BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7187

Length=1709
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009627128.1|  PREDICTED: methylthioribose-1-phosphate isom...    558   0.0      Nicotiana tomentosiformis
ref|XP_006346696.1|  PREDICTED: methylthioribose-1-phosphate isom...    558   0.0      Solanum tuberosum [potatoes]
ref|XP_009781605.1|  PREDICTED: methylthioribose-1-phosphate isom...    557   0.0      Nicotiana sylvestris
ref|XP_004244859.1|  PREDICTED: methylthioribose-1-phosphate isom...    546   0.0      Solanum lycopersicum
ref|XP_010666847.1|  PREDICTED: methylthioribose-1-phosphate isom...    544   0.0      Beta vulgaris subsp. vulgaris [field beet]
gb|KHG04432.1|  Methylthioribose-1-phosphate isomerase                  540   0.0      Gossypium arboreum [tree cotton]
gb|EYU28322.1|  hypothetical protein MIMGU_mgv1a008441mg                538   0.0      Erythranthe guttata [common monkey flower]
ref|XP_007012613.1|  NagB/RpiA/CoA transferase-like superfamily p...    538   0.0      
gb|KJB82981.1|  hypothetical protein B456_013G223100                    535   0.0      Gossypium raimondii
ref|XP_012077066.1|  PREDICTED: methylthioribose-1-phosphate isom...    534   0.0      Jatropha curcas
ref|XP_010090181.1|  Methylthioribose-1-phosphate isomerase             533   0.0      Morus notabilis
ref|XP_002516257.1|  Methylthioribose-1-phosphate isomerase, puta...    533   0.0      Ricinus communis
gb|AAM65143.1|  putative translation initiation factor eIF-2B alp...    533   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_027726.1|  methylthioribose-1-phosphate isomerase                532   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337200.1|  PREDICTED: methylthioribose-1-phosphate isom...    531   0.0      Pyrus x bretschneideri [bai li]
ref|XP_007202151.1|  hypothetical protein PRUPE_ppa007089mg             530   0.0      Prunus persica
ref|XP_008242258.1|  PREDICTED: methylthioribose-1-phosphate isom...    529   0.0      Prunus mume [ume]
ref|XP_010467106.1|  PREDICTED: methylthioribose-1-phosphate isom...    529   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_008337840.1|  PREDICTED: methylthioribose-1-phosphate isom...    527   0.0      
ref|XP_002883712.1|  eukaryotic translation initiation factor 2B ...    526   2e-180   
ref|XP_008388900.1|  PREDICTED: methylthioribose-1-phosphate isom...    526   2e-180   
emb|CDP03069.1|  unnamed protein product                                525   7e-180   Coffea canephora [robusta coffee]
ref|XP_010488779.1|  PREDICTED: methylthioribose-1-phosphate isom...    524   9e-180   Camelina sativa [gold-of-pleasure]
ref|XP_011019339.1|  PREDICTED: methylthioribose-1-phosphate isom...    524   1e-179   Populus euphratica
ref|XP_010412762.1|  PREDICTED: methylthioribose-1-phosphate isom...    524   1e-179   Camelina sativa [gold-of-pleasure]
ref|XP_006396133.1|  hypothetical protein EUTSA_v10002579mg             523   3e-179   Eutrema salsugineum [saltwater cress]
ref|XP_006474713.1|  PREDICTED: methylthioribose-1-phosphate isom...    523   3e-179   Citrus sinensis [apfelsine]
ref|XP_010047466.1|  PREDICTED: methylthioribose-1-phosphate isom...    522   6e-179   Eucalyptus grandis [rose gum]
gb|KFK39882.1|  hypothetical protein AALP_AA3G300900                    522   8e-179   Arabis alpina [alpine rockcress]
gb|KHN12290.1|  Methylthioribose-1-phosphate isomerase                  522   9e-179   Glycine soja [wild soybean]
ref|XP_006452822.1|  hypothetical protein CICLE_v10008682mg             521   1e-178   Citrus clementina [clementine]
ref|XP_009359722.1|  PREDICTED: methylthioribose-1-phosphate isom...    520   4e-178   Pyrus x bretschneideri [bai li]
ref|XP_010261799.1|  PREDICTED: methylthioribose-1-phosphate isom...    520   7e-178   Nelumbo nucifera [Indian lotus]
ref|XP_011078119.1|  PREDICTED: methylthioribose-1-phosphate isom...    519   9e-178   Sesamum indicum [beniseed]
ref|XP_002308521.2|  eukaryotic translation initiation factor 2B ...    519   1e-177   
gb|KDO73876.1|  hypothetical protein CISIN_1g017293mg                   518   2e-177   Citrus sinensis [apfelsine]
gb|KCW79381.1|  hypothetical protein EUGRSUZ_C00793                     521   3e-177   Eucalyptus grandis [rose gum]
ref|XP_009102357.1|  PREDICTED: methylthioribose-1-phosphate isom...    517   6e-177   Brassica rapa
ref|XP_008450940.1|  PREDICTED: methylthioribose-1-phosphate isom...    516   2e-176   Cucumis melo [Oriental melon]
ref|XP_010930603.1|  PREDICTED: methylthioribose-1-phosphate isom...    514   1e-175   
gb|KJB82984.1|  hypothetical protein B456_013G223100                    513   2e-175   Gossypium raimondii
gb|AES65569.2|  methylthioribose-1-phosphate isomerase                  513   2e-175   Medicago truncatula
emb|CDY33397.1|  BnaA07g04420D                                          512   5e-175   Brassica napus [oilseed rape]
ref|XP_007012614.1|  NagB/RpiA/CoA transferase-like superfamily p...    515   6e-175   
ref|XP_008786516.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    511   2e-174   Phoenix dactylifera
ref|XP_004287647.1|  PREDICTED: methylthioribose-1-phosphate isom...    510   3e-174   Fragaria vesca subsp. vesca
ref|XP_006280656.1|  hypothetical protein CARUB_v10026616mg             510   3e-174   Capsella rubella
emb|CDY70356.1|  BnaCnng67980D                                          509   5e-174   Brassica napus [oilseed rape]
ref|XP_011660028.1|  PREDICTED: methylthioribose-1-phosphate isom...    507   9e-173   Cucumis sativus [cucumbers]
ref|XP_002277806.1|  PREDICTED: methylthioribose-1-phosphate isom...    504   7e-172   Vitis vinifera
ref|XP_003595318.1|  Methylthioribose-1-phosphate isomerase             504   8e-172   
gb|KDO73879.1|  hypothetical protein CISIN_1g017293mg                   503   8e-172   Citrus sinensis [apfelsine]
ref|XP_004488081.1|  PREDICTED: methylthioribose-1-phosphate isom...    504   8e-172   Cicer arietinum [garbanzo]
ref|XP_007138649.1|  hypothetical protein PHAVU_009G226400g             504   1e-171   Phaseolus vulgaris [French bean]
emb|CBI27788.3|  unnamed protein product                                504   2e-171   Vitis vinifera
ref|XP_006452823.1|  hypothetical protein CICLE_v10008682mg             502   4e-171   
ref|XP_010541997.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    495   3e-168   Tarenaya hassleriana [spider flower]
ref|XP_004979099.1|  PREDICTED: methylthioribose-1-phosphate isom...    493   2e-167   Setaria italica
ref|XP_009406483.1|  PREDICTED: methylthioribose-1-phosphate isom...    491   8e-167   Musa acuminata subsp. malaccensis [pisang utan]
sp|B6TZD1.1|MTNA_MAIZE  RecName: Full=Methylthioribose-1-phosphat...    488   2e-165   Zea mays [maize]
ref|NP_001105275.1|  methylthioribose-1-phosphate isomerase             486   1e-164   
gb|ACG37871.1|  methylthioribose-1-phosphate isomerase                  485   1e-164   Zea mays [maize]
gb|EMS50123.1|  Methylthioribose-1-phosphate isomerase                  484   4e-164   Triticum urartu
ref|XP_003577698.1|  PREDICTED: methylthioribose-1-phosphate isom...    483   2e-163   Brachypodium distachyon [annual false brome]
gb|KJB82983.1|  hypothetical protein B456_013G223100                    482   2e-163   Gossypium raimondii
ref|XP_006662829.1|  PREDICTED: methylthioribose-1-phosphate isom...    478   2e-161   Oryza brachyantha
dbj|BAJ86257.1|  predicted protein                                      476   6e-161   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|A2ZCP0.1|MTNA_ORYSI  RecName: Full=Methylthioribose-1-phosphat...    476   6e-161   Oryza sativa Indica Group [Indian rice]
sp|Q9AYT7.1|MTNA_HORVU  RecName: Full=Methylthioribose-1-phosphat...    476   9e-161   Hordeum vulgare [barley]
ref|NP_001067511.1|  Os11g0216900                                       475   1e-160   
gb|ABA92066.2|  Initiation factor 2 subunit family protein, expre...    474   3e-158   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001077883.1|  methylthioribose-1-phosphate isomerase             461   9e-156   Arabidopsis thaliana [mouse-ear cress]
gb|EPS64192.1|  methylthioribose-1-phosphate isomerase                  461   3e-155   Genlisea aurea
ref|NP_973428.1|  methylthioribose-1-phosphate isomerase                459   5e-155   Arabidopsis thaliana [mouse-ear cress]
gb|ADE77025.1|  unknown                                                 459   3e-154   Picea sitchensis
ref|XP_006842716.1|  PREDICTED: methylthioribose-1-phosphate isom...    458   7e-154   Amborella trichopoda
ref|XP_006396132.1|  hypothetical protein EUTSA_v10002579mg             446   2e-149   
ref|XP_001754539.1|  predicted protein                                  432   5e-144   
ref|XP_002992382.1|  hypothetical protein SELMODRAFT_135203             425   5e-141   
gb|KJB82985.1|  hypothetical protein B456_013G223100                    421   2e-140   Gossypium raimondii
ref|XP_002967758.1|  hypothetical protein SELMODRAFT_87975              422   5e-140   
gb|EMT32201.1|  Methylthioribose-1-phosphate isomerase                  426   6e-140   
gb|KJB07314.1|  hypothetical protein B456_001G015800                    402   2e-132   Gossypium raimondii
gb|AFK48892.1|  unknown                                                 371   9e-121   Medicago truncatula
gb|KJB07315.1|  hypothetical protein B456_001G015800                    370   1e-120   Gossypium raimondii
ref|XP_007780227.1|  methylthioribose-1-phosphate isomerase             358   2e-114   Coniosporium apollinis CBS 100218
emb|CDS04006.1|  hypothetical protein LRAMOSA06961                      355   1e-113   Lichtheimia ramosa
gb|KEQ84160.1|  Methylthioribose-1-phosphate isomerase                  356   1e-113   Aureobasidium pullulans EXF-150
emb|CDH49387.1|  methylthioribose-1-phosphate isomerase                 354   7e-113   Lichtheimia corymbifera JMRC:FSU:9682
gb|KEQ63615.1|  Methylthioribose-1-phosphate isomerase                  353   2e-112   Aureobasidium melanogenum CBS 110374
gb|EMF09885.1|  methylthioribose-1-phosphate isomerase                  352   4e-112   Sphaerulina musiva SO2202
ref|XP_004993054.1|  methylthioribose-1-phosphate isomerase             351   5e-112   Salpingoeca rosetta
gb|KEQ71351.1|  Methylthioribose-1-phosphate isomerase                  351   6e-112   Aureobasidium namibiae CBS 147.97
gb|KJB82982.1|  hypothetical protein B456_013G223100                    344   7e-111   Gossypium raimondii
gb|KEQ98081.1|  hypothetical protein AUEXF2481DRAFT_63242               348   9e-111   Aureobasidium subglaciale EXF-2481
ref|XP_001933231.1|  methylthioribose-1-phosphate isomerase             348   1e-110   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007681661.1|  hypothetical protein BAUCODRAFT_319460             347   2e-110   Baudoinia panamericana UAMH 10762
ref|XP_001742754.1|  hypothetical protein                               345   4e-110   Monosiga brevicollis MX1
ref|XP_001216022.1|  hypothetical protein ATEG_07401                    346   5e-110   Aspergillus terreus NIH2624
sp|C0P108.1|MTNA_AJECG  RecName: Full=Methylthioribose-1-phosphat...    345   1e-109   Histoplasma capsulatum G186AR
ref|XP_001540232.1|  hypothetical protein HCAG_04072                    345   1e-109   Histoplasma capsulatum NAm1
gb|EKG14703.1|  Initiation factor 2B-related protein                    344   2e-109   Macrophomina phaseolina MS6
gb|KIW03172.1|  S-methyl-5-thioribose-1-phosphate isomerase             343   9e-109   Verruconis gallopava
ref|XP_002151818.1|  translation initiation factor, putative            343   1e-108   Talaromyces marneffei ATCC 18224
ref|XP_003218379.1|  PREDICTED: methylthioribose-1-phosphate isom...    341   2e-108   Anolis carolinensis [Carolina anole]
ref|XP_661894.1|  hypothetical protein AN4290.2                         341   4e-108   Aspergillus nidulans FGSC A4
gb|EHA19257.1|  hypothetical protein ASPNIDRAFT_54270                   340   7e-108   Aspergillus niger ATCC 1015
gb|EGC42562.1|  translation initiation factor                           340   2e-107   Histoplasma capsulatum H88
dbj|GAM84914.1|  hypothetical protein ANO11243_029160                   338   9e-107   fungal sp. No.11243
ref|XP_003850691.1|  hypothetical protein MYCGRDRAFT_73955              338   9e-107   Zymoseptoria tritici IPO323
ref|XP_002627028.1|  S-methyl-5-thioribose-1-phosphate isomerase        338   1e-106   Blastomyces gilchristii SLH14081
ref|XP_003296469.1|  hypothetical protein PTT_06581                     338   1e-106   
sp|C5GGE5.1|MTNA_AJEDR  RecName: Full=Methylthioribose-1-phosphat...    338   1e-106   Blastomyces dermatitidis ER-3
dbj|GAM36840.1|  hypothetical protein TCE0_022f06253                    337   1e-106   Talaromyces cellulolyticus
ref|XP_001604505.1|  PREDICTED: methylthioribose-1-phosphate isom...    335   3e-106   Nasonia vitripennis
ref|XP_007691907.1|  hypothetical protein COCMIDRAFT_105818             336   5e-106   Bipolaris oryzae ATCC 44560
gb|EMD90991.1|  hypothetical protein COCHEDRAFT_1176662                 336   5e-106   Bipolaris maydis C5
gb|EIE81164.1|  S-methyl-5-thioribose-1-phosphate isomerase             335   8e-106   Rhizopus delemar RA 99-880
gb|KJY01485.1|  methylthioribose-1-phosphate isomerase like protein     335   8e-106   Zymoseptoria brevis
gb|EYE93514.1|  Methylthioribose-1-phosphate isomerase                  335   1e-105   Aspergillus ruber CBS 135680
gb|EME39638.1|  hypothetical protein DOTSEDRAFT_75327                   335   1e-105   Dothistroma septosporum NZE10
ref|XP_007708817.1|  hypothetical protein COCCADRAFT_2167               335   2e-105   Bipolaris zeicola 26-R-13
gb|EPS29452.1|  hypothetical protein PDE_04401                          335   2e-105   Penicillium oxalicum 114-2
gb|KGO76677.1|  Initiation factor 2B alpha/beta/delta                   334   2e-105   Penicillium italicum
ref|XP_003833699.1|  hypothetical protein LEMA_P064600.1                337   3e-105   Leptosphaeria maculans JN3
ref|XP_008031489.1|  hypothetical protein SETTUDRAFT_166325             334   3e-105   Exserohilum turcica Et28A
ref|XP_007929107.1|  hypothetical protein MYCFIDRAFT_204427             333   4e-105   Pseudocercospora fijiensis CIRAD86
ref|XP_002480786.1|  translation initiation factor, putative            333   4e-105   Talaromyces stipitatus ATCC 10500
ref|XP_007702121.1|  hypothetical protein COCSADRAFT_38815              333   4e-105   Bipolaris sorokiniana ND90Pr
gb|EUN32000.1|  hypothetical protein COCVIDRAFT_86317                   333   7e-105   Bipolaris victoriae FI3
gb|EHJ70136.1|  eIF2B-alpha-like protein                                332   8e-105   
gb|KGO39130.1|  Initiation factor 2B alpha/beta/delta                   332   9e-105   Penicillium expansum
emb|CEI86534.1|  Putative S-methyl-5-thioribose-1-phosphate isome...    332   1e-104   Rhizopus microsporus
ref|XP_001267437.1|  translation initiation factor, putative            332   1e-104   Aspergillus fischeri NRRL 181
dbj|GAN06082.1|  translation initiation factor                          332   1e-104   Mucor ambiguus
ref|XP_010759673.1|  methylthioribose-1-phosphate isomerase             332   1e-104   Paracoccidioides brasiliensis Pb18
ref|XP_003760740.1|  PREDICTED: methylthioribose-1-phosphate isom...    331   2e-104   Sarcophilus harrisii
ref|XP_011563158.1|  PREDICTED: methylthioribose-1-phosphate isom...    331   2e-104   Plutella xylostella [cabbage moth]
ref|XP_004530069.1|  PREDICTED: methylthioribose-1-phosphate isom...    331   2e-104   Ceratitis capitata [medfly]
ref|XP_001820594.2|  methylthioribose-1-phosphate isomerase             331   2e-104   
gb|EIT82996.1|  putative translation initiation factor                  331   3e-104   Aspergillus oryzae 3.042
sp|Q2UIM3.1|MTNA_ASPOR  RecName: Full=Methylthioribose-1-phosphat...    331   3e-104   Aspergillus oryzae RIB40
gb|KFH66789.1|  S-methyl-5-thioribose-1-phosphate isomerase             331   3e-104   Mortierella verticillata NRRL 6337
ref|XP_001418690.1|  predicted protein                                  330   4e-104   Ostreococcus lucimarinus CCE9901
gb|KGQ02006.1|  methylthioribose-1-phosphate isomerase                  331   4e-104   Paracoccidioides lutzii Pb01
dbj|GAE00299.1|  translation initiation factor, putative                330   6e-104   Byssochlamys spectabilis No. 5
ref|XP_752241.1|  translation initiation factor                         330   6e-104   Aspergillus fumigatus Af293
gb|KEY83965.1|  translation initiation factor                           330   8e-104   Aspergillus fumigatus var. RP-2014
emb|CEP08072.1|  hypothetical protein                                   330   8e-104   Parasitella parasitica
ref|XP_011184740.1|  PREDICTED: methylthioribose-1-phosphate isom...    329   8e-104   Zeugodacus cucurbitae [melon fruit fly]
gb|KJJ15719.1|  Initiation factor 2B alphabetadelta                     330   9e-104   
gb|EFX71518.1|  hypothetical protein DAPPUDRAFT_308831                  329   1e-103   Daphnia pulex
gb|EPB91090.1|  S-methyl-5-thioribose-1-phosphate isomerase             330   1e-103   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_003726311.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    329   1e-103   
emb|CEG65982.1|  Putative S-methyl-5-thioribose-1-phosphate isome...    329   1e-103   Rhizopus microsporus
gb|EKV08512.1|  Methylthioribose-1-phosphate isomerase                  329   2e-103   Penicillium digitatum Pd1
ref|XP_011210381.1|  PREDICTED: methylthioribose-1-phosphate isom...    328   2e-103   Bactrocera dorsalis [papaya fruit fly]
emb|CDM34949.1|  Methylthioribose-1-phosphate isomerase                 329   2e-103   Penicillium roqueforti FM164
ref|XP_001357949.1|  GA10928                                            327   6e-103   Drosophila pseudoobscura pseudoobscura
ref|XP_002072272.1|  GK22419                                            327   6e-103   Drosophila willistoni
ref|NP_001037650.1|  methylthioribose-1-phosphate isomerase             327   8e-103   Bombyx mori [silk moth]
ref|XP_001271470.1|  translation initiation factor, putative            327   8e-103   Aspergillus clavatus NRRL 1
ref|XP_006023465.1|  PREDICTED: methylthioribose-1-phosphate isom...    327   9e-103   Alligator sinensis
ref|XP_002023756.1|  GL27236                                            327   1e-102   Drosophila persimilis
ref|XP_006003718.1|  PREDICTED: methylthioribose-1-phosphate isom...    326   1e-102   Latimeria chalumnae
ref|XP_005310723.1|  PREDICTED: methylthioribose-1-phosphate isom...    326   1e-102   Chrysemys picta bellii
ref|XP_002001025.1|  GI10562                                            326   1e-102   Drosophila mojavensis
gb|KIW51203.1|  S-methyl-5-thioribose-1-phosphate isomerase             327   2e-102   Exophiala xenobiotica
emb|CEJ01322.1|  Putative S-methyl-5-thioribose-1-phosphate isome...    327   2e-102   Rhizopus microsporus
ref|XP_001993776.1|  GH21593                                            326   2e-102   Drosophila grimshawi
gb|KIX06934.1|  S-methyl-5-thioribose-1-phosphate isomerase             327   2e-102   Rhinocladiella mackenziei CBS 650.93
ref|XP_007422307.1|  PREDICTED: methylthioribose-1-phosphate isom...    325   2e-102   
ref|XP_003236958.1|  methylthioribose-1-phosphate isomerase             326   2e-102   Trichophyton rubrum CBS 118892
ref|XP_009056765.1|  hypothetical protein LOTGIDRAFT_190615             327   2e-102   Lottia gigantea
ref|XP_007753953.1|  S-methyl-5-thioribose-1-phosphate isomerase        326   4e-102   Cladophialophora yegresii CBS 114405
ref|XP_969152.1|  PREDICTED: methylthioribose-1-phosphate isomerase     324   5e-102   Tribolium castaneum [rust-red flour beetle]
ref|XP_006621213.1|  PREDICTED: methylthioribose-1-phosphate isom...    324   5e-102   Apis dorsata [rock honeybee]
sp|C0S1C8.1|MTNA_PARBP  RecName: Full=Methylthioribose-1-phosphat...    325   6e-102   Paracoccidioides brasiliensis Pb03
ref|XP_002560080.1|  Pc14g00860                                         325   6e-102   Penicillium rubens Wisconsin 54-1255
ref|XP_005185612.1|  PREDICTED: methylthioribose-1-phosphate isom...    324   7e-102   Musca domestica
gb|EGE01404.1|  S-methyl-5-thioribose-1-phosphate isomerase             325   7e-102   Trichophyton equinum CBS 127.97
ref|XP_006262838.1|  PREDICTED: methylthioribose-1-phosphate isom...    325   7e-102   Alligator mississippiensis
gb|EGD96919.1|  translation initiation factor                           325   7e-102   Trichophyton tonsurans CBS 112818
gb|KKA21682.1|  S-methyl-5-thioribose-1-phosphate isomerase             325   8e-102   Rasamsonia emersonii CBS 393.64
ref|XP_001664017.1|  AAEL013828-PA                                      323   1e-101   
ref|XP_001953494.1|  GF17194                                            323   1e-101   Drosophila ananassae
ref|XP_002099512.1|  GE23315                                            323   2e-101   Drosophila yakuba
ref|XP_011114920.1|  hypothetical protein H072_9321                     324   2e-101   
emb|CEF98703.1|  Putative translation initiation factor,aIF-2BI/5...    337   2e-101   Ostreococcus tauri
ref|XP_003697763.1|  PREDICTED: methylthioribose-1-phosphate isom...    323   2e-101   
ref|XP_002054225.1|  GJ22917                                            323   2e-101   Drosophila virilis
ref|XP_003486247.1|  PREDICTED: methylthioribose-1-phosphate isom...    323   2e-101   Bombus impatiens
emb|CCX34105.1|  Similar to Methylthioribose-1-phosphate isomeras...    323   2e-101   Pyronema omphalodes CBS 100304
ref|XP_002105622.1|  GD16414                                            323   2e-101   
ref|XP_003397603.1|  PREDICTED: methylthioribose-1-phosphate isom...    322   3e-101   Bombus terrestris [large earth bumblebee]
ref|XP_008724306.1|  S-methyl-5-thioribose-1-phosphate isomerase        323   3e-101   Cladophialophora carrionii CBS 160.54
ref|XP_392553.1|  PREDICTED: methylthioribose-1-phosphate isomera...    322   4e-101   Apis mellifera [bee]
ref|XP_001641945.1|  predicted protein                                  322   4e-101   Nematostella vectensis
ref|XP_002842304.1|  hypothetical protein                               322   4e-101   Tuber melanosporum Mel28
ref|XP_003700639.1|  PREDICTED: methylthioribose-1-phosphate isom...    322   4e-101   Megachile rotundata
ref|XP_006678377.1|  hypothetical protein BATDEDRAFT_19408              323   5e-101   Batrachochytrium dendrobatidis JAM81
emb|CBJ48521.1|  eukaryotic translation initiation factor 2B fami...    334   7e-101   Ectocarpus siliculosus
ref|XP_002037477.1|  GM12085                                            322   9e-101   Drosophila sechellia
gb|KJE93735.1|  translation initiation factor eif-2b                    322   9e-101   Capsaspora owczarzaki ATCC 30864
ref|XP_003172192.1|  methylthioribose-1-phosphate isomerase             322   1e-100   Nannizzia gypsea CBS 118893
ref|XP_007583690.1|  putative methylthioribose-1-phosphate isomer...    346   1e-100   
ref|XP_002843502.1|  methylthioribose-1-phosphate isomerase             321   2e-100   Microsporum canis CBS 113480
ref|XP_003455807.1|  PREDICTED: methylthioribose-1-phosphate isom...    320   2e-100   Oreochromis niloticus
ref|XP_003798062.1|  PREDICTED: methylthioribose-1-phosphate isom...    320   2e-100   Otolemur garnettii
ref|XP_011496297.1|  PREDICTED: methylthioribose-1-phosphate isom...    320   3e-100   Ceratosolen solmsi marchali
ref|NP_651868.1|  CG11334, isoform B                                    320   3e-100   Drosophila melanogaster
gb|KIW71970.1|  S-methyl-5-thioribose-1-phosphate isomerase             321   4e-100   Phialophora americana
gb|KIV77933.1|  S-methyl-5-thioribose-1-phosphate isomerase             321   4e-100   Exophiala sideris
ref|XP_010740335.1|  PREDICTED: methylthioribose-1-phosphate isom...    319   4e-100   Larimichthys crocea [croceine croaker]
ref|XP_003972078.1|  PREDICTED: methylthioribose-1-phosphate isom...    319   5e-100   Takifugu rubripes [tiger puffer]
ref|XP_007737063.1|  S-methyl-5-thioribose-1-phosphate isomerase        320   1e-99    Capronia epimyces CBS 606.96
ref|XP_003057882.1|  translation initiation factor fusion with me...    332   1e-99    Micromonas pusilla CCMP1545
ref|XP_003080319.1|  methylthioribose kinase (ISS)                      337   2e-99    
ref|NP_001104708.1|  methylthioribose-1-phosphate isomerase             318   2e-99    Danio rerio [leopard danio]
ref|XP_008853656.1|  PREDICTED: methylthioribose-1-phosphate isom...    318   2e-99    Nannospalax galili
ref|XP_003123394.2|  PREDICTED: methylthioribose-1-phosphate isom...    319   2e-99    
gb|KIX97693.1|  hypothetical protein Z520_06471                         319   3e-99    Fonsecaea multimorphosa CBS 102226
ref|XP_004060186.1|  PREDICTED: methylthioribose-1-phosphate isom...    318   3e-99    
gb|KDR24083.1|  Methylthioribose-1-phosphate isomerase                  317   3e-99    Zootermopsis nevadensis
ref|XP_011120963.1|  hypothetical protein AOL_s00076g108                318   3e-99    Arthrobotrys oligospora ATCC 24927
gb|KIW17463.1|  S-methyl-5-thioribose-1-phosphate isomerase             318   4e-99    Exophiala spinifera
ref|XP_011143671.1|  PREDICTED: methylthioribose-1-phosphate isom...    317   4e-99    Harpegnathos saltator
ref|NP_001026897.1|  methylthioribose-1-phosphate isomerase isofo...    317   5e-99    Homo sapiens [man]
gb|KFB37657.1|  AGAP001589-PA-like protein                              317   5e-99    Anopheles sinensis
ref|XP_012054845.1|  PREDICTED: methylthioribose-1-phosphate isom...    317   7e-99    Atta cephalotes
ref|XP_001981082.1|  GG11866                                            316   9e-99    Drosophila erecta
gb|AIC57312.1|  MRI1                                                    316   1e-98    synthetic construct
ref|XP_002733184.1|  PREDICTED: methylthioribose-1-phosphate isom...    316   1e-98    Saccoglossus kowalevskii
pdb|4LDR|A  Chain A, Structure Of The S283y Mutant Of Mrdi              316   1e-98    Homo sapiens [man]
ref|XP_005805132.1|  PREDICTED: methylthioribose-1-phosphate isom...    315   1e-98    Xiphophorus maculatus
ref|NP_001016877.1|  methylthioribose-1-phosphate isomerase             315   2e-98    Xenopus tropicalis [western clawed frog]
sp|Q0VFN1.1|MTNA_XENTR  RecName: Full=Methylthioribose-1-phosphat...    315   2e-98    Xenopus tropicalis [western clawed frog]
ref|XP_007229603.1|  PREDICTED: methylthioribose-1-phosphate isom...    315   2e-98    Astyanax mexicanus [blind cave fish]
gb|KEF62771.1|  S-methyl-5-thioribose-1-phosphate isomerase             317   2e-98    Exophiala aquamarina CBS 119918
ref|XP_007744831.1|  S-methyl-5-thioribose-1-phosphate isomerase        317   2e-98    Cladophialophora psammophila CBS 110553
ref|XP_006206282.1|  PREDICTED: methylthioribose-1-phosphate isom...    315   2e-98    Vicugna pacos
ref|XP_003068154.1|  methylthioribose-1-phosphate isomerase, puta...    316   2e-98    Coccidioides posadasii C735 delta SOWgp
ref|XP_004389786.1|  PREDICTED: methylthioribose-1-phosphate isom...    315   3e-98    Trichechus manatus latirostris
gb|KIW94717.1|  S-methyl-5-thioribose-1-phosphate isomerase             316   3e-98    Cladophialophora bantiana CBS 173.52
ref|NP_001090076.1|  methylthioribose-1-phosphate isomerase             314   4e-98    Xenopus laevis [clawed frog]
ref|XP_007570269.1|  PREDICTED: methylthioribose-1-phosphate isom...    314   4e-98    Poecilia formosa
ref|XP_001943893.1|  PREDICTED: methylthioribose-1-phosphate isom...    315   4e-98    Acyrthosiphon pisum
ref|XP_004616861.1|  PREDICTED: methylthioribose-1-phosphate isom...    314   5e-98    Sorex araneus [Eurasian shrew]
ref|XP_011052943.1|  PREDICTED: methylthioribose-1-phosphate isom...    314   6e-98    Acromyrmex echinatior
ref|XP_001226203.1|  hypothetical protein CHGG_10936                    315   7e-98    Chaetomium globosum CBS 148.51
ref|XP_001794215.1|  hypothetical protein SNOG_03661                    314   8e-98    Parastagonospora nodorum SN15
ref|XP_007952565.1|  PREDICTED: methylthioribose-1-phosphate isom...    313   8e-98    Orycteropus afer afer
ref|XP_010870944.1|  PREDICTED: methylthioribose-1-phosphate isom...    313   1e-97    
gb|EFN81802.1|  Translation initiation factor eIF-2B subunit alph...    313   1e-97    Harpegnathos saltator
emb|CAD27760.1|  putative translation initiation factor                 312   2e-97    Anopheles gambiae
ref|XP_009433120.1|  PREDICTED: methylthioribose-1-phosphate isom...    313   2e-97    
ref|XP_321518.1|  AGAP001589-PA                                         312   2e-97    Anopheles gambiae str. PEST
gb|AEE61699.1|  unknown                                                 312   2e-97    Dendroctonus ponderosae
gb|KIW83076.1|  S-methyl-5-thioribose-1-phosphate isomerase             313   3e-97    Fonsecaea pedrosoi CBS 271.37
ref|XP_004066207.1|  PREDICTED: methylthioribose-1-phosphate isom...    312   3e-97    
ref|XP_004348313.2|  translation initiation factor eif-2b               313   3e-97    Capsaspora owczarzaki ATCC 30864
ref|XP_004872495.1|  PREDICTED: methylthioribose-1-phosphate isom...    312   4e-97    Heterocephalus glaber [naked mole rat]
ref|XP_005336293.1|  PREDICTED: methylthioribose-1-phosphate isom...    313   5e-97    Ictidomys tridecemlineatus
ref|XP_004399024.1|  PREDICTED: methylthioribose-1-phosphate isom...    313   5e-97    Odobenus rosmarus divergens
ref|XP_003468199.1|  PREDICTED: methylthioribose-1-phosphate isom...    311   7e-97    Cavia porcellus [guinea pig]
ref|XP_010359906.1|  PREDICTED: methylthioribose-1-phosphate isom...    311   8e-97    
ref|XP_007720298.1|  S-methyl-5-thioribose-1-phosphate isomerase        312   8e-97    Capronia coronata CBS 617.96
gb|KIL92878.1|  methylthioribose-1-phosphate isomerase                  311   1e-96    Fusarium avenaceum
ref|XP_007275439.1|  methylthioribose-1-phosphate isomerase             311   1e-96    
ref|XP_005336292.1|  PREDICTED: methylthioribose-1-phosphate isom...    313   1e-96    
ref|XP_004748335.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    313   1e-96    
ref|XP_011342004.1|  PREDICTED: methylthioribose-1-phosphate isom...    311   1e-96    Ooceraea biroi
ref|XP_006918814.1|  PREDICTED: methylthioribose-1-phosphate isom...    310   1e-96    Pteropus alecto
gb|ERL94382.1|  hypothetical protein D910_11661                         313   1e-96    Dendroctonus ponderosae
gb|ENH63320.1|  Methylthioribose-1-phosphate isomerase                  311   2e-96    Fusarium oxysporum f. sp. cubense race 1
ref|XP_011380861.1|  PREDICTED: methylthioribose-1-phosphate isom...    310   2e-96    Pteropus vampyrus
ref|XP_005850664.1|  hypothetical protein CHLNCDRAFT_140697             324   2e-96    Chlorella variabilis
gb|EQB52140.1|  S-methyl-5-thioribose-1-phosphate isomerase             311   3e-96    Colletotrichum gloeosporioides Cg-14
emb|CCT63771.1|  probable cig2 protein (putative GDP-GTP exchange...    310   3e-96    Fusarium fujikuroi IMI 58289
ref|XP_008315470.1|  PREDICTED: methylthioribose-1-phosphate isom...    309   3e-96    
ref|XP_006175447.1|  PREDICTED: methylthioribose-1-phosphate isom...    309   4e-96    
ref|XP_003275653.1|  PREDICTED: methylthioribose-1-phosphate isom...    310   4e-96    
ref|XP_002921063.2|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    310   4e-96    
gb|EXA01732.1|  methylthioribose-1-phosphate isomerase                  310   5e-96    
gb|EWG45098.1|  methylthioribose-1-phosphate isomerase                  310   5e-96    
gb|EGU81202.1|  hypothetical protein FOXB_08352                         310   5e-96    
gb|EXA48565.1|  methylthioribose-1-phosphate isomerase                  310   5e-96    
gb|EWZ41170.1|  methylthioribose-1-phosphate isomerase                  310   5e-96    
ref|XP_002949511.1|  eukaryotic translation initiation factor 2B ...    310   6e-96    
gb|KGQ07769.1|  Methylthioribose-1-phosphate isomerase                  310   6e-96    
ref|XP_008596336.1|  S-methyl-5-thioribose-1-phosphate isomerase        310   7e-96    
gb|EMT60763.1|  Methylthioribose-1-phosphate isomerase                  309   1e-95    
ref|XP_010992133.1|  PREDICTED: methylthioribose-1-phosphate isom...    308   1e-95    
gb|ENH78574.1|  methylthioribose-1-phosphate isomerase                  309   1e-95    
ref|XP_002584032.1|  S-methyl-5-thioribose-1-phosphate isomerase        309   1e-95    
ref|XP_003012717.1|  hypothetical protein ARB_00968                     310   2e-95    
gb|EHH29705.1|  Methylthioribose-1-phosphate isomerase                  308   2e-95    
ref|XP_012000263.1|  PREDICTED: methylthioribose-1-phosphate isom...    308   3e-95    
ref|XP_011837196.1|  PREDICTED: methylthioribose-1-phosphate isom...    307   4e-95    
ref|XP_008104502.1|  PREDICTED: methylthioribose-1-phosphate isom...    306   5e-95    
ref|XP_011323537.1|  hypothetical protein FGSG_05053                    307   6e-95    
ref|XP_011770520.1|  PREDICTED: methylthioribose-1-phosphate isom...    308   6e-95    
ref|NP_080699.3|  methylthioribose-1-phosphate isomerase                306   6e-95    
gb|KIW42782.1|  S-methyl-5-thioribose-1-phosphate isomerase             307   7e-95    
gb|KJZ80065.1|  Methylthioribose-1-phosphate isomerase                  307   8e-95    
ref|XP_006079940.1|  PREDICTED: methylthioribose-1-phosphate isom...    307   8e-95    
ref|XP_008719411.1|  S-methyl-5-thioribose-1-phosphate isomerase        307   8e-95    
ref|XP_006690569.1|  putative translation initiation factor             306   9e-95    
ref|XP_002424016.1|  conserved hypothetical protein                     306   9e-95    
ref|XP_008709946.1|  PREDICTED: methylthioribose-1-phosphate isom...    305   9e-95    
emb|CAG06038.1|  unnamed protein product                                305   1e-94    
ref|XP_003915067.2|  PREDICTED: methylthioribose-1-phosphate isom...    306   1e-94    
ref|XP_010952462.1|  PREDICTED: methylthioribose-1-phosphate isom...    305   1e-94    
ref|XP_006900885.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    306   1e-94    
ref|XP_012134569.1|  PREDICTED: methylthioribose-1-phosphate isom...    305   1e-94    
ref|XP_006874338.1|  PREDICTED: methylthioribose-1-phosphate isom...    305   1e-94    
ref|XP_006993155.1|  PREDICTED: methylthioribose-1-phosphate isom...    305   2e-94    
ref|NP_001039852.1|  methylthioribose-1-phosphate isomerase             305   2e-94    
ref|XP_007993674.1|  PREDICTED: methylthioribose-1-phosphate isom...    306   2e-94    
ref|XP_004688304.1|  PREDICTED: methylthioribose-1-phosphate isom...    305   2e-94    
gb|EHH59270.1|  Methylthioribose-1-phosphate isomerase                  305   2e-94    
ref|XP_003654207.1|  hypothetical protein THITE_2117012                 306   2e-94    
ref|XP_004715550.1|  PREDICTED: methylthioribose-1-phosphate isom...    305   2e-94    
ref|XP_011262788.1|  PREDICTED: methylthioribose-1-phosphate isom...    305   2e-94    
ref|XP_007591582.1|  S-methyl-5-thioribose-1-phosphate isomerase        305   2e-94    
gb|ETN63911.1|  translation initiation factor eif-2b                    304   3e-94    
ref|XP_002761866.2|  PREDICTED: methylthioribose-1-phosphate isom...    305   3e-94    
ref|XP_008546891.1|  PREDICTED: methylthioribose-1-phosphate isom...    304   3e-94    
ref|XP_002724279.1|  PREDICTED: methylthioribose-1-phosphate isom...    305   3e-94    
ref|XP_008156200.1|  PREDICTED: methylthioribose-1-phosphate isom...    304   3e-94    
ref|XP_006100374.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    305   4e-94    
ref|XP_007098210.1|  PREDICTED: methylthioribose-1-phosphate isom...    304   4e-94    
gb|KDN67943.1|  putative S-methyl-5-thioribose-1-phosphate isomerase    305   5e-94    
ref|XP_003025058.1|  hypothetical protein TRV_00716                     309   6e-94    
gb|ELR62033.1|  Methylthioribose-1-phosphate isomerase                  304   6e-94    
ref|NP_001010947.1|  methylthioribose-1-phosphate isomerase             304   6e-94    
ref|XP_003665347.1|  hypothetical protein MYCTH_2135256                 305   6e-94    
gb|EYB31804.1|  hypothetical protein FG05_05053                         305   6e-94    
ref|XP_005888077.1|  PREDICTED: methylthioribose-1-phosphate isom...    303   7e-94    
dbj|BAC33016.1|  unnamed protein product                                303   8e-94    
dbj|GAA90121.1|  translation initiation factor                          302   1e-93    
ref|XP_003389526.1|  PREDICTED: methylthioribose-1-phosphate isom...    303   1e-93    
gb|EQL00687.1|  methylthioribose-1-phosphate isomerase                  304   1e-93    
gb|KHG23802.1|  Methylthioribose-1-phosphate isomerase                  297   2e-93    
ref|XP_007828445.1|  Methylthioribose-1-phosphate isomerase             303   2e-93    
ref|XP_003501976.1|  PREDICTED: methylthioribose-1-phosphate isom...    303   2e-93    
ref|XP_005962906.1|  PREDICTED: methylthioribose-1-phosphate isom...    303   2e-93    
ref|XP_005370998.1|  PREDICTED: methylthioribose-1-phosphate isom...    303   2e-93    
ref|XP_003008283.1|  methylthioribose-1-phosphate isomerase             303   2e-93    
ref|XP_009651895.1|  methylthioribose-1-phosphate isomerase             303   2e-93    
ref|XP_001366752.1|  PREDICTED: methylthioribose-1-phosphate isom...    302   3e-93    
ref|XP_009152452.1|  S-methyl-5-thioribose-1-phosphate isomerase        303   3e-93    
ref|XP_004327551.1|  PREDICTED: methylthioribose-1-phosphate isom...    302   3e-93    
ref|XP_005855554.1|  methylthioribose-1-phosphate isomerase             316   3e-93    
gb|EWM30107.1|  Methylthioribose kinase                                 316   4e-93    
gb|EFN63924.1|  Translation initiation factor eIF-2B subunit alph...    301   4e-93    
ref|XP_003982003.3|  PREDICTED: methylthioribose-1-phosphate isom...    301   5e-93    
gb|KFY36346.1|  hypothetical protein V494_05095                         304   7e-93    
gb|KHN06061.1|  Methylthioribose-1-phosphate isomerase                  296   8e-93    
ref|XP_002500043.1|  translation initiation factor fusion with me...    313   9e-93    
ref|XP_003639811.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    301   9e-93    
gb|KFY24283.1|  hypothetical protein V493_05338                         304   1e-92    
ref|XP_011303133.1|  PREDICTED: methylthioribose-1-phosphate isom...    300   1e-92    
gb|KFX97244.1|  hypothetical protein O988_04954                         303   1e-92    
gb|KFZ14857.1|  hypothetical protein V501_03036                         303   1e-92    
ref|XP_004277483.1|  PREDICTED: methylthioribose-1-phosphate isom...    300   1e-92    
gb|KFY77341.1|  hypothetical protein V499_03240                         303   1e-92    
gb|KIZ04682.1|  isopentenyl-diphosphate Delta-isomerase                 307   2e-92    
emb|CBY31516.1|  unnamed protein product                                299   2e-92    
ref|XP_007129465.1|  PREDICTED: methylthioribose-1-phosphate isom...    301   2e-92    
ref|XP_011641354.1|  PREDICTED: methylthioribose-1-phosphate isom...    300   2e-92    
gb|KFY51323.1|  hypothetical protein V496_08871                         303   2e-92    
ref|XP_004672487.1|  PREDICTED: methylthioribose-1-phosphate isom...    300   3e-92    
gb|KFY12396.1|  hypothetical protein V492_03899                         302   3e-92    
ref|XP_004595907.1|  PREDICTED: methylthioribose-1-phosphate isom...    299   4e-92    
gb|KFX96181.1|  hypothetical protein V490_03482                         302   4e-92    
ref|XP_006666062.1|  methylthioribose-1-phosphate isomerase             300   6e-92    
ref|XP_007469132.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    300   7e-92    
gb|KHJ32211.1|  putative methylthioribose-1-phosphate isomerase         300   8e-92    
gb|KDB15846.1|  methylthioribose-1-phosphate isomerase                  299   1e-91    
ref|XP_006621214.1|  PREDICTED: methylthioribose-1-phosphate isom...    297   1e-91    
ref|XP_006962902.1|  hypothetical protein TRIREDRAFT_75304              298   1e-91    
ref|XP_001560925.1|  hypothetical protein BC1G_00010                    300   1e-91    
gb|EFQ35563.1|  S-methyl-5-thioribose-1-phosphate isomerase             298   2e-91    
ref|XP_007790511.1|  putative methylthioribose-1-phosphate isomer...    299   2e-91    
gb|KEZ46350.1|  Methylthioribose-1-phosphate isomerase                  298   2e-91    
ref|XP_007182139.1|  PREDICTED: methylthioribose-1-phosphate isom...    299   2e-91    
ref|XP_500138.1|  YALI0A16698p                                          297   3e-91    
ref|XP_001594777.1|  hypothetical protein SS1G_04585                    299   4e-91    
ref|XP_006560809.1|  PREDICTED: methylthioribose-1-phosphate isom...    295   5e-91    
ref|XP_001510432.2|  PREDICTED: methylthioribose-1-phosphate isom...    295   5e-91    
gb|KEY69218.1|  hypothetical protein S7711_01674                        297   6e-91    
gb|KIW26197.1|  S-methyl-5-thioribose-1-phosphate isomerase             297   7e-91    
ref|XP_011865942.1|  PREDICTED: methylthioribose-1-phosphate isom...    296   7e-91    
gb|KFA77974.1|  hypothetical protein S40288_07704                       296   8e-91    
emb|CEJ93750.1|  Putative Methylthioribose-1-phosphate isomerase        296   8e-91    
ref|XP_004635691.1|  PREDICTED: methylthioribose-1-phosphate isom...    295   9e-91    
gb|ACU24114.1|  unknown                                                 290   1e-90    
ref|XP_003045774.1|  predicted protein                                  296   1e-90    
ref|XP_007915793.1|  putative methylthioribose-1-phosphate isomer...    296   1e-90    
gb|KIV94203.1|  S-methyl-5-thioribose-1-phosphate isomerase             296   2e-90    
gb|KKA30065.1|  hypothetical protein TD95_003574                        295   2e-90    
ref|XP_008965945.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    294   2e-90    
ref|XP_009853534.1|  hypothetical protein NEUTE1DRAFT_67681             295   2e-90    
ref|XP_004448805.1|  PREDICTED: methylthioribose-1-phosphate isom...    294   3e-90    
ref|XP_011695735.1|  PREDICTED: methylthioribose-1-phosphate isom...    294   3e-90    
gb|KFA62564.1|  hypothetical protein S40285_05811                       295   3e-90    
gb|EHK18155.1|  hypothetical protein TRIVIDRAFT_80802                   295   4e-90    
ref|XP_959639.1|  methylthioribose-1-phosphate isomerase                294   6e-90    
ref|XP_011454865.1|  PREDICTED: methylthioribose-1-phosphate isom...    293   6e-90    
ref|XP_005381122.1|  PREDICTED: methylthioribose-1-phosphate isom...    293   7e-90    
gb|KFH48781.1|  Methylthioribose-1-phosphate isomerase-like protein     294   8e-90    
ref|XP_001865446.1|  translation initiation factor eif-2b               291   9e-90    
sp|P0CI29.1|MTNA_SORMK  RecName: Full=Methylthioribose-1-phosphat...    293   2e-89    
gb|EPE04150.1|  methylthioribose-1-phosphate isomerase                  292   3e-89    
ref|XP_011166413.1|  PREDICTED: methylthioribose-1-phosphate isom...    291   3e-89    
ref|XP_011674909.1|  PREDICTED: methylthioribose-1-phosphate isom...    291   3e-89    
emb|CCE31988.1|  probable cig2 protein (putative GDP-GTP exchange...    292   4e-89    
gb|EKF29009.1|  translation initiation factor 2 subunit, putative       291   5e-89    
gb|KID80714.1|  methylthioribose-1-phosphate isomerase                  291   6e-89    
ref|XP_809913.1|  translation initiation factor 2 subunit               291   8e-89    
ref|XP_003708706.1|  S-methyl-5-thioribose-1-phosphate isomerase        291   1e-88    
gb|KJR83671.1|  methylthioribose-1-phosphate isomerase                  291   1e-88    
ref|XP_008087169.1|  NagB/RpiA/CoA transferase-like protein             292   1e-88    
gb|KFZ08582.1|  hypothetical protein V502_09266                         293   2e-88    
gb|ETS04646.1|  methylthioribose-1-phosphate isomerase                  290   2e-88    
gb|ERS95656.1|  methylthioribose-1-phosphate isomerase                  290   2e-88    
gb|EPX71175.1|  methylthioribose-1-phosphate isomerase                  289   2e-88    
sp|B2AML6.2|MTNA_PODAN  RecName: Full=Methylthioribose-1-phosphat...    290   4e-88    
gb|KFG78348.1|  methylthioribose-1-phosphate isomerase                  289   4e-88    
gb|KJK83517.1|  Methylthioribose-1-phosphate isomerase                  289   5e-88    
gb|KID90826.1|  methylthioribose-1-phosphate isomerase                  289   6e-88    
gb|KJK92379.1|  Methylthioribose-1-phosphate isomerase                  289   6e-88    
gb|EPY53630.1|  methylthioribose-1-phosphate isomerase                  288   6e-88    
emb|CCC53713.1|  putative translation initiation factor 2 subunit       288   9e-88    
ref|XP_007817378.1|  methylthioribose-1-phosphate isomerase             288   1e-87    
gb|KIN04067.1|  hypothetical protein OIDMADRAFT_143525                  290   1e-87    
ref|XP_807040.1|  translation initiation factor 2 subunit               286   4e-87    
gb|ESZ99195.1|  putative Methylthioribose-1-phosphate isomerase         288   5e-87    
gb|KIE00968.1|  methylthioribose-1-phosphate isomerase                  286   6e-87    
ref|XP_009226519.1|  S-methyl-5-thioribose-1-phosphate isomerase        286   6e-87    
ref|XP_002107955.1|  hypothetical protein TRIADDRAFT_19292              285   6e-87    
gb|AGT02795.1|  S-methyl-5-thioribose-1-phosphate isomerase             286   6e-87    
ref|XP_009008789.1|  hypothetical protein HELRODRAFT_62224              285   7e-87    
gb|ESS62513.1|  translation initiation factor 2 subunit                 287   1e-86    
ref|XP_001905298.1|  hypothetical protein                               289   1e-86    
gb|EHB14460.1|  Methylthioribose-1-phosphate isomerase                  285   1e-86    
ref|XP_004903067.1|  PREDICTED: methylthioribose-1-phosphate isom...    285   1e-86    
ref|XP_002679019.1|  predicted protein                                  285   2e-86    
ref|XP_005099286.1|  PREDICTED: methylthioribose-1-phosphate isom...    284   3e-86    
ref|XP_002291786.1|  predicted protein                                  284   3e-86    
gb|KHN97965.1|  methylthioribose-1-phosphate isomerase                  285   3e-86    
gb|EHK50478.1|  hypothetical protein TRIATDRAFT_297230                  285   3e-86    
gb|AGT02618.1|  S-methyl-5-thioribose-1-phosphate isomerase             283   4e-86    
gb|EKC40771.1|  Methylthioribose-1-phosphate isomerase                  292   6e-86    
ref|XP_007514904.1|  translation initiation factor, aIF-2BI family      296   9e-86    
ref|XP_005533667.1|  PREDICTED: methylthioribose-1-phosphate isom...    282   1e-85    
gb|AGT02428.1|  S-methyl-5-thioribose-1-phosphate isomerase             282   2e-85    
gb|ESL11669.1|  translation initiation factor 2 subunit                 282   3e-85    
ref|WP_026289843.1|  methylthioribose-1-phosphate isomerase             280   3e-85    
gb|EPY28944.1|  methylthioribose-1-phosphate isomerase                  282   4e-85    
emb|CBY10943.1|  unnamed protein product                                280   4e-85    
gb|AGG11452.1|  hypothetical protein                                    281   5e-85    
ref|XP_008853657.1|  PREDICTED: methylthioribose-1-phosphate isom...    279   5e-85    
ref|XP_011526658.1|  PREDICTED: methylthioribose-1-phosphate isom...    279   7e-85    
ref|XP_007290300.1|  S-methyl-5-thioribose-1-phosphate isomerase        283   9e-85    
ref|WP_012638101.1|  methylthioribose-1-phosphate isomerase             279   1e-84    
gb|KIH90966.1|  methylthioribose-1-phosphate isomerase                  281   1e-84    
ref|XP_005648557.1|  hypothetical protein COCSUDRAFT_65695              300   1e-84    
sp|Q4Q0R9.2|MTNA_LEIMA  RecName: Full=Methylthioribose-1-phosphat...    279   2e-84    
ref|XP_005615138.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    277   2e-84    
ref|XP_003351360.1|  hypothetical protein SMAC_03666                    291   2e-84    
ref|XP_009235038.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    278   3e-84    
ref|XP_008315471.1|  PREDICTED: methylthioribose-1-phosphate isom...    276   6e-84    
gb|AGT02734.1|  S-methyl-5-thioribose-1-phosphate isomerase             278   7e-84    
ref|XP_008505941.1|  PREDICTED: methylthioribose-1-phosphate isom...    278   1e-83    
ref|XP_001240294.1|  hypothetical protein CIMG_07457                    275   2e-83    
ref|XP_001469414.1|  putative translation initiation factor 2 sub...    276   4e-83    
ref|XP_001687079.1|  putative translation initiation factor 2 sub...    280   4e-83    
gb|EFW14500.1|  methylthioribose-1-phosphate isomerase                  275   5e-83    
gb|EJK50909.1|  hypothetical protein THAOC_29980                        276   7e-83    
ref|XP_007066406.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    273   7e-83    
pdb|2A0U|A  Chain A, Crystal Structure Of The Eukaryotic Initiati...    275   8e-83    
ref|NP_596610.1|  methylthioribose-1-phosphate isomerase (predicted)    275   1e-82    
gb|KFM78652.1|  Methylthioribose-1-phosphate isomerase                  273   1e-82    
ref|XP_011808783.1|  PREDICTED: methylthioribose-1-phosphate isom...    274   1e-82    
gb|ERZ95985.1|  hypothetical protein GLOINDRAFT_89757                   275   1e-82    
ref|WP_022986533.1|  methylthioribose-1-phosphate isomerase             273   1e-82    
gb|ELU04603.1|  hypothetical protein CAPTEDRAFT_225838                  272   2e-82    
ref|XP_008564259.1|  PREDICTED: methylthioribose-1-phosphate isom...    273   2e-82    
ref|WP_041726234.1|  methylthioribose-1-phosphate isomerase             273   2e-82    
ref|XP_010591802.1|  PREDICTED: methylthioribose-1-phosphate isom...    273   3e-82    
gb|ADU64905.1|  translation initiation factor, aIF-2BI family           273   3e-82    
ref|WP_029132416.1|  methylthioribose-1-phosphate isomerase             272   9e-82    
gb|AGT02556.1|  S-methyl-5-thioribose-1-phosphate isomerase             271   2e-81    
emb|CBZ26352.1|  translation initiation factor 2 subunit,putative       275   2e-81    
gb|EQD24052.1|  hypothetical protein D084_Lepto4C00613G0001             270   2e-81    
gb|EFW99958.1|  translation initiation factor                           269   5e-81    
ref|XP_009256337.1|  hypothetical protein FPSE_04944                    269   6e-81    
ref|XP_001111047.1|  PREDICTED: methylthioribose-1-phosphate isom...    269   8e-81    



