   +S A +    +  S+   + +   + +W   +     ++  D   + ER++
Sbjct  831  QDTLLRAYPWSQARSMAWKESLSLDLVEEIPHLMTDWLYGSGKFAVNENDDAGTILERIM  890

Query  357  RQEAVGKGWHEYLRLEAESIGKEIEG  280
            +QE  G+GW + +R E + I + I G
Sbjct  891  QQEVEGRGWVKSMRWELDGITELIAG  916



>ref|NP_199201.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA98068.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM91604.1| putative protein [Arabidopsis thaliana]
 gb|AED95020.1| uncharacterized protein AT5G43880 [Arabidopsis thaliana]
Length=836

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 117/222 (53%), Gaps = 46/222 (21%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSPPIGS+ RTLS+DDS   T    YS     +  R EEE+   L  I TLLS A L
Sbjct  619  LLGKSPPIGSIGRTLSFDDS---TVARCYSSKRSTTSARDEEEDLRLL--INTLLSAADL  673

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            D + SD+L S+WHS +SPLDP LR+ Y +  E+       +R   + + LVFD VN  L+
Sbjct  674  DAI-SDNLLSKWHSSESPLDPSLRNSYADSTEQ-------KRLGSNVKNLVFDLVNTLLL  725

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISADRVWG-----RIKEWFPSAAGCLSDDGV-----  388
            ++     T ++ G     P  S +I + +  G     R++E       CL+ +G      
Sbjct  726  EL-----TPSYLG-----PRSSPMILSGKPLGVYVINRMQE-------CLTGNGRVEDRW  768

Query  387  --DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
              +D +L+     ++VR E    G  E LRLE +S+G+E+E 
Sbjct  769  WDEDGDLSSLAVNKVVRIEVAEIGSQESLRLEMDSMGEELEL  810



>ref|XP_010481809.1| PREDICTED: uncharacterized protein LOC104760567 isoform X1 [Camelina 
sativa]
 ref|XP_010481810.1| PREDICTED: uncharacterized protein LOC104760567 isoform X1 [Camelina 
sativa]
Length=829

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 112/221 (51%), Gaps = 45/221 (20%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSPPIGS+ RT S+DDS V    SS       S   T +EE +    I TLLS A L
Sbjct  620  LLGKSPPIGSIGRTFSFDDSTVARCFSSKR-----STTSTRDEEEDLRLLINTLLSEADL  674

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            D V SD+L S+WHS +SPLDP LR  Y  L E++       R   + + LVFD VN  L+
Sbjct  675  DAV-SDNLLSKWHSAESPLDPSLRTSYAELTEQQ-------RLGSNVKNLVFDLVNTLLL  726

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV------  388
            ++   +           +P    I+S    RV+   R++E       CL+ +G       
Sbjct  727  ELTPSY----------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWW  769

Query  387  -DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
             +D +L+     ++VR E    G  E LRLE +S+G+E+E 
Sbjct  770  DEDGDLSSLAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  810



>ref|XP_010494373.1| PREDICTED: uncharacterized protein LOC104771538 isoform X1 [Camelina 
sativa]
 ref|XP_010494374.1| PREDICTED: uncharacterized protein LOC104771538 isoform X1 [Camelina 
sativa]
Length=837

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 113/221 (51%), Gaps = 45/221 (20%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSPPIGS+ RT S+DDS V    SS       S   T +EE +    I TLLS A L
Sbjct  621  LLGKSPPIGSIGRTFSFDDSTVARCFSSKR-----STTSTRDEEEDLRLLINTLLSAADL  675

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            D + SD+L S+WHS +SPLDP LR+ Y    E++       R   + +KLVFD VN  L+
Sbjct  676  DAI-SDNLLSKWHSAESPLDPSLRNSYAESTEQQ-------RLGSNVKKLVFDLVNTLLL  727

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV------  388
            ++   +           +P    I+S    RV+   R++E       CL+ +G       
Sbjct  728  ELTPSY----------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWW  770

Query  387  -DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
             +D +L+     ++VR E    G  E LRLE +S+G+E+E 
Sbjct  771  DEDGDLSSLAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  811



>ref|XP_010494375.1| PREDICTED: uncharacterized protein LOC104771538 isoform X2 [Camelina 
sativa]
Length=835

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 113/221 (51%), Gaps = 45/221 (20%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSPPIGS+ RT S+DDS V    SS       S   T +EE +    I TLLS A L
Sbjct  619  LLGKSPPIGSIGRTFSFDDSTVARCFSSKR-----STTSTRDEEEDLRLLINTLLSAADL  673

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            D + SD+L S+WHS +SPLDP LR+ Y    E++       R   + +KLVFD VN  L+
Sbjct  674  DAI-SDNLLSKWHSAESPLDPSLRNSYAESTEQQ-------RLGSNVKKLVFDLVNTLLL  725

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV------  388
            ++   +           +P    I+S    RV+   R++E       CL+ +G       
Sbjct  726  ELTPSY----------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWW  768

Query  387  -DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
             +D +L+     ++VR E    G  E LRLE +S+G+E+E 
Sbjct  769  DEDGDLSSLAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  809



>ref|XP_010481813.1| PREDICTED: uncharacterized protein LOC104760567 isoform X2 [Camelina 
sativa]
Length=754

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 112/221 (51%), Gaps = 45/221 (20%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSPPIGS+ RT S+DDS V    SS       S   T +EE +    I TLLS A L
Sbjct  545  LLGKSPPIGSIGRTFSFDDSTVARCFSSKR-----STTSTRDEEEDLRLLINTLLSEADL  599

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            D V SD+L S+WHS +SPLDP LR  Y  L E++       R   + + LVFD VN  L+
Sbjct  600  DAV-SDNLLSKWHSAESPLDPSLRTSYAELTEQQ-------RLGSNVKNLVFDLVNTLLL  651

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV------  388
            ++   +           +P    I+S    RV+   R++E       CL+ +G       
Sbjct  652  ELTPSY----------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWW  694

Query  387  -DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
             +D +L+     ++VR E    G  E LRLE +S+G+E+E 
Sbjct  695  DEDGDLSSLAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  735



>ref|XP_010235705.1| PREDICTED: uncharacterized protein LOC100838495 [Brachypodium 
distachyon]
Length=896

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 111/219 (51%), Gaps = 15/219 (7%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD  715
            + +S  I +VA +L WDD+  ++ +      P +     +++E E    +Q ++S AGLD
Sbjct  681  VSRSSVIEAVACSLPWDDASSESPSVGIPRLPCLPSD-IDDDESECHVLVQNIMSSAGLD  739

Query  714  EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID  535
            +  S  + + WH PD P+DP+L +K + L           R++RS ++L+FDCVN AL++
Sbjct  740  DTHSSMVFTGWHLPDCPVDPVLCNKLLAL-----------REQRSCQRLLFDCVNVALVE  788

Query  534  IDTCHKTIAF--SGAHN-TIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTER  364
            I       AF  S AH  T    SS      VW  +K+W       +         + +R
Sbjct  789  IGENALLSAFSWSKAHTRTWRYISSPALGVEVWSILKDWIYGTRMFVVSKRDSTGIMMDR  848

Query  363  MVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
            +V+QE  G  W + +  +   I ++IE  +LEE+V +A+
Sbjct  849  IVKQEVEGSSWVKMMMSQVVDITEQIEEGVLEELVGEAL  887



>ref|XP_002863627.1| hypothetical protein ARALYDRAFT_494617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39886.1| hypothetical protein ARALYDRAFT_494617 [Arabidopsis lyrata subsp. 
lyrata]
Length=833