>ref|XP_009627128.1| PREDICTED: methylthioribose-1-phosphate isomerase {ECO:0000255|HAMAP-Rule:MF_03119} 
[Nicotiana tomentosiformis]
 sp|Q948X8.1|MTNA_TOBAC RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Nicotiana 
tabacum]
 dbj|BAB63262.1| CIG2 [Nicotiana tabacum]
Length=374

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/375 (81%), Positives = 335/375 (89%), Gaps = 1/375 (0%)
 Frame = -2

Query  1453  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  1274
             MANG +  DKTL +ICY RGSLQLLDQRKLPL+TIYLDI++ KDGWDAIKEMVVRGAPAI
Sbjct  1     MANG-NEGDKTLLSICYNRGSLQLLDQRKLPLETIYLDIQDTKDGWDAIKEMVVRGAPAI  59

Query  1273  aiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  1094
             AIAAALSLAVE SNL +F+GT+ DA  FLS KL+YLVSSRPTAVNLSDAA KL EVI K 
Sbjct  60    AIAAALSLAVEVSNLSSFDGTSDDASDFLSNKLDYLVSSRPTAVNLSDAAVKLKEVIKKA  119

Query  1093  ASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGS  914
             A+TA +A ++F+AYI AAE+MLEDDV SNKAIGS+GAS L+  L  S+KI+ILTHCNTGS
Sbjct  120   ATTAKDANSVFQAYIEAAEVMLEDDVTSNKAIGSYGASFLKEHLTDSQKITILTHCNTGS  179

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGVIRA+ T G LERA+CTETRPFNQGSRLTAFELV ENIPATLIADSAAA
Sbjct  180   LATAGYGTALGVIRALYTDGVLERAFCTETRPFNQGSRLTAFELVHENIPATLIADSAAA  239

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             ALM AGRV AVIVGADR+AANGDTANKIGTY+LAV AMHHG+PFYVAAPLTS+DLSLSSG
Sbjct  240   ALMNAGRVKAVIVGADRVAANGDTANKIGTYNLAVSAMHHGIPFYVAAPLTSIDLSLSSG  299

Query  553   QQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGND  374
             Q+IVIEERSPKELLHT GGLGEQ+AASGISVWNPAFDVTPA+LISGIITEKGVI+K G +
Sbjct  300   QEIVIEERSPKELLHTRGGLGEQVAASGISVWNPAFDVTPANLISGIITEKGVITKKGAE  359

Query  373   AFDITGFVHKVSGNV  329
              FDI  FV K SGN+
Sbjct  360   TFDIAEFVRKTSGNL  374



>ref|XP_006346696.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Solanum 
tuberosum]
Length=374

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/367 (82%), Positives = 330/367 (90%), Gaps = 0/367 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             DKTL+AICY+RGSLQLLDQRKLPL+T+YLDI +  D WDAIKEMVVRGAPAIAIAAALSL
Sbjct  8     DKTLEAICYRRGSLQLLDQRKLPLETLYLDIHDTNDAWDAIKEMVVRGAPAIAIAAALSL  67

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE SNL +F+GT+ DA  FLS+KL++LVSSRPTAVNLSDAA KL EVI+K A+TA E  
Sbjct  68    AVEISNLASFDGTSHDASVFLSKKLDFLVSSRPTAVNLSDAAVKLKEVISKAAATAKETN  127

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+AYI AAE+MLEDDV SNKAIGS+GAS ++N L  SK I+ILTHCNTGSLATAGYGT
Sbjct  128   SVFQAYIEAAEVMLEDDVTSNKAIGSYGASFIKNYLTDSKNITILTHCNTGSLATAGYGT  187

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA+   G LERAYCTETRPFNQGSRLTAFELV ENIPATLIADSAAAALM AGRV
Sbjct  188   ALGVIRALYADGALERAYCTETRPFNQGSRLTAFELVHENIPATLIADSAAAALMNAGRV  247

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
              AVIVGADR+AANGDTANKIGTY+LAV AMHHG+PFYVAAPLTSVDLSLSSGQ+IVIEER
Sbjct  248   KAVIVGADRVAANGDTANKIGTYNLAVSAMHHGIPFYVAAPLTSVDLSLSSGQEIVIEER  307

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKELLHT GGLGEQ+AASGISVWNPAFDVTPA LISGIITEKGVI+K+G D FDI GFV
Sbjct  308   SPKELLHTRGGLGEQVAASGISVWNPAFDVTPAKLISGIITEKGVITKNGTDTFDIAGFV  367

Query  349   HKVSGNV  329
              K SGN+
Sbjct  368   RKTSGNL  374



>ref|XP_009781605.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nicotiana 
sylvestris]
Length=374

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/366 (82%), Positives = 331/366 (90%), Gaps = 0/366 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             DKTL +ICYKRGSLQLLDQRKLPL+TI+LDI++ KDGWDAIKEMVVRGAPAIAIAAALSL
Sbjct  8     DKTLLSICYKRGSLQLLDQRKLPLETIFLDIQDTKDGWDAIKEMVVRGAPAIAIAAALSL  67

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE SNL +F+GT+ DA  FLS+KL+YLVSSRPTAVNLSDAA KL EVI K A+TA +A 
Sbjct  68    AVEVSNLSSFDGTSDDASDFLSKKLDYLVSSRPTAVNLSDAAVKLKEVIKKAATTAKDAN  127

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+AYI AAE+MLEDDV SNKAIGS+GAS L+  L  S+KI+ILTHCNTGSLATAGYGT
Sbjct  128   SVFQAYIEAAEVMLEDDVTSNKAIGSYGASFLKEHLTDSQKITILTHCNTGSLATAGYGT  187

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA+ T G LERAYCTETRPFNQGSRLTAFELV ENIPATLIADSAAAALM AGRV
Sbjct  188   ALGVIRALYTDGVLERAYCTETRPFNQGSRLTAFELVHENIPATLIADSAAAALMNAGRV  247

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
              AVIVGADR+AANGDTANKIGTY+LAV A+HHG+PFYVAAPLTS+DLSLSSGQ+IVIEER
Sbjct  248   KAVIVGADRVAANGDTANKIGTYNLAVSAVHHGIPFYVAAPLTSIDLSLSSGQEIVIEER  307

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKELLHT GGLGEQ+AASGISVWNPAFDVTPA+LISGIITEKGVI+K G D FDI  FV
Sbjct  308   SPKELLHTRGGLGEQVAASGISVWNPAFDVTPANLISGIITEKGVITKKGTDTFDIAEFV  367

Query  349   HKVSGN  332
              K SGN
Sbjct  368   RKTSGN  373



>ref|XP_004244859.1| PREDICTED: methylthioribose-1-phosphate isomerase [Solanum lycopersicum]
Length=374

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/367 (81%), Positives = 328/367 (89%), Gaps = 0/367 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             DKTL+AICY+RGSLQLLDQRKLPL+T++LDI +  D WDAIKEMVVRGAPAIAIAAALSL
Sbjct  8     DKTLEAICYRRGSLQLLDQRKLPLETLHLDIHDTNDAWDAIKEMVVRGAPAIAIAAALSL  67

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE SNL +F+GT+ DA  FLS+KL++LVSSRPTAVNLSD+A KL EVI+K A+ A EA 
Sbjct  68    AVEVSNLASFDGTSHDASVFLSKKLDFLVSSRPTAVNLSDSAVKLKEVISKAAAIAKEAN  127

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+AYI AAE+MLEDDV SNKAIGS+GAS ++N L  SK I+ILTHCNTGSLATAGYGT
Sbjct  128   SVFQAYIEAAEVMLEDDVTSNKAIGSYGASFIKNYLTDSKNITILTHCNTGSLATAGYGT  187

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA+   G LERAYCTETRPFNQGSRLTAFELV ENIPATLIADSAAAALM AGRV
Sbjct  188   ALGVIRALYADGALERAYCTETRPFNQGSRLTAFELVHENIPATLIADSAAAALMNAGRV  247

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
              AVIVGADRIAANGDTANKIGTY+LAV AMHHG+PFYVAAPLTSVDLSLSSGQ+IVIEER
Sbjct  248   KAVIVGADRIAANGDTANKIGTYNLAVSAMHHGIPFYVAAPLTSVDLSLSSGQEIVIEER  307

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKELLHT GGLGEQ+AASGI VWNPAFDVT A LISGIITEKGVI+K+G D FDI GFV
Sbjct  308   SPKELLHTRGGLGEQVAASGILVWNPAFDVTQAKLISGIITEKGVITKNGTDTFDIAGFV  367

Query  349   HKVSGNV  329
              K +GN+
Sbjct  368   RKTAGNL  374



>ref|XP_010666847.1| PREDICTED: methylthioribose-1-phosphate isomerase [Beta vulgaris 
subsp. vulgaris]
Length=379

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/359 (83%), Positives = 325/359 (91%), Gaps = 0/359 (0%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAICY RGSLQLLDQRKLPL+T+YL+I+NA DGW AIKEMVVRGAPAIAIAAALSLAVE
Sbjct  20    LQAICYNRGSLQLLDQRKLPLETVYLEIRNASDGWLAIKEMVVRGAPAIAIAAALSLAVE  79

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
             +SNL+ F GT +DA SFL+QKLEYLVSSRPTAVNLSDAATKL E+I K AST SEA T+F
Sbjct  80    SSNLKAFQGTPEDAASFLAQKLEYLVSSRPTAVNLSDAATKLKEIIAKAASTCSEADTVF  139

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             +AYI AAEIMLEDDVASNKAIGS+GAS  ++QL  +KKISILTHCNTGSLATAGYGTALG
Sbjct  140   QAYIEAAEIMLEDDVASNKAIGSYGASCFKSQLKDAKKISILTHCNTGSLATAGYGTALG  199

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             VIRAV+  G LERAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALMKAG V  V
Sbjct  200   VIRAVHAQGILERAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMKAGNVQGV  259

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
             IVGADR+AANGDTANKIGTYSLAV A HHG+PFYVAAPLTSVDLSL SG+ I+IEERSPK
Sbjct  260   IVGADRVAANGDTANKIGTYSLAVSAKHHGIPFYVAAPLTSVDLSLPSGEYIIIEERSPK  319

Query  520   ELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             ELL++ GGLGEQ+AASGISVWNPAFDVTPA+LISGIITEKGVI+K G+ AFDI  FV K
Sbjct  320   ELLNSRGGLGEQVAASGISVWNPAFDVTPANLISGIITEKGVITKSGDKAFDIKDFVQK  378



>gb|KHG04432.1| Methylthioribose-1-phosphate isomerase [Gossypium arboreum]
Length=385

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/367 (79%), Positives = 328/367 (89%), Gaps = 2/367 (1%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TLQAICYKRGSLQLLDQRKLPL+T+YLDI  + DGW+AI+EMVVRGAPAIAIAAALSL
Sbjct  15    DNTLQAICYKRGSLQLLDQRKLPLETVYLDIHGSADGWNAIREMVVRGAPAIAIAAALSL  74

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE +NL+ FNG ++DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K AST +  +
Sbjct  75    AVEVANLKDFNGGSKDAASFLESKLEYLVSSRPTAVNLSDAAIKLKEIISKAASTVTVPE  134

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+AYI AAEIML+DDVA+NKAIGSHGAS LQ+Q   SK+ S+LTHCNTGSLATAGYGT
Sbjct  135   SVFQAYIEAAEIMLDDDVATNKAIGSHGASFLQHQQNNSKRFSVLTHCNTGSLATAGYGT  194

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV
Sbjct  195   ALGVIRALHAQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEGRV  254

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AV+VGADR+ ANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DLSLSSGQ+IVIEER
Sbjct  255   DAVVVGADRVTANGDTANKIGTYSLALCAMHHHIPFYVAAPLTSIDLSLSSGQEIVIEER  314

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDG--NDAFDITG  356
             S KELLHT GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEKGVI+K+   +DAFDI  
Sbjct  315   SAKELLHTRGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKGVITKNDMKDDAFDIKD  374

Query  355   FVHKVSG  335
             F+ K +G
Sbjct  375   FIEKATG  381



>gb|EYU28322.1| hypothetical protein MIMGU_mgv1a008441mg [Erythranthe guttata]
Length=374

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/364 (80%), Positives = 325/364 (89%), Gaps = 0/364 (0%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+ICY RGSL+LLDQRKLPL+TIYLDI ++KDGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  10    SLQSICYTRGSLKLLDQRKLPLETIYLDIADSKDGWVAIKDMVVRGAPAIAIAAALSLAV  69

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E SNL  F+G  +DA SFLS KL+YLVSSRPTAVNLSDAATKL EV+ K A+ +SEA+ +
Sbjct  70    EVSNLGAFSGMPKDAASFLSDKLDYLVSSRPTAVNLSDAATKLKEVVHKAAAASSEAQNV  129

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             F+AY+ AAE+MLEDDVASNKAIG +GAS LQ Q    K IS+LTHCNTGSLATAGYGTAL
Sbjct  130   FQAYVEAAEVMLEDDVASNKAIGHYGASFLQKQQSDPKNISVLTHCNTGSLATAGYGTAL  189

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIRA++  G LERAYCTETRPFNQGSRLTAFELV ENIPATLIADSAAAALMKAG+V A
Sbjct  190   GVIRALHEKGVLERAYCTETRPFNQGSRLTAFELVHENIPATLIADSAAAALMKAGQVKA  249

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             VIVGADR+AANGDTANKIGTYSLA+ AMHHG+PFYVAAPLTS+DLSLSSG++IVIEERS 
Sbjct  250   VIVGADRVAANGDTANKIGTYSLAISAMHHGIPFYVAAPLTSIDLSLSSGEEIVIEERSA  309

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             KELLH  GGLGEQ+AASGISVWNPAFDVTPA++ISGIITEKGVI+KDG D+FDI  F  K
Sbjct  310   KELLHARGGLGEQVAASGISVWNPAFDVTPATVISGIITEKGVITKDGADSFDIKSFAEK  369

Query  343   VSGN  332
             VS N
Sbjct  370   VSSN  373



>ref|XP_007012613.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY30232.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 
[Theobroma cacao]
Length=424

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/365 (79%), Positives = 329/365 (90%), Gaps = 1/365 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TLQ+ICYK GSLQLLDQRKLPL+T+YLDI++A DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  57    DNTLQSICYKCGSLQLLDQRKLPLETVYLDIQDATDGWNAIRDMVVRGAPAIAIAAALSL  116

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE +NL+ FNGT +DA SFL  KLEYLVSSRPTAVNLSDAATKL ++I+K A+TA+   
Sbjct  117   AVEVANLKDFNGTCEDAASFLEMKLEYLVSSRPTAVNLSDAATKLRKIISKAATTATVPG  176

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
              +F+AYI AAE+MLEDDVASNKAIGS+GAS LQ+Q   SK+ S+LTHCNTGSLATAGYGT
Sbjct  177   NVFQAYIEAAEVMLEDDVASNKAIGSYGASFLQHQQKNSKRFSVLTHCNTGSLATAGYGT  236

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV
Sbjct  237   ALGVIRALHAEGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEGRV  296

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AVIVGADR+AANGDTANKIGTYSLA+CAM+H +PFYVAAPLTS+DLSLSSGQ+I+IEER
Sbjct  297   SAVIVGADRVAANGDTANKIGTYSLAICAMYHHIPFYVAAPLTSIDLSLSSGQEIIIEER  356

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             S KELLHT GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEKGVI+K+  DAFDI  F+
Sbjct  357   SAKELLHTRGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKGVITKN-TDAFDIKNFM  415

Query  349   HKVSG  335
              K +G
Sbjct  416   EKATG  420



>gb|KJB82981.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=385

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/367 (78%), Positives = 327/367 (89%), Gaps = 2/367 (1%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TLQAICYKRGSLQLLDQRKLPL+T+YLDI  + DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  15    DNTLQAICYKRGSLQLLDQRKLPLETMYLDIHGSTDGWNAIRDMVVRGAPAIAIAAALSL  74

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE +NL+ FNG ++DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K AST +  +
Sbjct  75    AVEVANLKDFNGGSKDAASFLESKLEYLVSSRPTAVNLSDAAIKLKEIISKAASTVTVPE  134

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+AYI AAEIML+DDVA+NKAIGSHGA+ LQ+Q   SK+ S+LTHCNTGSLATAGYGT
Sbjct  135   SVFQAYIEAAEIMLDDDVATNKAIGSHGANFLQHQQNNSKRFSVLTHCNTGSLATAGYGT  194

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  RV
Sbjct  195   ALGVIRALHAQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEDRV  254

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AVIVGADR+ ANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DLSLSSGQ+IVIEER
Sbjct  255   DAVIVGADRVTANGDTANKIGTYSLALCAMHHHIPFYVAAPLTSIDLSLSSGQEIVIEER  314

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDG--NDAFDITG  356
             S KELLHT GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEKGVI+K+   +DAFDI  
Sbjct  315   SAKELLHTRGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKGVITKNDMKDDAFDIKD  374

Query  355   FVHKVSG  335
             F+ K +G
Sbjct  375   FIEKATG  381



>ref|XP_012077066.1| PREDICTED: methylthioribose-1-phosphate isomerase [Jatropha curcas]
 gb|KDP33930.1| hypothetical protein JCGZ_07501 [Jatropha curcas]
Length=382

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/363 (80%), Positives = 323/363 (89%), Gaps = 0/363 (0%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQ+ICYKRGSL LLDQRKLPL+T YL I +A DGW AI+EMVVRGAPAIAIAAALSLAV
Sbjct  16    TLQSICYKRGSLHLLDQRKLPLETEYLVIGDASDGWSAIREMVVRGAPAIAIAAALSLAV  75

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NL+ FNGT+ DA SFL QKL+YLVSSRPTAVNLSDAATKL EVI+K A+  SE+K +
Sbjct  76    EVFNLQDFNGTSDDAGSFLFQKLDYLVSSRPTAVNLSDAATKLKEVISKTAAATSESKAV  135

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             F+AYI AAEIMLEDDVASNKAIGSHGAS ++NQL   +++S+LTHCNTGSLATAGYGTAL
Sbjct  136   FQAYIEAAEIMLEDDVASNKAIGSHGASFIKNQLKNIERLSVLTHCNTGSLATAGYGTAL  195

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIR+++T G LERAYCTETRPFNQG+RLTAFELV + IPATLIADSAAAALMK GRV+A
Sbjct  196   GVIRSLHTDGVLERAYCTETRPFNQGARLTAFELVHDKIPATLIADSAAAALMKDGRVSA  255

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             VIVGADR+AANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DL LSSG QIVIEERSP
Sbjct  256   VIVGADRVAANGDTANKIGTYSLALCAMHHNIPFYVAAPLTSIDLCLSSGNQIVIEERSP  315

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             KELL+T GGLGEQ+AASGIS+WNPAFDVTPA+LISGIITEKGVI+K G D FDI  FV  
Sbjct  316   KELLNTRGGLGEQVAASGISIWNPAFDVTPANLISGIITEKGVITKVGADYFDIKNFVKG  375

Query  343   VSG  335
               G
Sbjct  376   AVG  378



>ref|XP_010090181.1| Methylthioribose-1-phosphate isomerase [Morus notabilis]
 gb|EXB38978.1| Methylthioribose-1-phosphate isomerase [Morus notabilis]
Length=371

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/370 (79%), Positives = 329/370 (89%), Gaps = 1/370 (0%)
 Frame = -2

Query  1441  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  1262
             A S+D TLQAICYKRGSL+LLDQRKLPL+T YLDI+++ DGW AIK+MVVRGAPAIAIAA
Sbjct  2     ASSQDNTLQAICYKRGSLRLLDQRKLPLETAYLDIRDSTDGWHAIKDMVVRGAPAIAIAA  61

Query  1261  alslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA  1082
             ALSLAVE SNL+ F+G+  DAVS+L  KL+YLVSSRPTAVNLSDAATKL EVI+K + TA
Sbjct  62    ALSLAVEVSNLDPFDGSISDAVSYLIMKLDYLVSSRPTAVNLSDAATKLKEVISKASDTA  121

Query  1081  SEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV-GSKKISILTHCNTGSLAT  905
             SEAK IF+A+I AAEIMLEDDVASNKAIGS+GA  L      GSKK S+LTHCNTGSLAT
Sbjct  122   SEAKNIFQAFIDAAEIMLEDDVASNKAIGSYGADFLYRHADDGSKKFSVLTHCNTGSLAT  181

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AG+GTALGVIRA++T G L+RAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALM
Sbjct  182   AGFGTALGVIRALHTQGVLKRAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALM  241

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
             K GRV+AV+VGADR+AANGDTANKIGTYSLA+ A HH VPF+VAAPLTS+DLSLSSGQ+I
Sbjct  242   KDGRVSAVVVGADRVAANGDTANKIGTYSLALIAKHHNVPFFVAAPLTSIDLSLSSGQEI  301

Query  544   VIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFD  365
             VIEERSPKELLHT GGLGEQ+AASGI+VWNPAFDVTPA+LISGIITEKGVI+K   + FD
Sbjct  302   VIEERSPKELLHTRGGLGEQVAASGIAVWNPAFDVTPANLISGIITEKGVITKVDTEEFD  361

Query  364   ITGFVHKVSG  335
             I  FV K +G
Sbjct  362   IKDFVQKTAG  371



>ref|XP_002516257.1| Methylthioribose-1-phosphate isomerase, putative [Ricinus communis]
 sp|B9RR88.1|MTNA_RICCO RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Ricinus 
communis]
 gb|EEF46259.1| Methylthioribose-1-phosphate isomerase, putative [Ricinus communis]
Length=382

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 330/378 (87%), Gaps = 5/378 (1%)
 Frame = -2

Query  1453  MANGAHSE-----DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVR  1289
             MAN ++S      D TLQ+ICY RGSL+LLDQRKLPL+T +LDI+N+ DGW AI+EMVVR
Sbjct  1     MANNSNSGSELEVDDTLQSICYNRGSLKLLDQRKLPLETEFLDIRNSSDGWSAIREMVVR  60

Query  1288  GapaiaiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNE  1109
             GAPAIAIAAALSLAVE  N + F GT+ DA SFL +KLEYLVSSRPTAVNLSDAA KL E
Sbjct  61    GAPAIAIAAALSLAVEVFNFDDFTGTSNDAASFLFKKLEYLVSSRPTAVNLSDAANKLKE  120

Query  1108  VITKEASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTH  929
             VI K A+TAS++ ++F+AYI AAEIML+DD+ASNKAIGSHGAS +QNQL   +++SILTH
Sbjct  121   VIYKAAATASDSNSVFQAYIEAAEIMLKDDIASNKAIGSHGASFIQNQLKNPQRLSILTH  180

Query  928   CNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatlia  749
             CNTGSLATAGYGTALGVIRA++ AG L RAYCTETRPFNQGSRLTAFELV E IPATL+A
Sbjct  181   CNTGSLATAGYGTALGVIRALHAAGVLRRAYCTETRPFNQGSRLTAFELVHEKIPATLVA  240

Query  748   dsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDL  569
             DSAAAALMK  +V+AVIVGADR+AANGDTANKIGTYSLA+CAMHH +PFYVAAPLTSVDL
Sbjct  241   DSAAAALMKDDQVSAVIVGADRVAANGDTANKIGTYSLALCAMHHNIPFYVAAPLTSVDL  300

Query  568   SLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
             SLSSG+ IVIEERSPKELL++ GGLGEQ+AASGISVWNPAFDVTPA+LISGIITEKGVI+
Sbjct  301   SLSSGKHIVIEERSPKELLNSRGGLGEQVAASGISVWNPAFDVTPANLISGIITEKGVIT  360

Query  388   KDGNDAFDITGFVHKVSG  335
             K  +  FDI  FV + +G
Sbjct  361   KIDSSDFDIKNFVKRTAG  378



>gb|AAM65143.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
Length=374

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/366 (78%), Positives = 322/366 (88%), Gaps = 0/366 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL+AICYK GSLQLLDQRKLPL+TIYL+I++A DGW AI+EMVVRGAPAIAIA ALSL
Sbjct  6     DTTLKAICYKPGSLQLLDQRKLPLETIYLEIRDASDGWSAIQEMVVRGAPAIAIATALSL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE  N   F+G+A DAV+FL  KL+YLVSSRPTAVNL+DAA KL  VI K  +TA+EAK
Sbjct  66    AVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAALKLKHVIAKALATATEAK  125

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             +IF+AYI A+E MLEDDV SNKAIG+ G SLL+ Q     K+S+LTHCN GSLATAGYGT
Sbjct  126   SIFKAYIEASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKLSVLTHCNXGSLATAGYGT  185

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV
Sbjct  186   ALGVIRALHTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRV  245

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             + VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER
Sbjct  246   DGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEER  305

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKELLHTHGGLGE+IAA GISVWNPAFD+TPA LI+GIITEKGVI+K+GND FDI+ F 
Sbjct  306   SPKELLHTHGGLGERIAAPGISVWNPAFDMTPAELIAGIITEKGVITKNGNDTFDISSFA  365

Query  349   HKVSGN  332
              K++GN
Sbjct  366   KKITGN  371



>ref|NP_027726.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 sp|Q9ZUG4.2|MTNA_ARATH RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Arabidopsis 
thaliana]
 gb|AAC95160.2| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AEC05975.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=374

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/366 (78%), Positives = 324/366 (89%), Gaps = 0/366 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL+AICYK GSLQLLDQRKLPL+TIYL+I++A DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6     DTTLKAICYKPGSLQLLDQRKLPLETIYLEIRDASDGWSAIQEMVVRGAPAIAIAAALSL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE  N   F+G+A DAV+FL  KL+YLVSSRPTAVNL+DAA KL  VI K  +TA+EAK
Sbjct  66    AVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAALKLKHVIAKALATATEAK  125

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             +IF+AYI A+E MLEDDV SNKAIG+ G SLL+ Q     K+S+LTHCNTGSLATAGYGT
Sbjct  126   SIFKAYIEASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKLSVLTHCNTGSLATAGYGT  185

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV
Sbjct  186   ALGVIRALHTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRV  245

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             + VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER
Sbjct  246   DGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEER  305

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKEL+HTHGGLGE+IAA GISVWNPAFD+TPA LI+GIITEKGVI+K+GND FDI+ F 
Sbjct  306   SPKELMHTHGGLGERIAAPGISVWNPAFDMTPAELIAGIITEKGVITKNGNDTFDISSFA  365

Query  349   HKVSGN  332
              K++GN
Sbjct  366   KKITGN  371



>ref|XP_009337200.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pyrus 
x bretschneideri]
Length=378

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/362 (78%), Positives = 325/362 (90%), Gaps = 0/362 (0%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQAICYKRGSLQLLDQ KLPLQ+ YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  12    SLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  71

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDAA KL ++ ++ A+T S+A+ +
Sbjct  72    EIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQIASEVATTTSDARKV  131

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             FEAYI A+EIML+DDVASNKAIGSHGAS +Q+ L  SK IS+LTHCNTGSLATAGYGTAL
Sbjct  132   FEAYIEASEIMLKDDVASNKAIGSHGASFIQHLLGNSKNISMLTHCNTGSLATAGYGTAL  191

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIR+++T G LERAYCTE+RPFNQGSRLTAFELV +NIP TLIADSAAAALMK GRVNA
Sbjct  192   GVIRSLHTEGVLERAYCTESRPFNQGSRLTAFELVHDNIPGTLIADSAAAALMKFGRVNA  251

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADR+AANGDTANKIGTYS+AV A HH +PF+VAAPLTS+DLSLSSG++I+IEERSP
Sbjct  252   VVVGADRVAANGDTANKIGTYSVAVSAKHHNIPFFVAAPLTSIDLSLSSGEEIIIEERSP  311

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             KELL+THGGLGEQ+AASGI+VWNPAFDVTPA+LI+GIITEKGVI+K G DAFDI GFV K
Sbjct  312   KELLNTHGGLGEQVAASGIAVWNPAFDVTPANLITGIITEKGVITKKGTDAFDIKGFVQK  371

Query  343   VS  338
              +
Sbjct  372   AA  373



>ref|XP_007202151.1| hypothetical protein PRUPE_ppa007089mg [Prunus persica]
 gb|EMJ03350.1| hypothetical protein PRUPE_ppa007089mg [Prunus persica]
Length=382

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/362 (78%), Positives = 323/362 (89%), Gaps = 0/362 (0%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+ICYKRGSLQLLDQRKLPLQT YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16    SLQSICYKRGSLQLLDQRKLPLQTTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDA+ KL ++ +  A+  S+AK +
Sbjct  76    EVFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDASAKLRQIASTVAAATSDAKNV  135

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             FEA+I A+EIML+DDVASNKAIGS+GAS +Q+ L  SK IS+LTHCNTGSLA+AGYGTAL
Sbjct  136   FEAFIEASEIMLKDDVASNKAIGSYGASFIQHLLENSKSISMLTHCNTGSLASAGYGTAL  195

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIR+++T G LERAYCTETRPFNQGSRLTAFELV +NIPATL+ DSAAAALMK GRVNA
Sbjct  196   GVIRSLHTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLVVDSAAAALMKDGRVNA  255

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADR+AANGDTANKIGTYSLAV A +H +PF+VAAPLTSVDL+LSSGQ+I+IEERSP
Sbjct  256   VVVGADRVAANGDTANKIGTYSLAVSAKYHNIPFFVAAPLTSVDLALSSGQEIIIEERSP  315

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             KELLH+ GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEKGVI+K G DAFDI GFV K
Sbjct  316   KELLHSQGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKGVITKKGTDAFDIKGFVQK  375

Query  343   VS  338
              +
Sbjct  376   AA  377



>ref|XP_008242258.1| PREDICTED: methylthioribose-1-phosphate isomerase [Prunus mume]
Length=382