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 112/217 (52%), Gaps = 37/217 (17%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSPPIGS+ RTLS+DDS V    SS       S   T +EE +    I TLLS A  
Sbjct  617  LLGKSPPIGSIGRTLSFDDSTVARCYSSKR-----STTSTRDEEEDLRLLINTLLSAADF  671

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            D + SD+L S+WHS +SPLDP LR+ Y +  E+       +R   + + LVFD VN  L+
Sbjct  672  DTI-SDNLLSKWHSAESPLDPSLRNSYADSTEQ-------KRLGSNVKNLVFDLVNTLLL  723

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV-------DDN  379
            ++     T ++ G  + +      +    V  R++E       CL+ +G        +D 
Sbjct  724  EL-----TPSYLGPRSPLTLSGKPLQV-YVINRMQE-------CLTGNGRVEDRWWDEDG  770

Query  378  NLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
            +L+     ++VR E    G  E LRLE +S+G+E+E 
Sbjct  771  DLSSLAVNKVVRIEVAEIGSQESLRLEMDSMGEELEL  807



>ref|XP_009405681.1| PREDICTED: uncharacterized protein LOC103988772 [Musa acuminata 
subsp. malaccensis]
Length=931

 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 107/195 (55%), Gaps = 13/195 (7%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLD  715
            + +S PI SVAR++S + S +DTA  S  L   + + + +EE  +++F ++ L++ AGLD
Sbjct  720  LSRSSPIESVARSISKEFSYLDTA--SNPLRYSIVLSKADEEYEQYVF-VEKLIASAGLD  776

Query  714  EVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALID  535
              +S    + WHS +SPL+P+L + ++N        EAK R+R S ++L+FD +NAAL++
Sbjct  777  CKKSSVNFTGWHSLESPLNPMLLELHMN------GEEAKFRKRGSNKRLLFDSINAALLN  830

Query  534  IDTCHKTIAF---SGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTER  364
            I       ++           D  S   A+ VWG IK WF S    ++ +    +N  + 
Sbjct  831  ISQKETLASYPWSQACDRNKDDSLSGPLAEEVWGTIKSWF-SGHSYVTGEFNYSSNSVDW  889

Query  363  MVRQEAVGKGWHEYL  319
            +V++E  G  W E +
Sbjct  890  LVKKEMTGGQWVESM  904



>ref|XP_010441972.1| PREDICTED: uncharacterized protein LOC104725068 isoform X2 [Camelina 
sativa]
Length=832

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 112/221 (51%), Gaps = 45/221 (20%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSPPIGS+ RT S+DDS V     +   +   S   T +EE +    I TLLS A L
Sbjct  625  LLGKSPPIGSIGRTFSFDDSTV-----ARCFSSKRSTSSTRDEEEDLRLLINTLLSAADL  679

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            D V SD+L S+WHS +SPLDP LR  Y    E++       R   + +KLVFD VN  L+
Sbjct  680  DAV-SDNLLSKWHSAESPLDPSLRTSYAESTEQQ-------RLGSNVKKLVFDLVNTLLL  731

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV------  388
            ++   +           +P    I+S    RV+   R++E       CL+ +G       
Sbjct  732  ELSPSY----------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWW  774

Query  387  -DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
             +D +L+     ++VR E    G  E LRLE +S+G+E+E 
Sbjct  775  DEDGDLSSLAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  815



>ref|XP_010441970.1| PREDICTED: uncharacterized protein LOC104725068 isoform X1 [Camelina 
sativa]
 ref|XP_010441971.1| PREDICTED: uncharacterized protein LOC104725068 isoform X1 [Camelina 
sativa]
Length=827

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 112/221 (51%), Gaps = 45/221 (20%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSPPIGS+ RT S+DDS V     +   +   S   T +EE +    I TLLS A L
Sbjct  620  LLGKSPPIGSIGRTFSFDDSTV-----ARCFSSKRSTSSTRDEEEDLRLLINTLLSAADL  674

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
            D V SD+L S+WHS +SPLDP LR  Y    E++       R   + +KLVFD VN  L+
Sbjct  675  DAV-SDNLLSKWHSAESPLDPSLRTSYAESTEQQ-------RLGSNVKKLVFDLVNTLLL  726

Query  537  DIDTCHKTIAFSGAHNTIPDGSSIISAD--RVW--GRIKEWFPSAAGCLSDDGV------  388
            ++   +           +P    I+S    RV+   R++E       CL+ +G       
Sbjct  727  ELSPSY----------LVPRSPLILSGKPLRVYVINRMQE-------CLTGNGRVEDRWW  769

Query  387  -DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
             +D +L+     ++VR E    G  E LRLE +S+G+E+E 
Sbjct  770  DEDGDLSSLAVNKVVRVEVAEIGSPECLRLEMDSMGEELEL  810



>gb|EEC74239.1| hypothetical protein OsI_09439 [Oryza sativa Indica Group]
Length=934

 Score = 76.3 bits (186),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 69/240 (29%), Positives = 122/240 (51%), Gaps = 33/240 (14%)
 Frame = -2

Query  918  FSPXGPILIDKSPPIGSVARTLSWDDSCVDTAT-SSYSLNPPVSMQRTEEEEREWLFFIQ  742
            F    P  + +SP IGS +R+LSW+D  ++  + +S  L+   S     +E+++ L FIQ
Sbjct  715  FITASPQALSRSPLIGSFSRSLSWEDPPLEVMSPNSLRLSRLFS---KADEDQDSLTFIQ  771

Query  741  TLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVF  562
             L+  AG+D  +   LSS       PL+  L +K+ +  E+ T    K R+RRS  K +F
Sbjct  772  KLVCSAGIDR-EGCMLSS-------PLELYLLEKFSDYQEEGT----KLRERRSKEKFLF  819

Query  561  DCVNAALIDIDTCHKTIAFS-GAHNTI-----PDGSSIISADRVWGRIKEW-----FPSA  415
            D VN AL ++    + +A+S G  +++      +  S  +AD +W  I+ W     +P  
Sbjct  820  DAVNEALTELTWTAELMAYSWGTSSSLERKDCENAFSNSAADEIWRVIRNWSILDKYPPG  879

Query  414  AGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
                  + ++ N L E ++++E +     +  RLE   +   +   +LE+++ DAVV L+
Sbjct  880  ------ETIERNLLVEMILKREVLEAASSDTTRLETFELTSMVCTMVLEDLIADAVVDLS  933



>ref|XP_009113974.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
 ref|XP_009113975.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
 ref|XP_009113976.1| PREDICTED: uncharacterized protein LOC103839223 [Brassica rapa]
Length=757

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 108/222 (49%), Gaps = 41/222 (18%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSP IG   R  S++DS V    SS       +   T +EE +    I TLLS A L
Sbjct  535  LLGKSPSIG---RNFSFNDSTVARCHSSKR----STTISTRDEEEDLRLLINTLLSAANL  587

Query  717  DE--VQS---DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCV  553
            DE  V S   D+L S+WHS +SPLDP LR+ Y +  E++       +   + +KLVFD V
Sbjct  588  DEESVPSSIIDNLLSKWHSVESPLDPSLRESYADSTEQQ-------KHGSNVKKLVFDLV  640

Query  552  NAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV-----  388
            N  L+++   +  +     H  +  G ++     V  R++E       CL  +G      
Sbjct  641  NTLLLELTPSY--LGHGSHHMLLLSGKTL--GVYVINRMRE-------CLKGNGRVEYRW  689

Query  387  --DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
              +D +L+     ++VR E    G  E LRLE E +G+EIE 
Sbjct  690  WDEDGDLSSLAVNKVVRTEVAEIGSKESLRLEMECMGEEIEL  731



>gb|EPS72229.1| hypothetical protein M569_02537, partial [Genlisea aurea]
Length=151