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/362 (78%), Positives = 323/362 (89%), Gaps = 0/362 (0%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+ICYKRGSLQLLDQRKLPLQT YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16    SLQSICYKRGSLQLLDQRKLPLQTTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDAA KL ++ +  A+  S+AK +
Sbjct  76    EVFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLRQIASTVAAATSDAKNV  135

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             FEA+I A+EIML+DDVASNKAIGS+GAS +Q+ L  SK IS+LTHCNTGSLA+AGYGTAL
Sbjct  136   FEAFIEASEIMLKDDVASNKAIGSYGASFIQHLLENSKSISMLTHCNTGSLASAGYGTAL  195

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIR+++T G L+RAYCTETRPFNQGSRLTAFELV +NIPATL+ DSAAAALMK GRVNA
Sbjct  196   GVIRSLHTEGVLKRAYCTETRPFNQGSRLTAFELVHDNIPATLVVDSAAAALMKDGRVNA  255

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADR+AANGDTANKIGTYSLAV A +H +PF+VAAPLTSVDL+LSSGQ+I+IEERSP
Sbjct  256   VVVGADRVAANGDTANKIGTYSLAVSAKYHNIPFFVAAPLTSVDLALSSGQEIIIEERSP  315

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             KELLH+ GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEKGVI+K G DAFDI GFV K
Sbjct  316   KELLHSQGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKGVITKKGTDAFDIKGFVQK  375

Query  343   VS  338
              +
Sbjct  376   AA  377



>ref|XP_010467106.1| PREDICTED: methylthioribose-1-phosphate isomerase [Camelina sativa]
Length=374

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/366 (78%), Positives = 324/366 (89%), Gaps = 0/366 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL+AICYK GSLQLLDQRKLPL+T YL+I++A DGW AI+EMVVRGAPAIAIAAAL+L
Sbjct  6     DTTLKAICYKPGSLQLLDQRKLPLETTYLEIRDASDGWSAIQEMVVRGAPAIAIAAALAL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE  N   F+G++ DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI    + ++E  
Sbjct  66    AVEVFNFNGFDGSSADAVAFLEKKLDYLVSSRPTAVNLADAALKLKKVIANALAISTETN  125

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             +IF+AYI AAE MLEDDVASNKAIG+ G+SLL+ Q     K+SILTHCNTGSLATAGYGT
Sbjct  126   SIFKAYIKAAEDMLEDDVASNKAIGAFGSSLLRQQAKNPDKLSILTHCNTGSLATAGYGT  185

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV
Sbjct  186   ALGVIRALHTQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRV  245

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             + VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER
Sbjct  246   DGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEER  305

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKELLHTHGGLGE+IAA GISVWNPAFDVTPA LI+GIITEKGVI+K+GNDAFDI+ F 
Sbjct  306   SPKELLHTHGGLGERIAAPGISVWNPAFDVTPAELIAGIITEKGVITKNGNDAFDISSFA  365

Query  349   HKVSGN  332
              K++GN
Sbjct  366   QKMTGN  371



>ref|XP_008337840.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Malus 
domestica]
Length=382

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/360 (79%), Positives = 321/360 (89%), Gaps = 0/360 (0%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQAICYKRGSLQLLDQ KLPLQ+ YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16    SLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDAA KL ++ +  A+T S+A+ +
Sbjct  76    EIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQIASAVATTTSDARNV  135

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             FEAYI A+EIML+DDVASNKAIGSHGAS +QN L  SK IS+LTHCNTGSLATAGYGTAL
Sbjct  136   FEAYIEASEIMLKDDVASNKAIGSHGASFIQNLLGNSKNISMLTHCNTGSLATAGYGTAL  195

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIR+++T G LERAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALMK  RVNA
Sbjct  196   GVIRSLHTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMKFARVNA  255

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGA R+AANGDTANKIGTY+LAV A HH +PF+VAAPLTSVDLSLSSG++I+IEERSP
Sbjct  256   VVVGAYRVAANGDTANKIGTYNLAVSAKHHNIPFFVAAPLTSVDLSLSSGEEIIIEERSP  315

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             KELL+THGGLGEQ+AA GISVWNPAFDVTPA+LI+GIITEKGVI+K G DAFDI GFV K
Sbjct  316   KELLNTHGGLGEQVAAFGISVWNPAFDVTPANLITGIITEKGVITKKGTDAFDIKGFVQK  375



>ref|XP_002883712.1| eukaryotic translation initiation factor 2B family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59971.1| eukaryotic translation initiation factor 2B family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=369

 Score =   526 bits (1355),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 283/364 (78%), Positives = 322/364 (88%), Gaps = 0/364 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL+AICYK GSLQLLDQRKLPL+TIYL+I++A DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6     DTTLKAICYKPGSLQLLDQRKLPLETIYLEIRDASDGWSAIQEMVVRGAPAIAIAAALSL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE      F+G+A DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI K  + A+E K
Sbjct  66    AVEVFTFNGFDGSAADAVAFLEKKLDYLVSSRPTAVNLADAALKLKQVIAKALAIATEPK  125

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             +IF+ YI AAE MLEDDVASNKAIG+ G+SLL+ Q   + K+S+LTHCNTGSLATAGYGT
Sbjct  126   SIFKVYIEAAEDMLEDDVASNKAIGTFGSSLLRQQAKNADKLSVLTHCNTGSLATAGYGT  185

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV
Sbjct  186   ALGVIRALHAQGILERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRV  245

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             + VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER
Sbjct  246   DGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEER  305

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKELLHTHGGLGE+IAA GISVWNPAFDVTPA LI+GIITEKGVI+K+GND FDI+ F 
Sbjct  306   SPKELLHTHGGLGERIAAPGISVWNPAFDVTPAELIAGIITEKGVITKNGNDTFDISSFA  365

Query  349   HKVS  338
              K++
Sbjct  366   KKMT  369



>ref|XP_008388900.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Malus 
domestica]
Length=382

 Score =   526 bits (1355),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 281/362 (78%), Positives = 321/362 (89%), Gaps = 0/362 (0%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQAICYKRGSLQLLDQ KLPLQ+ YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16    SLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDAA KL ++ ++ A+T  +A  +
Sbjct  76    EIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQIASEVATTTXDASKV  135

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             FEAYI A+EIML+DDVASNKAIGSHGA  +Q+ L  SK IS+LTHCNTGSLATAGYGTAL
Sbjct  136   FEAYIEASEIMLKDDVASNKAIGSHGAXFIQHLLGNSKNISMLTHCNTGSLATAGYGTAL  195

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIR+++T G LERAYCTETRPFNQGSRLTAFELV +NIP TLIADSAAAALMK GRVNA
Sbjct  196   GVIRSLHTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPGTLIADSAAAALMKFGRVNA  255

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADR+A NGDTANKIGTYSLAV A HH +PF+VAAPLTS+DLSLSSG++I+IEERSP
Sbjct  256   VVVGADRVATNGDTANKIGTYSLAVSAKHHNIPFFVAAPLTSIDLSLSSGEEIIIEERSP  315

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             KELL+THGGLGEQ+AASGI+VWNPAFDVTPA+LI+GIITEKGVI+K G DAF+I GFV K
Sbjct  316   KELLNTHGGLGEQVAASGIAVWNPAFDVTPANLITGIITEKGVITKKGTDAFBIKGFVQK  375

Query  343   VS  338
              +
Sbjct  376   AA  377



>emb|CDP03069.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   525 bits (1351),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 281/364 (77%), Positives = 322/364 (88%), Gaps = 0/364 (0%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQAI YKRGSLQLLDQRKLPL+TIYLDI++  DGW AI++MVVRGAPAIAIAAALSLAV
Sbjct  10    SLQAILYKRGSLQLLDQRKLPLETIYLDIQDTNDGWVAIRDMVVRGAPAIAIAAALSLAV  69

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E SNL+ F+GT+ DA SFL +KLEYLVSSRPTAVNLSDAA+KL EV++K ASTA +   +
Sbjct  70    EVSNLKDFSGTSDDAASFLGKKLEYLVSSRPTAVNLSDAASKLKEVVSKAASTAKDTMGV  129

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             F+AYI AAEIML+DDVASNKAIGS+GA  L +QL    +IS+LTHCNTGSLATAGYGTAL
Sbjct  130   FQAYIEAAEIMLQDDVASNKAIGSYGAGFLLHQLKDFDRISVLTHCNTGSLATAGYGTAL  189

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIRA++  G LERAYCTETRPFNQGSRLTAFELV E IPATL+ DSAAAALMK GRVNA
Sbjct  190   GVIRALHAEGVLERAYCTETRPFNQGSRLTAFELVYEKIPATLLVDSAAAALMKDGRVNA  249

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADR+AANGDTANKIGTYSLA+CA HH +PF VAAPLTS+DLS++SG++IVIEERSP
Sbjct  250   VVVGADRVAANGDTANKIGTYSLALCAKHHNIPFLVAAPLTSIDLSITSGEEIVIEERSP  309

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             KE+LH  GGLGEQ+AASGI+VWNPAFDVTPA +ISGIITEKGVI+K+G + FDI GFV K
Sbjct  310   KEVLHARGGLGEQVAASGIAVWNPAFDVTPADIISGIITEKGVITKNGTEDFDIKGFVRK  369

Query  343   VSGN  332
              + N
Sbjct  370   AASN  373



>ref|XP_010488779.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Camelina 
sativa]
Length=374

 Score =   524 bits (1350),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 282/366 (77%), Positives = 322/366 (88%), Gaps = 0/366 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL+AICYK GSLQLLDQRKLPL+T YL+I++A DGW AI+EMVVRGAPAIAIAAAL+L
Sbjct  6     DTTLKAICYKPGSLQLLDQRKLPLETTYLEIRDASDGWSAIQEMVVRGAPAIAIAAALAL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE  N   F+G++ DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI    + ++E  
Sbjct  66    AVEVFNFNGFDGSSADAVAFLEKKLDYLVSSRPTAVNLADAALKLKKVIANALAISTETN  125

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             +IF+AYI AAE MLEDDVASNKAIG+ GASLL+ Q     K+SILTHCNTGSLATAGYGT
Sbjct  126   SIFKAYIKAAEDMLEDDVASNKAIGTFGASLLRQQAKNPDKLSILTHCNTGSLATAGYGT  185

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++T G LER YCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV
Sbjct  186   ALGVIRALHTQGILERGYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRV  245

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             + VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER
Sbjct  246   DGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEER  305

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKELLHTHGGLGE+IAA GISVWNPAFDVTPA LI+GIITEKGVI+K+ N+AFDI+ F 
Sbjct  306   SPKELLHTHGGLGERIAAPGISVWNPAFDVTPAELIAGIITEKGVITKNSNNAFDISSFA  365

Query  349   HKVSGN  332
              K++GN
Sbjct  366   QKMTGN  371



>ref|XP_011019339.1| PREDICTED: methylthioribose-1-phosphate isomerase [Populus euphratica]
Length=380

 Score =   524 bits (1350),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 281/365 (77%), Positives = 321/365 (88%), Gaps = 0/365 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TLQ+ICY RGSLQLLDQRKLPL+T YLDIK+  DGW AI+EMVVRGAPAIAI+AALSL
Sbjct  12    DNTLQSICYHRGSLQLLDQRKLPLETTYLDIKDTSDGWLAIREMVVRGAPAIAISAALSL  71

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE SNLE F+GT  +A SFL+ KL+YLVSSRPTAVNLSDAATKL EV++K A+ AS+ +
Sbjct  72    AVEVSNLENFSGTPVEAASFLAGKLDYLVSSRPTAVNLSDAATKLKEVVSKAAAVASDCQ  131

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+AYI AAEIML DDVASNKAIGS+GA  +QNQ     K+S+LTHCNTGSLATAGYGT
Sbjct  132   SVFQAYIEAAEIMLADDVASNKAIGSYGARFIQNQQKDPTKLSVLTHCNTGSLATAGYGT  191

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA+++ G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  +V
Sbjct  192   ALGVIRALHSEGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDSKV  251

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AV+VGADR+ ANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS D SLSSG++I+IEER
Sbjct  252   SAVVVGADRVVANGDTANKIGTYSLALCAMHHNIPFYVAAPLTSFDSSLSSGKEIIIEER  311

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKE+L+  GGLGEQ+AASGISVWNPAFDVTPASLISGIITEKGVI+K G D FDI  F+
Sbjct  312   SPKEMLNARGGLGEQVAASGISVWNPAFDVTPASLISGIITEKGVITKTGTDDFDIKDFI  371

Query  349   HKVSG  335
             ++  G
Sbjct  372   NRAVG  376



>ref|XP_010412762.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Camelina 
sativa]
Length=369

 Score =   524 bits (1349),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 281/364 (77%), Positives = 321/364 (88%), Gaps = 0/364 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL+AICYK GSLQLLDQRKLPL+T YL+I++A DGW AI+EMVVRGAPAIAIAAAL+L
Sbjct  6     DTTLKAICYKPGSLQLLDQRKLPLETTYLEIRDASDGWSAIQEMVVRGAPAIAIAAALAL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE  N   F+G++ DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI    + ++E  
Sbjct  66    AVEVFNFNGFDGSSADAVAFLEKKLDYLVSSRPTAVNLADAALKLKKVIANALAISTETN  125

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             +IF+AYI AAE MLEDDVASNKAIG+ G+SLL+ Q     K+SILTHCNTGSLATAGYGT
Sbjct  126   SIFKAYIKAAEDMLEDDVASNKAIGAFGSSLLRQQAKNPDKLSILTHCNTGSLATAGYGT  185

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++T GFLERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV
Sbjct  186   ALGVIRALHTQGFLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRV  245

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             + VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEER
Sbjct  246   DGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEER  305

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKELLHTHGGLGE+IAA GISVWNPAFD TPA LI+GIITEKGVI+K+ NDAFDI+ F 
Sbjct  306   SPKELLHTHGGLGERIAAPGISVWNPAFDATPAELIAGIITEKGVITKNSNDAFDISSFA  365

Query  349   HKVS  338
              K++
Sbjct  366   QKMT  369



>ref|XP_006396133.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
 gb|ESQ36912.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
Length=372

 Score =   523 bits (1347),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 284/367 (77%), Positives = 325/367 (89%), Gaps = 1/367 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL++ICYKRGSLQLLDQRKLPL+T YL+I+N+ DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6     DTTLKSICYKRGSLQLLDQRKLPLETTYLEIRNSVDGWSAIQEMVVRGAPAIAIAAALSL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASEA  1073
             AVE  N   F+G++ DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI K  A+T  E 
Sbjct  66    AVEVFNFNGFDGSSTDAVAFLEKKLDYLVSSRPTAVNLADAALKLKQVIAKALATTTIEP  125

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             K+IF+AYI AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYG
Sbjct  126   KSIFKAYIDAAENMLEDDVASNKAIGTFGSSLLRQQTKNPDKLSVLTHCNTGSLATAGYG  185

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GR
Sbjct  186   TALGVIRALHTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGR  245

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+ VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEE
Sbjct  246   VDGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEE  305

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGF  353
             R+PKELL+THGGLGE+IAA GISVWNPAFDVTPA LI+GIITEKG+I+K GN AFDI+ F
Sbjct  306   RTPKELLNTHGGLGERIAAPGISVWNPAFDVTPAELIAGIITEKGIITKSGNGAFDISSF  365

Query  352   VHKVSGN  332
               K++GN
Sbjct  366   AQKMTGN  372



>ref|XP_006474713.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Citrus 
sinensis]
 gb|KDO73877.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
 gb|KDO73878.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=373

 Score =   523 bits (1347),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 283/367 (77%), Positives = 328/367 (89%), Gaps = 2/367 (1%)
 Frame = -2

Query  1435  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  1256
             +++ +LQ+ICY+RGSLQLLDQRKLPL+TIYL+I+++ DGW AI+EMVVRGAPAIA+AAAL
Sbjct  8     TDNNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGAPAIAMAAAL  67

Query  1255  slaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  1076
             SLAVE  NL  F+GTA DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K A+TASE
Sbjct  68    SLAVEVFNLNAFSGTAADAASFLGNKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASE  127

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
             A ++F+AYI AAEIML+DDVA+NKAIGS+GAS LQNQL  SK  S+LTHCNTGSLATAGY
Sbjct  128   ANSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQLKNSK-FSVLTHCNTGSLATAGY  186

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIRA+++ G LERAYC+ETRPFNQGSRLTAFELV + IPATLIADSAAAALMK G
Sbjct  187   GTALGVIRALHSEGVLERAYCSETRPFNQGSRLTAFELVHDRIPATLIADSAAAALMKDG  246

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             RV+AVIVGADR+AANGDTANKIGTYSLA+CA  H + FYVAAPLTS+DL+LSSGQ+IVIE
Sbjct  247   RVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIE  306

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDG-NDAFDIT  359
             ERS KELL + GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEKGV++K G +DAFDI 
Sbjct  307   ERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGVVTKAGADDAFDIK  366

Query  358   GFVHKVS  338
              F+ K +
Sbjct  367   DFIQKTA  373



>ref|XP_010047466.1| PREDICTED: methylthioribose-1-phosphate isomerase [Eucalyptus 
grandis]
Length=380

 Score =   522 bits (1345),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 284/366 (78%), Positives = 326/366 (89%), Gaps = 0/366 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D +LQ+ICY+RGSL+LLDQRKLPL+T+YLDIK+A DGW AIK+MVVRGAPAIAIAAALSL
Sbjct  14    DASLQSICYERGSLRLLDQRKLPLETVYLDIKDATDGWHAIKDMVVRGAPAIAIAAALSL  73

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE  +L+ F+GTA +A SFL  KL+YLVSSRPTAVNLSDAATKL EVI+  A+TASEAK
Sbjct  74    AVEVYHLDAFSGTAVEAASFLIGKLDYLVSSRPTAVNLSDAATKLKEVISDAAATASEAK  133

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             +IF+AY  AAE+ML+DDVASNKAIG +GAS L+     SK +S+LTHCNTGSLATAGYGT
Sbjct  134   SIFQAYTEAAEVMLKDDVASNKAIGGYGASFLKLNQKKSKGLSVLTHCNTGSLATAGYGT  193

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATL+ADSAAAAL+K GRV
Sbjct  194   ALGVIRALHTEGALERAYCTETRPFNQGSRLTAFELVHERIPATLLADSAAAALVKEGRV  253

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AVIVGADR+AANGDTANKIGTYSLA+CA HH +PFYVAAPLTSVDLSLSSGQ IVIEER
Sbjct  254   DAVIVGADRVAANGDTANKIGTYSLALCARHHNIPFYVAAPLTSVDLSLSSGQDIVIEER  313

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             S KELL++ GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEKGV++K G+DAFD+  F 
Sbjct  314   SAKELLNSRGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKGVVTKKGSDAFDMKAFA  373

Query  349   HKVSGN  332
              ++ G 
Sbjct  374   LQLDGK  379



>gb|KFK39882.1| hypothetical protein AALP_AA3G300900 [Arabis alpina]
Length=374

 Score =   522 bits (1344),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 281/366 (77%), Positives = 323/366 (88%), Gaps = 0/366 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL++ICYK GSLQLLDQRKLPL+T YL+I++  DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6     DTTLKSICYKPGSLQLLDQRKLPLETTYLEIRDTADGWSAIQEMVVRGAPAIAIAAALSL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE SN   F+G++ DAV+FL  KL+YLVSSRPTAVNL+DAA KL +VI    +TA E K
Sbjct  66    AVEVSNFNAFDGSSADAVAFLQNKLDYLVSSRPTAVNLADAALKLKQVIANALATAIEPK  125

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             +IF+AYI AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYGT
Sbjct  126   SIFKAYIEAAENMLEDDVASNKAIGTFGSSLLRQQAKNPDKLSVLTHCNTGSLATAGYGT  185

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGV+RA+ T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV
Sbjct  186   ALGVLRALQTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGRV  245

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             + VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSL+SG++IVIEER
Sbjct  246   DGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLTSGKEIVIEER  305

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             +PKELL+THGGLGE+IAA GISVWNPAFDVTPA LI+GIITEKGVI+K+GNDAFDI+ F 
Sbjct  306   TPKELLNTHGGLGERIAAPGISVWNPAFDVTPAELIAGIITEKGVITKNGNDAFDISSFA  365

Query  349   HKVSGN  332
              +++GN
Sbjct  366   QQMTGN  371



>gb|KHN12290.1| Methylthioribose-1-phosphate isomerase [Glycine soja]
Length=372

 Score =   522 bits (1344),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 285/361 (79%), Positives = 326/361 (90%), Gaps = 3/361 (1%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAICYKRGSLQLLDQRKLPL+T+YL+I+++ DGW+AI+EMVVRGAPAIAIAAALSLAV
Sbjct  12    TLQAICYKRGSLQLLDQRKLPLETVYLEIRDSTDGWNAIREMVVRGAPAIAIAAALSLAV  71

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NL+ FNG+A DAVS L +KLEYLV+SRPTAVNLSDAATKL EVI+  A+T SE +++
Sbjct  72    EVFNLD-FNGSATDAVSLLQKKLEYLVTSRPTAVNLSDAATKLKEVISNAAATTSEGRSV  130

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             F+ YI AAE+MLEDDVASN+AIGS+GAS++Q Q    +K+S+LTHCNTGSLATAGYGTAL
Sbjct  131   FQVYIDAAEVMLEDDVASNRAIGSYGASIIQQQ-TEKQKLSVLTHCNTGSLATAGYGTAL  189

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIRA+++AG L+RAYCTETRPFNQGSRLTAFELV E IP TLIADSAAAALMKAG V+A
Sbjct  190   GVIRALHSAGVLKRAYCTETRPFNQGSRLTAFELVHEKIPGTLIADSAAAALMKAGHVDA  249

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADR+A+NGDTANKIGTYS+A+ A  H VPFYVAAPLTS+DLSLSSGQ+IVIEERSP
Sbjct  250   VVVGADRVASNGDTANKIGTYSVALSAKFHNVPFYVAAPLTSIDLSLSSGQEIVIEERSP  309

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITGFVH  347
             KELL+THGGLGEQIAASGISVWNPAFDVTPA+LISGIITEKGVI+K    DAFDI  FV 
Sbjct  310   KELLNTHGGLGEQIAASGISVWNPAFDVTPANLISGIITEKGVITKTSAGDAFDIKAFVQ  369

Query  346   K  344
             K
Sbjct  370   K  370



>ref|XP_006452822.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
 gb|ESR66062.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
Length=373

 Score =   521 bits (1343),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 284/366 (78%), Positives = 326/366 (89%), Gaps = 2/366 (1%)
 Frame = -2

Query  1432  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  1253
             +  +LQ+ICY+RGSLQLLDQRKLPL+TIYL+I+++ DGW AI+EMVVRGAPAIAIAAALS
Sbjct  9     DSNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGAPAIAIAAALS  68

Query  1252  laveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             LAVE  NL  F+GTA DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K A+TASEA
Sbjct  69    LAVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASEA  128

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
              ++F+AYI AAEIML+DDVA+NKAIGS+GAS LQNQL  SK  S+LTHCNTGSLATAGYG
Sbjct  129   NSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQLKNSK-FSVLTHCNTGSLATAGYG  187

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA+++ G LERAYC+ETRPFNQGSRLTAFELV + IPATLIADSAAAALMK GR
Sbjct  188   TALGVIRALHSEGVLERAYCSETRPFNQGSRLTAFELVHDRIPATLIADSAAAALMKDGR  247

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+AVIVGADR+AANGDTANKIGTYSLA+CA  H + FYVAAPLTS+DL+LSSGQ+IVIEE
Sbjct  248   VSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEE  307

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDG-NDAFDITG  356
             RS KELL + GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEKGV++K G +DAFDI  
Sbjct  308   RSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGVVTKAGADDAFDIKD  367

Query  355   FVHKVS  338
             F+ K +
Sbjct  368   FIQKTA  373



>ref|XP_009359722.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pyrus 
x bretschneideri]
Length=382

 Score =   520 bits (1340),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 281/360 (78%), Positives = 318/360 (88%), Gaps = 0/360 (0%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQAICYKRGSLQLLDQ KLPLQ+ YLDI+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16    SLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NLE FNGT  +A SF+  KLEYLVSSRPTAVNLSDAA KL ++ +  A+  S+A+ +
Sbjct  76    EIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQIASAVATNTSDARNV  135

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             FEAYI A+EIML+DDVASNKAIGSHGAS +Q+ L  SK I +LTHCNTGSLATAGYGTAL
Sbjct  136   FEAYIEASEIMLKDDVASNKAIGSHGASFIQHLLGNSKNIFMLTHCNTGSLATAGYGTAL  195

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIR+++T G LERAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAAALMK GRVNA
Sbjct  196   GVIRSLHTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMKFGRVNA  255

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADR+AANGDTANKIGTY+L V A HH +PF+VA PLTSVDLSLSSG++ +I+ERSP
Sbjct  256   VVVGADRVAANGDTANKIGTYNLCVSAKHHNIPFFVAVPLTSVDLSLSSGEERIIDERSP  315

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             KELL+THGGLGEQ AASGISVWNPAFDVTPA+LI+GIITEKGVI+K G DAFDI GFV K
Sbjct  316   KELLNTHGGLGEQFAASGISVWNPAFDVTPANLITGIITEKGVITKKGTDAFDIKGFVQK  375



>ref|XP_010261799.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nelumbo nucifera]
Length=377

 Score =   520 bits (1338),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 277/364 (76%), Positives = 327/364 (90%), Gaps = 0/364 (0%)
 Frame = -2

Query  1435  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  1256
             S + +LQ+ICYKRGSL+LLDQR+LPL+TIYLD+++  DGW+AI++MVVRGAPAIAIAAAL
Sbjct  12    SNESSLQSICYKRGSLRLLDQRRLPLETIYLDVRDVTDGWNAIRDMVVRGAPAIAIAAAL  71

Query  1255  slaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  1076
             SLAVE  NLE+F GT+ DA SFL +KLEYLVSSRPTAVNL DAATKL +VI   AST  E
Sbjct  72    SLAVEVFNLESFVGTSGDAASFLIKKLEYLVSSRPTAVNLYDAATKLKDVILNAASTTGE  131

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
             A++IF AYI AAE ML DDVASNKAIG++G+S LQ+QL  S ++SILTHCNTGSLATAGY
Sbjct  132   ARSIFHAYIEAAETMLNDDVASNKAIGAYGSSFLQSQLKDSNRLSILTHCNTGSLATAGY  191

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIRA++  G LERA+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALMK+G
Sbjct  192   GTALGVIRALHATGVLERAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMKSG  251

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             RV+AVIVGADR+A+NGDTANKIGTYSLA+CA++HG+PFYVAAP+TS+DLSL SGQ++VIE
Sbjct  252   RVDAVIVGADRVASNGDTANKIGTYSLALCALYHGIPFYVAAPVTSIDLSLPSGQEVVIE  311

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITG  356
             ERS KELL++ GGLGEQ+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K+G ++F+I  
Sbjct  312   ERSAKELLNSRGGLGEQVAASGISVWNPAFDVTPANLITAIITEKGVITKNGTESFEIKD  371

Query  355   FVHK  344
             FVHK
Sbjct  372   FVHK  375



>ref|XP_011078119.1| PREDICTED: methylthioribose-1-phosphate isomerase [Sesamum indicum]
Length=374

 Score =   519 bits (1337),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 293/372 (79%), Positives = 330/372 (89%), Gaps = 1/372 (0%)
 Frame = -2

Query  1453  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  1274
             MANG    DK+LQ+I Y RGSL LLDQRKLPL+T+YLDIK++KDGW AIKEMVVRGAPAI
Sbjct  1     MANGVEL-DKSLQSIRYNRGSLWLLDQRKLPLETVYLDIKDSKDGWVAIKEMVVRGAPAI  59

Query  1273  aiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  1094
             AIAAALSLAVE SNL  F+GT  DA SF+S K +YLVSSRPTAVNLSDAATKL EV+ K 
Sbjct  60    AIAAALSLAVEVSNLGVFSGTPNDAASFISNKFDYLVSSRPTAVNLSDAATKLKEVVQKA  119

Query  1093  ASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGS  914
             A+TASEA+T+ +AYI AAE+MLEDDVASNKAIG++GA+L+Q Q    K IS+LTHCNTGS
Sbjct  120   AATASEAETVLQAYIEAAEVMLEDDVASNKAIGNYGATLIQKQQKDPKSISVLTHCNTGS  179

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGVIRA++  G LERAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAA
Sbjct  180   LATAGYGTALGVIRALHEKGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAA  239

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             ALMK GRVNAVIVGADR+AANGDTANKIGTYSLA+ AMHHG+PFYVAAPLTS+DLSLSSG
Sbjct  240   ALMKDGRVNAVIVGADRVAANGDTANKIGTYSLALSAMHHGIPFYVAAPLTSIDLSLSSG  299

Query  553   QQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGND  374
             Q+IVIEERS KELL++ GGLGEQ+AASGISVWNPAFDVTPA++ISGIITEKGVI+KD   
Sbjct  300   QEIVIEERSAKELLNSRGGLGEQVAASGISVWNPAFDVTPATVISGIITEKGVITKDETG  359

Query  373   AFDITGFVHKVS  338
             +FDI  F  +V+
Sbjct  360   SFDIKSFAQEVA  371



>ref|XP_002308521.2| eukaryotic translation initiation factor 2B family protein [Populus 
trichocarpa]
 sp|B9HCR2.2|MTNA_POPTR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Populus 
trichocarpa]
 gb|EEE92044.2| eukaryotic translation initiation factor 2B family protein [Populus 
trichocarpa]
Length=375

 Score =   519 bits (1337),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 282/362 (78%), Positives = 320/362 (88%), Gaps = 0/362 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TLQ+ICY RGSL+LLDQRKLPL+T YLDIK+A DGW AI+EMVVRGAPAIAI+AALSL
Sbjct  12    DNTLQSICYHRGSLKLLDQRKLPLETTYLDIKDASDGWLAIREMVVRGAPAIAISAALSL  71

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE SNLE FNGT  +A SFL+ KL+YLVSSRPTAVNLSDAATKL EV++K A+ AS  +
Sbjct  72    AVEVSNLENFNGTPVEAASFLAGKLDYLVSSRPTAVNLSDAATKLKEVVSKAAAAASNCQ  131

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+AYI AAEIML DDVASNKAIGS+GA  +QNQ     K+S+LTHCNTGSLATAGYGT
Sbjct  132   SVFQAYIEAAEIMLADDVASNKAIGSYGARFIQNQQKDPTKLSVLTHCNTGSLATAGYGT  191

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++  G L+RAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  +V
Sbjct  192   ALGVIRALHGEGVLQRAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDSKV  251

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AV+VGADR+AANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS D SLSSG++I+IEER
Sbjct  252   SAVVVGADRVAANGDTANKIGTYSLALCAMHHNIPFYVAAPLTSFDSSLSSGKEIIIEER  311

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKE+L+  GGLGEQ+AASGISVWNPAFDVTPASLISGIITEKGVI+K G D FDI  F+
Sbjct  312   SPKEMLNARGGLGEQVAASGISVWNPAFDVTPASLISGIITEKGVITKTGMDDFDIKDFI  371

Query  349   HK  344
             +K
Sbjct  372   NK  373



>gb|KDO73876.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=374

 Score =   518 bits (1335),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 283/368 (77%), Positives = 328/368 (89%), Gaps = 3/368 (1%)
 Frame = -2

Query  1435  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  1256
             +++ +LQ+ICY+RGSLQLLDQRKLPL+TIYL+I+++ DGW AI+EMVVRGAPAIA+AAAL
Sbjct  8     TDNNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGAPAIAMAAAL  67

Query  1255  slaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  1076
             SLAVE  NL  F+GTA DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K A+TASE
Sbjct  68    SLAVEVFNLNAFSGTAADAASFLGNKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASE  127

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
             A ++F+AYI AAEIML+DDVA+NKAIGS+GAS LQNQL  SK  S+LTHCNTGSLATAGY
Sbjct  128   ANSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQLKNSK-FSVLTHCNTGSLATAGY  186

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIRA+++ G LERAYC+ETRPFNQGSRLTAFELV + IPATLIADSAAAALMK G
Sbjct  187   GTALGVIRALHSEGVLERAYCSETRPFNQGSRLTAFELVHDRIPATLIADSAAAALMKDG  246

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             RV+AVIVGADR+AANGDTANKIGTYSLA+CA  H + FYVAAPLTS+DL+LSSGQ+IVIE
Sbjct  247   RVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIE  306

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEK-GVISKDG-NDAFDI  362
             ERS KELL + GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEK GV++K G +DAFDI
Sbjct  307   ERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKQGVVTKAGADDAFDI  366

Query  361   TGFVHKVS  338
               F+ K +
Sbjct  367   KDFIQKTA  374



>gb|KCW79381.1| hypothetical protein EUGRSUZ_C00793 [Eucalyptus grandis]
Length=461

 Score =   521 bits (1343),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 284/366 (78%), Positives = 326/366 (89%), Gaps = 0/366 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D +LQ+ICY+RGSL+LLDQRKLPL+T+YLDIK+A DGW AIK+MVVRGAPAIAIAAALSL
Sbjct  95    DASLQSICYERGSLRLLDQRKLPLETVYLDIKDATDGWHAIKDMVVRGAPAIAIAAALSL  154

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE  +L+ F+GTA +A SFL  KL+YLVSSRPTAVNLSDAATKL EVI+  A+TASEAK
Sbjct  155   AVEVYHLDAFSGTAVEAASFLIGKLDYLVSSRPTAVNLSDAATKLKEVISDAAATASEAK  214

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             +IF+AY  AAE+ML+DDVASNKAIG +GAS L+     SK +S+LTHCNTGSLATAGYGT
Sbjct  215   SIFQAYTEAAEVMLKDDVASNKAIGGYGASFLKLNQKKSKGLSVLTHCNTGSLATAGYGT  274

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATL+ADSAAAAL+K GRV
Sbjct  275   ALGVIRALHTEGALERAYCTETRPFNQGSRLTAFELVHERIPATLLADSAAAALVKEGRV  334

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AVIVGADR+AANGDTANKIGTYSLA+CA HH +PFYVAAPLTSVDLSLSSGQ IVIEER
Sbjct  335   DAVIVGADRVAANGDTANKIGTYSLALCARHHNIPFYVAAPLTSVDLSLSSGQDIVIEER  394

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             S KELL++ GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEKGV++K G+DAFD+  F 
Sbjct  395   SAKELLNSRGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKGVVTKKGSDAFDMKAFA  454

Query  349   HKVSGN  332
              ++ G 
Sbjct  455   LQLDGK  460



>ref|XP_009102357.1| PREDICTED: methylthioribose-1-phosphate isomerase [Brassica rapa]
Length=372

 Score =   517 bits (1331),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 283/367 (77%), Positives = 324/367 (88%), Gaps = 1/367 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL++ICYK GSLQLLDQRKLPL+T YL+I++A DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6     DTTLKSICYKPGSLQLLDQRKLPLETTYLEIRDAADGWSAIQEMVVRGAPAIAIAAALSL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASEA  1073
             AVE SN   F+G++ +AV+FL  KL+YLVSSRPTAVNL+DAA KL +VI    AS+A+E 
Sbjct  66    AVEVSNFSGFDGSSAEAVAFLENKLDYLVSSRPTAVNLADAALKLKQVIANALASSAAEP  125

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
              +IF+AYI AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYG
Sbjct  126   NSIFKAYIEAAENMLEDDVASNKAIGTFGSSLLRQQAKNPDKLSVLTHCNTGSLATAGYG  185

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GR
Sbjct  186   TALGVIRALHTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGR  245

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+ VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEE
Sbjct  246   VDGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEE  305

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGF  353
             R+ KELL+THGGLGE+IAA GISVWNPAFDVTPA LI+GIITEKGVI+K+ NDAFDI+ F
Sbjct  306   RTAKELLNTHGGLGERIAAPGISVWNPAFDVTPAELIAGIITEKGVITKNANDAFDISSF  365

Query  352   VHKVSGN  332
               KV+GN
Sbjct  366   AKKVTGN  372



>ref|XP_008450940.1| PREDICTED: methylthioribose-1-phosphate isomerase [Cucumis melo]
Length=381

 Score =   516 bits (1329),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 271/365 (74%), Positives = 323/365 (88%), Gaps = 0/365 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D +LQ+ICYKRGSL+LLDQRKLPL+T+YLDIK+A DGW AI++MVVRGAPAIAI+AAL+L
Sbjct  14    DNSLQSICYKRGSLRLLDQRKLPLETVYLDIKDATDGWHAIRDMVVRGAPAIAISAALAL  73

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             A E  N   FNGT  DA S ++ KL+YLVSSRPTAVNL DAA KL E+++  A+ +SEA+
Sbjct  74    AAEVYNSAPFNGTPNDAASLIADKLDYLVSSRPTAVNLGDAAIKLKEIVSGAAAISSEAR  133

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+A+I AAE MLEDDVASNKAIG +GA+ +++Q    +K S+LTHCNTGSLATAGYGT
Sbjct  134   SVFQAFIEAAEAMLEDDVASNKAIGFYGANYIRDQQKSLEKFSVLTHCNTGSLATAGYGT  193

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA+++AG LERAYCTETRPFNQGSRLTA+ELV E IP+TLIADSAAAALMK GRV
Sbjct  194   ALGVIRALHSAGVLERAYCTETRPFNQGSRLTAYELVHEKIPSTLIADSAAAALMKFGRV  253

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             NAV+VGADR+AANGDTANKIGTYSLA+CAMHH +PF+VAAPLTS+DLSLSSG++IVIEER
Sbjct  254   NAVVVGADRVAANGDTANKIGTYSLALCAMHHKIPFFVAAPLTSIDLSLSSGEEIVIEER  313

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKELL++ GGLGEQ+AASGI+VWNPAFDVTPA LI GIITEKGVI+K G+D+F+I  FV
Sbjct  314   SPKELLNSRGGLGEQVAASGIAVWNPAFDVTPAHLICGIITEKGVITKAGSDSFNIKEFV  373

Query  349   HKVSG  335
              K +G
Sbjct  374   QKTAG  378



>ref|XP_010930603.1| PREDICTED: methylthioribose-1-phosphate isomerase [Elaeis guineensis]
Length=376

 Score =   514 bits (1323),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 280/374 (75%), Positives = 326/374 (87%), Gaps = 1/374 (0%)
 Frame = -2

Query  1453  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  1274
             MA  ++ +  +LQ+ICY+RGSL+LLDQR+LP +T+YLD+++A DGW+AI++MVVRGAPAI
Sbjct  1     MAVESNGKSDSLQSICYERGSLRLLDQRRLPRETVYLDVRDATDGWNAIRDMVVRGAPAI  60

Query  1273  aiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  1094
             AIAAALSLAVE  NL+ F GT+ DA SFL +KLEYLVSSRPTAVNLSDA+TKL  +++K 
Sbjct  61    AIAAALSLAVEVFNLD-FAGTSGDAASFLVKKLEYLVSSRPTAVNLSDASTKLQNIVSKT  119

Query  1093  ASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGS  914
             A TA+EAKT+F+AYI AAE ML DDVA NKAIG HGAS L  QL  S K+S+LTHCNTGS
Sbjct  120   AKTATEAKTVFQAYIDAAETMLTDDVADNKAIGFHGASFLPCQLKDSGKLSVLTHCNTGS  179

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGVIRA++  G LE A+CTETRPFNQGSRLTAFELV + IPATLI DSAAA
Sbjct  180   LATAGYGTALGVIRALHAGGSLETAFCTETRPFNQGSRLTAFELVHDEIPATLITDSAAA  239

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             ALMKAGRVNAVIVGADRIAANGDTANKIGTYSLAV A +HG+PFYVAAP+TS+DLSLSSG
Sbjct  240   ALMKAGRVNAVIVGADRIAANGDTANKIGTYSLAVSASYHGIPFYVAAPITSIDLSLSSG  299

Query  553   QQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGND  374
             QQIVIEERSPKELL + GGLG+Q+AASGI+VWNPAFD+TPA+L++ IITEKGVI+K   D
Sbjct  300   QQIVIEERSPKELLCSDGGLGKQVAASGIAVWNPAFDITPANLMTAIITEKGVITKATAD  359

Query  373   AFDITGFVHKVSGN  332
             AFDI GF+ K  GN
Sbjct  360   AFDIKGFIQKAQGN  373



>gb|KJB82984.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=367

 Score =   513 bits (1321),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 276/343 (80%), Positives = 310/343 (90%), Gaps = 0/343 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TLQAICYKRGSLQLLDQRKLPL+T+YLDI  + DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  15    DNTLQAICYKRGSLQLLDQRKLPLETMYLDIHGSTDGWNAIRDMVVRGAPAIAIAAALSL  74

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE +NL+ FNG ++DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K AST +  +
Sbjct  75    AVEVANLKDFNGGSKDAASFLESKLEYLVSSRPTAVNLSDAAIKLKEIISKAASTVTVPE  134

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+AYI AAEIML+DDVA+NKAIGSHGA+ LQ+Q   SK+ S+LTHCNTGSLATAGYGT
Sbjct  135   SVFQAYIEAAEIMLDDDVATNKAIGSHGANFLQHQQNNSKRFSVLTHCNTGSLATAGYGT  194

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  RV
Sbjct  195   ALGVIRALHAQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEDRV  254

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AVIVGADR+ ANGDTANKIGTYSLA+CAMHH +PFYVAAPLTS+DLSLSSGQ+IVIEER
Sbjct  255   DAVIVGADRVTANGDTANKIGTYSLALCAMHHHIPFYVAAPLTSIDLSLSSGQEIVIEER  314

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEK  401
             S KELLHT GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEK
Sbjct  315   SAKELLHTRGGLGEQVAASGISVWNPAFDVTPANLIAGIITEK  357



>gb|AES65569.2| methylthioribose-1-phosphate isomerase [Medicago truncatula]
Length=372

 Score =   513 bits (1322),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 281/371 (76%), Positives = 326/371 (88%), Gaps = 2/371 (1%)
 Frame = -2

Query  1453  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  1274
             MA+   +    LQAI Y RGSLQLLDQ KLPL+++YL+I+++ DGW+AI++MVVRGAPAI
Sbjct  1     MASSDSNATNMLQAIRYNRGSLQLLDQTKLPLESVYLEIRDSNDGWNAIRDMVVRGAPAI  60

Query  1273  aiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  1094
             AIAAALSLAVE SNL+ FNG+  DAV FL +KL+YLVSSRPTAVNLSDAATKL E+I+K 
Sbjct  61    AIAAALSLAVEVSNLDDFNGSTDDAVYFLQKKLDYLVSSRPTAVNLSDAATKLKEIISKA  120