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 60/98 (61%), Gaps = 8/98 (8%)
 Frame = -2

Query  906  GPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPV----SMQRTEEEEREWLFFIQT  739
            G   I KSP IG++ RTL WD+   +T +  +    PV    + +R  +EE EW  F +T
Sbjct  57   GSSAIGKSPAIGTIPRTLCWDELYAETESPHHH---PVGECPATRRRSDEEAEWAVFAKT  113

Query  738  LLSMAGL-DEVQSDSLSSRWHSPDSPLDPLLRDKYINL  628
            LLS++G+ DE  S+    RW+S +SPLDP LRD Y+++
Sbjct  114  LLSVSGIQDEGLSNLCGERWYSHESPLDPSLRDSYMDV  151



>ref|XP_006648110.1| PREDICTED: uncharacterized protein LOC102717592 [Oryza brachyantha]
Length=927

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/240 (29%), Positives = 116/240 (48%), Gaps = 33/240 (14%)
 Frame = -2

Query  918  FSPXGPILIDKSPPIGSVARTLSWDDSCVDTAT-SSYSLNPPVSMQRTEEEEREWLFFIQ  742
            F    P  + +SP IGS +R+LSW+D  ++  + +S  L+   S     +E+++ L FIQ
Sbjct  708  FISASPQTLSRSPLIGSFSRSLSWEDPPLEVMSPNSLRLSRLFS---KADEDQDSLTFIQ  764

Query  741  TLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVF  562
             L+  AG+D      L+       SPL+  L +K+ +  E+      K R+RRS  K +F
Sbjct  765  KLVCSAGIDR-DGCMLA-------SPLELELLEKFSDYQEEGI----KLRERRSKEKFLF  812

Query  561  DCVNAALIDIDTCHKTIA------FSGAHNTIPDGSSIISADRVWGRIKEW-----FPSA  415
            D VN AL ++    + +A      FS  H    +  S  +AD +W  I+ W     +P  
Sbjct  813  DAVNEALTELTWTAELMAYPWRRSFSLEHKDCENDCSNSAADEIWRVIRNWSILDRYPPG  872

Query  414  AGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
                  + ++ N L E ++++E V     +  RLE   +   I   +LE+++ DA V L+
Sbjct  873  ------ETIERNLLVEMILKREVVEAARGDMTRLETFELTTTICAMVLEDLIADAAVDLS  926



>ref|XP_003570390.1| PREDICTED: uncharacterized protein LOC100830114 [Brachypodium 
distachyon]
Length=931

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 69/242 (29%), Positives = 118/242 (49%), Gaps = 33/242 (14%)
 Frame = -2

Query  918  FSPXGPILIDKSPPIGSVARTLSWDDSCVDTAT-SSYSLNPPVSMQRTEEEEREWLFFIQ  742
            F    P  + +SP IGS +R+LSW+D   +  + +S  L+   S     +E+++ L FIQ
Sbjct  710  FITSSPQALSRSPLIGSFSRSLSWEDPPSEVMSPNSLRLSRLFS---KADEDQDSLTFIQ  766

Query  741  TLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVF  562
             L+S AG+D  +   LS       SPLDP L DK  +  + E +   K R+RRS  +L+F
Sbjct  767  KLVSFAGMDR-EGCILS-------SPLDPKLLDKLSDY-QGEGI---KLRERRSKERLLF  814

Query  561  DCVNAALIDIDTCHKTIAF------SGAHNTIPDGSSIISADRVWGRIKEW-----FPSA  415
            D VN AL ++    +  A+        A     D     +AD +W  I+ W     +P  
Sbjct  815  DAVNEALAELTRTTELAAYPWGRACCSARKDCEDDFCNSAADEIWRVIRNWSILEKYPPG  874

Query  414  AGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
                  + ++ N L + ++++E V     +  RLE   +   +   +LE+++++A+V L 
Sbjct  875  ------EIIERNLLVDMILKREVVETAIADTTRLETFELNMMVCEVILEDLLEEALVDLT  928

Query  234  DT  229
            + 
Sbjct  929  NN  930



>ref|NP_001048512.1| Os02g0816400 [Oryza sativa Japonica Group]
 dbj|BAD22010.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10426.1| Os02g0816400 [Oryza sativa Japonica Group]
 dbj|BAG94939.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58041.1| hypothetical protein OsJ_08870 [Oryza sativa Japonica Group]
Length=934

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/240 (28%), Positives = 117/240 (49%), Gaps = 33/240 (14%)
 Frame = -2

Query  918  FSPXGPILIDKSPPIGSVARTLSWDDSCVDTAT-SSYSLNPPVSMQRTEEEEREWLFFIQ  742
            F    P  + +SP IGS +R+LSW+D  ++  + +S  L+   S     +E+++ L FIQ
Sbjct  715  FITASPQALSRSPLIGSFSRSLSWEDPPLEVMSPNSLRLSRLFS---KADEDQDSLTFIQ  771

Query  741  TLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVF  562
             L+  AG+D  +   LS        PL+  L +K+ +  E+ T    K R+RRS  K +F
Sbjct  772  KLVCSAGIDR-EGCMLS-------GPLELYLLEKFSDYQEEGT----KLRERRSKEKFLF  819

Query  561  DCVNAALIDIDTCHKTIAF------SGAHNTIPDGSSIISADRVWGRIKEW-----FPSA  415
            D VN AL ++    + +A+      S       +  S  +AD +W  I+ W     +P  
Sbjct  820  DAVNEALTELTWTAELMAYPLGRSSSLERKDCENAFSNSAADEIWRVIRNWSILDKYPPG  879

Query  414  AGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
                  + ++ N L E ++++E +     +  RLE   +   +   +LE+++ DAVV L+
Sbjct  880  ------ETIERNLLVEMILKREVLEAASSDTTRLETFELTSMVCTMVLEDLIADAVVDLS  933



>gb|EMS54382.1| hypothetical protein TRIUR3_15055 [Triticum urartu]
Length=1009

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 119/243 (49%), Gaps = 34/243 (14%)
 Frame = -2

Query  918   FSPXGPILIDKSPPIGSVARTLSWDDSCVDTAT-SSYSLNPPVSMQRTEEEEREWLFFIQ  742
             F    P ++ +SP IGS +R+LSW+D   +  + +S  L     +    +++++ L  IQ
Sbjct  787   FITASPQIVSRSPHIGSFSRSLSWEDPPSEVMSPNSLRL---ARLFSKADDDQDSLTIIQ  843

Query  741   TLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVF  562
              L+S AG+D  +S  L+       SPLDP L +K  +        E K R++RS  +L+F
Sbjct  844   KLVSSAGMDR-KSCVLA-------SPLDPRLLEKLSD----HQAEEIKSREKRSKERLLF  891

Query  561   DCVNAALIDIDTCHKTIAF-------SGAHNTIPDGSSIISADRVWGRIKEW-----FPS  418
             D VN AL ++    +  A+       S   +   D S   +AD +W  I+ W     +P 
Sbjct  892   DAVNEALTELTWTTELSAYPWGRTFCSQRKDCDDDSSCNSAADEIWRVIRNWSILDKYPP  951

Query  417   AAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
                    + ++ N L E ++++E V     +  RLE   +   +   +LE+++++A+V L
Sbjct  952   G------EVIERNLLLEMILKREVVETATADTTRLETFEVCAMVCTVVLEDLLEEALVDL  1005

Query  237   ADT  229
              ++
Sbjct  1006  TNS  1008



>emb|CDY32928.1| BnaA09g16650D [Brassica napus]
Length=755

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 108/222 (49%), Gaps = 41/222 (18%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSP IG   R  S++DS V    SS       +   T +EE +    I TLLS A L
Sbjct  533  LLGKSPSIG---RNFSFNDSTVARCHSSKR----STTTSTRDEEEDLRLLINTLLSAANL  585

Query  717  DE--VQS---DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCV  553
            DE  V S   D+L S+WHS +SPLDP LR+ Y +  E++       R   + +KLVFD V
Sbjct  586  DEESVPSSIIDNLLSKWHSVESPLDPSLRESYADSTEQQ-------RHGSNVKKLVFDLV  638

Query  552  NAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV-----  388
            N  L+++   +  +     H  +  G ++     V  R++E       C+  +G      
Sbjct  639  NTLLLELTPSY--LGHGSHHMLLLSGKTL--GVYVINRMRE-------CVKGNGRVEYRW  687

Query  387  --DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
              +D +L+     ++VR E    G  E LRLE E +G+EIE 
Sbjct  688  WDEDGDLSSLAVNKVVRTEVAEIGSKESLRLEMECMGEEIEL  729



>ref|XP_006854321.1| PREDICTED: uncharacterized protein LOC18444081 [Amborella trichopoda]
 gb|ERN15788.1| hypothetical protein AMTR_s00039p00119340 [Amborella trichopoda]
Length=1073

 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 102/209 (49%), Gaps = 55/209 (26%)
 Frame = -2

Query  774   EEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLN--------EK  619
             E E+E   F++T+L+ +GL +    S+  RW+SP+SPLDP+L DK ++ N        E+
Sbjct  875   ESEQEVFLFVETILNASGLLDEPECSIFGRWYSPNSPLDPVLLDKCLDKNGSVSSKGGER  934

Query  618   E---------TVHEAKRR-------------QRRST--RKLVFDCVNAALIDI-DTCHKT  514
             E         T  E +R+             +RR    RKLVFDC+NA L++I   C   
Sbjct  935   ECCSKQNDPVTCIEGERKSCSDQNGMVICKVERRDEMERKLVFDCINAVLVEITGPCLDA  994

Query  513   IAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKG  334
               ++      P G  ++ A   W  ++EW   A G    +G+      ER +       G
Sbjct  995   HPWARPRRQGPVGQQLVQA--TWNLLREW---AHG----EGL------ERDL------SG  1033

Query  333   WHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
             W + L  E + IG EIE  +LE++++DA+
Sbjct  1034  WFD-LGQEMDWIGTEIERCVLEDLIEDAL  1061



>ref|XP_006403169.1| hypothetical protein EUTSA_v10003146mg [Eutrema salsugineum]
 gb|ESQ44622.1| hypothetical protein EUTSA_v10003146mg [Eutrema salsugineum]
Length=845

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 106/218 (49%), Gaps = 32/218 (15%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSPPIGS+ R  S++DS V    SS       S   T +EE +    I TLLS A L
Sbjct  622  LLGKSPPIGSIGRNFSFEDSTVARCYSSKR-----SPTFTRDEEEDLRLLINTLLSAADL  676

Query  717  DEVQSDSLSS-------RWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFD  559
            DE    S SS       +W+S +SPLDP LRD Y N         + +R   + +KLVFD
Sbjct  677  DEESESSSSSILDSLLSKWYSVESPLDPSLRDSYAN---------SHQRLGSNVKKLVFD  727

Query  558  CVNAALIDIDTCH-----KTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDD  394
             VN+ L+++   +       +A SG    +   + +       GR+++ +    G LS  
Sbjct  728  LVNSLLLELTPSYLGPRSSPMALSGKTLRVYIVNRMQECLTGKGRVEDRWWDEDGDLSSL  787

Query  393  GVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
             V+      ++VR E  G G  E L  E +S+G+E+E 
Sbjct  788  AVN------KVVRIEVAGIGSPESLGFEKDSMGEELEL  819



>ref|XP_004954364.1| PREDICTED: uncharacterized protein LOC101771268 isoform X1 [Setaria 
italica]
 ref|XP_004954365.1| PREDICTED: uncharacterized protein LOC101771268 isoform X2 [Setaria 
italica]
 ref|XP_004954366.1| PREDICTED: uncharacterized protein LOC101771268 isoform X3 [Setaria 
italica]
 ref|XP_004954367.1| PREDICTED: uncharacterized protein LOC101771268 isoform X4 [Setaria 
italica]
 ref|XP_004954368.1| PREDICTED: uncharacterized protein LOC101771268 isoform X5 [Setaria 
italica]
Length=915

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 115/242 (48%), Gaps = 33/242 (14%)
 Frame = -2

Query  918  FSPXGPILIDKSPPIGSVARTLSWDDSCVDTAT-SSYSLNPPVSMQRTEEEEREWLFFIQ  742
            F    P  + +SP IGS +R+LSW+D  ++  + +S  L+   S     +E+ + L FIQ
Sbjct  695  FIASSPQALSRSPLIGSFSRSLSWEDPPLEVMSPNSLRLSRLFS---KADEDLDSLTFIQ  751

Query  741  TLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVF  562
             L+   G+D  +   L+        PLDP L  K+ +  E       K  +RRS ++L+F
Sbjct  752  KLVHSCGMDR-EGCILA-------EPLDPKLLAKFSDYQEDGM----KSGKRRSKQRLLF  799

Query  561  DCVNAALIDIDTCHKTIAF------SGAHNTIPDGSSIISADRVWGRIKEW-----FPSA  415
            D VN AL ++ +  +  A+      S  H    +GSS    + +W  I+ W     +P  
Sbjct  800  DAVNEALAELTSMAELAAYPWGRSCSLEHRDCKNGSSNSVDEEIWRVIRNWSILEKYPPG  859

Query  414  AGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
                  + ++ N L E ++++E       +  RLE   +G  +   +LE++V++ ++ L 
Sbjct  860  ------EAIERNLLLEMILKREVAEAASADTARLEIFKLGAAVCSMVLEDLVEETLLDLT  913

Query  234  DT  229
            + 
Sbjct  914  NN  915



>emb|CDY22327.1| BnaA06g36490D [Brassica napus]
Length=198

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 93/181 (51%), Gaps = 30/181 (17%)
 Frame = -2

Query  786  QRTEEEEREWLFFIQTLLSMAGLDEVQSDSLSS----RWHSPDSPLDPLLRDKYINLNEK  619
            Q+ EEEE +    + TLLS A LDE +S+SLSS    +WHS +SPLDP LR  Y N  E 
Sbjct  10   QKIEEEEEDLRVLVNTLLSAADLDE-ESESLSSYVLSKWHSVESPLDPSLRGIYANSAEH  68

Query  618  ETVHEAKRRQRRSTRKLVFDCVNAALIDID------TCHKTIAFS--GAHNTIPDGSSII  463
            +       R   + +KLVFD VN  L+++        C K ++    GA+  I      +
Sbjct  69   Q-------RLGTNVKKLVFDLVNTLLLELTPSYLGPRCLKILSGKTLGAY-VINRMQKCL  120

Query  462  SADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIE  283
              +   GR+++ +    G LS   V+      R+VR E    G  E LRLE +S+G+E+E
Sbjct  121  KGN---GRVEDRWWDEDGDLSSLAVN------RVVRMEEAEIGSPESLRLEMDSMGEELE  171

Query  282  G  280
             
Sbjct  172  L  172



>emb|CDY50812.1| BnaCnng19760D [Brassica napus]
Length=750

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 71/222 (32%), Positives = 106/222 (48%), Gaps = 41/222 (18%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSP IG   R  S++DS V    SS       +   T +EE +    I TLLS A L
Sbjct  528  LLGKSPSIG---RNFSFNDSTVARCHSSKR----STTTSTRDEEEDLRLLINTLLSSAHL  580