Query  1093  ASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGS  914
             A+T SEAK +F+AY+ AAEIMLEDDVASN+AIG++GAS +QNQ     K+S+LTHCNTGS
Sbjct  121   AATTSEAKGVFQAYLEAAEIMLEDDVASNRAIGTYGASFIQNQ-TEKLKLSVLTHCNTGS  179

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGVIRA+ + G LERAYCTETRPFNQGSRLTA+ELV + IPATLIADSAAA
Sbjct  180   LATAGYGTALGVIRALYSGGVLERAYCTETRPFNQGSRLTAYELVHDKIPATLIADSAAA  239

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             ALM+AGRV+AV+VGADR+A+NGDTANKIGTYS+A+CA  H VPF+VAAPLTS+DLSLSSG
Sbjct  240   ALMQAGRVDAVVVGADRVASNGDTANKIGTYSVALCAKFHNVPFFVAAPLTSIDLSLSSG  299

Query  553   QQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGN  377
             QQIVIEERSPKELL+  GGLGEQ+AASGISVWNPAFDVTPA+LISGIITEKGVI+K    
Sbjct  300   QQIVIEERSPKELLNMRGGLGEQVAASGISVWNPAFDVTPANLISGIITEKGVITKTPAG  359

Query  376   DAFDITGFVHK  344
             DAFDI  FV K
Sbjct  360   DAFDIKAFVQK  370



>emb|CDY33397.1| BnaA07g04420D [Brassica napus]
Length=373

 Score =   512 bits (1319),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 283/368 (77%), Positives = 324/368 (88%), Gaps = 2/368 (1%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQ-RKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  1253
             D TL++ICYK GSLQLLDQ RKLPL+T YL+I++A DGW AI+EMVVRGAPAIAIAAALS
Sbjct  6     DTTLKSICYKPGSLQLLDQQRKLPLETTYLEIRDAADGWSAIQEMVVRGAPAIAIAAALS  65

Query  1252  laveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASE  1076
             LAVE SN   F+G++ +AV+FL  KL+YLVSSRPTAVNL+DAA KL +VI    AS+A+E
Sbjct  66    LAVEVSNFSGFDGSSAEAVTFLENKLDYLVSSRPTAVNLADAALKLKQVIANALASSAAE  125

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
               +IF+AYI AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGY
Sbjct  126   PNSIFKAYIEAAENMLEDDVASNKAIGTFGSSLLRQQAKNPDKLSVLTHCNTGSLATAGY  185

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK G
Sbjct  186   GTALGVIRALHTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDG  245

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             RV+ VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIE
Sbjct  246   RVDGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIE  305

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITG  356
             ER+ KELL+THGGLGE+IAA GISVWNPAFDVTPA LI+GIITEKGVI+K+ NDAFDI+ 
Sbjct  306   ERTAKELLNTHGGLGERIAAPGISVWNPAFDVTPAELIAGIITEKGVITKNANDAFDISS  365

Query  355   FVHKVSGN  332
             F  KV+GN
Sbjct  366   FAKKVTGN  373



>ref|XP_007012614.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 2 
[Theobroma cacao]
 gb|EOY30233.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 2 
[Theobroma cacao]
Length=458

 Score =   515 bits (1327),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 278/347 (80%), Positives = 315/347 (91%), Gaps = 0/347 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TLQ+ICYK GSLQLLDQRKLPL+T+YLDI++A DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  57    DNTLQSICYKCGSLQLLDQRKLPLETVYLDIQDATDGWNAIRDMVVRGAPAIAIAAALSL  116

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE +NL+ FNGT +DA SFL  KLEYLVSSRPTAVNLSDAATKL ++I+K A+TA+   
Sbjct  117   AVEVANLKDFNGTCEDAASFLEMKLEYLVSSRPTAVNLSDAATKLRKIISKAATTATVPG  176

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
              +F+AYI AAE+MLEDDVASNKAIGS+GAS LQ+Q   SK+ S+LTHCNTGSLATAGYGT
Sbjct  177   NVFQAYIEAAEVMLEDDVASNKAIGSYGASFLQHQQKNSKRFSVLTHCNTGSLATAGYGT  236

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV
Sbjct  237   ALGVIRALHAEGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEGRV  296

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AVIVGADR+AANGDTANKIGTYSLA+CAM+H +PFYVAAPLTS+DLSLSSGQ+I+IEER
Sbjct  297   SAVIVGADRVAANGDTANKIGTYSLAICAMYHHIPFYVAAPLTSIDLSLSSGQEIIIEER  356

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
             S KELLHT GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEK  +S
Sbjct  357   SAKELLHTRGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKVSLS  403



>ref|XP_008786516.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Phoenix dactylifera]
Length=376

 Score =   511 bits (1316),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 278/374 (74%), Positives = 325/374 (87%), Gaps = 1/374 (0%)
 Frame = -2

Query  1453  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  1274
             MA  ++ +  +LQ+ICY+RGSL+LLDQR+LP++T+YLD+++A DGW+A+++MVVRGAPAI
Sbjct  1     MAVESNGKSDSLQSICYERGSLRLLDQRRLPIETVYLDVRDATDGWNAVRDMVVRGAPAI  60

Query  1273  aiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  1094
             AIAAALSLAVE  NL+ F GT+ DA SFL +KLEYLVSSRPTAVNLSDA+TKL  ++ K 
Sbjct  61    AIAAALSLAVEVFNLD-FTGTSGDAASFLVKKLEYLVSSRPTAVNLSDASTKLQNIVLKT  119

Query  1093  ASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGS  914
             A TA+EAKT+F++YI AAE ML DDVA NKAIG HGAS L  QL  S K+S+LTHCNTGS
Sbjct  120   AKTATEAKTVFQSYIDAAETMLTDDVADNKAIGFHGASFLPCQLKDSGKLSVLTHCNTGS  179

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGVIRA++  G LE A+CTETRPFNQGSRLTAFELV + IPATLI DSAAA
Sbjct  180   LATAGYGTALGVIRALHAGGSLEAAFCTETRPFNQGSRLTAFELVHDKIPATLITDSAAA  239

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             ALMKAGRVNAVIVGADRIAANGDTANKIGTYSLAV A +HG+PFYVAAP+TS+DLSLSSG
Sbjct  240   ALMKAGRVNAVIVGADRIAANGDTANKIGTYSLAVSASYHGIPFYVAAPITSIDLSLSSG  299

Query  553   QQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGND  374
             +QIVIEERSPKELL + GGLG+Q+AASGI+VWNPAFDVTPA+LI+ IITEKG I+K   D
Sbjct  300   RQIVIEERSPKELLCSDGGLGKQVAASGIAVWNPAFDVTPANLITAIITEKGAITKATAD  359

Query  373   AFDITGFVHKVSGN  332
             AFDI GF+ K  GN
Sbjct  360   AFDIKGFIQKAQGN  373



>ref|XP_004287647.1| PREDICTED: methylthioribose-1-phosphate isomerase [Fragaria vesca 
subsp. vesca]
Length=376

 Score =   510 bits (1314),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 276/359 (77%), Positives = 318/359 (89%), Gaps = 0/359 (0%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQAI Y RGSLQLLDQ KLPL + YL+I+++ DGW AIK+MVVRGAPAIAIAAALSLAV
Sbjct  16    SLQAIRYNRGSLQLLDQTKLPLHSTYLNIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAV  75

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NL  FNGT  +A SF+  KLEYLVSSRPTAVNLSDAATKL +++ K A++ASE K++
Sbjct  76    EVFNLGDFNGTPDEASSFIIMKLEYLVSSRPTAVNLSDAATKLKQIVAKVAASASEYKSV  135

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             FEAYI A+E+ML++DV +NKAIGSHGA+ +Q  L  SK+I +LTHCNTGSLATAGYGTAL
Sbjct  136   FEAYIEASEVMLKEDVDTNKAIGSHGATFIQRHLENSKRICMLTHCNTGSLATAGYGTAL  195

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIR+++T G LERAYCTETRPFNQGSRLTA+ELV +NIPATLIADSAAAALMK G+VNA
Sbjct  196   GVIRSLHTEGVLERAYCTETRPFNQGSRLTAYELVHDNIPATLIADSAAAALMKDGKVNA  255

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             ++VGADR+A+NGDTANKIGTYSLAV A +H +PF+VAAPLTSVDLSLSSG +IVIEERSP
Sbjct  256   IVVGADRVASNGDTANKIGTYSLAVSAKYHNIPFFVAAPLTSVDLSLSSGGEIVIEERSP  315

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFVH  347
             KELL+THGGLGEQ+AASGISVWNPAFDVTPASLI GIITEKGVI+K G DAFDI GFV 
Sbjct  316   KELLNTHGGLGEQVAASGISVWNPAFDVTPASLIYGIITEKGVITKKGTDAFDIKGFVQ  374



>ref|XP_006280656.1| hypothetical protein CARUB_v10026616mg [Capsella rubella]
 gb|EOA13554.1| hypothetical protein CARUB_v10026616mg [Capsella rubella]
Length=370

 Score =   510 bits (1313),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 279/365 (76%), Positives = 320/365 (88%), Gaps = 1/365 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL++ICYK GSLQLLDQRKLPL+T YL+I++  DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6     DTTLKSICYKPGSLQLLDQRKLPLETTYLEIRDTADGWKAIQEMVVRGAPAIAIAAALSL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASEA  1073
             AVE  N   F+G++ DAV+FL  KL+YLVSSRPTAVNL+DAA KL +VI    A+TA E 
Sbjct  66    AVEVFNFNGFDGSSTDAVAFLDNKLDYLVSSRPTAVNLADAAVKLKQVIKNALATTAIEP  125

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             K+IF+AYI AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYG
Sbjct  126   KSIFKAYIEAAENMLEDDVASNKAIGNFGSSLLRQQAQNPDKLSVLTHCNTGSLATAGYG  185

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GR
Sbjct  186   TALGVIRALHTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGR  245

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+ VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIEE
Sbjct  246   VDGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIEE  305

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGF  353
             R+ KELL+THGGLGE+IAA GISVWNPAFDVTPA LI+GIITEKG+I+K+ NDAFDI+ F
Sbjct  306   RTAKELLNTHGGLGERIAAPGISVWNPAFDVTPAELIAGIITEKGIITKNDNDAFDISSF  365

Query  352   VHKVS  338
               K++
Sbjct  366   AKKMT  370



>emb|CDY70356.1| BnaCnng67980D [Brassica napus]
Length=373

 Score =   509 bits (1312),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 280/368 (76%), Positives = 324/368 (88%), Gaps = 2/368 (1%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQ-RKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  1253
             D TL++ICYK GSLQLLDQ RKLPL+T YL+I++  DGW AI+EMVVRGAPAIAIAAALS
Sbjct  6     DTTLKSICYKPGSLQLLDQQRKLPLETTYLEIRDTADGWSAIQEMVVRGAPAIAIAAALS  65

Query  1252  laveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASE  1076
             LAVE SN   F+G++ +AV+FL +KL+YLVSSRPTAVNL+DA+ KL +VI    AS+A+E
Sbjct  66    LAVEVSNFSGFDGSSAEAVAFLEKKLDYLVSSRPTAVNLADASLKLKQVIANALASSAAE  125

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
               +IF+AYI AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGY
Sbjct  126   PNSIFKAYIEAAENMLEDDVASNKAIGTFGSSLLRQQAKNPDKLSVLTHCNTGSLATAGY  185

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK G
Sbjct  186   GTALGVIRALHTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDG  245

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             RV+ V+VGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTSVDLSLSSG++IVIE
Sbjct  246   RVDGVVVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSVDLSLSSGKEIVIE  305

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITG  356
             ER+ KELL+THGGLGE+IAA GISVWNPAFDVTPA LI+GIITEKGVI+K+ NDAFDI+ 
Sbjct  306   ERTAKELLNTHGGLGERIAAPGISVWNPAFDVTPAELIAGIITEKGVITKNANDAFDISS  365

Query  355   FVHKVSGN  332
             F  KV+GN
Sbjct  366   FAKKVTGN  373



>ref|XP_011660028.1| PREDICTED: methylthioribose-1-phosphate isomerase [Cucumis sativus]
 gb|KGN66312.1| hypothetical protein Csa_1G597100 [Cucumis sativus]
Length=381

 Score =   507 bits (1305),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 272/365 (75%), Positives = 325/365 (89%), Gaps = 0/365 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D +LQ+ICYKRGSL+LLDQRKLPL+T+YLDIK+A DGW AI++MVVRGAPAIAI+AAL+L
Sbjct  14    DNSLQSICYKRGSLRLLDQRKLPLETVYLDIKDATDGWHAIRDMVVRGAPAIAISAALAL  73

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             A E +N   FNGT  DA SF++ KL+YLVSSRPTAVNL DAA KL E++++ A+ +SEA 
Sbjct  74    AAEVNNSAPFNGTPNDAASFIADKLDYLVSSRPTAVNLGDAAIKLKEIVSRAAAISSEAS  133

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+A+I AAE MLEDDVASNKAIG +GA+ +++Q    +K S+LTHCNTGSLATAGYGT
Sbjct  134   SVFQAFIEAAEAMLEDDVASNKAIGLYGANYIRDQQKSLEKFSVLTHCNTGSLATAGYGT  193

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA+++AG LERAYCTETRPFNQGSRLTA+ELV E IP+TLIADSAAAALMK GRV
Sbjct  194   ALGVIRALHSAGVLERAYCTETRPFNQGSRLTAYELVHEKIPSTLIADSAAAALMKFGRV  253

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             NAV+VGADR+AANGDTANKIGTYSLA+CAMHH +PF+VAAPLTS+DLSLSSG++IVIEER
Sbjct  254   NAVVVGADRVAANGDTANKIGTYSLALCAMHHKIPFFVAAPLTSIDLSLSSGEEIVIEER  313

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGFV  350
             SPKELL++ GGLGEQ+AASGI+VWNPAFDVTPA LI GIITEKGVI+K G+D+F+I  FV
Sbjct  314   SPKELLNSRGGLGEQVAASGIAVWNPAFDVTPAHLICGIITEKGVITKAGSDSFNIKEFV  373

Query  349   HKVSG  335
              K +G
Sbjct  374   QKTAG  378



>ref|XP_002277806.1| PREDICTED: methylthioribose-1-phosphate isomerase [Vitis vinifera]
 ref|XP_010656105.1| PREDICTED: methylthioribose-1-phosphate isomerase [Vitis vinifera]
 sp|D7TCD0.2|MTNA_VITVI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Vitis 
vinifera]
Length=376

 Score =   504 bits (1298),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 277/374 (74%), Positives = 323/374 (86%), Gaps = 1/374 (0%)
 Frame = -2

Query  1453  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  1274
             MA+       +LQ+ICYKRGSLQLLDQRKLPL+T+YL+IK A DGW AI++MVVRGAPAI
Sbjct  1     MADSNSKHQDSLQSICYKRGSLQLLDQRKLPLETVYLEIKGADDGWHAIRDMVVRGAPAI  60

Query  1273  aiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  1094
             AIAAALSLAVE SNLE F GT+ DA SFL+ KL+YLV+SRPTAVNLSDA TKL  VI+  
Sbjct  61    AIAAALSLAVEVSNLEDFIGTSDDAASFLNSKLDYLVTSRPTAVNLSDAVTKLKGVISNA  120

Query  1093  ASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGS  914
             A+TA EA ++F+A++ AAE ML +DVA+N+AIG +GAS LQ+ +  SK +SILTHCNTGS
Sbjct  121   AATAFEAMSVFQAFLEAAEDMLREDVAANRAIGLYGASFLQSHIKDSKNLSILTHCNTGS  180

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGVIR+V+  G L RAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAA
Sbjct  181   LATAGYGTALGVIRSVHAEGILLRAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAA  240

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             ALM+AGRV+AVIVGADR+AANGDTANKIGTYSLA+ A HH +PF+VAAPLTS+DL+LSSG
Sbjct  241   ALMQAGRVDAVIVGADRVAANGDTANKIGTYSLALSAKHHHIPFFVAAPLTSIDLTLSSG  300

Query  553   QQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGND  374
             Q+IVIEERSPKELL++ GGLGEQ+AASGI VWNPAFDVTPA LI+GIITEKGVI+K G D
Sbjct  301   QEIVIEERSPKELLNSRGGLGEQVAASGICVWNPAFDVTPADLIAGIITEKGVITKTG-D  359

Query  373   AFDITGFVHKVSGN  332
              FDI  F+H  + +
Sbjct  360   VFDIKDFIHNATSH  373



>ref|XP_003595318.1| Methylthioribose-1-phosphate isomerase [Medicago truncatula]
Length=382

 Score =   504 bits (1299),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 281/381 (74%), Positives = 326/381 (86%), Gaps = 12/381 (3%)
 Frame = -2

Query  1453  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  1274
             MA+   +    LQAI Y RGSLQLLDQ KLPL+++YL+I+++ DGW+AI++MVVRGAPAI
Sbjct  1     MASSDSNATNMLQAIRYNRGSLQLLDQTKLPLESVYLEIRDSNDGWNAIRDMVVRGAPAI  60

Query  1273  aiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  1094
             AIAAALSLAVE SNL+ FNG+  DAV FL +KL+YLVSSRPTAVNLSDAATKL E+I+K 
Sbjct  61    AIAAALSLAVEVSNLDDFNGSTDDAVYFLQKKLDYLVSSRPTAVNLSDAATKLKEIISKA  120

Query  1093  ASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGS  914
             A+T SEAK +F+AY+ AAEIMLEDDVASN+AIG++GAS +QNQ     K+S+LTHCNTGS
Sbjct  121   AATTSEAKGVFQAYLEAAEIMLEDDVASNRAIGTYGASFIQNQ-TEKLKLSVLTHCNTGS  179

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGVIRA+ + G LERAYCTETRPFNQGSRLTA+ELV + IPATLIADSAAA
Sbjct  180   LATAGYGTALGVIRALYSGGVLERAYCTETRPFNQGSRLTAYELVHDKIPATLIADSAAA  239

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             ALM+AGRV+AV+VGADR+A+NGDTANKIGTYS+A+CA  H VPF+VAAPLTS+DLSLSSG
Sbjct  240   ALMQAGRVDAVVVGADRVASNGDTANKIGTYSVALCAKFHNVPFFVAAPLTSIDLSLSSG  299

Query  553   QQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEK---------  401
             QQIVIEERSPKELL+  GGLGEQ+AASGISVWNPAFDVTPA+LISGIITEK         
Sbjct  300   QQIVIEERSPKELLNMRGGLGEQVAASGISVWNPAFDVTPANLISGIITEKVCLTSSVSC  359

Query  400   -GVISK-DGNDAFDITGFVHK  344
              GVI+K    DAFDI  FV K
Sbjct  360   MGVITKTPAGDAFDIKAFVQK  380



>gb|KDO73879.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=358

 Score =   503 bits (1296),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 273/349 (78%), Positives = 314/349 (90%), Gaps = 1/349 (0%)
 Frame = -2

Query  1435  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  1256
             +++ +LQ+ICY+RGSLQLLDQRKLPL+TIYL+I+++ DGW AI+EMVVRGAPAIA+AAAL
Sbjct  8     TDNNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGAPAIAMAAAL  67

Query  1255  slaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  1076
             SLAVE  NL  F+GTA DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K A+TASE
Sbjct  68    SLAVEVFNLNAFSGTAADAASFLGNKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASE  127

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
             A ++F+AYI AAEIML+DDVA+NKAIGS+GAS LQNQL  SK  S+LTHCNTGSLATAGY
Sbjct  128   ANSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQLKNSK-FSVLTHCNTGSLATAGY  186

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIRA+++ G LERAYC+ETRPFNQGSRLTAFELV + IPATLIADSAAAALMK G
Sbjct  187   GTALGVIRALHSEGVLERAYCSETRPFNQGSRLTAFELVHDRIPATLIADSAAAALMKDG  246

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             RV+AVIVGADR+AANGDTANKIGTYSLA+CA  H + FYVAAPLTS+DL+LSSGQ+IVIE
Sbjct  247   RVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIE  306

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
             ERS KELL + GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEK  +S
Sbjct  307   ERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKVSVS  355



>ref|XP_004488081.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Cicer 
arietinum]
Length=372

 Score =   504 bits (1298),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 275/363 (76%), Positives = 322/363 (89%), Gaps = 3/363 (1%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y RGSLQLLDQ KLPL+++YL+I+++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  11    LQAIRYNRGSLQLLDQTKLPLESVYLEIRDSNDGWNAIRDMVVRGAPAIAIAAALALAVE  70

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
              SNL+ F+G+  DA  FL +KLEYLV+SRPTAVNLSDAATKL E+I+  A+T SEA+ +F
Sbjct  71    VSNLDDFSGSTDDAAYFLHKKLEYLVTSRPTAVNLSDAATKLKEIISMAAATTSEARGVF  130

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             +AY+ AAEIMLEDDVASNKAIG +GAS +QN      K+S+LTHCNTGSLATAGYGTALG
Sbjct  131   QAYVEAAEIMLEDDVASNKAIGIYGASFIQNH-TEKHKLSVLTHCNTGSLATAGYGTALG  189

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             VIRA+++ G LERAYCTETRPFNQGSRLTA+ELV + IPATLIADSAAAALM+AGRV+AV
Sbjct  190   VIRALHSGGVLERAYCTETRPFNQGSRLTAYELVHDKIPATLIADSAAAALMQAGRVDAV  249

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
             +VGADR+A+NGDTANKIGTYS+A+CA  H VPFYVAAPLTS+DLSLSSG+QIVIEERSPK
Sbjct  250   VVGADRVASNGDTANKIGTYSVALCAKFHNVPFYVAAPLTSIDLSLSSGKQIVIEERSPK  309

Query  520   ELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKD--GNDAFDITGFVH  347
             ELL+T GGLGEQ+AASGISVWNPAFDVTPA+LISGIITEKGVI+K   G+ +FDI  FV 
Sbjct  310   ELLNTRGGLGEQVAASGISVWNPAFDVTPANLISGIITEKGVITKTSAGDASFDIKTFVQ  369

Query  346   KVS  338
             K S
Sbjct  370   KTS  372



>ref|XP_007138649.1| hypothetical protein PHAVU_009G226400g [Phaseolus vulgaris]
 gb|ESW10643.1| hypothetical protein PHAVU_009G226400g [Phaseolus vulgaris]
Length=373

 Score =   504 bits (1297),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 276/361 (76%), Positives = 321/361 (89%), Gaps = 2/361 (1%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQ+I Y RGSL LLDQRKLPL+T YL+I+++ DGW+AI++MVVRGAPAIAIAAALSLAV
Sbjct  12    TLQSIRYTRGSLHLLDQRKLPLETTYLEIRDSTDGWNAIRDMVVRGAPAIAIAAALSLAV  71

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NL+ FNG+A +AVSFL  KLEYLVSSRPTAVNLSDAATKL EV++  A+TASE +++
Sbjct  72    EVFNLDGFNGSAGEAVSFLQNKLEYLVSSRPTAVNLSDAATKLKEVVSNAAATASEGRSV  131

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             F+A+I A+E+MLEDDVASN+AIGS+GA+ +Q Q    +K+S+LTHCNTGSLATAGYGTAL
Sbjct  132   FQAFIEASEVMLEDDVASNRAIGSYGATCIQQQ-TEKQKLSVLTHCNTGSLATAGYGTAL  190

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIRA+++ G LERAYCTETRPFNQGSRLTA+ELV E IP+TLIADSAAAALMKAG V+A
Sbjct  191   GVIRALHSGGVLERAYCTETRPFNQGSRLTAYELVHEKIPSTLIADSAAAALMKAGSVDA  250

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADR+A+NGDTANKIGTYS+A+ A  H VPFYVAAPLTSVDLSLSSGQ+IVIEERSP
Sbjct  251   VVVGADRVASNGDTANKIGTYSVALFAKFHNVPFYVAAPLTSVDLSLSSGQEIVIEERSP  310

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITGFVH  347
             KELL+  GGLGEQ+AASGISVWNPAFDVTPA+LISGIITEKGVI+K    DAFDI  FV 
Sbjct  311   KELLNARGGLGEQVAASGISVWNPAFDVTPANLISGIITEKGVITKTSAGDAFDIKAFVQ  370

Query  346   K  344
             K
Sbjct  371   K  371



>emb|CBI27788.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   504 bits (1299),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 277/374 (74%), Positives = 323/374 (86%), Gaps = 1/374 (0%)
 Frame = -2

Query  1453  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  1274
             MA+       +LQ+ICYKRGSLQLLDQRKLPL+T+YL+IK A DGW AI++MVVRGAPAI
Sbjct  43    MADSNSKHQDSLQSICYKRGSLQLLDQRKLPLETVYLEIKGADDGWHAIRDMVVRGAPAI  102

Query  1273  aiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  1094
             AIAAALSLAVE SNLE F GT+ DA SFL+ KL+YLV+SRPTAVNLSDA TKL  VI+  
Sbjct  103   AIAAALSLAVEVSNLEDFIGTSDDAASFLNSKLDYLVTSRPTAVNLSDAVTKLKGVISNA  162

Query  1093  ASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGS  914
             A+TA EA ++F+A++ AAE ML +DVA+N+AIG +GAS LQ+ +  SK +SILTHCNTGS
Sbjct  163   AATAFEAMSVFQAFLEAAEDMLREDVAANRAIGLYGASFLQSHIKDSKNLSILTHCNTGS  222

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGVIR+V+  G L RAYCTETRPFNQGSRLTAFELV +NIPATLIADSAAA
Sbjct  223   LATAGYGTALGVIRSVHAEGILLRAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAA  282

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             ALM+AGRV+AVIVGADR+AANGDTANKIGTYSLA+ A HH +PF+VAAPLTS+DL+LSSG
Sbjct  283   ALMQAGRVDAVIVGADRVAANGDTANKIGTYSLALSAKHHHIPFFVAAPLTSIDLTLSSG  342

Query  553   QQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGND  374
             Q+IVIEERSPKELL++ GGLGEQ+AASGI VWNPAFDVTPA LI+GIITEKGVI+K G D
Sbjct  343   QEIVIEERSPKELLNSRGGLGEQVAASGICVWNPAFDVTPADLIAGIITEKGVITKTG-D  401

Query  373   AFDITGFVHKVSGN  332
              FDI  F+H  + +
Sbjct  402   VFDIKDFIHNATSH  415



>ref|XP_006452823.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
 gb|ESR66063.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
Length=358

 Score =   502 bits (1292),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 274/348 (79%), Positives = 312/348 (90%), Gaps = 1/348 (0%)
 Frame = -2

Query  1432  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  1253
             +  +LQ+ICY+RGSLQLLDQRKLPL+TIYL+I+++ DGW AI+EMVVRGAPAIAIAAALS
Sbjct  9     DSNSLQSICYRRGSLQLLDQRKLPLETIYLEIRDSADGWSAIREMVVRGAPAIAIAAALS  68

Query  1252  laveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             LAVE  NL  F+GTA DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K A+TASEA
Sbjct  69    LAVEVFNLNAFSGTAADAASFLGDKLEYLVSSRPTAVNLSDAAAKLKEIISKAAATASEA  128

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
              ++F+AYI AAEIML+DDVA+NKAIGS+GAS LQNQL  SK  S+LTHCNTGSLATAGYG
Sbjct  129   NSVFQAYIEAAEIMLKDDVATNKAIGSYGASFLQNQLKNSK-FSVLTHCNTGSLATAGYG  187

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA+++ G LERAYC+ETRPFNQGSRLTAFELV + IPATLIADSAAAALMK GR
Sbjct  188   TALGVIRALHSEGVLERAYCSETRPFNQGSRLTAFELVHDRIPATLIADSAAAALMKDGR  247

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+AVIVGADR+AANGDTANKIGTYSLA+CA  H + FYVAAPLTS+DL+LSSGQ+IVIEE
Sbjct  248   VSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEE  307

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
             RS KELL + GGLGEQ+AASGISVWNPAFDVTPA+LI+GIITEK  +S
Sbjct  308   RSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKVSVS  355



>ref|XP_010541997.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Tarenaya hassleriana]
Length=367

 Score =   495 bits (1274),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 273/365 (75%), Positives = 317/365 (87%), Gaps = 7/365 (2%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             DK LQ+ICYKRGSL+LLDQRKLPL+T YLDI  A+DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  7     DKVLQSICYKRGSLKLLDQRKLPLETTYLDILGAEDGWNAIRDMVVRGAPAIAIAAALSL  66

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE  N+++F+GT++DA +FL ++L+ LVSSRPTAVNL+DAA KL EVI+   + ASE K
Sbjct  67    AVEVFNMDSFDGTSEDAAAFLRKQLDCLVSSRPTAVNLADAAVKLKEVISGAMAAASEPK  126

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+AYI AAE MLE+DVASNKAIGS+G+S L+ Q   S K+S+LTHCNTGSLATAGYGT
Sbjct  127   SVFQAYIEAAENMLEEDVASNKAIGSYGSSFLRQQAKNSDKLSVLTHCNTGSLATAGYGT  186

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA+ + G LERAYCTETRPFNQGSRLTAFELV E  PATLIADSAAAALM  GRV
Sbjct  187   ALGVIRALQSQGVLERAYCTETRPFNQGSRLTAFELVHETPPATLIADSAAAALMNDGRV  246

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AVIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLTS+DLSLSSG++IVIEER
Sbjct  247   DAVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLTSIDLSLSSGKEIVIEER  306

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDA--FDITG  356
             SPKELL+THGGLGE+I ASGISVWNPA     A L+SGIITEKGVI+K G DA  FDI  
Sbjct  307   SPKELLNTHGGLGERIGASGISVWNPAX----AELVSGIITEKGVITK-GTDASSFDIRS  361

Query  355   FVHKV  341
             F  K+
Sbjct  362   FARKM  366



>ref|XP_004979099.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Setaria 
italica]
Length=367

 Score =   493 bits (1268),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 272/359 (76%), Positives = 313/359 (87%), Gaps = 2/359 (1%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQ+I Y RGSL+LLDQRKLPL+  Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7     LQSIVYARGSLRLLDQRKLPLEVDYIDVKDSADGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
              S L+ F GT   A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++K A TA +AK IF
Sbjct  67    VSGLD-FTGTPAGAASFVSKKLEYLVSSRPTAVNLSDAATKLQTLVSKTAETAKDAKAIF  125

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             + YI AAE ML DDVA NKAIGSHGA  LQ QL  SK IS+LTHCNTGSLATAGYGTALG
Sbjct  126   QVYIEAAETMLIDDVADNKAIGSHGAEFLQKQLGNSKNISVLTHCNTGSLATAGYGTALG  185

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             VIRA+++ G LE+A+CTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GRV AV
Sbjct  186   VIRALHSGGVLEKAFCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKQGRVQAV  245

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
             IVGADRIAANGDTANKIGTY+LA+ A HHGV FYVAAP+TS+DL+L SG++IVIEERSPK
Sbjct  246   IVGADRIAANGDTANKIGTYNLAISAKHHGVQFYVAAPVTSIDLTLPSGEEIVIEERSPK  305

Query  520   ELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITGFVH  347
             ELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K DG+ AFDI GF+ 
Sbjct  306   ELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKTDGDGAFDIKGFIQ  364



>ref|XP_009406483.1| PREDICTED: methylthioribose-1-phosphate isomerase {ECO:0000255|HAMAP-Rule:MF_03119} 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   491 bits (1265),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 271/360 (75%), Positives = 314/360 (87%), Gaps = 2/360 (1%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+ICY+RGSL+LLDQRKLPL+T+YLD+K++ DGW AI++MVVRGAPAIAIAAALSLAV
Sbjct  18    SLQSICYERGSLRLLDQRKLPLETVYLDVKDSTDGWTAIRDMVVRGAPAIAIAAALSLAV  77

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  NL+ FNGT++DA S L +KLEYLVSSRPTAVNLSDA  KL  ++ K   TA+EAKT+
Sbjct  78    EVWNLD-FNGTSEDASSLLIKKLEYLVSSRPTAVNLSDAVEKLRSLVLKTVETATEAKTV  136

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             F+AYI AAE ML DDVASNKAIG HGA  L++ L   +KIS+LTHCNTGSLATAGYGTAL
Sbjct  137   FQAYIDAAETMLIDDVASNKAIGFHGAKHLRSNLDSLEKISVLTHCNTGSLATAGYGTAL  196

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIRA+ + GFLE+A+CTETRPFNQGSRLTAFELV + IPATLIADSA AALMKAG VNA
Sbjct  197   GVIRALRSEGFLEKAFCTETRPFNQGSRLTAFELVHDRIPATLIADSAVAALMKAGCVNA  256

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             VIVGADRIAANGDTANKIGTY++A+ A HHG+ FYVAAP+TS+DLS+SSG+QIVIEERS 
Sbjct  257   VIVGADRIAANGDTANKIGTYNVALSAFHHGIQFYVAAPITSIDLSISSGEQIVIEERSA  316

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGND-AFDITGFVH  347
             KELLH+ GG G+Q+AASGISVWNPAFDVTPA LI+ IITEKGVI K  +D AFDI GF+ 
Sbjct  317   KELLHSDGGRGKQVAASGISVWNPAFDVTPARLITAIITEKGVIIKKASDEAFDIKGFIE  376



>sp|B6TZD1.1|MTNA_MAIZE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=ZmIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Zea mays]
 gb|ACG42464.1| methylthioribose-1-phosphate isomerase [Zea mays]
 gb|AFW60581.1| methylthioribose-1-phosphate isomerase isoform 1 [Zea mays]
 gb|AFW60582.1| methylthioribose-1-phosphate isomerase isoform 2 [Zea mays]
Length=367

 Score =   488 bits (1255),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 268/358 (75%), Positives = 314/358 (88%), Gaps = 2/358 (1%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQ+I Y RGSL+LLDQRKLPL+  Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7     LQSIVYSRGSLRLLDQRKLPLEMEYIDVKSSADGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
              S+L+ F GT ++A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++K A TA ++K+IF
Sbjct  67    VSDLD-FIGTPEEAASFVSKKLEYLVSSRPTAVNLSDAATKLQTLVSKAAETAKDSKSIF  125

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             + YI AAE ML DDVA NKAIGSHGA  LQ QL  SKKIS+LTHCNTGSLATAGYGTALG
Sbjct  126   QVYIEAAETMLVDDVADNKAIGSHGAVFLQRQLANSKKISVLTHCNTGSLATAGYGTALG  185

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             VIRA+++ G LE+A+CTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK G V AV
Sbjct  186   VIRALHSGGVLEKAFCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKQGHVQAV  245

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
             IVGADRIAANGDTANKIGTY+LA+ A HH V FYV+AP+TS+DLSL SG +IVIEERSPK
Sbjct  246   IVGADRIAANGDTANKIGTYNLAISAKHHSVQFYVSAPVTSIDLSLPSGDEIVIEERSPK  305

Query  520   ELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITGFV  350
             ELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K D + +FDI GF+
Sbjct  306   ELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKTDADGSFDIKGFL  363



>ref|NP_001105275.1| methylthioribose-1-phosphate isomerase [Zea mays]
 gb|AAU86895.1| isopentenyl-diphosphate delta isomerase 2 [Zea mays]
Length=367

 Score =   486 bits (1250),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 268/358 (75%), Positives = 313/358 (87%), Gaps = 2/358 (1%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQ+I Y RGSL+LLDQRKLPL+  Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7     LQSIVYSRGSLRLLDQRKLPLEMEYIDVKSSADGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
              S+L+ F GT ++A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++K A TA ++K+IF
Sbjct  67    VSDLD-FIGTPEEAASFVSKKLEYLVSSRPTAVNLSDAATKLQTLVSKAAETAKDSKSIF  125

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             + YI AAE ML DDVA NKAIGSHGA  LQ QL  SKKIS+LTHCNTGSLATAGYGTALG
Sbjct  126   QVYIEAAETMLVDDVADNKAIGSHGAVFLQRQLANSKKISVLTHCNTGSLATAGYGTALG  185

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             VIRA+++ G LE+A+CTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK G V AV
Sbjct  186   VIRALHSGGVLEKAFCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKQGHVQAV  245

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
             IVGADRIAANGDTANKIGTY+LA+ A HH V  YVAAP+TS+DLSL SG +IVIEERSPK
Sbjct  246   IVGADRIAANGDTANKIGTYNLAISAKHHSVQVYVAAPVTSIDLSLPSGDEIVIEERSPK  305

Query  520   ELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITGFV  350
             ELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K D + +FDI GF+
Sbjct  306   ELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKTDADGSFDIKGFL  363



>gb|ACG37871.1| methylthioribose-1-phosphate isomerase [Zea mays]
Length=367

 Score =   485 bits (1249),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 268/358 (75%), Positives = 313/358 (87%), Gaps = 2/358 (1%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQ+I Y RGSL+LLDQRKLPL+  Y+D+K++ DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7     LQSIVYSRGSLRLLDQRKLPLEMEYIDVKSSADGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
              S+L+ F GT ++A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++K A TA ++K+IF
Sbjct  67    VSDLD-FIGTPEEAASFVSKKLEYLVSSRPTAVNLSDAATKLQTLVSKAAETAKDSKSIF  125

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             + YI AAE ML DDVA NKAIGSHGA  LQ QL  SKKIS+LTHCNTGSLATAGYGTALG
Sbjct  126   QVYIEAAETMLVDDVADNKAIGSHGAVFLQRQLANSKKISVLTHCNTGSLATAGYGTALG  185

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             VIRA+++ G LE+A+CTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK G V AV
Sbjct  186   VIRALHSGGVLEKAFCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKQGHVQAV  245

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
             IVGADRIAANGDTANKIGTY+LA+ A HH V  YVAAP+TS+DLSL SG +IVIEERSPK
Sbjct  246   IVGADRIAANGDTANKIGTYNLAISAKHHSVQVYVAAPVTSIDLSLPSGDEIVIEERSPK  305

Query  520   ELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITGFV  350
             ELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K D + +FDI GF+
Sbjct  306   ELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKTDADGSFDIKGFL  363



>gb|EMS50123.1| Methylthioribose-1-phosphate isomerase [Triticum urartu]
Length=367

 Score =   484 bits (1246),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 265/364 (73%), Positives = 313/364 (86%), Gaps = 2/364 (1%)
 Frame = -2

Query  1432  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  1253
             E   LQ+I Y RG+L+LLDQRKLPL+ +Y+D+K++ DGW+AI++MVVRGAPAIAIAAALS
Sbjct  3     ESSALQSILYDRGALRLLDQRKLPLEEVYIDVKDSADGWNAIRDMVVRGAPAIAIAAALS  62

Query  1252  laveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             LAVE  N   F GT  +A SF+S+KLEYLVSSRPTAVNLSDAATKL  ++++ A TA +A
Sbjct  63    LAVEV-NDHDFTGTPVEAASFVSKKLEYLVSSRPTAVNLSDAATKLQNLVSRTAETAKDA  121

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             K+IF+ +I AAE ML DDVA NKAIG HGA  LQ QL  S+ IS+LTHCNTGSLATAGYG
Sbjct  122   KSIFQVFIEAAEAMLVDDVADNKAIGLHGAEFLQRQLGSSRNISVLTHCNTGSLATAGYG  181

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA+++ G LE+A+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALM  G+
Sbjct  182   TALGVIRALHSGGVLEKAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMNNGQ  241

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V AVIVGADRIAANGDTANKIGTY+L++ A HHGV FYVAAP+TS+DLSL SG+QIVIEE
Sbjct  242   VQAVIVGADRIAANGDTANKIGTYNLSISAKHHGVQFYVAAPVTSIDLSLPSGKQIVIEE  301

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITG  356
             RSPKELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K D N +FDI G
Sbjct  302   RSPKELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKSDPNGSFDIKG  361

Query  355   FVHK  344
             F+ +
Sbjct  362   FIER  365



>ref|XP_003577698.1| PREDICTED: methylthioribose-1-phosphate isomerase [Brachypodium 
distachyon]
Length=368

 Score =   483 bits (1242),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 263/358 (73%), Positives = 312/358 (87%), Gaps = 2/358 (1%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQ+I Y RGSL+LLDQRKLPL+ +Y+D+K++ DGW+AI++MVVRGAPAIAIAAALSLAVE
Sbjct  8     LQSILYDRGSLRLLDQRKLPLEEVYIDVKDSTDGWNAIRDMVVRGAPAIAIAAALSLAVE  67

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
               N + F GT+++A SF+S+KLEYLVSSRPTAVNLSDAATKL  ++ + A TA +AK+IF
Sbjct  68    VFN-QDFIGTSEEAASFVSKKLEYLVSSRPTAVNLSDAATKLQNLVLRTAETAKDAKSIF  126

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             + +I A E ML DDVA NKAIG HGA  LQ Q+  SK IS+LTHCNTGSLATAGYGTALG
Sbjct  127   QVFIEATETMLVDDVADNKAIGLHGAEFLQRQVGRSKNISVLTHCNTGSLATAGYGTALG  186

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             VIRA+++ G LE+A+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALM  G++ AV
Sbjct  187   VIRALHSGGVLEKAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMNNGQIQAV  246

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
             IVGADRIAANGDTANKIGTY+L++ A HHGV FYVAAP+TS+DLSL+SG+QIVIEERSPK
Sbjct  247   IVGADRIAANGDTANKIGTYNLSISAKHHGVEFYVAAPVTSIDLSLASGKQIVIEERSPK  306

Query  520   ELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITGFV  350
             ELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K D N  FDI GF+
Sbjct  307   ELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKSDPNGTFDIKGFI  364



>gb|KJB82983.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=345

 Score =   482 bits (1240),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 264/341 (77%), Positives = 302/341 (89%), Gaps = 2/341 (1%)
 Frame = -2

Query  1351  IYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslaveaSNLETFNGTAQDAVSFLSQKLE  1172
             +YLDI  + DGW+AI++MVVRGAPAIAIAAALSLAVE +NL+ FNG ++DA SFL  KLE
Sbjct  1     MYLDIHGSTDGWNAIRDMVVRGAPAIAIAAALSLAVEVANLKDFNGGSKDAASFLESKLE  60

Query  1171  YLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGS  992
             YLVSSRPTAVNLSDAA KL E+I+K AST +  +++F+AYI AAEIML+DDVA+NKAIGS
Sbjct  61    YLVSSRPTAVNLSDAAIKLKEIISKAASTVTVPESVFQAYIEAAEIMLDDDVATNKAIGS  120

Query  991   HGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFN  812
             HGA+ LQ+Q   SK+ S+LTHCNTGSLATAGYGTALGVIRA++  G LERAYCTETRPFN
Sbjct  121   HGANFLQHQQNNSKRFSVLTHCNTGSLATAGYGTALGVIRALHAQGVLERAYCTETRPFN  180

Query  811   QGSRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLA  632
             QGSRLTAFELV E IPATLIADSAAAALMK  RV+AVIVGADR+ ANGDTANKIGTYSLA
Sbjct  181   QGSRLTAFELVHEKIPATLIADSAAAALMKEDRVDAVIVGADRVTANGDTANKIGTYSLA  240

Query  631   VCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNP  452
             +CAMHH +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT GGLGEQ+AASGISVWNP
Sbjct  241   LCAMHHHIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHTRGGLGEQVAASGISVWNP  300

Query  451   AFDVTPASLISGIITEKGVISKDG--NDAFDITGFVHKVSG  335
             AFDVTPA+LI+GIITEKGVI+K+   +DAFDI  F+ K +G
Sbjct  301   AFDVTPANLIAGIITEKGVITKNDMKDDAFDIKDFIEKATG  341



>ref|XP_006662829.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Oryza 
brachyantha]
Length=367

 Score =   478 bits (1229),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 265/363 (73%), Positives = 311/363 (86%), Gaps = 2/363 (1%)
 Frame = -2

Query  1432  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  1253
             E   LQ+I Y RGSL+LLDQRKLPL+  Y+D+K + DGW+AI++MVVRGAPAIAIAAAL+
Sbjct  3     ESCALQSIVYHRGSLRLLDQRKLPLEVAYIDVKCSTDGWNAIRDMVVRGAPAIAIAAALA  62

Query  1252  laveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             LAVE S L+ F GT  +A SF+S+KLEYLVSSRPTAVNLSDAATKL  ++++ A T  +A
Sbjct  63    LAVEVSGLD-FTGTPAEAASFVSEKLEYLVSSRPTAVNLSDAATKLQSLVSRTAETEKDA  121

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             K IF+AYI AAE ML DDVA NKAIGS+GA  L+ +L  SK IS+LTHCNTGSLATAGYG
Sbjct  122   KAIFQAYIDAAETMLVDDVADNKAIGSYGAEFLKQKLGNSKHISVLTHCNTGSLATAGYG  181

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA+++ G LE+A+CTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GR
Sbjct  182   TALGVIRALHSGGILEKAFCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKNGR  241

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V AVIVGADRIAANGDTANKIGTY+LA+ A HHGV FYVAAP+TS+DLSL SG +IVIEE
Sbjct  242   VQAVIVGADRIAANGDTANKIGTYNLAISAKHHGVQFYVAAPVTSIDLSLPSGDEIVIEE  301

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITG  356
             RSPKELL+T GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKG+++K D ++ F+I  
Sbjct  302   RSPKELLNTEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGLVTKSDADETFNIKD  361

Query  355   FVH  347
             F+ 
Sbjct  362   FMQ  364



>dbj|BAJ86257.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   476 bits (1225),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 264/363 (73%), Positives = 309/363 (85%), Gaps = 2/363 (1%)
 Frame = -2

Query  1432  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  1253
             E   LQ+I Y RG+L+LLDQRKLPL+ +Y+D+K++ DGW+AI++MVVRGAPAIAIAAALS
Sbjct  3     ESSALQSILYGRGALRLLDQRKLPLEEVYVDVKDSADGWNAIRDMVVRGAPAIAIAAALS  62

Query  1252  laveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             LAVE  N   F GT  +A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++  A TA +A
Sbjct  63    LAVEV-NDHNFIGTPAEAASFVSKKLEYLVSSRPTAVNLSDAATKLQNLVSTTAETAKDA  121

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             K+IF+ +I AAE ML DDVA NKAIG HGA  LQ QL  SK IS+LTHCNTGSLATAGYG
Sbjct  122   KSIFQVFIEAAETMLVDDVADNKAIGLHGAEFLQRQLGSSKNISVLTHCNTGSLATAGYG  181

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA+++ G LE+A+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALM  G+
Sbjct  182   TALGVIRALHSGGVLEKAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMNNGQ  241

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V AVIVGADRIAANGDTANKIGTY+L++ A HHGV FYVAAP+TS+DLSL SG+QIVIEE
Sbjct  242   VQAVIVGADRIAANGDTANKIGTYNLSIAAKHHGVQFYVAAPVTSIDLSLPSGKQIVIEE  301

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITG  356
             RSPKELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K D +  FDI  
Sbjct  302   RSPKELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKSDPDGTFDIKS  361

Query  355   FVH  347
             F+ 
Sbjct  362   FIE  364



>sp|A2ZCP0.1|MTNA_ORYSI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Oryza 
sativa Indica Group]
 gb|EAY80374.1| hypothetical protein OsI_35550 [Oryza sativa Indica Group]
Length=374

 Score =   476 bits (1226),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 261/359 (73%), Positives = 310/359 (86%), Gaps = 1/359 (0%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQ+I Y RGSL+LLDQRKLPL+  Y+D+K + DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7     LQSIVYHRGSLRLLDQRKLPLEVDYIDVKCSGDGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
              S LE F GT  +A +F+S+KLEYLVSSRPTAVNLSDAATKL  ++++ A T  +AK IF
Sbjct  67    VSGLEDFTGTPAEAAAFVSEKLEYLVSSRPTAVNLSDAATKLRSLVSRTAETEKDAKAIF  126

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             +AYI AAE ML DDV+ NKAIGSHGA  L+ +L  SK IS+LTHCNTGSLATAGYGTALG
Sbjct  127   QAYIDAAETMLVDDVSDNKAIGSHGAEFLKQKLEVSKDISVLTHCNTGSLATAGYGTALG  186

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             VIRA+++ G LE+A+CTETRPFNQGSRLTAFELV + +PATLIADSAAAALMK+G + AV
Sbjct  187   VIRALHSGGILEKAFCTETRPFNQGSRLTAFELVHDKVPATLIADSAAAALMKSGCIQAV  246

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
             IVGADRIAANGDTANKIGTY+LA+ A HHGV FYVAAP+TS+DLSL SG+QIVIEERSP 
Sbjct  247   IVGADRIAANGDTANKIGTYNLAISAKHHGVQFYVAAPITSIDLSLPSGEQIVIEERSPN  306

Query  520   ELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITGFVH  347
             ELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K D ++ F+I  F+ 
Sbjct  307   ELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKSDADETFNIKDFIQ  365



>sp|Q9AYT7.1|MTNA_HORVU RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=HvIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Hordeum vulgare]
 dbj|BAB21393.1| IDI2 [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   476 bits (1224),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 264/363 (73%), Positives = 308/363 (85%), Gaps = 2/363 (1%)
 Frame = -2

Query  1432  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  1253
             E   LQ+I Y RG+L+LLDQRKLPL+ +Y+D+K++ DGW+AI++MVVRGAPAIAIAAALS
Sbjct  3     ESSALQSILYGRGALRLLDQRKLPLEEVYVDVKDSADGWNAIRDMVVRGAPAIAIAAALS  62

Query  1252  laveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             LAVE  N   F GT  +A SF+S+KLEYLVSSRPTAVNLSDAATKL  +++  A TA +A
Sbjct  63    LAVEV-NDHNFIGTPAEAASFVSKKLEYLVSSRPTAVNLSDAATKLQNLVSTTAETAKDA  121

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             K+IF+ +I AAE ML DDVA NKAIG HGA  LQ QL  SK IS+LTHCNTGSLATAGYG
Sbjct  122   KSIFQVFIEAAETMLVDDVADNKAIGLHGAEFLQRQLGSSKNISVLTHCNTGSLATAGYG  181

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA+++ G LE+A+CTETRPFNQGSRLTAFELV + IPATLIADSAAAALM  G+
Sbjct  182   TALGVIRALHSGGVLEKAFCTETRPFNQGSRLTAFELVHDKIPATLIADSAAAALMNNGQ  241

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V AVIVGADRIAANGDTANKIGTY+L++ A HHGV FYVAAP+TS+DLSL SG+QIVIEE
Sbjct  242   VQAVIVGADRIAANGDTANKIGTYNLSIAAKHHGVQFYVAAPVTSIDLSLPSGKQIVIEE  301

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITG  356
             RSPKELL++ GGLG+Q+AASGISVWNPAFDVTPA LI+ IITEKGVI+K D +  FDI  
Sbjct  302   RSPKELLNSEGGLGKQVAASGISVWNPAFDVTPADLITAIITEKGVITKSDPDGTFDIKS  361

Query  355   FVH  347
             F+ 
Sbjct  362   FIE  364



>ref|NP_001067511.1| Os11g0216900 [Oryza sativa Japonica Group]
 sp|Q0ITU1.1|MTNA_ORYSJ RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=OsIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Oryza sativa Japonica Group]
 dbj|BAF27874.1| Os11g0216900 [Oryza sativa Japonica Group]
 tpd|FAA00313.1| TPA: eukaryotic translation initiation factor 2B-like putative 
methylthioribose-1-phosphate isomerase [Oryza sativa Japonica 
Group]
 gb|EEE51856.1| hypothetical protein OsJ_33377 [Oryza sativa Japonica Group]
Length=374

 Score =   475 bits (1223),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 261/359 (73%), Positives = 309/359 (86%), Gaps = 1/359 (0%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQ+I Y RGSL+LLDQRKLPL+  Y+D+K + DGW+AI++MVVRGAPAIAIAAAL+LAVE
Sbjct  7     LQSIVYHRGSLRLLDQRKLPLEVDYIDVKCSGDGWNAIRDMVVRGAPAIAIAAALALAVE  66

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
              S LE F GT  +A  F+S+KLEYLVSSRPTAVNLSDAATKL  ++++ A T  +AK IF
Sbjct  67    VSGLEDFTGTPAEAAVFVSEKLEYLVSSRPTAVNLSDAATKLRSLVSRTAETEKDAKAIF  126

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             +AYI AAE ML DDV+ NKAIGSHGA  L+ +L  SK IS+LTHCNTGSLATAGYGTALG
Sbjct  127   QAYIDAAETMLVDDVSDNKAIGSHGAEFLKQKLEVSKDISVLTHCNTGSLATAGYGTALG  186

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             VIRA+++ G LE+A+CTETRPFNQGSRLTAFELV + +PATLIADSAAAALMK+G + AV
Sbjct  187   VIRALHSGGILEKAFCTETRPFNQGSRLTAFELVHDKVPATLIADSAAAALMKSGCIQAV  246

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
             IVGADRIAANGDTANKIGTY+LA+ A HHGV FYVAAP+TS+DLSL SG+QIVIEERSP 
Sbjct  247   IVGADRIAANGDTANKIGTYNLAISAKHHGVQFYVAAPITSIDLSLPSGEQIVIEERSPN  306

Query  520   ELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITGFVH  347
             ELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K D ++ F+I  F+ 
Sbjct  307   ELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKSDADETFNIKDFIQ  365



>gb|ABA92066.2| Initiation factor 2 subunit family protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA92067.2| Initiation factor 2 subunit family protein, expressed [Oryza 
sativa Japonica Group]
Length=508

 Score =   474 bits (1221),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 263/366 (72%), Positives = 311/366 (85%), Gaps = 1/366 (0%)
 Frame = -2

Query  1441  AHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaa  1262
             A  E   LQ+I Y RGSL+LLDQRKLPL+  Y+D+K + DGW+AI++MVVRGAPAIAIAA
Sbjct  134   AMGELGALQSIVYHRGSLRLLDQRKLPLEVDYIDVKCSGDGWNAIRDMVVRGAPAIAIAA  193

Query  1261  alslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA  1082
             AL+LAVE S LE F GT  +A  F+S+KLEYLVSSRPTAVNLSDAATKL  ++++ A T 
Sbjct  194   ALALAVEVSGLEDFTGTPAEAAVFVSEKLEYLVSSRPTAVNLSDAATKLRSLVSRTAETE  253

Query  1081  SEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATA  902
              +AK IF+AYI AAE ML DDV+ NKAIGSHGA  L+ +L  SK IS+LTHCNTGSLATA
Sbjct  254   KDAKAIFQAYIDAAETMLVDDVSDNKAIGSHGAEFLKQKLEVSKDISVLTHCNTGSLATA  313

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk  722
             GYGTALGVIRA+++ G LE+A+CTETRPFNQGSRLTAFELV + +PATLIADSAAAALMK
Sbjct  314   GYGTALGVIRALHSGGILEKAFCTETRPFNQGSRLTAFELVHDKVPATLIADSAAAALMK  373

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +G + AVIVGADRIAANGDTANKIGTY+LA+ A HHGV FYVAAP+TS+DLSL SG+QIV
Sbjct  374   SGCIQAVIVGADRIAANGDTANKIGTYNLAISAKHHGVQFYVAAPITSIDLSLPSGEQIV  433

Query  541   IEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFD  365
             IEERSP ELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ IITEKGVI+K D ++ F+
Sbjct  434   IEERSPNELLNSEGGLGKQVAASGISVWNPAFDVTPANLITAIITEKGVITKSDADETFN  493

Query  364   ITGFVH  347
             I  F+ 
Sbjct  494   IKDFIQ  499



>ref|NP_001077883.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AEC05978.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=328

 Score =   461 bits (1187),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 254/324 (78%), Positives = 286/324 (88%), Gaps = 0/324 (0%)
 Frame = -2

Query  1303  EMVVRGapaiaiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAA  1124
             EMVVRGAPAIAIAAALSLAVE  N   F+G+A DAV+FL  KL+YLVSSRPTAVNL+DAA
Sbjct  2     EMVVRGAPAIAIAAALSLAVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAA  61

Query  1123  TKLNEVITKEASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKI  944
              KL  VI K  +TA+EAK+IF+AYI A+E MLEDDV SNKAIG+ G SLL+ Q     K+
Sbjct  62    LKLKHVIAKALATATEAKSIFKAYIEASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKL  121

Query  943   SILTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIP  764
             S+LTHCNTGSLATAGYGTALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IP
Sbjct  122   SVLTHCNTGSLATAGYGTALGVIRALHTQGILERAYCTETRPFNQGSRLTAFELVHEKIP  181

Query  763   atliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
             ATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPL
Sbjct  182   ATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPL  241

Query  583   TSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITE  404
             TSVDLSLSSG++IVIEERSPKEL+HTHGGLGE+IAA GISVWNPAFD+TPA LI+GIITE
Sbjct  242   TSVDLSLSSGKEIVIEERSPKELMHTHGGLGERIAAPGISVWNPAFDMTPAELIAGIITE  301

Query  403   KGVISKDGNDAFDITGFVHKVSGN  332
             KGVI+K+GND FDI+ F  K++GN
Sbjct  302   KGVITKNGNDTFDISSFAKKITGN  325



>gb|EPS64192.1| methylthioribose-1-phosphate isomerase, partial [Genlisea aurea]
Length=341

 Score =   461 bits (1185),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 254/342 (74%), Positives = 295/342 (86%), Gaps = 1/342 (0%)
 Frame = -2

Query  1426  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  1247
             K+LQ+I Y RGSLQLLDQRKLPL+TIYLDIKN++ GW AIK+MVVRGAPAIAIAAALSLA
Sbjct  1     KSLQSIRYSRGSLQLLDQRKLPLETIYLDIKNSEAGWIAIKDMVVRGAPAIAIAAALSLA  60

Query  1246  veaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT  1067
             VE SN+E F G  +DA  F+S KL+YLV+SRPTAVNLSDAA KL +V+   AS +   ++
Sbjct  61    VEVSNMEDFIGDPEDAALFISNKLDYLVTSRPTAVNLSDAAEKLKKVV-HNASESPHPQS  119

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTA  887
             +F AY+ A+E MLEDDVASNKAIG+HGA  L  +     + S+LTHCNTGSLATAGYGTA
Sbjct  120   VFRAYVEASEFMLEDDVASNKAIGNHGADFLHEEQKHLHRFSVLTHCNTGSLATAGYGTA  179

Query  886   LGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVN  707
             LGVIR+++  G LERAYCTETRPFNQGSRLTAFELV ++IPATLIADSAAAALM AGRV+
Sbjct  180   LGVIRSLHEKGLLERAYCTETRPFNQGSRLTAFELVHDSIPATLIADSAAAALMNAGRVD  239

Query  706   AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERS  527
              V+VGADR+AANGDTANKIGTYSL++ A HHG+PFYVAAPLTSVDL L SG++I IEERS
Sbjct  240   VVVVGADRVAANGDTANKIGTYSLSLSAAHHGIPFYVAAPLTSVDLLLPSGKEIAIEERS  299

Query  526   PKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEK  401
             P+ELL+  GGLGE++AASGISVWNPAFDVTPA+LISGIITEK
Sbjct  300   PEELLNARGGLGERVAASGISVWNPAFDVTPAALISGIITEK  341



>ref|NP_973428.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 ref|NP_001031339.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AAM20446.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AAM91239.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AEC05976.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AEC05977.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=326

 Score =   459 bits (1182),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 253/323 (78%), Positives = 285/323 (88%), Gaps = 0/323 (0%)
 Frame = -2

Query  1300  MVVRGapaiaiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAAT  1121
             MVVRGAPAIAIAAALSLAVE  N   F+G+A DAV+FL  KL+YLVSSRPTAVNL+DAA 
Sbjct  1     MVVRGAPAIAIAAALSLAVEVFNFHGFDGSASDAVAFLENKLDYLVSSRPTAVNLADAAL  60

Query  1120  KLNEVITKEASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKIS  941
             KL  VI K  +TA+EAK+IF+AYI A+E MLEDDV SNKAIG+ G SLL+ Q     K+S
Sbjct  61    KLKHVIAKALATATEAKSIFKAYIEASEDMLEDDVVSNKAIGNFGLSLLRQQAKNPDKLS  120

Query  940   ILTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPa  761
             +LTHCNTGSLATAGYGTALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPA
Sbjct  121   VLTHCNTGSLATAGYGTALGVIRALHTQGILERAYCTETRPFNQGSRLTAFELVHEKIPA  180

Query  760   tliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLT  581
             TLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HHG+PFYVAAPLT
Sbjct  181   TLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHHGIPFYVAAPLT  240

Query  580   SVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEK  401
             SVDLSLSSG++IVIEERSPKEL+HTHGGLGE+IAA GISVWNPAFD+TPA LI+GIITEK
Sbjct  241   SVDLSLSSGKEIVIEERSPKELMHTHGGLGERIAAPGISVWNPAFDMTPAELIAGIITEK  300

Query  400   GVISKDGNDAFDITGFVHKVSGN  332
             GVI+K+GND FDI+ F  K++GN
Sbjct  301   GVITKNGNDTFDISSFAKKITGN  323



>gb|ADE77025.1| unknown [Picea sitchensis]
Length=384

 Score =   459 bits (1182),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 249/362 (69%), Positives = 304/362 (84%), Gaps = 1/362 (0%)
 Frame = -2

Query  1432  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  1253
             E+ TLQ+I Y RG LQLLDQRKLP  ++Y+DI+++  GW AI +MVVRGAPAIAI+AALS
Sbjct  10    EENTLQSIRYSRGRLQLLDQRKLPHDSVYIDIQDSTAGWHAIHDMVVRGAPAIAISAALS  69

Query  1252  laveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             LAVE +NL + + +  DA+SFL ++LE+LVSSRPTAVNLSDAATKLN+V+ K  +  S+ 
Sbjct  70    LAVEVANLGSVDWSVNDAISFLQKRLEFLVSSRPTAVNLSDAATKLNDVVLKATNDMSKP  129

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             + IF+AY+ AAE ML DD+ +NKAIGS+GA  + +Q      + +LTHCNTGSLATAGYG
Sbjct  130   EAIFQAYVEAAEGMLIDDIDTNKAIGSNGAKFILSQTQKCHNLHVLTHCNTGSLATAGYG  189

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA+++ G LE A+CTETRP+NQGSRLTA+EL+ ++IPA LIADSAAAAL K+GR
Sbjct  190   TALGVIRALHSEGLLETAFCTETRPYNQGSRLTAYELIHDHIPAVLIADSAAAALQKSGR  249

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+A+IVGADRIA NGDTANKIGTY+LA+ A HHG+PFYVAAPLTSVDLSLSSG+QI+IEE
Sbjct  250   VDAIIVGADRIAENGDTANKIGTYNLALSAFHHGIPFYVAAPLTSVDLSLSSGEQIIIEE  309

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS-KDGNDAFDITG  356
             RSPKEL H  GG G+Q+A SGISVWNPAFDVTPA+LI+ IITEKGVI+ KD +  FDI G
Sbjct  310   RSPKELTHALGGQGQQVAPSGISVWNPAFDVTPANLITAIITEKGVITKKDSSTTFDIKG  369

Query  355   FV  350
             FV
Sbjct  370   FV  371



>ref|XP_006842716.1| PREDICTED: methylthioribose-1-phosphate isomerase [Amborella 
trichopoda]
 gb|ERN04391.1| hypothetical protein AMTR_s00147p00099160 [Amborella trichopoda]
Length=372

 Score =   458 bits (1179),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 300/362 (83%), Gaps = 1/362 (0%)
 Frame = -2

Query  1432  EDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaals  1253
             E+ +LQ+I Y  G L+LLDQ++LP +++YLDI N + GW AIK++VVRGAPAIAI+AALS
Sbjct  12    EEGSLQSIRYSPGRLELLDQQRLPHESVYLDINNTESGWIAIKDLVVRGAPAIAISAALS  71

Query  1252  laveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             LAVE SNL++F+GT+ DA SFL +KLEYLVSSRPTAVNLSDAAT+L E++ K A+T   A
Sbjct  72    LAVEVSNLKSFDGTSTDAASFLVKKLEYLVSSRPTAVNLSDAATRLKEIVLK-AATDGNA  130

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             +++F+AYI AAE ML DDV SNKAIG HGA  + NQ   SKK+SILTHCNTGSLATAGYG
Sbjct  131   ESVFQAYIEAAEAMLVDDVRSNKAIGKHGADFIMNQHKDSKKLSILTHCNTGSLATAGYG  190

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA++  G LE A+ TETRP NQGSRLTA+ELV + IPATLI DSAAAALMKAGR
Sbjct  191   TALGVIRALHAEGVLETAFFTETRPVNQGSRLTAYELVHDKIPATLITDSAAAALMKAGR  250

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+AVIVGADRIAANGDTANKIGTYS A+ A +HGVPFYVAAP TS+DLSL+SG QI IEE
Sbjct  251   VDAVIVGADRIAANGDTANKIGTYSHAISASYHGVPFYVAAPFTSIDLSLTSGDQITIEE  310

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGF  353
             RS KEL H  GG GEQ+  +GIS WNPAFDVTPASLI+ IITEKGVI+K   + F I  F
Sbjct  311   RSAKELTHARGGQGEQVVVNGISAWNPAFDVTPASLITAIITEKGVITKASANDFKIRDF  370

Query  352   VH  347
             +H
Sbjct  371   IH  372



>ref|XP_006396132.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
 gb|ESQ36911.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
Length=341

 Score =   446 bits (1146),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 256/367 (70%), Positives = 295/367 (80%), Gaps = 32/367 (9%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TL++ICYKRGSLQLLDQRKLPL+T YL+I+N+ DGW AI+EMVVRGAPAIAIAAALSL
Sbjct  6     DTTLKSICYKRGSLQLLDQRKLPLETTYLEIRNSVDGWSAIQEMVVRGAPAIAIAAALSL  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE-ASTASEA  1073
             AVE  N   F+G++ DAV+FL +KL+YLVSSRPTAVNL+DAA KL +VI K  A+T  E 
Sbjct  66    AVEVFNFNGFDGSSTDAVAFLEKKLDYLVSSRPTAVNLADAALKLKQVIAKALATTTIEP  125

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             K+IF+AYI AAE MLEDDVASNKAIG+ G+SLL+ Q     K+S+LTHCNTGSLATAGYG
Sbjct  126   KSIFKAYIDAAENMLEDDVASNKAIGTFGSSLLRQQTKNPDKLSVLTHCNTGSLATAGYG  185

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA++T G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK GR
Sbjct  186   TALGVIRALHTQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKDGR  245

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+ VIVGADR+A+N                               VDLSLSSG++IVIEE
Sbjct  246   VDGVIVGADRVASN-------------------------------VDLSLSSGKEIVIEE  274

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGF  353
             R+PKELL+THGGLGE+IAA GISVWNPAFDVTPA LI+GIITEKG+I+K GN AFDI+ F
Sbjct  275   RTPKELLNTHGGLGERIAAPGISVWNPAFDVTPAELIAGIITEKGIITKSGNGAFDISSF  334

Query  352   VHKVSGN  332
               K++GN
Sbjct  335   AQKMTGN  341



>ref|XP_001754539.1| predicted protein [Physcomitrella patens]
 gb|EDQ80509.1| predicted protein, partial [Physcomitrella patens]
Length=362

 Score =   432 bits (1112),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 238/361 (66%), Positives = 292/361 (81%), Gaps = 2/361 (1%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L AI Y+RGSLQLLDQRKLP ++IY DIK+A  GW AI +MVVRGAPAIAIAAAL+LAVE
Sbjct  1     LLAIRYRRGSLQLLDQRKLPYESIYSDIKDAVAGWAAISDMVVRGAPAIAIAAALALAVE  60

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
               +L+ F+G   +AV+FL  +L+YLVSSRPTAVNL++AAT L  +    A    +A+ ++
Sbjct  61    VESLKPFSGAGLEAVAFLKNRLDYLVSSRPTAVNLAEAATNLLNICQAVADKGDDAEAVY  120

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGA-SLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
             +AY+ AAE ML  DVASNKAIG++GA +LLQ +      + +LTHCNTGSLAT+ YGTAL
Sbjct  121   QAYLEAAEKMLAADVASNKAIGAYGAEALLQAKPASGNGMRVLTHCNTGSLATSQYGTAL  180

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIRA++  G LE A CTETRP+NQGSRLTAFELV + IPA L+ADSAAA+L   GRV+A
Sbjct  181   GVIRALHAQGKLETAICTETRPYNQGSRLTAFELVHDKIPAILVADSAAASLQSLGRVDA  240

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADRIAANGDTANKIGTYSLA+ A HHGVPFYVA+PLT++D +  SG++I+IEERSP
Sbjct  241   VVVGADRIAANGDTANKIGTYSLALSAFHHGVPFYVASPLTTIDTATKSGKEIIIEERSP  300

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGN-DAFDITGFVH  347
             KEL H+HGG G QIAA G+ VWNPAFDVTPA LI+GIIT++GVI+K+GN D FDI  F+ 
Sbjct  301   KELTHSHGGQGTQIAADGVGVWNPAFDVTPARLITGIITDQGVITKEGNSDVFDIPSFIA  360

Query  346   K  344
             +
Sbjct  361   R  361



>ref|XP_002992382.1| hypothetical protein SELMODRAFT_135203, partial [Selaginella 
moellendorffii]
 gb|EFJ06532.1| hypothetical protein SELMODRAFT_135203, partial [Selaginella 
moellendorffii]
Length=368

 Score =   425 bits (1093),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 245/364 (67%), Positives = 293/364 (80%), Gaps = 4/364 (1%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D  L+AI Y RGSL+LLDQR+LP + +YLD+ ++  GW AIK+MVVRGAPAIAIAAALSL
Sbjct  4     DGALRAIVYNRGSLRLLDQRELPFKIVYLDVNDSGTGWKAIKDMVVRGAPAIAIAAALSL  63

Query  1249  aveaSNLETFN-GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SE  1076
             AVE  NL      T QDA+  L ++L+YLVSSRPTAVNL+DAA KL +V +  AST  + 
Sbjct  64    AVEVHNLRPGKVTTPQDALLLLQKRLDYLVSSRPTAVNLADAAEKLKKVASVAASTDNAS  123

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
             A+ +F+AYI AAE  LE+DV+SNKAIG +G++ L N    S+K+++LTHCNTGSLATAGY
Sbjct  124   AQDVFQAYIEAAEAFLEEDVSSNKAIGDYGSAFLLNGADESRKLAVLTHCNTGSLATAGY  183

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQ-GSRLTAFELVTENIPatliadsaaaalmkA  719
             GTALGVIRA+++   L  A+CTETRP+NQ GSRLTAFELV +NIPA L+ADSAAA+L  +
Sbjct  184   GTALGVIRALHSQNRLHTAFCTETRPYNQQGSRLTAFELVHDNIPAVLVADSAAASLQSS  243

Query  718   GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
             GRV+AVIVGADR+AANGDTANKIGTYSLAV A  HG+PF VAAPLTSVDLS+SSG QI I
Sbjct  244   GRVDAVIVGADRVAANGDTANKIGTYSLAVSASRHGIPFLVAAPLTSVDLSISSGDQISI  303

Query  538   EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDI  362
             EERS  EL HT GG G ++AA GISVWNPAFDVTPA+LIS IIT+KGVI+K D +  FDI
Sbjct  304   EERSALELTHTQGGQGHRVAAEGISVWNPAFDVTPAALISAIITDKGVITKADESGTFDI  363

Query  361   TGFV  350
               FV
Sbjct  364   PAFV  367



>gb|KJB82985.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=285

 Score =   421 bits (1081),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 218/279 (78%), Positives = 248/279 (89%), Gaps = 2/279 (1%)
 Frame = -2

Query  1165  VSSRPTAVNLSDAATKLNEVITKEASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHG  986
             + SRPTAVNLSDAA KL E+I+K AST +  +++F+AYI AAEIML+DDVA+NKAIGSHG
Sbjct  3     IFSRPTAVNLSDAAIKLKEIISKAASTVTVPESVFQAYIEAAEIMLDDDVATNKAIGSHG  62

Query  985   ASLLQNQLVGSKKISILTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQG  806
             A+ LQ+Q   SK+ S+LTHCNTGSLATAGYGTALGVIRA++  G LERAYCTETRPFNQG
Sbjct  63    ANFLQHQQNNSKRFSVLTHCNTGSLATAGYGTALGVIRALHAQGVLERAYCTETRPFNQG  122

Query  805   SRLTAFELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVC  626
             SRLTAFELV E IPATLIADSAAAALMK  RV+AVIVGADR+ ANGDTANKIGTYSLA+C
Sbjct  123   SRLTAFELVHEKIPATLIADSAAAALMKEDRVDAVIVGADRVTANGDTANKIGTYSLALC  182

Query  625   AMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAF  446
             AMHH +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT GGLGEQ+AASGISVWNPAF
Sbjct  183   AMHHHIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHTRGGLGEQVAASGISVWNPAF  242

Query  445   DVTPASLISGIITEKGVISKDG--NDAFDITGFVHKVSG  335
             DVTPA+LI+GIITEKGVI+K+   +DAFDI  F+ K +G
Sbjct  243   DVTPANLIAGIITEKGVITKNDMKDDAFDIKDFIEKATG  281



>ref|XP_002967758.1| hypothetical protein SELMODRAFT_87975, partial [Selaginella moellendorffii]
 gb|EFJ31105.1| hypothetical protein SELMODRAFT_87975, partial [Selaginella moellendorffii]
Length=368

 Score =   422 bits (1086),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 245/364 (67%), Positives = 291/364 (80%), Gaps = 4/364 (1%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D  L+AI Y RGSL+LLDQR+LP + +YLD+ ++  GW AIK+MVVRGAPAIAIAAALSL
Sbjct  4     DGALRAIIYNRGSLRLLDQRELPFKIVYLDVNDSGTGWKAIKDMVVRGAPAIAIAAALSL  63

Query  1249  aveaSNLETFN-GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SE  1076
             AVE  NL      T QDA   L ++L+YLVSSRPTAVNL+DAA KL  V +  AST  + 
Sbjct  64    AVEVHNLRPGEVTTPQDAHLLLRKRLDYLVSSRPTAVNLADAAEKLKRVASVAASTDNAS  123

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
             A+ +F+AYI AAE  LE+DV+SNKAIG +G++ L N    S+K+++LTHCNTGSLATAGY
Sbjct  124   AQDVFQAYIEAAEAFLEEDVSSNKAIGDYGSAFLLNGADESRKLAVLTHCNTGSLATAGY  183

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQ-GSRLTAFELVTENIPatliadsaaaalmkA  719
             GTALGVIRA+++   L  A+CTETRP+NQ GSRLTAFELV +NIPA L+ADSAAA+L  +
Sbjct  184   GTALGVIRALHSQNRLHTAFCTETRPYNQQGSRLTAFELVHDNIPAVLVADSAAASLQSS  243

Query  718   GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
             GRV+AVIVGADR+AANGDTANKIGTYSLAV A  HG+PF VAAPLTSVDLS+SSG QI I
Sbjct  244   GRVDAVIVGADRVAANGDTANKIGTYSLAVSASRHGIPFLVAAPLTSVDLSISSGDQISI  303

Query  538   EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDI  362
             EERS  EL HT GG G ++AA GISVWNPAFDVTPA+LIS IIT+KGVI+K D +  FDI
Sbjct  304   EERSALELTHTQGGQGHRVAAEGISVWNPAFDVTPAALISAIITDKGVITKADESGTFDI  363

Query  361   TGFV  350
               FV
Sbjct  364   PAFV  367



>gb|EMT32201.1| Methylthioribose-1-phosphate isomerase [Aegilops tauschii]
Length=452

 Score =   426 bits (1094),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 242/324 (75%), Positives = 281/324 (87%), Gaps = 2/324 (1%)
 Frame = -2

Query  1315  DAIKEMVVRGapaiaiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNL  1136
             +AI++MVVRGAPAIAIAAALSLAVE  N   F GT  +A SF+S+KLEYLVSSRPTAVNL
Sbjct  127   NAIRDMVVRGAPAIAIAAALSLAVEV-NDHDFTGTPVEAASFVSKKLEYLVSSRPTAVNL  185

Query  1135  SDAATKLNEVITKEASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVG  956
             SDAATKL  ++++ A TA +AK+IF+ +I AAE ML DDVA NKAIGSHGA  LQ QL  
Sbjct  186   SDAATKLQNLVSRTAETAKDAKSIFQVFIEAAEAMLVDDVADNKAIGSHGAEFLQRQLGS  245

Query  955   SKKISILTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVT  776
             S+ IS+LTHCNTGSLATAGYGTALGVIRA+++ G LE+A+CTETRPFNQGSRLTAFELV 
Sbjct  246   SRNISVLTHCNTGSLATAGYGTALGVIRALHSGGVLEKAFCTETRPFNQGSRLTAFELVH  305

Query  775   ENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYV  596
             + IPATLIADSAAAALM  G+V AVIVGADRIAANGDTANKIGTY+L++ A HHG+ FYV
Sbjct  306   DKIPATLIADSAAAALMNNGQVQAVIVGADRIAANGDTANKIGTYNLSISAKHHGMQFYV  365

Query  595   AAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISG  416
             AAP+TS+DLSL SG+QIVIEERSPKELL++ GGLG+Q+AASGISVWNPAFDVTPA+LI+ 
Sbjct  366   AAPVTSIDLSLPSGKQIVIEERSPKELLNSEGGLGKQVAASGISVWNPAFDVTPANLITA  425

Query  415   IITEKGVISK-DGNDAFDITGFVH  347
             IITEKGVI+K D N +FDI GF+ 
Sbjct  426   IITEKGVITKSDPNGSFDIKGFIE  449



>gb|KJB07314.1| hypothetical protein B456_001G015800 [Gossypium raimondii]
 gb|KJB07316.1| hypothetical protein B456_001G015800 [Gossypium raimondii]
Length=325

 Score =   402 bits (1032),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 239/322 (74%), Positives = 277/322 (86%), Gaps = 1/322 (0%)
 Frame = -2

Query  1300  MVVRGapaiaiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAAT  1121
             MVVRGAPAIAIAAALSLAVE +N + FNGT+++A SF+  KLEYLVSSRPTAVNLSDAA 
Sbjct  1     MVVRGAPAIAIAAALSLAVEVANFKDFNGTSEEAASFIELKLEYLVSSRPTAVNLSDAAK  60

Query  1120  KLNEVITKEASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKIS  941
             KL E+ +  AST    +++F+AYI AAEIML+DDVASNKAIGS+G+  LQ+Q     + S
Sbjct  61    KLIEITSNAASTTIMPESVFQAYIEAAEIMLDDDVASNKAIGSYGSRFLQDQRKIVPRFS  120

Query  940   ILTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPa  761
             +LTHCNTGSLATAGYGTALGVIRA++  G LERAYCTETRPFNQGS LTAFELV + IPA
Sbjct  121   VLTHCNTGSLATAGYGTALGVIRALHAEGVLERAYCTETRPFNQGSWLTAFELVHDKIPA  180

Query  760   tliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLT  581
             TLIADSAAAALMK  R++AVIVGAD +AANGDTANKI TYSLAVCAMHH +PFY+AA L+
Sbjct  181   TLIADSAAAALMKESRLSAVIVGADPVAANGDTANKIRTYSLAVCAMHHHIPFYIAASLS  240

Query  580   SVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEK  401
             S+DLSLSSG++IVIEERS KELLH+ GGLGEQ+AASGI VWNPAFDVTPA LI+GI+TEK
Sbjct  241   SIDLSLSSGEEIVIEERSSKELLHSRGGLGEQVAASGILVWNPAFDVTPAYLITGIVTEK  300

Query  400   GVISKDGNDAFDITGFVHKVSG  335
             GVI+K+ NDAF+I  FV K +G
Sbjct  301   GVITKN-NDAFNIKDFVEKAAG  321



>gb|AFK48892.1| unknown [Medicago truncatula]
Length=304

 Score =   371 bits (952),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 209/290 (72%), Positives = 250/290 (86%), Gaps = 1/290 (0%)
 Frame = -2

Query  1453  MANGAHSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapai  1274
             MA+   +    LQ I Y RGSLQLLDQ KLPL+++YL+I+++ DGW+AI++MVVRGAPAI
Sbjct  1     MASSDSNATNMLQTIRYNRGSLQLLDQTKLPLESVYLEIRDSNDGWNAIRDMVVRGAPAI  60

Query  1273  aiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE  1094
             AIAAALSLAVE SNL+ FNG+  DAV FL +KL+YLVSSRPTAVNLSDAATKL E+I+K 
Sbjct  61    AIAAALSLAVEVSNLDDFNGSTDDAVYFLQKKLDYLVSSRPTAVNLSDAATKLKEIISKA  120

Query  1093  ASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGS  914
             A+T SEA+ +F+AY+ AAEIMLEDDVASN+AIG++GAS +QNQ     K+S+LTHCNTGS
Sbjct  121   AATTSEARGVFQAYLEAAEIMLEDDVASNRAIGTYGASFIQNQ-TEKLKLSVLTHCNTGS  179

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGVIRA+ + G LERAYCTETRPFNQGSRLTA+ELV + IPATLIADSAAA
Sbjct  180   LATAGYGTALGVIRALYSGGVLERAYCTETRPFNQGSRLTAYELVHDKIPATLIADSAAA  239

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
             ALM+AGRV+AV+VGADR+A+NGDTANKIGTYS+A+CA  H VPF+   PL
Sbjct  240   ALMQAGRVDAVVVGADRVASNGDTANKIGTYSVALCAKFHNVPFFCGCPL  289



>gb|KJB07315.1| hypothetical protein B456_001G015800 [Gossypium raimondii]
Length=298

 Score =   370 bits (951),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 222/295 (75%), Positives = 255/295 (86%), Gaps = 0/295 (0%)
 Frame = -2

Query  1300  MVVRGapaiaiaaalslaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAAT  1121
             MVVRGAPAIAIAAALSLAVE +N + FNGT+++A SF+  KLEYLVSSRPTAVNLSDAA 
Sbjct  1     MVVRGAPAIAIAAALSLAVEVANFKDFNGTSEEAASFIELKLEYLVSSRPTAVNLSDAAK  60

Query  1120  KLNEVITKEASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKIS  941
             KL E+ +  AST    +++F+AYI AAEIML+DDVASNKAIGS+G+  LQ+Q     + S
Sbjct  61    KLIEITSNAASTTIMPESVFQAYIEAAEIMLDDDVASNKAIGSYGSRFLQDQRKIVPRFS  120

Query  940   ILTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPa  761
             +LTHCNTGSLATAGYGTALGVIRA++  G LERAYCTETRPFNQGS LTAFELV + IPA
Sbjct  121   VLTHCNTGSLATAGYGTALGVIRALHAEGVLERAYCTETRPFNQGSWLTAFELVHDKIPA  180

Query  760   tliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLT  581
             TLIADSAAAALMK  R++AVIVGAD +AANGDTANKI TYSLAVCAMHH +PFY+AA L+
Sbjct  181   TLIADSAAAALMKESRLSAVIVGADPVAANGDTANKIRTYSLAVCAMHHHIPFYIAASLS  240

Query  580   SVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISG  416
             S+DLSLSSG++IVIEERS KELLH+ GGLGEQ+AASGI VWNPAFDVTPA LI+G
Sbjct  241   SIDLSLSSGEEIVIEERSSKELLHSRGGLGEQVAASGILVWNPAFDVTPAYLITG  295



>ref|XP_007780227.1| methylthioribose-1-phosphate isomerase [Coniosporium apollinis 
CBS 100218]
 gb|EON64910.1| methylthioribose-1-phosphate isomerase [Coniosporium apollinis 
CBS 100218]
Length=395

 Score =   358 bits (918),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 222/377 (59%), Positives = 270/377 (72%), Gaps = 26/377 (7%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y RGSLQ+LDQ KLP   +Y DI+ + D W AIKEM  RGAPAIAI AAL+LAVE
Sbjct  3     LQAIKYTRGSLQILDQLKLPHAEVYDDIRTSTDAWHAIKEMRTRGAPAIAIVAALALAVE  62

Query  1240  aSNLETFNGTAQ---DAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI---TKEASTAS  1079
               N+ T    +Q   +   F+ +KLEYLV+SRPTAVNL+DAA KL + +    K+ S + 
Sbjct  63    LENIATKGELSQFGEEVKVFIEEKLEYLVTSRPTAVNLADAARKLKKAVEEAAKDDSVSG  122

Query  1078  EAKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVG-SKKISILTHCNTGSLAT  905
             EA  + EAYI AAE ML DDV  N+AIG HGA  +++N  VG S ++S+LTHCNTGSLAT
Sbjct  123   EA--VKEAYIKAAEKMLVDDVQDNEAIGKHGAEWVVKNTEVGKSGQVSMLTHCNTGSLAT  180

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa--  731
             AGYGTALGVIR++++ G L+ A+CTETRP+NQGSRLTAFELV +NIPATL+ DS AAA  
Sbjct  181   AGYGTALGVIRSLHSNGSLKHAFCTETRPYNQGSRLTAFELVHDNIPATLVTDSMAAALL  240