Query  717  DEVQS-----DSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCV  553
            DE        D+L S+WHS +SPLDP LR+ Y +  E++ +         + +KLVFD V
Sbjct  581  DEEPDSSSIIDNLLSKWHSVESPLDPSLRESYADSTEQQKLGS-------NVKKLVFDLV  633

Query  552  NAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGV-----  388
            N  L+++   +      G+H+ +      +    +  R++E       CL  +G      
Sbjct  634  NTLLLELTPSYHG---HGSHHMLLLSGKTLGV-YLINRMRE-------CLKGNGRVEYRW  682

Query  387  --DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
              +D +L+     ++VR E    G  E LRLE E +G+EIE 
Sbjct  683  WDEDRDLSSLAVNKVVRTEVAEIGSKESLRLEMECMGEEIEL  724



>ref|XP_008646431.1| PREDICTED: uncharacterized protein LOC103627892 isoform X3 [Zea 
mays]
 gb|AFW74025.1| hypothetical protein ZEAMMB73_702258 [Zea mays]
Length=932

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 67/242 (28%), Positives = 118/242 (49%), Gaps = 34/242 (14%)
 Frame = -2

Query  918  FSPXGPILIDKSPPIGSVARTLSWDDSCVDTAT-SSYSLNPPVSMQRTEEEEREWLFFIQ  742
            F    P  + +SP IGS +R+LSW+D  ++  + +S  L+   S     +E+ + L FIQ
Sbjct  710  FITSSPQALSRSPLIGSFSRSLSWEDPPLEVMSPNSLRLSRLFS---KADEDLDSLTFIQ  766

Query  741  TLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVF  562
             L+   G    +S  L+        PLDP L +K I+  E++ +   KRR +   ++L+F
Sbjct  767  KLVHSRGTGR-ESCILA-------DPLDPSLLEK-ISDYEEDGIKFGKRRPK---QRLLF  814

Query  561  DCVNAALIDIDTCHKTIAF------SGAHNTIPDGSSIIS-ADRVWGRIKEW-----FPS  418
            D VN ALI++ +  +  A+      S  H    +GSS  S A+ +W  I+ W     +P 
Sbjct  815  DAVNEALIELASMAELAAYPWGRSCSSEHGDCKNGSSSNSAAEEIWRVIRNWSILEKYPP  874

Query  417  AAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
                   + ++ N L E ++++E       +  RLE   +   +   +L+ +V++ VV L
Sbjct  875  G------EAIERNLLLEMILKREVAEAASADTTRLETFDLNTTVCAMVLDGLVEETVVDL  928

Query  237  AD  232
             +
Sbjct  929  TN  930



>ref|XP_008646424.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646425.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646426.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646428.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
 ref|XP_008646429.1| PREDICTED: uncharacterized protein LOC103627892 isoform X1 [Zea 
mays]
Length=937

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 67/242 (28%), Positives = 118/242 (49%), Gaps = 34/242 (14%)
 Frame = -2

Query  918  FSPXGPILIDKSPPIGSVARTLSWDDSCVDTAT-SSYSLNPPVSMQRTEEEEREWLFFIQ  742
            F    P  + +SP IGS +R+LSW+D  ++  + +S  L+   S     +E+ + L FIQ
Sbjct  715  FITSSPQALSRSPLIGSFSRSLSWEDPPLEVMSPNSLRLSRLFS---KADEDLDSLTFIQ  771

Query  741  TLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVF  562
             L+   G    +S  L+        PLDP L +K I+  E++ +   KRR +   ++L+F
Sbjct  772  KLVHSRGTGR-ESCILA-------DPLDPSLLEK-ISDYEEDGIKFGKRRPK---QRLLF  819

Query  561  DCVNAALIDIDTCHKTIAF------SGAHNTIPDGSSIIS-ADRVWGRIKEW-----FPS  418
            D VN ALI++ +  +  A+      S  H    +GSS  S A+ +W  I+ W     +P 
Sbjct  820  DAVNEALIELASMAELAAYPWGRSCSSEHGDCKNGSSSNSAAEEIWRVIRNWSILEKYPP  879

Query  417  AAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGL  238
                   + ++ N L E ++++E       +  RLE   +   +   +L+ +V++ VV L
Sbjct  880  G------EAIERNLLLEMILKREVAEAASADTTRLETFDLNTTVCAMVLDGLVEETVVDL  933

Query  237  AD  232
             +
Sbjct  934  TN  935



>gb|EMT03099.1| hypothetical protein F775_52439 [Aegilops tauschii]
Length=939

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 120/242 (50%), Gaps = 32/242 (13%)
 Frame = -2

Query  918  FSPXGPILIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQT  739
            F    P ++ +SP IGS +R+LSW++   +   S  SL       + ++++ + L  IQ 
Sbjct  717  FITASPQIVSRSPLIGSFSRSLSWEEPPSEV-MSPNSLRLARLFSKADDDQ-DSLTIIQK  774

Query  738  LLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFD  559
            ++S AG+D  ++  L+S       PLD  L +K   L++ + V E K R+RRS  +L+FD
Sbjct  775  IVSSAGMDR-KNCVLAS-------PLDLKLLEK---LSDHQAV-EIKSRERRSKERLLFD  822

Query  558  CVNAALIDIDTCHKTIAF-------SGAHNTIPDGSSIISADRVWGRIKEW-----FPSA  415
             VN AL ++    +  A+       S   +   D S   +AD +W  I+ W     +P  
Sbjct  823  AVNVALTELTWTAELSAYPWGRTCCSQRKDQDDDSSCNSAADEIWRVIRNWSILDKYPPG  882

Query  414  AGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLA  235
                  + ++ N L E ++++E V     +  RLE       +   +LE+++++A+V L 
Sbjct  883  ------EVIERNLLLEMILKREVVETATADTTRLETFEGCAMVCTVVLEDLLEEALVDLT  936

Query  234  DT  229
            ++
Sbjct  937  NS  938



>ref|XP_008646430.1| PREDICTED: uncharacterized protein LOC103627892 isoform X2 [Zea 
mays]
Length=936

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 116/234 (50%), Gaps = 34/234 (15%)
 Frame = -2

Query  894  IDKSPPIGSVARTLSWDDSCVDTAT-SSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            + +SP IGS +R+LSW+D  ++  + +S  L+   S     +E+ + L FIQ L+   G 
Sbjct  722  LSRSPLIGSFSRSLSWEDPPLEVMSPNSLRLSRLFS---KADEDLDSLTFIQKLVHSRGT  778

Query  717  DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALI  538
               +S  L+        PLDP L +K I+  E++ +   KRR +   ++L+FD VN ALI
Sbjct  779  GR-ESCILA-------DPLDPSLLEK-ISDYEEDGIKFGKRRPK---QRLLFDAVNEALI  826

Query  537  DIDTCHKTIAF------SGAHNTIPDGSSIIS-ADRVWGRIKEW-----FPSAAGCLSDD  394
            ++ +  +  A+      S  H    +GSS  S A+ +W  I+ W     +P        +
Sbjct  827  ELASMAELAAYPWGRSCSSEHGDCKNGSSSNSAAEEIWRVIRNWSILEKYPPG------E  880

Query  393  GVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVVGLAD  232
             ++ N L E ++++E       +  RLE   +   +   +L+ +V++ VV L +
Sbjct  881  AIERNLLLEMILKREVAEAASADTTRLETFDLNTTVCAMVLDGLVEETVVDLTN  934



>gb|EMS57338.1| hypothetical protein TRIUR3_10172 [Triticum urartu]
Length=816

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (60%), Gaps = 10/99 (10%)
 Frame = -2

Query  879  PIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSD  700
            PIGSVARTLSWD+S  +   +      P S +  +  E+E   F++ +LS AGL    + 
Sbjct  716  PIGSVARTLSWDESSSEEEAA------PCSSKDDDSHEQERYEFVEKILSSAGLCAEATG  769