Query  730   --lmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSS  557
                  + R+ A++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   S
Sbjct  241   RLKGPSERIAAIVVGADRVAANGDTANKIGTYSLAIAAKHHGVKFLVAAPRTTIDLDTQS  300

Query  556   GQQIVIEERSPKELL------HTHGGLGEQ------IAASGISVWNPAFDVTPASLISGI  413
             G+ IVIEER  KE+       H    L  Q      IAA+GI VWNPAFDVTPA LI GI
Sbjct  301   GEGIVIEERPGKEVTMIKGPRHDGASLDLQNVETVSIAANGIGVWNPAFDVTPAELIDGI  360

Query  412   ITEKGVISKDGNDAFDI  362
             ITE GV+ K  +  F++
Sbjct  361   ITEVGVVEKGSDGGFNL  377



>emb|CDS04006.1| hypothetical protein LRAMOSA06961 [Absidia idahoensis var. thermophila]
Length=372

 Score =   355 bits (911),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 212/369 (57%), Positives = 267/369 (72%), Gaps = 10/369 (3%)
 Frame = -2

Query  1426  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  1247
             KTL+AI Y  G+LQ+L+Q  LP  TI+  + N +DG  AIK M  RGAPAIAI AALSLA
Sbjct  3     KTLEAIKYTSGNLQILNQLALPHDTIFEPVINVQDGHAAIKTMKTRGAPAIAIVAALSLA  62

Query  1246  veaSNLETFN--GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             V+ +   + N   T  DAV FL + LEYL +SRPTAVNL DAA KL+ ++   A  A++ 
Sbjct  63    VDVNTRRSKNEFKTVDDAVRFLHESLEYLKTSRPTAVNLFDAAAKLDHLVNTVARDATDP  122

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
               + +AYI AAE ML DDV  NK IG +GA  + + +     IS+LTHCNTGSLATAG+G
Sbjct  123   NVVVDAYIAAAEKMLVDDVQDNKNIGKYGAEYIVDHVKDKSNISVLTHCNTGSLATAGWG  182

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG-  716
             TALG+IR ++  G L+ A+CTETRP+NQGSRLTA+ELV E+IPATLI DS A+AL++   
Sbjct  183   TALGIIRDLHHNGNLKHAFCTETRPYNQGSRLTAYELVYESIPATLICDSMASALLRLNP  242

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              V A+IVGADR+AANGDTANKIGTY LA+ A HHG+ F VAAP TS+DLS+SSG++IVIE
Sbjct  243   SVQAIIVGADRVAANGDTANKIGTYQLAITAKHHGILFIVAAPSTSIDLSMSSGKEIVIE  302

Query  535   ERSPKELLHTHGGLGEQ------IAASGISVWNPAFDVTPASLISGIITEKGV-ISKDGN  377
             ER  KEL+ T G L ++       AA GI VWNP+FDVTP+ LIS I+TEKGV + + G+
Sbjct  303   ERPAKELVTTTGVLDDKSSATVHTAAEGIQVWNPSFDVTPSELISAIVTEKGVAVKQSGH  362

Query  376   DAFDITGFV  350
               FD+  F+
Sbjct  363   TEFDLAAFL  371



>gb|KEQ84160.1| Methylthioribose-1-phosphate isomerase [Aureobasidium pullulans 
EXF-150]
Length=395

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 213/376 (57%), Positives = 265/376 (70%), Gaps = 27/376 (7%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+AI YKRG L +LDQ +LP   +Y ++K+A+D W AIKEM  RGAPAIAI AAL LAV
Sbjct  2     SLEAIKYKRGQLDILDQLQLPHTEVYDEVKSAQDAWHAIKEMRTRGAPAIAIVAALGLAV  61

Query  1243  eaSNLETFNG------TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA  1082
                 LE   G       A++   F+ +KLEYLV+SRPTAVNL+DAA KL +++   A   
Sbjct  62    ---ELELIAGKKELSSVAEEVEFFIKEKLEYLVTSRPTAVNLADAARKLQKIVQTAAKAQ  118

Query  1081  SEAKT-IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLA  908
             S + T + +AY+ AAE ML DDV+ NKAIG HGA  +L+N   G  ++SILTHCNTGSLA
Sbjct  119   SASGTSVKDAYVQAAEQMLVDDVSDNKAIGEHGADWILKNAAGGKDQVSILTHCNTGSLA  178

Query  907   TAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaal  728
             TAGYGTALGVIR+V+  G L +A+C+ETRP+NQGSRLTAFELV + IPATL+ DS AAAL
Sbjct  179   TAGYGTALGVIRSVHARGSLRKAFCSETRPYNQGSRLTAFELVHDKIPATLVTDSMAAAL  238

Query  727   mkAG----RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLS  560
             ++       + A++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   
Sbjct  239   LRLKGPTENIAAIVVGADRVAANGDTANKIGTYSLAILAKHHGVKFLVAAPRTTIDLDTK  298

Query  559   SGQQIVIEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISG  416
             SG  IVIEER+ KE+    G   +             IAA+GI VWNPAFDVTPA LI G
Sbjct  299   SGADIVIEERAGKEMTMIKGPCYKGSSLDLKQIETVSIAANGIDVWNPAFDVTPAELIDG  358

Query  415   IITEKGVISKDGNDAF  368
             ++TEKGV+ K  +  F
Sbjct  359   VVTEKGVVEKGSDGVF  374



>emb|CDH49387.1| methylthioribose-1-phosphate isomerase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=398

 Score =   354 bits (908),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 211/369 (57%), Positives = 268/369 (73%), Gaps = 10/369 (3%)
 Frame = -2

Query  1426  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  1247
             KTL+AI Y  G+LQ+L+Q  LP  TI+  + N +DG  AIK M  RGAPAIAI AALSLA
Sbjct  29    KTLEAIKYTSGNLQILNQLALPHDTIFEPVINVQDGHAAIKTMKTRGAPAIAIVAALSLA  88

Query  1246  veaSNLETFN--GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             V+ +   + N   T  DAV FL + LEYL +SRPTAVNL DAA KL++++   A  A+E 
Sbjct  89    VDVNARRSKNEFKTVDDAVRFLHESLEYLKTSRPTAVNLFDAAAKLDQLVNTVARDATEP  148

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
               + +AYI AAE ML DDV  NK IG +GA  + + +     IS+LTHCNTGSLATAG+G
Sbjct  149   NAVVDAYIAAAEKMLVDDVQDNKNIGKYGAEYIVDHVKDKSNISVLTHCNTGSLATAGWG  208

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG-  716
             TALG+IR ++  G L+ A+CTETRP+NQGSRLTA+ELV E+IPATL+ DS A+AL++   
Sbjct  209   TALGIIRDLHHNGNLKHAFCTETRPYNQGSRLTAYELVYESIPATLVCDSMASALLRLNP  268

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              V A+IVGADR+AANGDTANKIGTY LA+ A HHG+ F VAAP TS+DLS++SG++IVIE
Sbjct  269   SVQAIIVGADRVAANGDTANKIGTYQLAITAKHHGILFVVAAPSTSIDLSMASGKEIVIE  328

Query  535   ERSPKELLHTHGGLGEQ------IAASGISVWNPAFDVTPASLISGIITEKGV-ISKDGN  377
             ER  KEL+ T G L ++       AA GI VWNP+FDVTP+ LIS I+TEKGV + + G+
Sbjct  329   ERPAKELVTTTGVLDDKSSATVRTAAEGIQVWNPSFDVTPSELISAIVTEKGVAVKQPGH  388

Query  376   DAFDITGFV  350
               FD+  F+
Sbjct  389   TEFDLAAFL  397



>gb|KEQ63615.1| Methylthioribose-1-phosphate isomerase [Aureobasidium melanogenum 
CBS 110374]
Length=395

 Score =   353 bits (905),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 212/375 (57%), Positives = 264/375 (70%), Gaps = 27/375 (7%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI Y RG L +LDQ +LP   +Y ++K+A+D W AIKEM  RGAPAIAI AAL LAV 
Sbjct  3     LEAIKYSRGELDILDQLQLPHTEVYDEVKSAQDAWHAIKEMRTRGAPAIAIVAALGLAV-  61

Query  1240  aSNLETFNGT------AQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  1079
                LE   G       A++   F+ +KLEYLV+SRPTAVNL+DAA KL +++   A   +
Sbjct  62    --ELELIAGKNELSNIAEEVELFIKEKLEYLVTSRPTAVNLADAARKLQKIVQDAAKAQN  119

Query  1078  EAKT-IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLAT  905
              + T + +AY+ AAE ML DDV+ NKAIG HGA  +L+N   G  ++SILTHCNTGSLAT
Sbjct  120   ASGTSVKDAYVKAAEQMLVDDVSDNKAIGEHGADWILKNAAGGKDQVSILTHCNTGSLAT  179

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR+V+  G L+RA+C+ETRP+NQGSRLTAFELV + IPATL+ DS AAAL+
Sbjct  180   AGYGTALGVIRSVHARGSLKRAFCSETRPYNQGSRLTAFELVHDKIPATLVTDSMAAALL  239

Query  724   kAG----RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSS  557
             +       + A++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   S
Sbjct  240   RLKGPTENIAAIVVGADRVAANGDTANKIGTYSLAILAKHHGVKFLVAAPRTTIDLETKS  299

Query  556   GQQIVIEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGI  413
             G  IVIEER+ KE+    G   +             IAA+GI VWNPAFDVTPA LI G+
Sbjct  300   GADIVIEERAGKEMTMIKGPCVKGASLDLKQIETVSIAANGIDVWNPAFDVTPAELIDGV  359

Query  412   ITEKGVISKDGNDAF  368
             +TEKGV+ K  +  F
Sbjct  360   VTEKGVVEKGSDGVF  374



>gb|EMF09885.1| methylthioribose-1-phosphate isomerase [Sphaerulina musiva SO2202]
Length=389

 Score =   352 bits (902),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 212/371 (57%), Positives = 266/371 (72%), Gaps = 19/371 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y+ GSLQ+L+Q KLP Q  Y +IK+A+DGW AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3     LQAIRYQPGSLQILNQLKLPHQEEYDEIKSAEDGWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA-STASEAKTI  1064
              +N+ T +  A++  +F+ +KLEYLV+SRPTAVNL+DAA KL +++T  A S  +   T+
Sbjct  63    LTNM-TSSEKAEEVAAFIVEKLEYLVTSRPTAVNLADAAGKLKKIVTSAARSDGASGATV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
              +AY  AA  ML  DVA N+ IG +GA  + ++  G  K+S++THCNTGSLATAGYGTAL
Sbjct  122   SQAYCDAAAQMLVADVADNEGIGKYGAEWI-SKAAGGGKVSVVTHCNTGSLATAGYGTAL  180

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa----lmkAG  716
             GVIR+++  G L+ A+CTETRP+NQGSRLTAFELV +NIPATLI DS A+A         
Sbjct  181   GVIRSLHANGSLKHAFCTETRPYNQGSRLTAFELVHDNIPATLITDSMASALLRLKGPEQ  240

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             R+ A++VGADR+AANGDTANKIGTY LA+ A +HGV F VAAP T++DL   SG  IVIE
Sbjct  241   RIAAIVVGADRVAANGDTANKIGTYQLAITAKYHGVKFLVAAPRTTIDLGTKSGADIVIE  300

Query  535   ERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
             ER  KE+    G   +             IAA GI VWNP+FDVTPA LI GIITE GV+
Sbjct  301   ERPGKEMTFVKGPRFDGVDLDLSQVETVSIAAKGIDVWNPSFDVTPAELIDGIITEIGVV  360

Query  391   SKDGNDAFDIT  359
              KD +  FD+T
Sbjct  361   EKDASGKFDLT  371



>ref|XP_004993054.1| methylthioribose-1-phosphate isomerase [Salpingoeca rosetta]
 gb|EGD74153.1| methylthioribose-1-phosphate isomerase [Salpingoeca rosetta]
Length=378

 Score =   351 bits (901),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 209/366 (57%), Positives = 264/366 (72%), Gaps = 9/366 (2%)
 Frame = -2

Query  1435  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  1256
             +E+K L+AI Y+ G L +++Q KLPL T Y  I + +DGWDAI+EM VRGAPAIAI AAL
Sbjct  13    AENK-LEAIRYRDGQLSIINQLKLPLVTEYDAISSVQDGWDAIREMRVRGAPAIAIVAAL  71

Query  1255  slaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK-EASTAS  1079
             SLAVE     TF  +A DA +F+   L++L +SRPTAVNL +AA KL  +  K  A   +
Sbjct  72    SLAVELHK-RTF-ASAGDAAAFIKTSLDHLRTSRPTAVNLFEAANKLEALSAKLAAQEGA  129

Query  1078  EAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAG  899
              A+ +    +   E M+  D+A N+AIG HGA  +  +  G  K+ ILTHCNTGSLATA 
Sbjct  130   TAQQVVAGTLAKIEGMMAADIADNRAIGKHGAEAILAK-TGKDKVRILTHCNTGSLATAQ  188

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA  719
             YGTALGVIR ++  G L+ A+CTETRP+NQG+RLTA+ELVTE IP+TL+ADS  + LMK 
Sbjct  189   YGTALGVIRCLHELGSLDHAFCTETRPYNQGARLTAYELVTEKIPSTLVADSMVSVLMKE  248

Query  718   GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
               ++AV+VGADR+ ANGDTANKIGTY +A+ A HHGVPFYVAAP+TSVDL L  G  IVI
Sbjct  249   KDISAVVVGADRVVANGDTANKIGTYQIAIAAKHHGVPFYVAAPITSVDLDLPDGSHIVI  308

Query  538   EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDI  362
             EER   EL H     G+++AA GI+ WNPAFDVTPASLI+GI+TE+GV+ K DG   FD+
Sbjct  309   EERKGDELTHI---FGKRLAAPGINTWNPAFDVTPASLITGIVTERGVVKKPDGAPEFDM  365

Query  361   TGFVHK  344
               FV +
Sbjct  366   HAFVQE  371



>gb|KEQ71351.1| Methylthioribose-1-phosphate isomerase [Aureobasidium namibiae 
CBS 147.97]
Length=395

 Score =   351 bits (901),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 212/375 (57%), Positives = 262/375 (70%), Gaps = 27/375 (7%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI Y RG L +LDQ +LP   +Y ++K+A+D W AIKEM  RGAPAIAI AAL LAV 
Sbjct  3     LEAIKYSRGKLDILDQLQLPHTEVYDEVKSAQDAWHAIKEMRTRGAPAIAIVAALGLAV-  61

Query  1240  aSNLETFNGT------AQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-  1082
                LE   G       A++   F+ +KLEYLV+SRPTAVNL+DAA KL +++   A    
Sbjct  62    --ELELIAGKNELSKFAEEVEVFIKEKLEYLVTSRPTAVNLADAARKLEKIVQTAAKEQN  119

Query  1081  SEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLAT  905
             +   ++  AYI AAE ML DDV+ NKAIG HGA  +L+N   G  ++SILTHCNTGSLAT
Sbjct  120   ASGNSVKNAYIKAAEQMLVDDVSDNKAIGEHGADWILKNAAGGKDQVSILTHCNTGSLAT  179

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR+V+  G L+RA+C+ETRP+NQGSRLTAFELV + IPATL+ DS AAAL+
Sbjct  180   AGYGTALGVIRSVHARGSLKRAFCSETRPYNQGSRLTAFELVHDKIPATLVTDSMAAALL  239

Query  724   kAG----RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSS  557
             +       + A++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   S
Sbjct  240   RLKGPTENIAAIVVGADRVAANGDTANKIGTYSLAILAKHHGVKFLVAAPRTTIDLETKS  299

Query  556   GQQIVIEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGI  413
             G  IVIEER+ KE+    G   +             IAA+GI VWNPAFDVTPA LI G+
Sbjct  300   GADIVIEERAGKEMTMIKGPCFKGASLDLEQIETVSIAANGIDVWNPAFDVTPAELIDGV  359

Query  412   ITEKGVISKDGNDAF  368
             +TEKGV+ K  +  F
Sbjct  360   VTEKGVVEKGSDGVF  374



>gb|KJB82982.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=278

 Score =   344 bits (883),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 197/254 (78%), Positives = 224/254 (88%), Gaps = 0/254 (0%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D TLQAICYKRGSLQLLDQRKLPL+T+YLDI  + DGW+AI++MVVRGAPAIAIAAALSL
Sbjct  15    DNTLQAICYKRGSLQLLDQRKLPLETMYLDIHGSTDGWNAIRDMVVRGAPAIAIAAALSL  74

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
             AVE +NL+ FNG ++DA SFL  KLEYLVSSRPTAVNLSDAA KL E+I+K AST +  +
Sbjct  75    AVEVANLKDFNGGSKDAASFLESKLEYLVSSRPTAVNLSDAAIKLKEIISKAASTVTVPE  134

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             ++F+AYI AAEIML+DDVA+NKAIGSHGA+ LQ+Q   SK+ S+LTHCNTGSLATAGYGT
Sbjct  135   SVFQAYIEAAEIMLDDDVATNKAIGSHGANFLQHQQNNSKRFSVLTHCNTGSLATAGYGT  194

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIRA++  G LERAYCTETRPFNQGSRLTAFELV E IPATLIADSAAAALMK  RV
Sbjct  195   ALGVIRALHAQGVLERAYCTETRPFNQGSRLTAFELVHEKIPATLIADSAAAALMKEDRV  254

Query  709   NAVIVGADRIAANG  668
             +AVIVGADR+ ANG
Sbjct  255   DAVIVGADRVTANG  268



>gb|KEQ98081.1| hypothetical protein AUEXF2481DRAFT_63242 [Aureobasidium subglaciale 
EXF-2481]
Length=395

 Score =   348 bits (894),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 211/375 (56%), Positives = 262/375 (70%), Gaps = 27/375 (7%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI Y RG L +LDQ +LP   +Y ++K+A+D W AIKEM  RGAPAIAI AAL LAV 
Sbjct  3     LEAIKYSRGKLDILDQLQLPHTEVYNEVKSAQDAWHAIKEMRTRGAPAIAIVAALGLAV-  61

Query  1240  aSNLETFNGT------AQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  1079
                LE   G       A++   F  +KLEYLV+SRPTAVNL+DAA KL +++   A    
Sbjct  62    --ELELIAGKNELSSFAEEVEVFTKEKLEYLVTSRPTAVNLADAARKLQKIVQNAAKAEH  119

Query  1078  EAKT-IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLAT  905
              + T +  AY+ AAE ML DDV+ NKAIG +GA  +L+N   G  ++SILTHCNTGSLAT
Sbjct  120   ASGTSVKNAYVEAAEQMLVDDVSDNKAIGENGADWILKNAAGGKDQVSILTHCNTGSLAT  179

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR+V+  G L+RA+C+ETRP+NQGSRLTAFELV + IPATL+ DS AAAL+
Sbjct  180   AGYGTALGVIRSVHARGSLKRAFCSETRPYNQGSRLTAFELVHDKIPATLVTDSMAAALL  239

Query  724   kAG----RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSS  557
             +       + A++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   S
Sbjct  240   RLKGPTENIAAIVVGADRVAANGDTANKIGTYSLAILAKHHGVKFLVAAPRTTIDLETKS  299

Query  556   GQQIVIEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGI  413
             G  IVIEER+ KE+    G + +             IAA+GI VWNPAFDVTPA LI G+
Sbjct  300   GADIVIEERAGKEMTMIKGPVFKGASLDLQQIETVSIAANGIDVWNPAFDVTPAELIDGV  359

Query  412   ITEKGVISKDGNDAF  368
             +TEKGV+ K  +  F
Sbjct  360   VTEKGVVEKGSDGVF  374



>ref|XP_001933231.1| methylthioribose-1-phosphate isomerase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 sp|B2VZQ8.1|MTNA_PYRTR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Pyrenophora 
tritici-repentis Pt-1C-BFP]
 gb|EDU45421.1| methylthioribose-1-phosphate isomerase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=392

 Score =   348 bits (893),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 213/372 (57%), Positives = 267/372 (72%), Gaps = 20/372 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y RG L++LDQ KLP    Y  I ++ D W AIKEM  RGAPAIAI AAL+LAVE
Sbjct  3     LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKEMRTRGAPAIAIVAALALAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI-TKEASTASEAKTI  1064
              SN++     A++   F+++KL+YLV+SRPTAVNL+DAA KL  +  +  AS  ++  ++
Sbjct  63    LSNMK-LPSVAEEVKVFITEKLDYLVTSRPTAVNLADAAGKLQRITESAAASEGADGDSV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSK-KISILTHCNTGSLATAGYGT  890
              EAY+ AAE ML DDV+ N++IG HGA  +++N   G K  +S++THCNTGSLATAGYGT
Sbjct  122   REAYVSAAEKMLVDDVSDNESIGKHGAEWIMKNTEAGKKGPVSMMTHCNTGSLATAGYGT  181

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa----lmk  722
             ALGVIR++++AG L+ A+C+ETRP+NQGSRLTAFELV + IPATLI DS AAA      +
Sbjct  182   ALGVIRSLHSAGSLKHAFCSETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLRLRGE  241

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  +  ++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  IV
Sbjct  242   SENIAGIVVGADRVAANGDTANKIGTYSLAILAKHHGVKFLVAAPRTTIDLKTKSGADIV  301

Query  541   IEERSPKELLHTHG----------GLGE--QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IEERS KE+    G          G+ E   IAA+GI VWNPAFDVTPA LI GIITE G
Sbjct  302   IEERSGKEVTLVKGPRHDGVTLDLGVIETISIAANGIGVWNPAFDVTPAELIDGIITEVG  361

Query  397   VISKDGNDAFDI  362
             V+ KD N  F +
Sbjct  362   VVEKDSNGVFHL  373



>ref|XP_007681661.1| hypothetical protein BAUCODRAFT_319460 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC91246.1| hypothetical protein BAUCODRAFT_319460 [Baudoinia compniacensis 
UAMH 10762]
Length=389

 Score =   347 bits (891),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 211/373 (57%), Positives = 263/373 (71%), Gaps = 23/373 (6%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI YK GSLQ+L+Q KLP Q  Y ++KN+ DGW AIKEM  RGAPAIAI AALSLAV 
Sbjct  3     LEAIRYKPGSLQILNQLKLPHQEEYDEVKNSTDGWHAIKEMRTRGAPAIAIVAALSLAV-  61

Query  1240  aSNLET--FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE-AK  1070
                L+T   +  A++  +F+ +KL+YLV+SRPTAVNL+DAA KL +++   A  AS    
Sbjct  62    --ELQTGAVSDQAEEVSAFIIEKLDYLVTSRPTAVNLADAARKLKKIVESAAKHASSTGD  119

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
              + +AY  AA  ML  DVA N+ IG +GA+ ++ Q  G  ++S+LTHCNTGSLATAGYGT
Sbjct  120   AVKKAYCDAAAQMLISDVADNQGIGKYGAAWIEQQ-AGGGQVSVLTHCNTGSLATAGYGT  178

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk----  722
             ALGVIR+++  G L+RA+CTETRP+NQGSRLTAFELV +NIPATL+ DS A+AL++    
Sbjct  179   ALGVIRSLHANGSLKRAFCTETRPYNQGSRLTAFELVHDNIPATLVTDSMASALLRLRGP  238

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
               R+ A++VGADR+AANGDTANKIGTY LA+ A HHGV F VAAP T++DL   SG  I 
Sbjct  239   TERIAAIVVGADRVAANGDTANKIGTYQLAITAKHHGVKFLVAAPRTTIDLHTKSGADIT  298

Query  541   IEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IEER  KE+    G   +             IAA GI VWNPAFDVTPA LI GIITE G
Sbjct  299   IEERPGKEMTFIKGPRYDGVDLDLSQVETVSIAAKGIDVWNPAFDVTPAELIDGIITELG  358

Query  397   VISKDGNDAFDIT  359
             V+ K     FD++
Sbjct  359   VVEKSAEGVFDLS  371



>ref|XP_001742754.1| hypothetical protein [Monosiga brevicollis MX1]
 sp|A9UQ62.1|MTNA_MONBE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Monosiga 
brevicollis]
 gb|EDQ92992.1| predicted protein [Monosiga brevicollis MX1]
Length=361

 Score =   345 bits (886),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 202/362 (56%), Positives = 258/362 (71%), Gaps = 7/362 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y    L +LDQ KLPL+T Y ++ + +DGWDAI+EM VRGAPAIAI AAL++AV
Sbjct  3     TLEAIKYDGEKLLVLDQIKLPLETHYDEVLSIQDGWDAIREMRVRGAPAIAIVAALTIAV  62

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
                   TF  TA +  +F+   LE+L +SRPTAVNL + A +L  ++ ++ +  +EA  +
Sbjct  63    VMKR-STF-ATAAELAAFVRTSLEHLRTSRPTAVNLFEMAGRLEALLQEQPADCTEA-AL  119

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
              +A +   E M++ D+A N+AIG  GA  +   L    K+ +LTHCNTGSLATA YGTAL
Sbjct  120   RQAVLSYIEGMMQADIADNQAIGKFGAEAILKDLSADVKVKVLTHCNTGSLATARYGTAL  179

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIR+++    LE A+CTETRP+NQG+RLTA+ELVTE IP TL+ADS  + LMK   ++A
Sbjct  180   GVIRSLHEQQRLEHAFCTETRPYNQGARLTAYELVTEGIPGTLVADSMVSLLMKQKGISA  239

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADR+ ANGDTANKIGTY +A+ A HHGVPF+VAAPLTSVDL LS G +I IEER  
Sbjct  240   VVVGADRVVANGDTANKIGTYQIAIAAKHHGVPFFVAAPLTSVDLKLSHGSEITIEERPG  299

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-DGNDAFDITGFVH  347
             KEL H     G+Q+AA GI  WNPAFDVTPA LI+GIITE+GV  K +G   FD+  F  
Sbjct  300   KELTHI---FGQQLAAPGIGTWNPAFDVTPADLITGIITERGVAYKAEGQQEFDMASFAA  356

Query  346   KV  341
              V
Sbjct  357   SV  358



>ref|XP_001216022.1| hypothetical protein ATEG_07401 [Aspergillus terreus NIH2624]
 sp|Q0CFY3.1|MTNA_ASPTN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
terreus NIH2624]
 gb|EAU31663.1| hypothetical protein ATEG_07401 [Aspergillus terreus NIH2624]
Length=377

 Score =   346 bits (887),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 215/372 (58%), Positives = 264/372 (71%), Gaps = 18/372 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y  G L ++DQ +LP    Y+ I N+++GW AIK+M VRGAPAIAI AAL+LA 
Sbjct  2     TLQAIKYNNGDLAIIDQLQLPHVEKYVTIHNSEEGWHAIKDMRVRGAPAIAIVAALALAS  61

Query  1243  eaSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA-STASE  1076
             E   L   +  +  A+D  +F+ +KL YLVSSRPTAVNLSDAA KL  V+ + A +  + 
Sbjct  62    ELHGLMAHDKLSPEAEDVQTFVVEKLRYLVSSRPTAVNLSDAARKLEVVVAQSARAPGAT  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAG  899
              KT+  A+I AAE ML  DV  NK IG HGA  +L+N L G  K ++LTHCNTGSLAT+G
Sbjct  122   GKTVATAFIQAAEEMLVKDVEDNKKIGEHGAQWILKNSLEGHGKATVLTHCNTGSLATSG  181

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA  719
             YGTALGVIR++ +A  L+ AYCTETRP+NQGSRLTAFELV + +PATLI DS AAAL+ +
Sbjct  182   YGTALGVIRSLASADSLQHAYCTETRPYNQGSRLTAFELVHDALPATLITDSMAAALLAS  241

Query  718   GR--VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
              +  VNA++VGADR+AANGDTANKIGTY LAV A +H V F VAAPLT++DL+  SG QI
Sbjct  242   KKAGVNAIVVGADRVAANGDTANKIGTYGLAVLAKYHNVKFLVAAPLTTIDLNTKSGDQI  301

Query  544   VIEERSPKELLHTHG---GLGEQ--------IAASGISVWNPAFDVTPASLISGIITEKG  398
             VIEER   E+    G     G +         AA GI+VWNPAFDVTPA+LI GIITEKG
Sbjct  302   VIEERLASEVTSIRGPRDNTGSEDVELVTVCTAAKGINVWNPAFDVTPAALIDGIITEKG  361

Query  397   VISKDGNDAFDI  362
             V+ KD    F +
Sbjct  362   VMEKDSAGMFHL  373



>sp|C0P108.1|MTNA_AJECG RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Histoplasma 
capsulatum G186AR]
 gb|EEH02644.1| conserved hypothetical protein [Histoplasma capsulatum G186AR]
Length=392

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 216/387 (56%), Positives = 260/387 (67%), Gaps = 33/387 (9%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL AI Y RGSL +L+Q  LP QT Y  + +A+D W AI EM VRGAPAIAI AALSLAV
Sbjct  2     TLVAITYTRGSLHILNQLLLPHQTTYDPLHSARDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  1243  eaSNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-E  1076
             E   L T N      +D    + +KLE+LVSSRPTAVNL++AA +L  ++   A      
Sbjct  62    ELHTLATNNQLSAEPKDVELLILEKLEFLVSSRPTAVNLAEAAGRLGRIVNGRAQVQGVG  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV---------GSKKISILTHCN  923
                + EAYI AAE MLEDDV  N+AIG  GA  +    +         G  K+++LTHCN
Sbjct  122   GNEVAEAYIEAAERMLEDDVRDNRAIGESGAKWVLEHAITTKGSMSGTGQAKVAVLTHCN  181

Query  922   TGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliads  743
             TGSLATAGYGTALGVIR+++  G LERAYCTETRP+NQGSRLTAFELV +NIPATLI D+
Sbjct  182   TGSLATAGYGTALGVIRSLHATGSLERAYCTETRPYNQGSRLTAFELVHDNIPATLITDN  241

Query  742   aaaalmkAGR--------VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAP  587
              AAAL+            V+A+IVGADR+AANGDTANKIGTY LAV A +HGV F VAAP
Sbjct  242   MAAALLARQSAGPAQSVGVSAIIVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAP  301

Query  586   LTSVDLSLSSGQQIVIEERSPKELLHTHG--------GLGEQ----IAASGISVWNPAFD  443
              T++D++  +G  IVIEER  KE+    G        GLG      +AA GI VWNPAFD
Sbjct  302   RTTIDMNTKTGADIVIEERPEKEVTKIRGPRVGEEGNGLGAMETITVAADGIGVWNPAFD  361

Query  442   VTPASLISGIITEKGVISKDGNDAFDI  362
             VTPA+L+ GIITE GV+ KDG+  F +
Sbjct  362   VTPAALVDGIITEVGVVEKDGSGVFHL  388



>ref|XP_001540232.1| hypothetical protein HCAG_04072 [Histoplasma capsulatum NAm1]
 sp|A6R364.1|MTNA_AJECN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Histoplasma 
capsulatum NAm1]
 gb|EDN07562.1| hypothetical protein HCAG_04072 [Histoplasma capsulatum NAm1]
Length=391

 Score =   345 bits (885),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 216/386 (56%), Positives = 260/386 (67%), Gaps = 32/386 (8%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL AI Y RGSL +L+Q  LP QT Y  + +A+D W AI EM VRGAPAIAI AALSLAV
Sbjct  2     TLVAITYTRGSLHILNQLLLPHQTTYDPLHSARDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  1243  eaSNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-E  1076
             E   L T N      +D    + +KLE+LVSSRPTAVNL++AA +L  ++   A      
Sbjct  62    ELHTLATSNQLSAEPKDVGQLILEKLEFLVSSRPTAVNLAEAAGRLGRIVNGRAQVQGVG  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV--------GSKKISILTHCNT  920
                + EAYI AAE ML+DDV  N+AIG  GA  +    +        G  K+++LTHCNT
Sbjct  122   GNEVAEAYIEAAERMLDDDVRDNRAIGESGAKWVLEHAITKGSISGTGQAKVAVLTHCNT  181

Query  919   GSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsa  740
             GSLATAGYGTALGVIR+++  G LERAYCTETRP+NQGSRLTAFELV +NIPATLI DS 
Sbjct  182   GSLATAGYGTALGVIRSLHATGSLERAYCTETRPYNQGSRLTAFELVHDNIPATLITDSM  241

Query  739   aaalmkAGR--------VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
             AAAL+            V+A+IVGADR+AANGDTANKIGTY LAV A +HGV F VAAP 
Sbjct  242   AAALLARQSAGPAQSVGVSAIIVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKELLHTHG--------GLGEQ----IAASGISVWNPAFDV  440
             T++D++  +G  IVIEER  KE+    G        GLG      +AA GI VWNPAFDV
Sbjct  302   TTIDMNTKTGADIVIEERPEKEVTRIRGPRDGEEGNGLGAMETITVAADGIGVWNPAFDV  361

Query  439   TPASLISGIITEKGVISKDGNDAFDI  362
             TPA+L+ GIITE GV+ KDG+  F +
Sbjct  362   TPAALVDGIITEVGVVEKDGSGVFHL  387



>gb|EKG14703.1| Initiation factor 2B-related protein [Macrophomina phaseolina 
MS6]
Length=383

 Score =   344 bits (883),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 209/373 (56%), Positives = 265/373 (71%), Gaps = 22/373 (6%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y+RGSLQ+LDQ +LP + +Y ++ +A+D W AIKEM  RGAPAIAI AAL LAVE
Sbjct  3     LQAIKYQRGSLQILDQLRLPHEEVYDEVHSAQDAWHAIKEMRTRGAPAIAIVAALGLAVE  62

Query  1240  aSNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
                +   N     A++   F+ +KL YLV+SRPTAVNL+DAA KLN+ +   AS    + 
Sbjct  63    LETIAAKNELSSVAEEVKVFVEEKLSYLVTSRPTAVNLADAARKLNKTVDAAASAQDASG  122

Query  1069  -TIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSK-KISILTHCNTGSLATAG  899
              ++ +AY+ AAE ML DDV+ N+ IG HGA  +++N   G   ++S++THCNTGSLATAG
Sbjct  123   LSVKDAYVKAAEKMLVDDVSDNENIGKHGAEWIVKNTEAGKGGQVSVVTHCNTGSLATAG  182

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA  719
             YGTALGVIR+++  G L  A+CTETRP+NQGSRLTAFELV + IPATL+ DS AAAL++ 
Sbjct  183   YGTALGVIRSLHATGTLRHAFCTETRPYNQGSRLTAFELVHDKIPATLVTDSMAAALLRL  242

Query  718   G----RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQ  551
                  R+ A++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   +G+
Sbjct  243   KGEPERIAAIVVGADRVAANGDTANKIGTYSLAINARHHGVKFLVAAPRTTIDLQTKTGE  302

Query  550   QIVIEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIIT  407
              IVIEER+ KE+    G                 IAA+GI+VWNPAFDVTPA LI GIIT
Sbjct  303   DIVIEERAGKEVTLVKGPRFNGASLDLKVVETVSIAANGINVWNPAFDVTPAELIDGIIT  362

Query  406   EKGVISKDGNDAF  368
             E GV+ KD +  F
Sbjct  363   EVGVVEKDSDGVF  375



>gb|KIW03172.1| S-methyl-5-thioribose-1-phosphate isomerase [Verruconis gallopava]
Length=382

 Score =   343 bits (879),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 212/374 (57%), Positives = 270/374 (72%), Gaps = 22/374 (6%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y+RGSL +LDQ +LP  T +  ++ A +GW AIK M  RGAPAIAI AALSLAVE
Sbjct  3     LQAIRYERGSLLVLDQLQLPYTTHFDSVRTATEGWHAIKSMRTRGAPAIAIVAALSLAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA--KT  1067
              ++ ET +   ++  +F+ +KLEYLV+SRPTAVNL+DAA KL E I +EA +A  A  ++
Sbjct  63    LTH-ETLSTIPEEVAAFIIEKLEYLVTSRPTAVNLADAARKL-EAIVEEAKSAEGATGES  120

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGAS--LLQNQLVGSKKISILTHCNTGSLATAGYG  893
             + +AY+ AAE MLEDDV  N+ IG +GA   L   +   S  +SILTHCNTGSLATAGYG
Sbjct  121   VRDAYVAAAERMLEDDVKDNRGIGDYGAKWILEHTEAAQSGPVSILTHCNTGSLATAGYG  180

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk---  722
             TALGVIR+++  G L++A+CTETRP+NQGSRLTA+ELV + IPATL+ DS AAALM+   
Sbjct  181   TALGVIRSLHEKGALKQAFCTETRPYNQGSRLTAYELVHDAIPATLVTDSMAAALMRLKG  240

Query  721   -AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
              A ++ AV+VGADR+AANGDTANKIGTY+L++ A HHG+ F VAAP T++DL   +G+ I
Sbjct  241   PADKLVAVVVGADRVAANGDTANKIGTYALSILAKHHGIKFLVAAPRTTIDLQTPNGEHI  300

Query  544   VIEERSPKELLHTHGG--LGEQ----------IAASGISVWNPAFDVTPASLISGIITEK  401
              IEER+  E+    G   LG +          IAA GI +WNPAFDVTPA LI GIITE 
Sbjct  301   TIEERASSEVATIKGPRVLGRELEKDKIETIAIAAQGIDIWNPAFDVTPAELIDGIITEV  360

Query  400   GVISKDGNDAFDIT  359
             GV  KD N  F+++
Sbjct  361   GVAEKDANGRFNLS  374



>ref|XP_002151818.1| translation initiation factor, putative [Talaromyces marneffei 
ATCC 18224]
 sp|B6QRG1.1|MTNA_PENMQ RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Talaromyces 
marneffei ATCC 18224]
 gb|EEA20818.1| translation initiation factor, putative [Talaromyces marneffei 
ATCC 18224]
 gb|KFX45181.1| Methylthioribose-1-phosphate isomerase [Talaromyces marneffei 
PM1]
Length=384

 Score =   343 bits (879),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 199/374 (53%), Positives = 264/374 (71%), Gaps = 21/374 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQAI Y    LQ++DQ +LP  T Y+ I++A+DGW AIKEM VRGAPAIAI A LSLAV
Sbjct  2     SLQAIKYADNQLQIIDQLQLPFVTEYIPIRSAQDGWHAIKEMRVRGAPAIAIVAILSLAV  61

Query  1243  eaSNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASE  1076
             E S ++T    + ++++   F+ +KL YLV+SRPTAVNL+DAA K   ++T+   T  S 
Sbjct  62    ELSEIQTAGKLSSSSEEVGLFIIEKLHYLVTSRPTAVNLADAARKFETMVTEHTKTQGST  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV--GSKKISILTHCNTGSLATA  902
              +++  AY+  AE+ML  D++ NK IG++GA  +  +    G  K+++LTHCNTGSLATA
Sbjct  122   GQSLVAAYLQEAELMLVHDLSDNKNIGAYGAKWILERAATEGQAKVNVLTHCNTGSLATA  181

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaal  728
             GYGTALGVIR+++    L R YCTETRP+NQG+RLTA+ELV E +PAT    + +A+   
Sbjct  182   GYGTALGVIRSLHEGNALNRVYCTETRPYNQGARLTAYELVHEKMPATLITDSMAASLLA  241

Query  727   mkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
                 +V+A++VGADR+AANGDTANKIGTY+LAV A +HGV F VAAP T++D    SG +
Sbjct  242   KPESKVSAIVVGADRVAANGDTANKIGTYALAVLAKYHGVKFLVAAPRTTIDRGTPSGNE  301

Query  547   IVIEERSPKELLHTHGGL----GE-------QIAASGISVWNPAFDVTPASLISGIITEK  401
             IVIEER+P E+    G L    G+       Q+AA+GI VWNPAFDVTPA+LI  +ITEK
Sbjct  302   IVIEERAPSEVTTIKGPLQGRVGDALQMETIQLAATGIDVWNPAFDVTPAALIDAVITEK  361

Query  400   GVISK--DGNDAFD  365
             GV+ K  DG+  FD
Sbjct  362   GVVEKGSDGHFHFD  375



>ref|XP_003218379.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Anolis carolinensis]
 ref|XP_008104501.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Anolis carolinensis]
Length=359

 Score =   341 bits (875),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 197/347 (57%), Positives = 252/347 (73%), Gaps = 6/347 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+AI Y+RGSL++L+Q  LP Q++Y  + + + GW+AI+ M VRGAPAIAI   LSLAV
Sbjct  2     SLEAIRYRRGSLEILNQLLLPQQSLYEAVGSVRQGWEAIRSMKVRGAPAIAIIGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAKT  1067
             E  N  T   +  +  +F+   L YLVS+RPTAVN++ AA +L  ++ +EA    S  ++
Sbjct  62    ELHNKTTTEESVDNLETFVLDSLSYLVSARPTAVNMAQAAQELGRIVRQEAKREGSTVES  121

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTA  887
             + E  I  AE ML+ D+  N++IG HGA  L  Q VG  K+ +LTHCNTGSLATAGYGTA
Sbjct  122   LREKVICWAEAMLDQDLKDNRSIGDHGALHLLQQ-VGQDKVIVLTHCNTGSLATAGYGTA  180

Query  886   LGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVN  707
             LGVIR+++T G LE  YCTETRP+NQG+RLTA+ELV E IPATLIADS  +  MK  +++
Sbjct  181   LGVIRSLHTMGCLEHVYCTETRPYNQGARLTAYELVYEEIPATLIADSMVSMAMKEKKIS  240

Query  706   AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERS  527
             AVIVGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL  G QI+IEER 
Sbjct  241   AVIVGADRVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLEHGGQIIIEERP  300

Query  526   PKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVIS  389
              +EL   +   G ++AA GI VWNPAFDVTP  LI+ GI+TE GV +
Sbjct  301   SQELTDIN---GVRVAAPGIGVWNPAFDVTPHDLITGGIVTELGVFA  344



>ref|XP_661894.1| hypothetical protein AN4290.2 [Aspergillus nidulans FGSC A4]
 sp|Q5B590.1|MTNA_EMENI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
nidulans FGSC A4]
 gb|EAA60042.1| hypothetical protein AN4290.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF77829.1| TPA: translation initiation factor, putative (AFU_orthologue; 
AFUA_4G05830) [Aspergillus nidulans FGSC A4]
Length=379

 Score =   341 bits (875),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 205/372 (55%), Positives = 251/372 (67%), Gaps = 19/372 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI YK G L ++DQ +LP    Y++I+ +++GW AIK M VRGAPAIAI AALSLA E
Sbjct  3     LEAIRYKDGKLSIIDQLQLPFTERYIEIRTSEEGWQAIKNMQVRGAPAIAIVAALSLASE  62