Query  699  SLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            ++ +RWHS DSPL P + D+++    +  V +AK R+RR
Sbjct  770  NVFARWHSLDSPLAPTVPDQFL----ERKVEDAKCRERR  804



>emb|CDX94731.1| BnaC07g17400D [Brassica napus]
Length=794

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 104/224 (46%), Gaps = 49/224 (22%)
 Frame = -2

Query  897  LIDKSPPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGL  718
            L+ KSP IG   R  S+DDS V    SS       ++   EEEE +    +  LLS A L
Sbjct  576  LLGKSPSIG---RIFSFDDSTVSRCYSSKR----STLSTREEEEEDLRLLVNALLSAADL  628

Query  717  DEVQSDSLSS---RWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNA  547
            DE      S    +WHS +SPLDP LR  Y N  E +       R   + ++LVFD VN 
Sbjct  629  DEESESLSSYLLSKWHSVESPLDPSLRGIYANSAEHQ-------RLGTNVKQLVFDLVNT  681

Query  546  ALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWG----RIKEWFPSAAGCLSDDGV---  388
             L+++     T ++ G     P G  I+S   +      R++E       CL  +G    
Sbjct  682  LLLEL-----TPSYLG-----PRGLKILSGKTLGAYAINRMQE-------CLKGNGRVED  724

Query  387  ----DDNNLT----ERMVRQEAVGKGWHEYLRLEAESIGKEIEG  280
                +D +L+     R+VR E    G  E LRLE +S+G+E+E 
Sbjct  725  RWWDEDGDLSSLAVNRVVRMEVAEIGSPESLRLEMDSMGEEVEL  768



>ref|XP_008679174.1| PREDICTED: uncharacterized protein LOC103654120 isoform X5 [Zea 
mays]
Length=828

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 114/242 (47%), Gaps = 41/242 (17%)
 Frame = -2

Query  921  LFSPXGPILIDKSPPIGSVARTL--SWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFF  748
            L+S   P  + +SP IGS  R+L  SW+D   + ATS  SL       + +E+  + L F
Sbjct  610  LYSSPSPQALSRSPLIGSFPRSLPVSWEDPPPE-ATSPNSLRLSRLFSKADED-LDSLTF  667

Query  747  IQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKL  568
            IQ L+   G+D   S  L+        PLDP       +L EK + HE     R   R+L
Sbjct  668  IQKLVRSCGMDRA-SCVLAG-------PLDP-------DLLEKVSEHEDDG-TRFGRRRL  711

Query  567  VFDCVNAALIDIDTCHKTIAF--SGAHNTI----PDGSSIISA-DRVWGRIKEW-----F  424
            +FD VN AL ++    +  A+   G  + +     +GS   SA + +W  I+ W     +
Sbjct  712  LFDAVNEALAELAWTAELAAYPWGGGRSRLDCNCKNGSGGDSAAEEIWRVIRNWSTLDKY  771

Query  423  PSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
            P        + ++ N L E ++R+EA      E  RLE   +G  +   +LEE+V++ VV
Sbjct  772  PPC------ETIEGNVLLEMILRREADS---GETARLEVFGLGASVCAVVLEELVEETVV  822

Query  243  GL  238
             L
Sbjct  823  DL  824



>ref|XP_008679172.1| PREDICTED: uncharacterized protein LOC103654120 isoform X3 [Zea 
mays]
Length=930

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 114/242 (47%), Gaps = 41/242 (17%)
 Frame = -2

Query  921  LFSPXGPILIDKSPPIGSVARTL--SWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFF  748
            L+S   P  + +SP IGS  R+L  SW+D   + ATS  SL       + +E+  + L F
Sbjct  712  LYSSPSPQALSRSPLIGSFPRSLPVSWEDPPPE-ATSPNSLRLSRLFSKADED-LDSLTF  769

Query  747  IQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKL  568
            IQ L+   G+D   S  L+        PLDP       +L EK + HE     R   R+L
Sbjct  770  IQKLVRSCGMDRA-SCVLAG-------PLDP-------DLLEKVSEHEDDG-TRFGRRRL  813

Query  567  VFDCVNAALIDIDTCHKTIAF--SGAHNTI----PDGSSIISA-DRVWGRIKEW-----F  424
            +FD VN AL ++    +  A+   G  + +     +GS   SA + +W  I+ W     +
Sbjct  814  LFDAVNEALAELAWTAELAAYPWGGGRSRLDCNCKNGSGGDSAAEEIWRVIRNWSTLDKY  873

Query  423  PSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
            P        + ++ N L E ++R+EA      E  RLE   +G  +   +LEE+V++ VV
Sbjct  874  PPC------ETIEGNVLLEMILRREA---DSGETARLEVFGLGASVCAVVLEELVEETVV  924

Query  243  GL  238
             L
Sbjct  925  DL  926



>ref|XP_008679165.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679166.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679167.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679168.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679169.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
 ref|XP_008679170.1| PREDICTED: uncharacterized protein LOC103654120 isoform X1 [Zea 
mays]
Length=936

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 114/242 (47%), Gaps = 41/242 (17%)
 Frame = -2

Query  921  LFSPXGPILIDKSPPIGSVARTL--SWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFF  748
            L+S   P  + +SP IGS  R+L  SW+D   + ATS  SL       + +E+  + L F
Sbjct  718  LYSSPSPQALSRSPLIGSFPRSLPVSWEDPPPE-ATSPNSLRLSRLFSKADED-LDSLTF  775

Query  747  IQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKL  568
            IQ L+   G+D   S  L+        PLDP       +L EK + HE     R   R+L
Sbjct  776  IQKLVRSCGMDRA-SCVLAG-------PLDP-------DLLEKVSEHEDDG-TRFGRRRL  819

Query  567  VFDCVNAALIDIDTCHKTIAF--SGAHNTI----PDGSSIISA-DRVWGRIKEW-----F  424
            +FD VN AL ++    +  A+   G  + +     +GS   SA + +W  I+ W     +
Sbjct  820  LFDAVNEALAELAWTAELAAYPWGGGRSRLDCNCKNGSGGDSAAEEIWRVIRNWSTLDKY  879

Query  423  PSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
            P        + ++ N L E ++R+EA      E  RLE   +G  +   +LEE+V++ VV
Sbjct  880  PPC------ETIEGNVLLEMILRREA---DSGETARLEVFGLGASVCAVVLEELVEETVV  930

Query  243  GL  238
             L
Sbjct  931  DL  932



>ref|XP_008679173.1| PREDICTED: uncharacterized protein LOC103654120 isoform X4 [Zea 
mays]
 gb|AFW64006.1| hypothetical protein ZEAMMB73_603433 [Zea mays]
Length=926

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 114/242 (47%), Gaps = 41/242 (17%)
 Frame = -2

Query  921  LFSPXGPILIDKSPPIGSVARTL--SWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFF  748
            L+S   P  + +SP IGS  R+L  SW+D   + ATS  SL       + +E+  + L F
Sbjct  708  LYSSPSPQALSRSPLIGSFPRSLPVSWEDPPPE-ATSPNSLRLSRLFSKADED-LDSLTF  765

Query  747  IQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKL  568
            IQ L+   G+D   S  L+        PLDP       +L EK + HE     R   R+L
Sbjct  766  IQKLVRSCGMDRA-SCVLAG-------PLDP-------DLLEKVSEHEDDG-TRFGRRRL  809

Query  567  VFDCVNAALIDIDTCHKTIAF--SGAHNTI----PDGSSIISA-DRVWGRIKEW-----F  424
            +FD VN AL ++    +  A+   G  + +     +GS   SA + +W  I+ W     +
Sbjct  810  LFDAVNEALAELAWTAELAAYPWGGGRSRLDCNCKNGSGGDSAAEEIWRVIRNWSTLDKY  869

Query  423  PSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
            P        + ++ N L E ++R+EA      E  RLE   +G  +   +LEE+V++ VV
Sbjct  870  PPC------ETIEGNVLLEMILRREA---DSGETARLEVFGLGASVCAVVLEELVEETVV  920

Query  243  GL  238
             L
Sbjct  921  DL  922



>ref|XP_008679171.1| PREDICTED: uncharacterized protein LOC103654120 isoform X2 [Zea 
mays]
Length=932

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 74/242 (31%), Positives = 114/242 (47%), Gaps = 41/242 (17%)
 Frame = -2

Query  921  LFSPXGPILIDKSPPIGSVARTL--SWDDSCVDTATSSYSLNPPVSMQRTEEEEREWLFF  748
            L+S   P  + +SP IGS  R+L  SW+D   + ATS  SL       + +E+  + L F
Sbjct  714  LYSSPSPQALSRSPLIGSFPRSLPVSWEDPPPE-ATSPNSLRLSRLFSKADED-LDSLTF  771

Query  747  IQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRKL  568
            IQ L+   G+D   S  L+        PLDP       +L EK + HE     R   R+L
Sbjct  772  IQKLVRSCGMDRA-SCVLAG-------PLDP-------DLLEKVSEHEDDG-TRFGRRRL  815

Query  567  VFDCVNAALIDIDTCHKTIAF--SGAHNTI----PDGSSIISA-DRVWGRIKEW-----F  424
            +FD VN AL ++    +  A+   G  + +     +GS   SA + +W  I+ W     +
Sbjct  816  LFDAVNEALAELAWTAELAAYPWGGGRSRLDCNCKNGSGGDSAAEEIWRVIRNWSTLDKY  875

Query  423  PSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAVV  244
            P        + ++ N L E ++R+EA      E  RLE   +G  +   +LEE+V++ VV
Sbjct  876  PPC------ETIEGNVLLEMILRREA---DSGETARLEVFGLGASVCAVVLEELVEETVV  926

Query  243  GL  238
             L
Sbjct  927  DL  928



>ref|XP_006307114.1| hypothetical protein CARUB_v10008702mg, partial [Capsella rubella]
 gb|EOA40012.1| hypothetical protein CARUB_v10008702mg, partial [Capsella rubella]
Length=574

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 64/232 (28%), Positives = 107/232 (46%), Gaps = 31/232 (13%)
 Frame = -2

Query  930  ESCLFSPXGPILIDKS---PPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEERE  760
            ES L SP   IL       P + S+  T    D+ V       SL    +    EE+E  
Sbjct  367  ESYLDSPNRRILPQDPHSVPSVSSLEDTAEKTDTLVSQGLGLSSLE---TYNHEEEDEDA  423

Query  759  WLFFIQTLLSMAG-LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            +  +++ +L ++G LD   +D    +WH+ + PL+P L      + E E   EA      
Sbjct  424  YFCYVKKVLEVSGFLDNKDNDE---KWHAEEQPLNPSL------VYELEIQEEAV----V  470

Query  582  STRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCL  403
            + R+L+FD VN A+++       I F     T P G   +  D VWGR+ EW  S  G  
Sbjct  471  NNRELLFDLVNEAIVETHN-ESHIYFP---KTFPYGKRYL--DEVWGRV-EWNLSGVGAE  523

Query  402  SDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
            + D   D+ +   ++++   G GW   LR E+E +  E+E  + ++++ + +
Sbjct  524  NKDRSLDDIVGRDLLKK---GDGWMN-LRRESEWLTLELEDLIFDDVLDELL  571



>ref|XP_006307115.1| hypothetical protein CARUB_v10008702mg [Capsella rubella]
 gb|EOA40013.1| hypothetical protein CARUB_v10008702mg [Capsella rubella]
Length=557

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 64/232 (28%), Positives = 107/232 (46%), Gaps = 31/232 (13%)
 Frame = -2

Query  930  ESCLFSPXGPILIDKS---PPIGSVARTLSWDDSCVDTATSSYSLNPPVSMQRTEEEERE  760
            ES L SP   IL       P + S+  T    D+ V       SL    +    EE+E  
Sbjct  350  ESYLDSPNRRILPQDPHSVPSVSSLEDTAEKTDTLVSQGLGLSSLE---TYNHEEEDEDA  406

Query  759  WLFFIQTLLSMAG-LDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRR  583
            +  +++ +L ++G LD   +D    +WH+ + PL+P L      + E E   EA      
Sbjct  407  YFCYVKKVLEVSGFLDNKDNDE---KWHAEEQPLNPSL------VYELEIQEEAV----V  453

Query  582  STRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCL  403
            + R+L+FD VN A+++       I F     T P G   +  D VWGR+ EW  S  G  
Sbjct  454  NNRELLFDLVNEAIVETHN-ESHIYFP---KTFPYGKRYL--DEVWGRV-EWNLSGVGAE  506

Query  402  SDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
            + D   D+ +   ++++   G GW   LR E+E +  E+E  + ++++ + +
Sbjct  507  NKDRSLDDIVGRDLLKK---GDGWMN-LRRESEWLTLELEDLIFDDVLDELL  554



>ref|XP_011101155.1| PREDICTED: uncharacterized protein LOC105179248 isoform X2 [Sesamum 
indicum]
Length=645

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 91/178 (51%), Gaps = 18/178 (10%)
 Frame = -2

Query  762  EWLFFIQTLLSMAGL-DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQR  586
            E+  +IQ +L   G+ D+V   +L  +WH+P  PLDP +   Y+ L        A    R
Sbjct  464  EYKPYIQRILKRTGIIDKVTPLTLG-KWHTPSHPLDPSIF-YYLELFHPSAATLAV-LSR  520

Query  585  RSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGC  406
            R  RKL+F  V+  L +I   H  + F    + I D  S+  AD +  +I E FP AA C
Sbjct  521  RCNRKLIFQLVDELLAEILRPH--LDFKPWVSPITDHLSL--ADELCKKI-ESFP-AANC  574

Query  405  LSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQD--AVVGL  238
               + +D       ++ ++    G + +L  E ES+  EIEG+++E +V++  A+VG+
Sbjct  575  QVLEDIDS------LIEKDLGKSGLNWFLEEEGESLVCEIEGEIMESLVRETVAMVGV  626



>ref|XP_010317454.1| PREDICTED: uncharacterized protein LOC101266997 [Solanum lycopersicum]
 ref|XP_010317455.1| PREDICTED: uncharacterized protein LOC101266997 [Solanum lycopersicum]
Length=719

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 86/166 (52%), Gaps = 22/166 (13%)
 Frame = -2

Query  750  FIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRK  571
            +IQ +L   GLD+    SL+ +W+SP  PLDP +   Y+ L    T H +     RS RK
Sbjct  572  YIQRILKRTGLDKSSPISLA-KWYSPSHPLDPSIF-HYLELFN-STTHNS---TLRSNRK  625

Query  570  LVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
            L+F  V+  L+DI   +  +     H ++ +G  +I  D +  +I++ FPS A C   + 
Sbjct  626  LIFHLVDELLVDILIKNNNL----KHRSM-NGEGLI--DALCSKIQD-FPS-ANCQVLED  676

Query  390  VDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQD  253
            +D   L ER ++      G   +   E ESI  EIE +++EE++ D
Sbjct  677  IDA--LIERDMK-----IGGSVFFEEEVESIVCEIEREIMEEVLHD  715



>ref|XP_011101154.1| PREDICTED: uncharacterized protein LOC105179248 isoform X1 [Sesamum 
indicum]
Length=647