Query  1240  aSNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEA  1073
                L   N    TA+D  +F+ ++L +LVSSRPTAVNLSDAA KL  ++++ + T  S A
Sbjct  63    LHELSIRNKISTTAEDVTAFIRERLGHLVSSRPTAVNLSDAARKLEVIVSERSQTPGSTA  122

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLL-QNQL-VGSKKISILTHCNTGSLATAG  899
             + I   +I AAE ML  DV  N  IG +GA  +  N L     K  +LTHCNTGSLATAG
Sbjct  123   QDIVNVFIQAAEGMLAKDVEDNTRIGENGAKWISMNALPTDHDKAVVLTHCNTGSLATAG  182

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaalm  725
             YGTALGVIR++     L+ AYCTETRP+NQGSRLTAFELV + IPAT    + +AA    
Sbjct  183   YGTALGVIRSLMANNTLQHAYCTETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLSR  242

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
                RVNA++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL+  SG  I
Sbjct  243   PETRVNAIVVGADRVAANGDTANKIGTYGLAVLARYHGVKFLVAAPLTTIDLATKSGGDI  302

Query  544   VIEERSPKELLHTHGGLGEQ-----------IAASGISVWNPAFDVTPASLISGIITEKG  398
             VIEER P E+    G   +            IAA GI+VWNPAFDVTP+ LI GIITEKG
Sbjct  303   VIEERPPSEVTRVKGSREDDTTGDVRLETISIAAEGINVWNPAFDVTPSELIDGIITEKG  362

Query  397   VISKDGNDAFDI  362
             V  KD +  F +
Sbjct  363   VAEKDTDGRFHL  374



>gb|EHA19257.1| hypothetical protein ASPNIDRAFT_54270 [Aspergillus niger ATCC 
1015]
Length=382

 Score =   340 bits (873),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 196/371 (53%), Positives = 253/371 (68%), Gaps = 17/371 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y  G L ++DQ +LP    Y+ ++++++ W AIK+M VRGAPAIAI AAL+LA 
Sbjct  2     TLQAIRYNDGDLSIIDQLQLPYVERYITVQSSEEAWHAIKDMRVRGAPAIAIVAALALAS  61

Query  1243  eaSNLETFNGTAQDAV---SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS-TASE  1076
             E   L   N    +A    +F+++KL+YLVSSRPTAVNL+DAA KL  V +       S 
Sbjct  62    ELHRLMACNNIPSEAPEVQAFIAKKLDYLVSSRPTAVNLADAARKLRAVASDHTQRPGST  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              +++  A I AAE ML+ D+  NK IG HGA  +     G  K ++LTHCNTGSLAT+GY
Sbjct  122   GRSVATALIQAAEEMLKKDIEDNKNIGKHGAQWIMANAAGKPKATVLTHCNTGSLATSGY  181

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaalmk  722
             GTALGVIRA+ +A  L  AYCTETRP+NQGSRLTAFELV + +PAT    + +AA     
Sbjct  182   GTALGVIRALASADNLNHAYCTETRPYNQGSRLTAFELVHDRLPATLITDSMAAALLAKS  241

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
               +V+A++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL+  SG +I+
Sbjct  242   GSKVDAIVVGADRVAANGDTANKIGTYGLAVLARYHGVKFLVAAPLTTIDLATPSGNEII  301

Query  541   IEERSPKELLHTHGGLGE-----------QIAASGISVWNPAFDVTPASLISGIITEKGV  395
             IEER+  E+ +  G               +IAA GI VWNPAFDVTP++LI GIITE+GV
Sbjct  302   IEERAASEVTNVRGPRASNSTNGIELETVRIAADGIDVWNPAFDVTPSTLIDGIITERGV  361

Query  394   ISKDGNDAFDI  362
             + KD +  F +
Sbjct  362   VEKDASGQFHL  372



>gb|EGC42562.1| translation initiation factor [Histoplasma capsulatum H88]
Length=394

 Score =   340 bits (871),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 213/389 (55%), Positives = 258/389 (66%), Gaps = 35/389 (9%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL AI Y RGSL +L+Q  LP QT Y  + +A+D W AI EM VRGAPAIAI AALSLAV
Sbjct  2     TLVAITYTRGSLHILNQLLLPHQTTYDPLHSARDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  1243  eaSNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-E  1076
             E   L T N      +D    + +KLE+LVSSRPTAVNL++AA +L  ++   A      
Sbjct  62    ELHTLATNNQLSAEPKDVELLILEKLEFLVSSRPTAVNLAEAAGRLGRIVNGRAQVQGVG  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV---------GSKKISILTHCN  923
                + EAYI AAE MLEDDV  N+AIG  GA  +    +         G  K+++LTHCN
Sbjct  122   GNEVAEAYIEAAERMLEDDVRDNRAIGESGAKWVLEHAITTKGSMSGMGQAKVAVLTHCN  181

Query  922   TGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliads  743
             TGSLATAGYGTALGVIR+++  G LERAYCTETRP+NQGSRLTAFELV +NIPATLI D+
Sbjct  182   TGSLATAGYGTALGVIRSLHATGSLERAYCTETRPYNQGSRLTAFELVHDNIPATLITDN  241

Query  742   aaaalmkAGR--------VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAP  587
              AAAL+            V+A+IVGADR+AANGDTANKIGTY LAV A +HGV F VAAP
Sbjct  242   MAAALLARQSAGPAQSVGVSAIIVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAP  301

Query  586   LTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQ--------------IAASGISVWNPA  449
              T++D++  +G  IVIEER  KE+    G    +              +AA GI VWNPA
Sbjct  302   RTTIDMNTKTGADIVIEERPEKEVTRIRGPRVGEEGNGNGLGAMETITVAADGIGVWNPA  361

Query  448   FDVTPASLISGIITEKGVISKDGNDAFDI  362
             FDVTPA+L+ GIITE GV+ KDG+  F +
Sbjct  362   FDVTPAALVDGIITEVGVVEKDGSGVFHL  390



>dbj|GAM84914.1| hypothetical protein ANO11243_029160 [fungal sp. No.11243]
Length=379

 Score =   338 bits (866),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 212/372 (57%), Positives = 258/372 (69%), Gaps = 20/372 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L AI Y  G L +LDQ +LP    Y  I+N++D W AIKEM  RGAPAIAI AAL LAVE
Sbjct  3     LHAIKYTPGRLDILDQLQLPHAEHYDHIRNSEDAWHAIKEMRTRGAPAIAIVAALGLAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVIT--KEASTASEAKT  1067
               N +  + +AQD   ++  KL YLV+SRPTAVNL+DA  KL +V++   E + AS A +
Sbjct  63    VFNSDLDSKSAQDVQEYIYDKLAYLVTSRPTAVNLADAVGKLRKVVSAASEKTDASGA-S  121

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             +  AYI AAE ML DDVA N+AIG HGA+ +L +     + +S+LTHCNTGSLATAGYGT
Sbjct  122   VKAAYIGAAEQMLVDDVADNEAIGKHGATWILAHNAQSGENVSVLTHCNTGSLATAGYGT  181

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa----lmk  722
             ALGVIR+++    L+ A+CTETRP+NQGSRLT+FELV + IPATLI DS AAA      K
Sbjct  182   ALGVIRSLHAQKSLKHAFCTETRPYNQGSRLTSFELVHDQIPATLITDSMAAALLRLKGK  241

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
                + A++VGADR+AANGDTANKIGTY LA+ A  H V F VAAP T++D S  SGQ I 
Sbjct  242   TENIAAIVVGADRVAANGDTANKIGTYGLAILAKQHNVRFLVAAPRTTIDRSTKSGQDIH  301

Query  541   IEERSPKELLHTHG----------GLGE--QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IEER  +E+ H  G          G  E  +IAA+GI+VWNPAFDVTPA LI GIITEKG
Sbjct  302   IEERPGQEVTHIKGPRVKGTEIVPGSAETIKIAANGINVWNPAFDVTPAELIDGIITEKG  361

Query  397   VISKDGNDAFDI  362
             V+ K  N AFD 
Sbjct  362   VVEKGANGAFDF  373



>ref|XP_003850691.1| hypothetical protein MYCGRDRAFT_73955 [Zymoseptoria tritici IPO323]
 gb|EGP85667.1| hypothetical protein MYCGRDRAFT_73955 [Zymoseptoria tritici IPO323]
Length=389

 Score =   338 bits (866),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 203/370 (55%), Positives = 265/370 (72%), Gaps = 19/370 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI Y+ GSLQ+L+Q KLP Q  Y  I++A+DGW AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3     LEAIRYQPGSLQILNQLKLPHQEEYDHIRSAEDGWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI-TKEASTASEAKTI  1064
               +  T +  A++  +F+ +KL+YLV+SRPTAVNL+DAA KL +++ T   +  ++  ++
Sbjct  63    LQSTTTSD-HAEEVAAFILEKLDYLVTSRPTAVNLADAAGKLKKIVDTASNAEGADGASV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
              +AY  AA  ML  DVA N+ IG HGA  +     G  K+S++THCNTGSLATAGYGTAL
Sbjct  122   KKAYCDAAAEMLVADVADNRGIGKHGAEWITKS-AGGGKVSVVTHCNTGSLATAGYGTAL  180

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk----AG  716
             GVIR+++  G L+ A+CTETRP+NQGSRLTAFELV + IPATLI DS A+AL++    + 
Sbjct  181   GVIRSLHANGSLQHAFCTETRPYNQGSRLTAFELVHDKIPATLITDSMASALLRLRGPSE  240

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             R+ A++VGADR+AANGDTANKIGTY LA+ A +HGV F VAAP T++DL+  SG  IVIE
Sbjct  241   RIAAIVVGADRVAANGDTANKIGTYQLAITARYHGVKFLVAAPRTTIDLATKSGNDIVIE  300

Query  535   ERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
             ER  KE+    G   +             IAA+GI VWNP+FDVTPA LI GI+TE+GV+
Sbjct  301   ERPGKEMTMIKGPRSDGVDLDLSRVETVSIAAAGIDVWNPSFDVTPAELIDGIVTERGVV  360

Query  391   SKDGNDAFDI  362
              K  +  FD+
Sbjct  361   EKGADGKFDL  370



>ref|XP_002627028.1| S-methyl-5-thioribose-1-phosphate isomerase [Blastomyces dermatitidis 
SLH14081]
 sp|C5JGS0.1|MTNA_AJEDS RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Blastomyces 
dermatitidis SLH14081]
 gb|EEQ74668.1| S-methyl-5-thioribose-1-phosphate isomerase [Blastomyces dermatitidis 
SLH14081]
Length=392

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 216/386 (56%), Positives = 270/386 (70%), Gaps = 32/386 (8%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL AI Y RGSL +L+Q  LP QT Y  + +A D W AI EM VRGAPAIAI AALSLAV
Sbjct  2     TLAAITYTRGSLSILNQLLLPHQTTYDPLHSACDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  1243  eaSNLETFNGTA---QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-E  1076
             E   L   N  +   ++   F+ +KLEYLVSSRPTAVNL++AA +L  +++ +A     +
Sbjct  62    ELDALAANNQLSPEPKEVEVFIREKLEYLVSSRPTAVNLAEAAGRLGGIVSAKAEVRGVD  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQL-VGSK------KISILTHCNT  920
              + + EAYI AA+ MLEDDV  N+AIG  GA  +L+N +  GS+      K+++LTHCNT
Sbjct  122   GREVAEAYIAAAQRMLEDDVKDNRAIGEFGARWVLENAVATGSESGSEKGKVAVLTHCNT  181

Query  919   GSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsa  740
             GSLATAGYGTALGVIR+++  G LERAYCTETRP+NQGSRLTA+ELV + IPATLI D+ 
Sbjct  182   GSLATAGYGTALGVIRSLHATGSLERAYCTETRPYNQGSRLTAYELVHDKIPATLITDNM  241

Query  739   aaalmkAGR--------VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
             AAAL+   R        V+A+IVGADR+AANGDTANKIGTY LAV A +HGV F VAAP 
Sbjct  242   AAALLARNRAGSAASVGVSAIIVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKELLHTHGG-LGEQ-----------IAASGISVWNPAFDV  440
             T++D++  +G  IVIEER  +E+    G   GE+           +AA+GI VWNPAFDV
Sbjct  302   TTIDMNTKTGADIVIEERPKQEVTRVRGPRAGEEVDGLRAMETITVAANGIDVWNPAFDV  361

Query  439   TPASLISGIITEKGVISKDGNDAFDI  362
             TPA+LI GIITE GV+ KD + AF +
Sbjct  362   TPAALIDGIITEVGVVEKDASGAFHL  387



>ref|XP_003296469.1| hypothetical protein PTT_06581 [Pyrenophora teres f. teres 0-1]
 gb|EFQ95433.1| hypothetical protein PTT_06581 [Pyrenophora teres f. teres 0-1]
Length=392

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 208/372 (56%), Positives = 263/372 (71%), Gaps = 20/372 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y RG L++LDQ KLP    Y  I ++ D W AIKEM  RGAPAIAI AAL+LAVE
Sbjct  3     LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKEMRTRGAPAIAIVAALALAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS-TASEAKTI  1064
              SN++     A++   F+++KL+YLV+SRPTAVNL+DAA KL  +    A+   +   ++
Sbjct  63    LSNMK-LPSVAEEVNVFIAEKLDYLVTSRPTAVNLADAAGKLRRITESAAALEGANGDSV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSK-KISILTHCNTGSLATAGYGT  890
              EAY+ AAE ML DDV+ N++IG HGA  +++N   G K  +S++THCNTGSLATAGYGT
Sbjct  122   REAYVAAAEKMLVDDVSDNESIGKHGAEWIMKNTEAGKKGPVSMMTHCNTGSLATAGYGT  181

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa----lmk  722
             ALGVIR+++++  L+ A+C+ETRP+NQGSRLTAFELV + IPATLI DS AAA      +
Sbjct  182   ALGVIRSLHSSASLKHAFCSETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLRLRGE  241

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  +  ++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  IV
Sbjct  242   SENIAGIVVGADRVAANGDTANKIGTYSLAILAKHHGVKFLVAAPRTTIDLKTKSGADIV  301

Query  541   IEERSPKELLHTHG----------GLGE--QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IEER  KE+    G          G+ E   IAA+GI VWNPAFDVTPA LI GIITE G
Sbjct  302   IEERPGKEVTLVKGPRHDGITLDLGVVETISIAANGIGVWNPAFDVTPAELIDGIITEVG  361

Query  397   VISKDGNDAFDI  362
             V+ KD +  F +
Sbjct  362   VVEKDSDGVFHL  373



>sp|C5GGE5.1|MTNA_AJEDR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Blastomyces 
dermatitidis ER-3]
 gb|EEQ88736.1| S-methyl-5-thioribose-1-phosphate isomerase [Blastomyces dermatitidis 
ER-3]
 gb|EGE77093.1| S-methyl-5-thioribose-1-phosphate isomerase [Blastomyces dermatitidis 
ATCC 18188]
 gb|EQL38862.1| methylthioribose-1-phosphate isomerase [Blastomyces dermatitidis 
ATCC 26199]
Length=392

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 216/386 (56%), Positives = 270/386 (70%), Gaps = 32/386 (8%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL AI Y RGSL +L+Q  LP QT Y  + +A D W AI EM VRGAPAIAI AALSLAV
Sbjct  2     TLAAITYTRGSLSILNQLLLPHQTTYDPLHSACDAWHAIHEMRVRGAPAIAIVAALSLAV  61

Query  1243  eaSNLETFNGTA---QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-E  1076
             E   L   N  +   ++   F+ +KLEYLVSSRPTAVNL++AA +L  +++ +A     +
Sbjct  62    ELDALAANNQLSPEPKEVEVFIREKLEYLVSSRPTAVNLAEAAGRLGGIVSAKAEVRGVD  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQL-VGSK------KISILTHCNT  920
              + + EAYI AA+ MLEDDV  N+AIG  GA  +L+N +  GS+      K+++LTHCNT
Sbjct  122   GREVAEAYIAAAQRMLEDDVKDNRAIGEFGARWVLENGVATGSESGSEKGKVAVLTHCNT  181

Query  919   GSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsa  740
             GSLATAGYGTALGVIR+++  G LERAYCTETRP+NQGSRLTA+ELV + IPATLI D+ 
Sbjct  182   GSLATAGYGTALGVIRSLHATGSLERAYCTETRPYNQGSRLTAYELVHDKIPATLITDNM  241

Query  739   aaalmkAGR--------VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
             AAAL+   R        V+A+IVGADR+AANGDTANKIGTY LAV A +HGV F VAAP 
Sbjct  242   AAALLARNRAGSAASVGVSAIIVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKELLHTHGG-LGEQ-----------IAASGISVWNPAFDV  440
             T++D++  +G  IVIEER  +E+    G   GE+           +AA+GI VWNPAFDV
Sbjct  302   TTIDMNTKTGADIVIEERPKQEVTRVRGPRAGEEVDGLRAMETITVAANGIDVWNPAFDV  361

Query  439   TPASLISGIITEKGVISKDGNDAFDI  362
             TPA+LI GIITE GV+ KD + AF +
Sbjct  362   TPAALIDGIITEVGVVEKDASGAFHL  387



>dbj|GAM36840.1| hypothetical protein TCE0_022f06253 [Talaromyces cellulolyticus]
Length=384

 Score =   337 bits (865),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 194/371 (52%), Positives = 260/371 (70%), Gaps = 20/371 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQAI Y    LQ++DQ +LP  T Y+ I++A+DGW AIKEM VRGAPAIAI A LSLAV
Sbjct  2     SLQAIKYADNQLQIIDQLQLPFVTEYIPIRSAQDGWHAIKEMRVRGAPAIAIVAILSLAV  61

Query  1243  eaSNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SE  1076
             E S ++T    + ++++   F+ +KL YLV+SRPTAVNL+DAA K   ++T+      S 
Sbjct  62    ELSEIQTAGTLSSSSEEVGLFIIEKLHYLVTSRPTAVNLADAARKFEAMVTEHTKAQDST  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV--GSKKISILTHCNTGSLATA  902
               ++  AY+  AE+ML  D++ N+ IG++GA  + ++    G  K+++LTHCNTGSLATA
Sbjct  122   GPSLVAAYLKEAELMLVHDLSDNQNIGAYGAKWILDRAAAQGQSKVNVLTHCNTGSLATA  181

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaal  728
             GYGTALGVIR+++    L R YCTETRP+NQG+RLTA+ELV E +PAT    + +A+   
Sbjct  182   GYGTALGVIRSLHAGNALNRVYCTETRPYNQGARLTAYELVHEKMPATLITDSMAASLLA  241

Query  727   mkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
                 +V+A++VGADR+AANGDTANKIGTY+LAV A +HGV F VAAP T++D    SG +
Sbjct  242   KSESKVSAIVVGADRVAANGDTANKIGTYALAVLAKYHGVKFLVAAPRTTIDRGTPSGSE  301

Query  547   IVIEERSPKELLHTHGGLGE-----------QIAASGISVWNPAFDVTPASLISGIITEK  401
             IVIEER+P E+    G L             Q+AA+GI VWNPAFDVTPA+LI  +ITE+
Sbjct  302   IVIEERAPSEVTTIKGPLQGRMADTLQMETIQLAATGIDVWNPAFDVTPAALIDAVITEQ  361

Query  400   GVISKDGNDAF  368
             GV+ K G+D F
Sbjct  362   GVVEK-GSDGF  371



>ref|XP_001604505.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nasonia vitripennis]
Length=350

 Score =   335 bits (859),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 193/346 (56%), Positives = 247/346 (71%), Gaps = 11/346 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI +K G L++LDQ  LP Q+ Y+++ + +DGW+AI +M VRGAPAIAI   LSLA 
Sbjct  2     TLQAIKWKSGKLEILDQLLLPAQSKYIEVTSVEDGWNAIYKMQVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTAQDAVSFLS---QKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
                 +E  + + +D  + L    +KLEYLV++RPTAVN+  AA     + T  +   S  
Sbjct  61    ----VEIQHKSYEDTKALLKDVKEKLEYLVTARPTAVNIKLAADDFTRLATNLSHDESSP  116

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             + + +  I     MLE DVA NKAIG HGA+ +       K + I+THCNTGSLATAGYG
Sbjct  117   EDMKKRIISEITSMLEKDVADNKAIGDHGAAEILKTHPNEKNLRIITHCNTGSLATAGYG  176

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIR++++ G LE AYCTETRP+NQG+RLTA+ELV + IP+TLI D   AALMK+  
Sbjct  177   TALGVIRSIHSNGKLEHAYCTETRPYNQGARLTAYELVHDKIPSTLICDDMVAALMKSKN  236

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             ++AV+VGADR+ ANGDTANKIGTY +AV A HH VPFYVAAP T++D S+ +G+ I IEE
Sbjct  237   ISAVVVGADRVVANGDTANKIGTYQIAVLAKHHNVPFYVAAPFTTIDFSIPTGEGIKIEE  296

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  395
             R   EL H +   G +IAA GI+VWNPAFDVTPA LI+GI+TEKGV
Sbjct  297   RPANELTHVN---GTRIAAEGINVWNPAFDVTPAELITGIVTEKGV  339



>ref|XP_007691907.1| hypothetical protein COCMIDRAFT_105818 [Bipolaris oryzae ATCC 
44560]
 gb|EUC41567.1| hypothetical protein COCMIDRAFT_105818 [Bipolaris oryzae ATCC 
44560]
Length=392

 Score =   336 bits (862),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 208/372 (56%), Positives = 263/372 (71%), Gaps = 20/372 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y RG L++LDQ KLP    Y  I ++ D W AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3     LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAKTI  1064
              +N++     A++   F+ +KL+YLV+SRPTAVNL+DAA KL ++    A+   ++ + +
Sbjct  63    LTNMK-LPSAAEEVKVFIIEKLDYLVTSRPTAVNLADAAGKLQKITENAAAKEGADGEAV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVG-SKKISILTHCNTGSLATAGYGT  890
              EAY+ AAE ML DDV+ N++IG HGA  +++N   G +  +S++THCNTGSLATAGYGT
Sbjct  122   REAYVAAAEQMLVDDVSDNESIGKHGADWIVKNTEAGKAGPVSMMTHCNTGSLATAGYGT  181

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa----lmk  722
             ALGVIR+++  G L+ A+C+ETRP+NQGSRLTAFELV + IPATLI DS AAA      K
Sbjct  182   ALGVIRSLHANGSLKHAFCSETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLRLRGK  241

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  +  ++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  IV
Sbjct  242   SENIAGIVVGADRVAANGDTANKIGTYSLAILARHHGVKFLVAAPRTTIDLKTKSGADIV  301

Query  541   IEERSPKELLHTHG----------GLGE--QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IEER  KE+    G          G+ E   IAA+GI VWNPAFDVTPA LI GIITE G
Sbjct  302   IEERPGKEVTLVKGPRHDGVSLDLGVVETISIAANGIGVWNPAFDVTPAELIDGIITEVG  361

Query  397   VISKDGNDAFDI  362
             V+ KD N  F +
Sbjct  362   VVEKDSNGVFHL  373



>gb|EMD90991.1| hypothetical protein COCHEDRAFT_1176662 [Bipolaris maydis C5]
 gb|ENI05925.1| hypothetical protein COCC4DRAFT_31803 [Bipolaris maydis ATCC 
48331]
Length=392

 Score =   336 bits (862),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 208/372 (56%), Positives = 262/372 (70%), Gaps = 20/372 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y RG L++LDQ KLP    Y  I ++ D W AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3     LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAKTI  1064
              +N++     A++   F+ +KL+YLV+SRPTAVNL+DAA KL ++    A+   +  + +
Sbjct  63    VTNMK-LPSAAEEVKVFIIEKLDYLVTSRPTAVNLADAAGKLQKITENAAAKEGANGEAV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVG-SKKISILTHCNTGSLATAGYGT  890
              EAY+ AAE ML DDV+ N++IG HGA  +++N   G +  +S++THCNTGSLATAGYGT
Sbjct  122   REAYVAAAEQMLVDDVSDNESIGKHGADWIVKNTEAGKTGPVSMMTHCNTGSLATAGYGT  181

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa----lmk  722
             ALGVIR+++  G L+ A+C+ETRP+NQGSRLTAFELV + IPATLI DS AAA      K
Sbjct  182   ALGVIRSLHANGSLKHAFCSETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLRLRGK  241

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  +  ++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  IV
Sbjct  242   SENIAGIVVGADRVAANGDTANKIGTYSLAILARHHGVKFLVAAPRTTIDLKTKSGADIV  301

Query  541   IEERSPKELLHTHG----------GLGE--QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IEER  KE+    G          G+ E   IAA+GI VWNPAFDVTPA LI GIITE G
Sbjct  302   IEERPGKEVTLVKGPRHDGVSLDLGVVETISIAANGIEVWNPAFDVTPAELIDGIITEVG  361

Query  397   VISKDGNDAFDI  362
             V+ KD N  F +
Sbjct  362   VVEKDSNGVFHL  373



>gb|EIE81164.1| S-methyl-5-thioribose-1-phosphate isomerase [Rhizopus delemar 
RA 99-880]
Length=377

 Score =   335 bits (859),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 211/372 (57%), Positives = 259/372 (70%), Gaps = 15/372 (4%)
 Frame = -2

Query  1426  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  1247
             KTL+AI Y RG+L++L+Q  LP +T++  + N ++G  AIK M  RGAPAIAI AALSLA
Sbjct  7     KTLEAIQYTRGNLRILNQLVLPHETVFESVCNIQNGHAAIKTMKTRGAPAIAIVAALSLA  66

Query  1246  veaSNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  1076
             V+  N     G   T +  V FL   LEYL +SRPTAVNL DAA KL  +I   A  A E
Sbjct  67    VDV-NSRFEKGEFSTVEQVVQFLKDALEYLKTSRPTAVNLFDAAAKLEALIESTAKEAKE  125

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
               T+  AYI AAE ML DDV  NK IG  GA  + N +     I++LTHCNTGSLATAG+
Sbjct  126   PATVVYAYIEAAEKMLVDDVQDNKNIGRLGAEYITNHVKDKGDIAVLTHCNTGSLATAGW  185

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALG+IR ++  G L+ AYCTETRP+NQGSRLTA+ELV ENIPATLI DS A+AL+K  
Sbjct  186   GTALGIIRDLHANGQLKHAYCTETRPYNQGSRLTAYELVYENIPATLICDSMASALLKQN  245

Query  715   -RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
              +V A++VGADR+AANGDTANKIGTY LA+ A HHG+ F VAAP TS+DL+  SG  IVI
Sbjct  246   PQVQAIVVGADRVAANGDTANKIGTYQLAITAKHHGILFIVAAPSTSIDLNTKSGDAIVI  305

Query  538   EERSPKELLHTHGGLGEQ--------IAASGISVWNPAFDVTPASLISGIITEKGVISK-  386
             E+R P E L T  G+  Q         AA  I VWNP+FDVTP+ LIS I+TEKGV++K 
Sbjct  306   EQR-PSEELVTVAGIRVQDAQPTTIRTAAENIGVWNPSFDVTPSELISAIVTEKGVVTKQ  364

Query  385   DGNDAFDITGFV  350
             +G+  FD+  F+
Sbjct  365   EGSTQFDLASFL  376



>gb|KJY01485.1| methylthioribose-1-phosphate isomerase like protein [Zymoseptoria 
brevis]
Length=389

 Score =   335 bits (860),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 205/381 (54%), Positives = 269/381 (71%), Gaps = 19/381 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI ++ GSLQ+L+Q KL  Q  Y  IK+A+DGW AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3     LEAIRFQPGSLQILNQLKLSHQEEYDHIKSAEDGWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI-TKEASTASEAKTI  1064
               N  T +  A++  +F+ +KL YLV+SRPTAVNL+DAA KL +++ T   +  ++  ++
Sbjct  63    LQNTTTSD-HAEEVAAFILEKLNYLVTSRPTAVNLADAAGKLKKIVDTASNAEKADGASV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
              +AY  AA  ML  DVA N+ IG HGA  +  +  G  K+S++THCNTGSLATAGYGTAL
Sbjct  122   KKAYCDAAAEMLVADVADNQEIGKHGAEWI-TKSAGGGKVSVVTHCNTGSLATAGYGTAL  180

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk----AG  716
             GVIR+++  G L+ A+CTETRP+NQGSRLTAFELV + IPATLI DS A+AL++    + 
Sbjct  181   GVIRSLHANGSLQHAFCTETRPYNQGSRLTAFELVHDKIPATLITDSMASALLRLRGPSE  240

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             R+ A++VGADR+AANGDTANKIGTY LA+ A +HGV F VAAP T++DL+  SG+ IVIE
Sbjct  241   RIAAIVVGADRVAANGDTANKIGTYQLAITAKYHGVKFLVAAPRTTIDLATKSGKDIVIE  300

Query  535   ERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
             ER  KE+    G   +             IAA+GI VWNP+FDVTPA LI GI+TE+GV+
Sbjct  301   ERPGKEMTMVKGPRSDGVDLDLSRVETVSIAAAGIDVWNPSFDVTPAELIDGIVTERGVV  360

Query  391   SKDGNDAFDITGFVHKVSGNV  329
              K  +  FD+   ++  S  V
Sbjct  361   EKGADGKFDLASVMNAGSDGV  381



>gb|EYE93514.1| Methylthioribose-1-phosphate isomerase [Aspergillus ruber CBS 
135680]
Length=380

 Score =   335 bits (858),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 205/374 (55%), Positives = 251/374 (67%), Gaps = 20/374 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y  G L ++DQ KLP    Y+ I+ A++GW AIKEM VRGAPAIAI AAL+LA 
Sbjct  2     TLQAIRYTNGDLTIIDQLKLPFVEEYIPIRTAEEGWHAIKEMRVRGAPAIAIVAALALAS  61

Query  1243  eaSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             E   L   +  +  A++   F+ +KL YLV+SRPTAVNLSDAA KL  ++T+ ASTA  A
Sbjct  62    EVHQLVNNKKLSAAAEEVRIFIVEKLHYLVTSRPTAVNLSDAAHKLEVLVTERASTAGSA  121

Query  1072  -KTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQL-VGSKKISILTHCNTGSLATA  902
                +  A+I AAE M+  DV  NK IG +GA  +L N L  G  K SILTHCNTGSLAT+
Sbjct  122   GHDVATAFIRAAEHMMVKDVEDNKKIGQNGAQWILANALKSGLSKASILTHCNTGSLATS  181

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaal  728
             GYGTALGVIR++ +   L  AYCTETRP+NQGSRLTAFELV + +PAT    + +AA   
Sbjct  182   GYGTALGVIRSLASNNGLRHAYCTETRPYNQGSRLTAFELVHDGLPATLITDSMAAALLA  241

Query  727   mkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
                  +NA++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL+  SG +
Sbjct  242   RTDADMNAIVVGADRVAANGDTANKIGTYGLAVLARYHGVKFLVAAPLTTIDLATKSGNE  301

Query  547   IVIEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITE  404
             I IEER   E+    G   +             IAA GI+VWNPAFD+ PA+LI GIITE
Sbjct  302   ITIEERPASEVTRIKGPSQKDDTAGVLSLETINIAAKGINVWNPAFDIAPATLIDGIITE  361

Query  403   KGVISKDGNDAFDI  362
              GV  KD    F +
Sbjct  362   VGVAEKDSKGHFHL  375



>gb|EME39638.1| hypothetical protein DOTSEDRAFT_75327 [Dothistroma septosporum 
NZE10]
Length=391

 Score =   335 bits (859),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 208/372 (56%), Positives = 257/372 (69%), Gaps = 19/372 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI Y+ GSL +L+Q KLP Q  Y +IK A+DGW AIK+M  RGAPAIAI AALSLAVE
Sbjct  3     LEAIRYEPGSLYILNQLKLPHQEEYDEIKTAEDGWHAIKDMRTRGAPAIAIVAALSLAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE--AKT  1067
              +N +  +  A++  +F+ +KL YLV+SRPTAVNL+DAA KL ++    A+ +S+     
Sbjct  63    LTNTKVSD-KAEEVAAFIIEKLNYLVTSRPTAVNLADAAGKLKKITESAAAQSSDDDGAA  121

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTA  887
             + +AY  AA  ML  DV+ N+ IG HGA  +         IS+LTHCNTGSLATAGYGTA
Sbjct  122   VSKAYCDAAAAMLIADVSDNEGIGHHGADWILRNTPHKGPISVLTHCNTGSLATAGYGTA  181

Query  886   LGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG---  716
             LGVIR+++ +G L  A+CTETRP+NQGSRLTAFELV + IPATLI DS A+AL++     
Sbjct  182   LGVIRSLHFSGKLHHAFCTETRPYNQGSRLTAFELVHDKIPATLITDSMASALLRLKGDK  241

Query  715   -RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
              ++ AV+VGADR+AANGDTANKIGTY LA+ A HHGV F VAAP T++DLS  SG  IVI
Sbjct  242   EKIAAVVVGADRVAANGDTANKIGTYQLAITAKHHGVKFLVAAPRTTIDLSTPSGSSIVI  301

Query  538   EERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKGV  395
             EER   E+    G   +             IAA GI VWNP+FDVTP  LI GIITE GV
Sbjct  302   EERPGVEMTMLKGPRFDGVDIDVKAVETISIAAKGIEVWNPSFDVTPKELIDGIITEIGV  361

Query  394   ISKDGNDAFDIT  359
               KDG   FD+T
Sbjct  362   FEKDGKGEFDLT  373



>ref|XP_007708817.1| hypothetical protein COCCADRAFT_2167 [Bipolaris zeicola 26-R-13]
 gb|EUC36860.1| hypothetical protein COCCADRAFT_2167 [Bipolaris zeicola 26-R-13]
Length=392

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 208/372 (56%), Positives = 262/372 (70%), Gaps = 20/372 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y RG L++LDQ KLP    Y  I ++ D W AIK+M  RGAPAIAI AALSLAVE
Sbjct  3     LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKDMRTRGAPAIAIVAALSLAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAKTI  1064
              +N++     A++   F+ +KL+YLV+SRPTAVNL+DAA KL ++    A+   +  + +
Sbjct  63    LTNMK-LPSAAEEVKVFIIEKLDYLVTSRPTAVNLADAAGKLQKITENAAAKEGANGQAV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVG-SKKISILTHCNTGSLATAGYGT  890
              +AY+ AAE ML DDV+ N++IG HGA  +++N   G +  +S++THCNTGSLATAGYGT
Sbjct  122   RDAYVAAAEQMLVDDVSDNESIGKHGADWIVKNTEAGKAGPVSMMTHCNTGSLATAGYGT  181

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa----lmk  722
             ALGVIR+++  G L+ A+C+ETRP+NQGSRLTAFELV + IPATLI DS AAA      K
Sbjct  182   ALGVIRSLHANGSLKHAFCSETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLRLRGK  241

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  +  ++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  IV
Sbjct  242   SENIAGIVVGADRVAANGDTANKIGTYSLAILARHHGVKFLVAAPRTTIDLKTKSGADIV  301

Query  541   IEERSPKELLHTHG----------GLGE--QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IEER  KE+    G          G+ E   IAA+GI VWNPAFDVTPA LI GIITE G
Sbjct  302   IEERPGKEVTLVKGPRHDGVSLDLGVVETISIAANGIGVWNPAFDVTPAELIDGIITEVG  361

Query  397   VISKDGNDAFDI  362
             V+ KD N  F +
Sbjct  362   VVEKDSNGVFHL  373



>gb|EPS29452.1| hypothetical protein PDE_04401 [Penicillium oxalicum 114-2]
Length=385

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 199/373 (53%), Positives = 261/373 (70%), Gaps = 20/373 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y +G L++LDQ +LP    Y+ I+ A+DGW+AIK+M VRGAPAIAI A L+LA E
Sbjct  2     LQAIKYDQGHLEILDQLQLPFVEKYIPIQTAEDGWNAIKDMKVRGAPAIAIVAMLALASE  61

Query  1240  aSNLETFN---GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA-STASEA  1073
                L++ +    + Q+A + ++QKLEYLV+SRPTAVNL+DAA KL  V+T +A    +  
Sbjct  62    LHALQSADKIPDSPQEAETLIAQKLEYLVTSRPTAVNLADAARKLGAVVTTQAGQVGATG  121

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGY  896
              T+  A++  AE M+  D+  N+ IG HGA  ++ N   G   +++LTHCNTGSLAT+GY
Sbjct  122   PTVVAAFMRGAEEMMGKDLDDNQRIGHHGAEWIMANATKGGSDVAVLTHCNTGSLATSGY  181

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIR++ +   L  AYC+ETRP+NQGSRLTAFELV + IPATLI DS AAAL+   
Sbjct  182   GTALGVIRSLFSKNVLRHAYCSETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLADP  241

Query  715   R--VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  VNA++VGADR+AANGDTANKIGTYSLAV A +HGV F VAAP T++DL+   G +IV
Sbjct  242   KAGVNAIVVGADRVAANGDTANKIGTYSLAVLAKYHGVKFLVAAPRTTIDLATKFGNEIV  301

Query  541   IEERSPKELLHTHGGLGEQ-------------IAASGISVWNPAFDVTPASLISGIITEK  401
             IE+R   E+++  G                  IAA GI+VWNP+FD+TPA+LI GIITE 
Sbjct  302   IEQRPAAEMINIKGPRAGAPAIDGNVTLETVCIAAPGINVWNPSFDITPAALIDGIITEV  361

Query  400   GVISKDGNDAFDI  362
             GV+ K  +  F +
Sbjct  362   GVVEKGSDGLFHM  374



>gb|KGO76677.1| Initiation factor 2B alpha/beta/delta [Penicillium italicum]
Length=382

 Score =   334 bits (857),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 190/375 (51%), Positives = 256/375 (68%), Gaps = 19/375 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGa---paiaiaaalsl  1250
             LQAI + +G+L++LDQ +LP    Y+ I+  +DGW AIK+M VRGA     +A+ A  S 
Sbjct  2     LQAIKFSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVRGAPAIAIVAMLALASE  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SEA  1073
                A N +  + + ++   ++++KL YLV+SRPTAVNL+DAA KL  V+     T+ S  
Sbjct  62    LTSAVNSDKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAARKLEVVVVNRTKTSGSTG  121

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV-GSKKISILTHCNTGSLATAGY  896
             + +  A+I AAE M+  D+  NK IG +GA  +      G+ ++++LTHCNTGSLAT+GY
Sbjct  122   QEVAAAFIQAAEDMMGKDLEDNKRIGHNGAEWIATHAARGNSEVAVLTHCNTGSLATSGY  181

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R++ +   L  AYCTETRP+NQGSRLTAFELV + IPATLI DS AAAL+   
Sbjct  182   GTALGVVRSLASKNILRHAYCTETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLADT  241

Query  715   R--VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  VNA++VGADR+AANGDTANKIGTY+LAV A +HGV F VAAPLT++D++  SG+ IV
Sbjct  242   QVGVNAIVVGADRVAANGDTANKIGTYALAVLAKYHGVKFLVAAPLTTIDMATKSGKDIV  301

Query  541   IEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IE+R+  E+    G                +IAA GI+VWNPAFD+TPASLI GIITE G
Sbjct  302   IEQRAASEVTSIKGPRAGSEATDQIAIETVKIAAPGINVWNPAFDITPASLIDGIITEVG  361

Query  397   VISKDGNDAFDITGF  353
             V+ K  +D + + G 
Sbjct  362   VVEKGSDDKYHLGGL  376



>ref|XP_003833699.1| hypothetical protein LEMA_P064600.1 [Leptosphaeria maculans JN3]
 emb|CBX90334.1| hypothetical protein LEMA_P064600.1 [Leptosphaeria maculans JN3]
Length=479

 Score =   337 bits (865),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 211/378 (56%), Positives = 269/378 (71%), Gaps = 22/378 (6%)
 Frame = -2

Query  1435  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  1256
             S    LQAI Y RG L++LDQ KLP    Y  + ++ D W AIK+M  RGAPAIAI AAL
Sbjct  85    SSKMVLQAIKYSRGRLEILDQLKLPHSEEYDSMYSSTDAWHAIKDMRTRGAPAIAIVAAL  144

Query  1255  slaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKE--ASTA  1082
             +LAVE +N++  +  A++   F+++KL+YLV+SRPTAVNL+DAA KL   IT+E  A   
Sbjct  145   ALAVELANMK-LSSIAEEVKVFVTEKLDYLVTSRPTAVNLADAAGKLRR-ITEETAARDG  202

Query  1081  SEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLL-QNQLVGSK-KISILTHCNTGSLA  908
             ++ +++ EAYI AAE ML DDV+ N+ IG HGA  + +N   G K  +S+LTHCNTGSLA
Sbjct  203   ADGESVREAYIAAAEQMLIDDVSDNQNIGKHGAEWIAKNTPAGQKGPVSMLTHCNTGSLA  262

Query  907   TAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaal  728
             TAGYGTALGVIR+++ AG L+ A+C+ETRP+NQGSRLTAFELV + IPATLI DS AAAL
Sbjct  263   TAGYGTALGVIRSLHAAGSLKHAFCSETRPYNQGSRLTAFELVHDKIPATLITDSMAAAL  322

Query  727   m----kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLS  560
             +     +  + A++VGADR+AANGDTANKIGTYSLA+ A HHG+ F VAAP T++D++  
Sbjct  323   LRLRGTSENMAAIVVGADRVAANGDTANKIGTYSLAILARHHGIKFLVAAPRTTIDMNTP  382

Query  559   SGQQIVIEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISG  416
             SG  IVIEER  KE+    G   +             IAA+GI+VWNPAFDVTPA LI G
Sbjct  383   SGADIVIEERPGKEVTLVKGPRYDGVTLDLAVVETISIAANGINVWNPAFDVTPAELIDG  442

Query  415   IITEKGVISKDGNDAFDI  362
             IITE GV+ KD +  F +
Sbjct  443   IITEVGVVEKDSDGKFPL  460



>ref|XP_008031489.1| hypothetical protein SETTUDRAFT_166325 [Setosphaeria turcica 
Et28A]
 gb|EOA80895.1| hypothetical protein SETTUDRAFT_166325 [Setosphaeria turcica 
Et28A]
Length=392

 Score =   334 bits (856),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 208/372 (56%), Positives = 260/372 (70%), Gaps = 20/372 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y+RG LQ+LDQ KLP    Y  I ++ D W AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3     LQAIKYERGQLQILDQLKLPHAEEYDHIYSSTDAWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT-I  1064
              +N++      ++   F+++KL+YLV+SRPTAVNL+DAA KL ++    A+ A      +
Sbjct  63    LTNMK-LAAVPEEVKVFITEKLDYLVTSRPTAVNLADAAGKLRKITEHAAAEAGATGETV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGT  890
              E Y+ AAE ML DDV+ N++IG HGA  + +     KK  +S+LTHCNTGSLATAGYGT
Sbjct  122   REVYVTAAEQMLVDDVSDNESIGKHGAEWIVSNTEAGKKGPVSMLTHCNTGSLATAGYGT  181