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 91/178 (51%), Gaps = 18/178 (10%)
 Frame = -2

Query  762  EWLFFIQTLLSMAGL-DEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQR  586
            E+  +IQ +L   G+ D+V   +L  +WH+P  PLDP +   Y+ L        A    R
Sbjct  466  EYKPYIQRILKRTGIIDKVTPLTLG-KWHTPSHPLDPSIF-YYLELFHPSAATLAV-LSR  522

Query  585  RSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGC  406
            R  RKL+F  V+  L +I   H  + F    + I D  S+  AD +  +I E FP AA C
Sbjct  523  RCNRKLIFQLVDELLAEILRPH--LDFKPWVSPITDHLSL--ADELCKKI-ESFP-AANC  576

Query  405  LSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQD--AVVGL  238
               + +D       ++ ++    G + +L  E ES+  EIEG+++E +V++  A+VG+
Sbjct  577  QVLEDIDS------LIEKDLGKSGLNWFLEEEGESLVCEIEGEIMESLVRETVAMVGV  628



>emb|CDY57257.1| BnaC08g47610D [Brassica napus]
Length=512

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 101/195 (52%), Gaps = 32/195 (16%)
 Frame = -2

Query  807  LNPPVSMQRTEEEEREWLF-FIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYIN  631
            ++P + +   E+E+ +  F +++ +L ++G   ++++    +W+S + PLDP L  + +N
Sbjct  343  ISPGLGLNSLEKEDEDVYFCYVKKVLKLSGF--LENEYKEVKWYSEEQPLDPSLLYE-LN  399

Query  630  LNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-DTCH----KTIAFSGAHNTIPDGSSI  466
            + E+E V+          ++L+FD VN A+ +  +  H    KT++F+      P G   
Sbjct  400  IQEQEEVN----------KELLFDLVNEAITETRNQSHIYFPKTLSFA-----YPKGKRF  444

Query  465  ISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEI  286
            +  D VW R+ EW  S  G  + D   D +L + + R    G GW   LR E+E +  E+
Sbjct  445  L--DEVWRRV-EW--SLLGLGAQDS--DRSLDDIVGRDFTKGDGWMN-LRGESEWLTLEL  496

Query  285  EGKLLEEIVQDAVVG  241
            E  + +E++ + + G
Sbjct  497  EDLIFDEVLDEMLCG  511



>ref|XP_006362707.1| PREDICTED: protein LONGIFOLIA 1-like [Solanum tuberosum]
Length=679

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 82/168 (49%), Gaps = 22/168 (13%)
 Frame = -2

Query  750  FIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAKRRQRRSTRK  571
            +IQ +L   GLD+    SL+ +W+SP  PLDP +   Y+ L    T H    +     RK
Sbjct  534  YIQRILKRTGLDKTTPISLA-KWYSPSHPLDPSIF-HYLELFN-STTHNLTLK---CNRK  587

Query  570  LVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDG  391
            L+F  V+  L+DI    K   F   H ++ DG  +I  D +  RI+  FPSA  C   + 
Sbjct  588  LIFHLVDELLVDI--LMKNNNF--KHRSM-DGEELI--DTLCSRIRS-FPSA-NCQVLED  638

Query  390  VDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
            +D        +  + +  G   +   + ESI  EIE +++EE+V D V
Sbjct  639  ID-------ALIDKDMEIGASVFFEEQVESIVCEIEREIMEEVVHDTV  679



>emb|CDX95141.1| BnaC05g05300D [Brassica napus]
Length=539

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 93/204 (46%), Gaps = 33/204 (16%)
 Frame = -2

Query  840  SCVDTATSSYSLNPPVSMQRTEEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPL  661
            S +D       L+        EE+E  +  +++ +L ++G  E   +  S  WHS + PL
Sbjct  360  SSLDNTAQGLGLSSLEIYNHVEEDEDAYFCYVKKVLQLSGFLENVHNGES--WHSEEQPL  417

Query  660  DP-LLRDKYINLNEKETVHEAKRRQRRSTRKLVFDCVNAALIDI-DTCH----KTIAFSG  499
            +P LL + YI   EKE            +++L+FD VN A+ +  +  H    KT +F+ 
Sbjct  418  NPSLLYEVYIQ-EEKEV-----------SKELLFDLVNEAIAETRNQSHIYFPKTFSFA-  464

Query  498  AHNTIPDGSSIISADRVWGRIKEWFPSAAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYL  319
                 P     +  D VWGR+ EW  S  G  +     D +L + + R    G GW   L
Sbjct  465  ----YPIEKRFL--DEVWGRV-EWSLSGLGAEN----RDRSLDDIVGRDLTKGDGWMN-L  512

Query  318  RLEAESIGKEIEGKLLEEIVQDAV  247
            R E E +  EIE  + +E++ + +
Sbjct  513  RGETEWLTLEIEDLIFDEVLDEMI  536



>dbj|BAD42902.1| putative GTP-binding protein [Arabidopsis thaliana]
Length=552

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/177 (26%), Positives = 92/177 (52%), Gaps = 23/177 (13%)
 Frame = -2

Query  777  EEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAK  598
            EE+E  +  +++ +L ++G  E + +    +W+S + PL+P L  + +++ E+ETV++  
Sbjct  396  EEDEDAYFCYVKKVLKVSGFLENKDNE--EKWYSEEQPLNPSLLYE-LDIQEEETVND--  450

Query  597  RRQRRSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPS  418
                   ++L+FD VN A+++    H  I F     T P G   +  D VWGR+ EW  S
Sbjct  451  -------KELLFDLVNEAIVETQN-HSQIYFP---KTFPYGKRYL--DEVWGRV-EWSLS  496

Query  417  AAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
              G  + D   D+ +   ++ +     GW   L+ E+E +  E+E  + ++++ + +
Sbjct  497  GLGAENRDRSLDDIVGRDLLTK---SDGWMN-LQGESEWLTLELEDLIFDDVLDELL  549



>ref|NP_172241.2| GTPase OBGM [Arabidopsis thaliana]
 sp|F4HSD5.1|TRM32_ARATH RecName: Full=Protein TRM32; AltName: Full=TON1-RECRUITING MOTIF 
protein 32 [Arabidopsis thaliana]
 gb|AEE28150.1| GTP-binding protein Obg/CgtA [Arabidopsis thaliana]
Length=552

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/177 (26%), Positives = 92/177 (52%), Gaps = 23/177 (13%)
 Frame = -2

Query  777  EEEEREWLFFIQTLLSMAGLDEVQSDSLSSRWHSPDSPLDPLLRDKYINLNEKETVHEAK  598
            EE+E  +  +++ +L ++G  E + +    +W+S + PL+P L  + +++ E+ETV++  
Sbjct  396  EEDEDAYFCYVKKVLKVSGFLENKDNE--EKWYSEEQPLNPSLLYE-LDIQEEETVND--  450

Query  597  RRQRRSTRKLVFDCVNAALIDIDTCHKTIAFSGAHNTIPDGSSIISADRVWGRIKEWFPS  418
                   ++L+FD VN A+++    H  I F     T P G   +  D VWGR+ EW  S
Sbjct  451  -------KELLFDLVNEAIVETQN-HSQIYFP---KTFPYGKRYL--DEVWGRV-EWSLS  496

Query  417  AAGCLSDDGVDDNNLTERMVRQEAVGKGWHEYLRLEAESIGKEIEGKLLEEIVQDAV  247
              G  + D   D+ +   ++ +     GW   L+ E+E +  E+E  + ++++ + +
Sbjct  497  GLGAENRDRSLDDIVGRDLLTK---SDGWMN-LQGESEWLTLELEDLIFDDVLDELL  549



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2295928061616