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa----lmk  722
             ALGVIR+++  G L+ A+C+ETRP+NQGSRLTAFELV + IPATLI DS AAA      +
Sbjct  182   ALGVIRSLHANGSLKHAFCSETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLRLRGE  241

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  +  ++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL+  SG  IV
Sbjct  242   SENIAGIVVGADRVAANGDTANKIGTYSLAILARHHGVKFLVAAPRTTIDLNTKSGTDIV  301

Query  541   IEERSPKELLHTHG----------GLGE--QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IEER  KE+    G          G+ E   IAA+GI VWNPAFDVTPA LI GIITE G
Sbjct  302   IEERPGKEVTLVKGPRHDGVSLDLGVVETISIAANGIGVWNPAFDVTPAELIDGIITEVG  361

Query  397   VISKDGNDAFDI  362
             V+ KD N  F +
Sbjct  362   VVEKDSNGVFHL  373



>ref|XP_007929107.1| hypothetical protein MYCFIDRAFT_204427 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME80035.1| hypothetical protein MYCFIDRAFT_204427 [Pseudocercospora fijiensis 
CIRAD86]
Length=385

 Score =   333 bits (855),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 267/367 (73%), Gaps = 15/367 (4%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI Y   SLQ+L+Q KLP Q  Y ++K A+DGW AIK+M  RGAPAIAI AALSLAVE
Sbjct  3     LEAIRYAPCSLQILNQLKLPHQEEYDEVKTAEDGWHAIKDMRTRGAPAIAIVAALSLAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SEAKTI  1064
              SN +T +  A++  +F+ +KL+YLV+SRPTAVNL+DA  KL +++T  A+ + +   ++
Sbjct  63    LSNNKTSD-KAEEVAAFIVEKLDYLVTSRPTAVNLADAVGKLKKIVTSAAAISDANGDSV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
              + Y  AA+ ML  DV+ NK IG +GA  ++ ++ G  ++S++THCNTGSLATAGYGTAL
Sbjct  122   SKTYCDAAQAMLAADVSDNKGIGKYGAEWIE-KVAGGGQVSVVTHCNTGSLATAGYGTAL  180

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk----AG  716
             GVIR+++  G L+ A+CTETRP+NQGSRLTAFELV + IPATLI DS A+AL++      
Sbjct  181   GVIRSLHANGSLKHAFCTETRPYNQGSRLTAFELVHDKIPATLITDSMASALLRLQGPEK  240

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             R+ A++VGADR+AANGDTANKIGTY LA+ A +HGV F VAAP T++DL+  SG  IVIE
Sbjct  241   RITAIVVGADRVAANGDTANKIGTYQLAITAKYHGVKFLVAAPRTTIDLNTRSGADIVIE  300

Query  535   ERSPKELLHTHG----GLGE----QIAASGISVWNPAFDVTPASLISGIITEKGVISKDG  380
             ER  +E+    G     L +     IAA GI+VWNP+FDVTPA LI GIITE GV  KD 
Sbjct  301   ERPGEEMTMLTGPRLNDLDQVETISIAAKGINVWNPSFDVTPAELIDGIITEIGVFEKDS  360

Query  379   NDAFDIT  359
                +D++
Sbjct  361   KRVYDLS  367



>ref|XP_002480786.1| translation initiation factor, putative [Talaromyces stipitatus 
ATCC 10500]
 sp|B8M7D2.1|MTNA_TALSN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Talaromyces 
stipitatus ATCC 10500]
 gb|EED20352.1| translation initiation factor, putative [Talaromyces stipitatus 
ATCC 10500]
Length=384

 Score =   333 bits (855),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 194/371 (52%), Positives = 261/371 (70%), Gaps = 20/371 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQAI Y    LQ++DQ +LP  T Y+ I++A+DGW AIKEM VRGAPAIAI A LSLAV
Sbjct  2     SLQAIKYFDNQLQIIDQLQLPFVTEYIPIRSAQDGWYAIKEMRVRGAPAIAIVAILSLAV  61

Query  1243  eaSNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA-STASE  1076
             E + + T    + ++++   F+ +KL YLV+SRPTAVNL+DAA K   ++T+   +  S 
Sbjct  62    ELNEIHTAGKLSSSSEEVGLFIIEKLHYLVTSRPTAVNLADAARKFENMVTEHTRAQDST  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV--GSKKISILTHCNTGSLATA  902
              +++  AY+  AE+ML  D++ N+ IG +GA  +  +    G  K+++LTHCNTGSLATA
Sbjct  122   GQSLVAAYLKEAELMLVHDLSDNQNIGEYGAKWILERAATQGQNKVNVLTHCNTGSLATA  181

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaal  728
             GYGTALGVIR+++    L R YCTETRP+NQG+RLTA+ELV E +PAT    + +A+   
Sbjct  182   GYGTALGVIRSLHAKNALNRVYCTETRPYNQGARLTAYELVHEKMPATLITDSMAASLLA  241

Query  727   mkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
                 +V+A++VGADR+AANGDTANKIGTY+LAV A +HGV F VAAP T++D    +G +
Sbjct  242   KSHSKVSAIVVGADRVAANGDTANKIGTYALAVLAKYHGVKFLVAAPRTTIDRGTLTGTE  301

Query  547   IVIEERSPKELLHTHGGL----GE-------QIAASGISVWNPAFDVTPASLISGIITEK  401
             IVIEER+P E+    G L    G+       Q+AA+GI VWNPAFDVTPA+LI  +ITEK
Sbjct  302   IVIEERAPSEVTTIKGPLQGRVGDTLQMETIQLAATGIDVWNPAFDVTPAALIDAVITEK  361

Query  400   GVISKDGNDAF  368
             GV+ K G+D F
Sbjct  362   GVVEK-GSDGF  371



>ref|XP_007702121.1| hypothetical protein COCSADRAFT_38815 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD62015.1| hypothetical protein COCSADRAFT_38815 [Bipolaris sorokiniana 
ND90Pr]
Length=392

 Score =   333 bits (855),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 210/373 (56%), Positives = 263/373 (71%), Gaps = 22/373 (6%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L AI Y RG L++LDQ KLP    Y  I ++ D W AIK+M  RGAPAIAI AAL+LAVE
Sbjct  3     LHAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAIKDMRTRGAPAIAIVAALALAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA--KT  1067
              +N++     A++   F+ +KL+YLV+SRPTAVNL+DAA KL + IT+ A+   EA  + 
Sbjct  63    LTNMK-LPSAAEEVKVFIIEKLDYLVTSRPTAVNLADAAGKLRK-ITENAAAKEEANGEA  120

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVG-SKKISILTHCNTGSLATAGYG  893
             + EAY+ AAE ML DDV+ N++IG HGA  +++N   G +  + ++THCNTGSLATAGYG
Sbjct  121   VREAYVAAAEQMLVDDVSDNESIGKHGADWIVKNTEAGKAGPVGMMTHCNTGSLATAGYG  180

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa----lm  725
             TALGVIR+++  G L+ A+C+ETRP+NQGSRLTAFELV + IPATLI DS AAA      
Sbjct  181   TALGVIRSLHANGSLKHAFCSETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLRLRG  240

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
             K+  +  ++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  I
Sbjct  241   KSENIAGIVVGADRVAANGDTANKIGTYSLAILARHHGVKFLVAAPRTTIDLKTKSGADI  300

Query  544   VIEERSPKELLHTHG----------GLGE--QIAASGISVWNPAFDVTPASLISGIITEK  401
             VIEER  KE+    G          G+ E   IAA+GI VWNPAFDVTPA LI GIITE 
Sbjct  301   VIEERPGKEVTLVKGPRHDGILLDLGVVETISIAANGIGVWNPAFDVTPAELIDGIITEV  360

Query  400   GVISKDGNDAFDI  362
             GV+ KD N  F +
Sbjct  361   GVVEKDSNGVFHL  373



>gb|EUN32000.1| hypothetical protein COCVIDRAFT_86317 [Bipolaris victoriae FI3]
Length=392

 Score =   333 bits (854),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 207/372 (56%), Positives = 261/372 (70%), Gaps = 20/372 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y RG L++LDQ KLP    Y  I ++ D W A+K+M  RGAPAIAI AALSLAVE
Sbjct  3     LQAIKYSRGQLEILDQLKLPHAEEYDHIYSSTDAWHAVKDMRTRGAPAIAIVAALSLAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-EAKTI  1064
              +N++     A++   F+ +KL+YLV+SRPTAVNL+DAA KL ++    A+      + +
Sbjct  63    LTNMK-LPSAAEEVKVFIIEKLDYLVTSRPTAVNLADAAGKLQKITENAAAKEGVNGQAV  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVG-SKKISILTHCNTGSLATAGYGT  890
              +AY+ AAE ML DDV+ N++IG HGA  +++N   G +  +S++THCNTGSLATAGYGT
Sbjct  122   RDAYVAAAEQMLVDDVSDNESIGKHGADWIVKNTEAGKAGPVSMMTHCNTGSLATAGYGT  181

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa----lmk  722
             ALGVIR+++  G L+ A+C+ETRP+NQGSRLTAFELV + IPATLI DS AAA      K
Sbjct  182   ALGVIRSLHANGSLKHAFCSETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLRLRGK  241

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  +  ++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T++DL   SG  IV
Sbjct  242   SENIAGIVVGADRVAANGDTANKIGTYSLAILARHHGVKFLVAAPRTTIDLKTKSGADIV  301

Query  541   IEERSPKELLHTHG----------GLGE--QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IEER  KE+    G          G+ E   IAA+GI VWNPAFDVTPA LI GIITE G
Sbjct  302   IEERPGKEVTLVKGPRHDGVSLDLGVVETISIAANGIGVWNPAFDVTPAELIDGIITEVG  361

Query  397   VISKDGNDAFDI  362
             V+ KD N  F +
Sbjct  362   VVEKDSNGVFHL  373



>gb|EHJ70136.1| eIF2B-alpha-like protein [Danaus plexippus]
Length=351

 Score =   332 bits (850),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 196/355 (55%), Positives = 247/355 (70%), Gaps = 20/355 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L++I Y+RG L++LDQ  LPLQT Y+ ++  +DGW  I +M VRGAPAIAI   LSLA 
Sbjct  2     SLESIKYERGKLEILDQLLLPLQTRYVKVQGVEDGWKVINKMQVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTAQDAVSFLSQ---KLEYLVSSRPTAVNLSDAATKL----NEVITKEAST  1085
                 +E       D      +   KL YLVS+RPTAVN+  A  +L    N +   E  T
Sbjct  61    ----IELMKDDCSDKKIMRQEIEGKLNYLVSARPTAVNIKLAGDELINFANSLCADENVT  116

Query  1084  ASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLAT  905
             A + +   E +I + E ML  D+  NKAIG +G   +   + G   + ILTHCNTGSLAT
Sbjct  117   ADDFR---ERFIRSIENMLIKDIEDNKAIGKYGCEAILKTIEGDGHVRILTHCNTGSLAT  173

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR++N A  LE  YCTETRP+NQG+RLTA+ELV E IPATL+ DS  AA+M
Sbjct  174   AGYGTALGVIRSLNAAKKLEHVYCTETRPYNQGARLTAYELVHEKIPATLVVDSMVAAIM  233

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
              A  ++AV+VGADR+AANGDTANKIGTY +A+ A HH VPFYVAAPLTS+D+SL SG +I
Sbjct  234   HARNISAVVVGADRVAANGDTANKIGTYQIAIVAKHHNVPFYVAAPLTSIDMSLKSGDRI  293

Query  544   VIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVISKD  383
              IEER  +E+ H    +GE +IAA GI+ WNP+FDVTPA+LI+GIITEKGV + D
Sbjct  294   KIEERPDREMTH----IGEHRIAAPGINCWNPSFDVTPAALITGIITEKGVFAPD  344



>gb|KGO39130.1| Initiation factor 2B alpha/beta/delta [Penicillium expansum]
 gb|KGO49452.1| Initiation factor 2B alpha/beta/delta [Penicillium expansum]
 gb|KGO55325.1| Initiation factor 2B alpha/beta/delta [Penicillium expansum]
Length=382

 Score =   332 bits (852),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 189/375 (50%), Positives = 256/375 (68%), Gaps = 19/375 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGa---paiaiaaalsl  1250
             LQAI + +G+L++LDQ +LP    Y+ I+  +DGW AIK+M VRGA     +A+ A  S 
Sbjct  2     LQAIKFSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVRGAPAIAIVAMLALASE  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SEA  1073
                A + +  + + ++   ++++KL YLV+SRPTAVNL+DAA KL  V+     T+ S  
Sbjct  62    LTSAVDSDKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAARKLEVVVVNRTKTSGSTG  121

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV-GSKKISILTHCNTGSLATAGY  896
             + +  A+I AAE M+  D+  NK IG +GA  +      G+ ++++LTHCNTGSLAT+GY
Sbjct  122   QEVAAAFIQAAEDMMGKDLEDNKRIGHNGAEWIATHAARGNSEVAVLTHCNTGSLATSGY  181

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R++ +   L  AYCTETRP+NQGSRLTAFELV + IPATLI DS AAAL+   
Sbjct  182   GTALGVVRSLASKNILRHAYCTETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLADT  241

Query  715   R--VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  VNA++VGADR+AANGDTANKIGTY+LAV A +HGV F VAAPLT++D++  SG+ IV
Sbjct  242   QVGVNAIVVGADRVAANGDTANKIGTYALAVLAKYHGVKFLVAAPLTTIDMATKSGKDIV  301

Query  541   IEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IE+R+  E+    G                +IAA GI+VWNPAFD+TPASLI GIITE G
Sbjct  302   IEQRAASEVTSIKGPRAGSETTDQIAIETVKIAAPGINVWNPAFDITPASLIDGIITEVG  361

Query  397   VISKDGNDAFDITGF  353
             V+ K  +D + + G 
Sbjct  362   VVEKGSDDKYHLGGL  376



>emb|CEI86534.1| Putative S-methyl-5-thioribose-1-phosphate isomerase [Rhizopus 
microsporus]
Length=377

 Score =   332 bits (852),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 207/377 (55%), Positives = 258/377 (68%), Gaps = 13/377 (3%)
 Frame = -2

Query  1438  HSEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             H+  KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGAPAIAI AA
Sbjct  2     HTATKTLEAIQYTRGDLRILNQLVLPHETIFETVLNIQNGHSAIKTMKTRGAPAIAIVAA  61

Query  1258  lslaveaSNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  1088
             LSLAV+  N     G   T    V F+ + LEYL +SRPTAVNL DAA KL  V+   A 
Sbjct  62    LSLAVDI-NTRFEKGEFTTVDQVVQFVQESLEYLKTSRPTAVNLFDAAAKLLTVVQDSAK  120

Query  1087  TASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLA  908
              A E   +  AYI AAE ML DDV  NK IG  GA  + + +     I +LTHCNTGSLA
Sbjct  121   GAKEPADVVYAYIEAAEKMLVDDVQDNKNIGKFGADYITSNVKDKDNICVLTHCNTGSLA  180

Query  907   TAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaal  728
             TAG+GTALG+IR ++ +G L+ AYCTETRP+NQGSRLTA+ELV ENIPATLI D+ A+AL
Sbjct  181   TAGWGTALGIIRDLHASGNLKHAYCTETRPYNQGSRLTAYELVYENIPATLICDNMASAL  240

Query  727   mkAG-RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQ  551
             +K   +V A++VGADR+AANGDTANKIGTY LA+ A +HG+ F VAAP TS+DL+  SG 
Sbjct  241   LKQNPQVQAIVVGADRVAANGDTANKIGTYQLAITAKYHGILFIVAAPSTSIDLNTKSGA  300

Query  550   QIVIEERSPKELLHTHGGLGE-------QIAASGISVWNPAFDVTPASLISGIITEKG-V  395
              IVIE+R  +EL+   G   +       + AA  I VWNP+FDVTP+ LIS I+TEKG V
Sbjct  301   DIVIEQRPAEELVTVSGVRVQDNEPTSIRTAAEHIGVWNPSFDVTPSELISAIVTEKGVV  360

Query  394   ISKDGNDAFDITGFVHK  344
             + KDG   FD+  F+ K
Sbjct  361   VKKDGETQFDMAAFLSK  377



>ref|XP_001267437.1| translation initiation factor, putative [Neosartorya fischeri 
NRRL 181]
 sp|A1CY38.1|MTNA_NEOFI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Neosartorya 
fischeri NRRL 181]
 gb|EAW25540.1| translation initiation factor, putative [Neosartorya fischeri 
NRRL 181]
Length=387

 Score =   332 bits (852),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 199/373 (53%), Positives = 252/373 (68%), Gaps = 20/373 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y RG L ++DQ +LP    ++ I+  +D W AIKEM VRGAPAIAI AAL+LA E
Sbjct  5     LQAIRYSRGKLAIIDQLQLPYVEKFITIQTPEDAWHAIKEMRVRGAPAIAIVAALALASE  64

Query  1240  aSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEA  1073
              + L   +  +  A++   F+ +KL+YLVSSRPTAVNLSDAA KL   I+  A T  +  
Sbjct  65    LNTLIVHDKLSSGAEEVKLFIREKLDYLVSSRPTAVNLSDAARKLESTISDHADTPGATG  124

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAG  899
             +T+ EA+I AAE M+  D+  N  IG +GA  +    + ++K   ++LTHCNTGSLAT+G
Sbjct  125   RTVAEAFIRAAEDMMTKDLDDNMRIGKNGAEWIIKHALAARKSTATVLTHCNTGSLATSG  184

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaalm  725
             YGTALGVIRA+ +   LE AYCTETRP+NQGSRLTAFELV + +PAT    +  AA    
Sbjct  185   YGTALGVIRALASKKALEHAYCTETRPYNQGSRLTAFELVHDRLPATLITDSMVAALLAN  244

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
                 V+A++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL   SG+ I
Sbjct  245   TKAEVDAIVVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPLTTIDLGTKSGEDI  304

Query  544   VIEERSPKELLHTHGGL-GE-----------QIAASGISVWNPAFDVTPASLISGIITEK  401
             VIEER   E+    G + G+            IAA GI+VWNPAFDVTP++LI GIITE 
Sbjct  305   VIEERPAAEVTKIRGPVDGDHSADIVKLETVHIAAKGINVWNPAFDVTPSTLIDGIITEV  364

Query  400   GVISKDGNDAFDI  362
             GVI K  +  F +
Sbjct  365   GVIEKGTDGQFHL  377



>dbj|GAN06082.1| translation initiation factor [Mucor ambiguus]
Length=377

 Score =   332 bits (851),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 209/371 (56%), Positives = 253/371 (68%), Gaps = 13/371 (4%)
 Frame = -2

Query  1426  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  1247
             KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGAPAIAI AALSLA
Sbjct  7     KTLEAIKYTRGDLRILNQLVLPHETIFETVLNVQNGHAAIKTMKTRGAPAIAIVAALSLA  66

Query  1246  veaSNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  1076
             V+  N     G   T   AV FL + L+YL +SRPTAVNL DAA KL  +I   A TA E
Sbjct  67    VDV-NARFEQGEFETVDQAVKFLLESLDYLKTSRPTAVNLFDAAAKLENLINTTAKTAQE  125

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
               T+  AYI AAE ML DDV  NK IG  GA  +         IS+LTHCNTGSLATAG+
Sbjct  126   PVTVVTAYIEAAEQMLIDDVKDNKNIGKFGADYIVENAKNPNSISVLTHCNTGSLATAGW  185

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALG+IR ++    LE AYCTETRP+NQGSRLTA+ELV E IPATLI D+ A+AL+K  
Sbjct  186   GTALGIIRDLHQNNKLEHAYCTETRPYNQGSRLTAYELVYEQIPATLICDNMASALLKQN  245

Query  715   -RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
               V A++VGADR+AANGDTANKIGTY LA+ A HHG+ F VAAP TS+DL   SG  I I
Sbjct  246   PNVQAIVVGADRVAANGDTANKIGTYQLAITAKHHGILFIVAAPSTSIDLKTKSGDDIPI  305

Query  538   EERSPKELLHTHG-------GLGEQIAASGISVWNPAFDVTPASLISGIITEKG-VISKD  383
             E+R  +EL+   G           + AA+ I VWNP+FDVTPASLIS I+TE+G V+ K+
Sbjct  306   EQRPAEELVTVAGVRVNDNEPTTIRTAAAEIGVWNPSFDVTPASLISAIVTEQGVVVKKE  365

Query  382   GNDAFDITGFV  350
             G D FD+  F+
Sbjct  366   GEDVFDMAAFL  376



>ref|XP_010759673.1| methylthioribose-1-phosphate isomerase [Paracoccidioides brasiliensis 
Pb18]
 sp|C1G9Q3.1|MTNA_PARBD RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Paracoccidioides 
brasiliensis Pb18]
 gb|EEH47905.1| methylthioribose-1-phosphate isomerase [Paracoccidioides brasiliensis 
Pb18]
Length=382

 Score =   332 bits (851),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 203/375 (54%), Positives = 251/375 (67%), Gaps = 22/375 (6%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L AI Y  G L +L+Q  LP QT Y  I +A D W AI +M VRGAPAIAI AALSLAVE
Sbjct  3     LIAISYSHGKLSILNQLFLPHQTTYDPIYSACDAWHAIHDMRVRGAPAIAIVAALSLAVE  62

Query  1240  aSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNE-VITKEASTASEA  1073
               +L      +  A++   F+ +KLEY+ SSRPTAVNL +AA +L + V+ +        
Sbjct  63    LYDLIQKGKLSDQAKEVEIFIREKLEYIASSRPTAVNLVEAAGRLGKIVVARSCGEGVTG  122

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV----GSKKISILTHCNTGSLAT  905
             + + E YI AAE MLEDDV  N+ IG  GA  +  Q +    G  K+++LTHCNTGSLAT
Sbjct  123   REVAEEYIRAAEKMLEDDVKDNRGIGEFGAKWIMKQAIDGAEGKGKVAVLTHCNTGSLAT  182

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaa  731
             AGYGTALGVIR+++ A  L+ AYCTETRP+NQGSRLTA+ELV +NIPAT    + +AA  
Sbjct  183   AGYGTALGVIRSLHAANSLKHAYCTETRPYNQGSRLTAYELVHDNIPATLITDSMAAALL  242

Query  730   lmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQ  551
               K+  V A++VGADR+AANGDTANKIGTY LAV A HHGV F VAAP T++D++  SG+
Sbjct  243   AHKSAGVGAIVVGADRVAANGDTANKIGTYGLAVLAKHHGVKFLVAAPRTTIDMNTKSGE  302

Query  550   QIVIEERSPKELLHTHG--------GLGEQ----IAASGISVWNPAFDVTPASLISGIIT  407
              I IEER  +E+    G        GLG      +AA GI VWNPAFDVTPASLI GIIT
Sbjct  303   GIAIEERPRQEMTRIRGPRVGGEQDGLGAMETITVAADGIDVWNPAFDVTPASLIDGIIT  362

Query  406   EKGVISKDGNDAFDI  362
             E GV+ KD +  F +
Sbjct  363   EIGVVEKDRDGEFHL  377



>ref|XP_003760740.1| PREDICTED: methylthioribose-1-phosphate isomerase [Sarcophilus 
harrisii]
Length=358

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 250/352 (71%), Gaps = 15/352 (4%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+AI Y RGSL +LDQ  LP Q+ Y  + + +  W+AI+ M VRGAPAIAI   LSLA 
Sbjct  2     SLEAIRYHRGSLHVLDQLLLPQQSHYESVTSVRQAWEAIRAMKVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTA----QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  1076
                 +E   G+     +  V+F+   L+YLV++RPTAVN++ AA +++EV ++EA     
Sbjct  61    ----VELHAGSGGPGLEALVTFVQDSLKYLVTARPTAVNMAQAAREMSEVASQEAGQEGA  116

Query  1075  AKT-IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATA  902
              ++ + E  I  AE MLE DV  N++IG HGA  LL+    G  ++++LTHCNTGSLATA
Sbjct  117   TESAVRERLICWAEHMLEKDVKDNQSIGDHGAQHLLERVAPGGGQVTVLTHCNTGSLATA  176

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk  722
             GYGTALGVIR+++  G L+  +CTETRP+NQG+RLTA+ELV E IPATLI DS  AA + 
Sbjct  177   GYGTALGVIRSLHALGRLKHVFCTETRPYNQGARLTAYELVYEKIPATLITDSMVAAAIA  236

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
                V AVIVGADR+ ANGDTANK+GTY LA+ A HHG+PFYVA P++S DLSL +GQ+IV
Sbjct  237   HKEVGAVIVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVATPVSSCDLSLKTGQEIV  296

Query  541   IEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVIS  389
             IEER  +EL +     G +IAA GI VWNPAFDVTP  LI+ GIITE+GV S
Sbjct  297   IEERPGQELTNL---CGTRIAAPGIGVWNPAFDVTPHELITGGIITERGVFS  345



>ref|XP_011563158.1| PREDICTED: methylthioribose-1-phosphate isomerase [Plutella xylostella]
 ref|XP_011563159.1| PREDICTED: methylthioribose-1-phosphate isomerase [Plutella xylostella]
Length=352

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 198/355 (56%), Positives = 249/355 (70%), Gaps = 20/355 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L++I YKRG L++LDQ  LPLQT Y+ IK  +DGW  I +M VRGAPAIAI   LSLA 
Sbjct  2     SLESIKYKRGHLEILDQLLLPLQTRYVTIKGVEDGWKVINKMQVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTAQDAVSFLSQ---KLEYLVSSRPTAVNLSDAATKL----NEVITKEAST  1085
                 +E  N  + D      +   KL YLVS+RPTAVN+  A   L    N +   E  T
Sbjct  61    ----VELLNDNSSDKKIMRQEIEGKLNYLVSARPTAVNIKLATDDLINLANTLSADENVT  116

Query  1084  ASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLAT  905
              ++ K   E +I + E ML  D+  NKAIG +G   +  QL G  ++ ILTHCNTGSLAT
Sbjct  117   PNDFK---ERFISSIEGMLTKDIEDNKAIGRYGCETILKQLDGDGQVRILTHCNTGSLAT  173

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR+++ +  LE  YCTETRP+NQG+RLTA+EL+ E +PATL+ DS  AALM
Sbjct  174   AGYGTALGVIRSLHESKRLEHVYCTETRPYNQGARLTAYELLHERVPATLVVDSMVAALM  233

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
                RV+AV+VGADR+A+NGDTANKIGTY +A+ A +H VPFYVAAPLTS+D+SL SG +I
Sbjct  234   ATRRVDAVVVGADRVASNGDTANKIGTYQIAILAKYHEVPFYVAAPLTSIDMSLVSGDRI  293

Query  544   VIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVISKD  383
              IE R  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITEKGV + +
Sbjct  294   KIEVRPEREMTH----IGEHRIAAPGINCWNPAFDVTPASLITGIITEKGVFAPN  344



>ref|XP_004530069.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Ceratitis capitata]
 ref|XP_004530070.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X2 [Ceratitis capitata]
 ref|XP_004530071.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X3 [Ceratitis capitata]
Length=356

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 199/350 (57%), Positives = 249/350 (71%), Gaps = 14/350 (4%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y  G L +LDQ  LP+Q+ Y+ +K  +DGW AI +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYVPGKLDILDQLLLPVQSKYVAVKGVEDGWKAINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E    E F+ + +     +  KL YLVS+RPTAVN+  AA +L    NE+   EA    E
Sbjct  62    ELLP-EDFD-SKKSLRQEIEGKLNYLVSARPTAVNMKIAADELIALANELTKDEAVNVLE  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              K   + ++ A E ML+ D+A NKAIG +GA  + N       I +LTHCNTGSLATAGY
Sbjct  120   MK---QRFLHATEAMLQKDIADNKAIGKNGAEAILNTCAKDTAIRVLTHCNTGSLATAGY  176

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R ++    LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AALM+A 
Sbjct  177   GTALGVVRKLHELKKLEHVYCTETRPYNQGARLTAYELVHDKLPATLVLDSMVAALMRAK  236

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              + AV+VGADR+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG  I+IE
Sbjct  237   NIAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLQIPSGDHIIIE  296

Query  535   ERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
             ER  +E+ H    +GE +IAA GI+ WNPAFDVTPA+LISGIITE+GV S
Sbjct  297   ERPDREMTH----VGEHRIAAPGINCWNPAFDVTPAALISGIITERGVFS  342



>ref|XP_001820594.2| methylthioribose-1-phosphate isomerase [Aspergillus oryzae RIB40]
Length=366

 Score =   331 bits (848),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 202/362 (56%), Positives = 251/362 (69%), Gaps = 11/362 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y  G L ++DQ +LP    Y+ I  +++GW AIKEM VRGAPAIAI AAL+LA 
Sbjct  2     TLQAIKYSGGKLAIIDQLQLPHVEKYVTIHTSEEGWHAIKEMRVRGAPAIAIVAALALAS  61

Query  1243  eaSNLETFNGTAQDAV---SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SE  1076
             E + L   N  + +A+   +F+++KL YLVSSRPTAVNLSDAA KL  ++ +      S 
Sbjct  62    ELTTLIARNQLSSNAIETQTFITEKLHYLVSSRPTAVNLSDAAGKLETIVAESVKMPEST  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSK--KISILTHCNTGSLATA  902
                +  A+I AAE ML  DV  N+ IG +GA  +    +     K ++LTHCNTGSLATA
Sbjct  122   GHAVATAFIQAAEAMLAKDVEDNRMIGEYGAKWISENALSKNFTKATVLTHCNTGSLATA  181

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk  722
             G+GTALGVIRA+++   L  AYCTETRP+NQGSRLTAFELV + IPATLI DS AAAL+ 
Sbjct  182   GFGTALGVIRALSSTDTLRHAYCTETRPYNQGSRLTAFELVHDRIPATLITDSMAAALLA  241

Query  721   AGR--VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
                  V+A++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL   SG +
Sbjct  242   RAEIGVDAIVVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPLTTIDLVTKSGNE  301

Query  547   IVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAF  368
             I IEER   E+          IAA GI+VWNPAFD+TP +LI GIITEKGV+ KD +  F
Sbjct  302   ITIEERPASEVTTMETVC---IAAEGINVWNPAFDITPGALIDGIITEKGVVEKDSDGLF  358

Query  367   DI  362
              +
Sbjct  359   HL  360



>gb|EIT82996.1| putative translation initiation factor [Aspergillus oryzae 3.042]
Length=381

 Score =   331 bits (849),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 205/374 (55%), Positives = 254/374 (68%), Gaps = 20/374 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y  G L ++DQ +LP    Y+ I  +++GW AIKEM VRGAPAIAI AAL+LA 
Sbjct  2     TLQAIKYSGGKLAIIDQLQLPHVEKYVTIHTSEEGWHAIKEMRVRGAPAIAIVAALALAS  61

Query  1243  eaSNLETFNGTAQDAV---SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SE  1076
             E + L   N  + +A+   +F+++KL YLVSSRPTAVNLSDAA KL  ++ +      S 
Sbjct  62    ELTTLIARNQLSSNAIETQTFITEKLHYLVSSRPTAVNLSDAAGKLETIVAESVKMPEST  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSK--KISILTHCNTGSLATA  902
                +  A+I AAE ML  DV  N+ IG +GA  +    +     K ++LTHCNTGSLATA
Sbjct  122   GHAVATAFIQAAEAMLAKDVEDNRMIGEYGAKWISENALSKNFTKATVLTHCNTGSLATA  181

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk  722
             G+GTALGVIRA+++   L  AYCTETRP+NQGSRLTAFELV + IPATLI DS AAAL+ 
Sbjct  182   GFGTALGVIRALSSTDTLRHAYCTETRPYNQGSRLTAFELVHDRIPATLITDSMAAALLA  241

Query  721   AGR--VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
                  V+A++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL   SG +
Sbjct  242   RAEIGVDAIVVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPLTTIDLVTKSGNE  301

Query  547   IVIEERSPKELLHTH-----GGLGEQ-------IAASGISVWNPAFDVTPASLISGIITE  404
             I IEER   E+         GG  E        IAA GI+VWNPAFD+TP +LI GIITE
Sbjct  302   ITIEERPASEVTTVRGTCEDGGASEAVKMETVCIAAKGINVWNPAFDITPGALIDGIITE  361

Query  403   KGVISKDGNDAFDI  362
             KGV+ KD +  F +
Sbjct  362   KGVVEKDSDGLFHL  375



>sp|Q2UIM3.1|MTNA_ASPOR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
oryzae RIB40]
 dbj|BAE58592.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=381

 Score =   331 bits (849),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 205/374 (55%), Positives = 254/374 (68%), Gaps = 20/374 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y  G L ++DQ +LP    Y+ I  +++GW AIKEM VRGAPAIAI AAL+LA 
Sbjct  2     TLQAIKYSGGKLAIIDQLQLPHVEKYVTIHTSEEGWHAIKEMRVRGAPAIAIVAALALAS  61

Query  1243  eaSNLETFNGTAQDAV---SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SE  1076
             E + L   N  + +A+   +F+++KL YLVSSRPTAVNLSDAA KL  ++ +      S 
Sbjct  62    ELTTLIARNQLSSNAIETQTFITEKLHYLVSSRPTAVNLSDAAGKLETIVAESVKMPEST  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSK--KISILTHCNTGSLATA  902
                +  A+I AAE ML  DV  N+ IG +GA  +    +     K ++LTHCNTGSLATA
Sbjct  122   GHAVATAFIQAAEAMLAKDVEDNRMIGEYGAKWISENALSKNFTKATVLTHCNTGSLATA  181

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk  722
             G+GTALGVIRA+++   L  AYCTETRP+NQGSRLTAFELV + IPATLI DS AAAL+ 
Sbjct  182   GFGTALGVIRALSSTDTLRHAYCTETRPYNQGSRLTAFELVHDRIPATLITDSMAAALLA  241

Query  721   AGR--VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
                  V+A++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL   SG +
Sbjct  242   RAEIGVDAIVVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPLTTIDLVTKSGNE  301

Query  547   IVIEERSPKELLHTH-----GGLGEQ-------IAASGISVWNPAFDVTPASLISGIITE  404
             I IEER   E+         GG  E        IAA GI+VWNPAFD+TP +LI GIITE
Sbjct  302   ITIEERPASEVTTVRGTCEDGGASEAVKMETVCIAAEGINVWNPAFDITPGALIDGIITE  361

Query  403   KGVISKDGNDAFDI  362
             KGV+ KD +  F +
Sbjct  362   KGVVEKDSDGLFHL  375



>gb|KFH66789.1| S-methyl-5-thioribose-1-phosphate isomerase [Mortierella verticillata 
NRRL 6337]
Length=387

 Score =   331 bits (849),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 199/380 (52%), Positives = 253/380 (67%), Gaps = 22/380 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y+RGSL ++DQ  LP +T+Y+ I     G DAIK M VRGAPAIAI AAL+LAV
Sbjct  5     TLQAIRYQRGSLDIIDQLLLPHETLYIPISTLALGHDAIKTMKVRGAPAIAIVAALTLAV  64

Query  1243  eaSNLETFN--GTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAK  1070
                +  T     +AQDAV+F+ + LE+L +SRPTAVNL DAA KL + + + A TA+  +
Sbjct  65    VLVDAATAPRLTSAQDAVAFIEESLEFLKTSRPTAVNLFDAAHKLAKGVREAAVTATSGQ  124

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
              I   Y+  +E MLE+DV  N  IG  GA  + +   G + + ++THCNTGSLATAGYGT
Sbjct  125   EIVNKYLELSERMLEEDVKDNMNIGHFGAEFILSAWKGDEDLRVITHCNTGSLATAGYGT  184

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaalmkAG  716
             ALG+IRA+     L  AYCTETRP+NQGSRLTA+ELV ENIP+T    + ++A     AG
Sbjct  185   ALGIIRALAGQKKLTHAYCTETRPYNQGSRLTAYELVYENIPSTLITDSMASALLAQNAG  244

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             ++ A++VGADR+AANGDTANKIGTY LA+ A +H VPF VAAP TSVDL++ SG++I IE
Sbjct  245   KIAAIVVGADRVAANGDTANKIGTYQLAITARYHNVPFIVAAPSTSVDLNIDSGKEIHIE  304

Query  535   ERSPKELLHTHGG----------------LGEQI--AASGISVWNPAFDVTPASLISGII  410
              R   E+    G                 + E I  AA GI VWNP+FDVTPA LIS I+
Sbjct  305   VRPAVEVTTLRGPVVAAPSTEFKKDAGTVVSETIAVAARGIGVWNPSFDVTPAELISAIV  364

Query  409   TEKGVISKDGNDAFDITGFV  350
             TEKGV+ K     FD+  F+
Sbjct  365   TEKGVVLKGDGQQFDMKTFL  384



>ref|XP_001418690.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 sp|A4S068.1|MTNA_OSTLU RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO96983.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=365

 Score =   330 bits (847),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 196/366 (54%), Positives = 261/366 (71%), Gaps = 8/366 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+AI Y RG+L+LLDQ  LPL+T Y+D+++    W  IK+M VRGAPAIAIAAAL+LAV
Sbjct  3     SLEAIRYARGNLELLDQLALPLETKYIDVRDCNACWRCIKDMNVRGAPAIAIAAALALAV  62

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E         T + A +F+ ++ +++ +SRPTAVNL +A  ++ + + K  S + +   +
Sbjct  63    ELEAKRGTLTTCEAAEAFVRERFDHMYTSRPTAVNLGEAKNRI-QALAKRLSESGDVSGM  121

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSK---KISILTHCNTGSLATAGYG  893
              E  I   E M  +DVAS +AIG  GA+ L  +  G+K    I ++T CNTGSLATAGYG
Sbjct  122   IEGVIEGCEAMHAEDVASCRAIGDKGAAALL-RACGAKDGENIKVMTCCNTGSLATAGYG  180

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA+  +G LERAYC ETRP+NQGSRLTA+ELV E IP TLI D+ AAALM  G 
Sbjct  181   TALGVIRALWESGRLERAYCLETRPYNQGSRLTAYELVYEKIPGTLICDNMAAALMARGD  240

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+A++VGADR+AANGD ANKIGTYSLAV A HHGVP + AAP+T++D   ++G  I IEE
Sbjct  241   VDAIVVGADRVAANGDFANKIGTYSLAVNAKHHGVPMFTAAPVTTLDPETATGADIHIEE  300

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGF  353
             R  +E+ H+   LG+++AA GI VWNP+FDVTPA+L++G+ITE GVI K+ +  F +  F
Sbjct  301   RPGEEVTHS---LGKRVAAEGIDVWNPSFDVTPAALLTGVITEHGVIEKNASGLFPVADF  357

Query  352   VHKVSG  335
             V +  G
Sbjct  358   VAQAKG  363



>gb|KGQ02006.1| methylthioribose-1-phosphate isomerase [Paracoccidioides sp. 
'lutzii' Pb01]
Length=382

 Score =   331 bits (848),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 203/375 (54%), Positives = 252/375 (67%), Gaps = 22/375 (6%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L AI Y  G L +L+Q  LP QT Y  I +A D W AI +M VRGAPAIAI AALSLA+E
Sbjct  3     LIAISYSHGKLSILNQLFLPHQTTYDPIYSACDAWHAIHDMRVRGAPAIAIVAALSLAIE  62

Query  1240  aSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNE-VITKEASTASEA  1073
               +L      +  A++   F+ +KLEYLVSSRPTAVNL++AA +L + V+ +        
Sbjct  63    LYDLIQKGKLSDQAKEVELFIREKLEYLVSSRPTAVNLAEAAGRLGKIVVARSCGEGVMG  122

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV----GSKKISILTHCNTGSLAT  905
             + + E YI AAE MLEDDV  N  IG  GA  +  + +    G  KI++LTHCNTGSLAT
Sbjct  123   REVAEEYIRAAEKMLEDDVKDNHGIGEFGAKWIMKKAIDGAEGKGKIAVLTHCNTGSLAT  182

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaa  731
             AGYGTALGVIR+++ A  L+ AYCTETRP+NQGSRLTA+ELV ++IPAT    + +AA  
Sbjct  183   AGYGTALGVIRSLHAANSLKHAYCTETRPYNQGSRLTAYELVHDSIPATLITDSMAAALL  242

Query  730   lmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQ  551
               K+  V A++VGADR+AANGDTANKIGTY LAV A HHGV F VAAP T++D++  SG+
Sbjct  243   AHKSAGVGAIVVGADRVAANGDTANKIGTYGLAVLAKHHGVKFLVAAPRTTIDMNTKSGE  302

Query  550   QIVIEERSPKELLHTHG--------GLGE----QIAASGISVWNPAFDVTPASLISGIIT  407
              I IEER  +E+    G        GLG      +AA GI VWNPAFDVTPASLI GIIT
Sbjct  303   GIAIEERPRQEVTRIRGPRVGGEQDGLGAIETITVAADGIDVWNPAFDVTPASLIDGIIT  362

Query  406   EKGVISKDGNDAFDI  362
             E GV+ KD +  F +
Sbjct  363   EVGVVEKDRDGVFHL  377



>dbj|GAE00299.1| translation initiation factor, putative [Byssochlamys spectabilis 
No. 5]
Length=379

 Score =   330 bits (847),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 255/372 (69%), Gaps = 18/372 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y    L +LDQ +LP    Y++I++A++GW AIKEM VRGAPAIAI AALSLAV
Sbjct  2     TLEAIKYDGTQLSILDQLQLPHVVEYIEIRSAEEGWHAIKEMKVRGAPAIAIVAALSLAV  61

Query  1243  eaSNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLN-EVITKEASTASE  1076
             E   L T    +  A++    + +KL YL +SRPTAVNLSDAA KL   V T    + S 
Sbjct  62    ELKALVTDGKLSANAEEVQLLIREKLHYLTTSRPTAVNLSDAARKLEAHVSTTARGSEST  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATA  902
               ++  A+I AA  ML DD+A N+ IG +GA  L     G+ K  I++LTHCNTGSLAT+
Sbjct  122   GDSVASAFIEAAARMLTDDLADNQNIGKYGADWLVQDTAGTGKQEINVLTHCNTGSLATS  181

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaal  728
             GYGTALGVIRA+++   L+RAYCTETRP+NQGSRLTAFELV +NIP+T    + +AA   
Sbjct  182   GYGTALGVIRALHSRKALKRAYCTETRPYNQGSRLTAFELVHDNIPSTLITDSMAAALLS  241

Query  727   mkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
              K  +V+A++VGADR+AANGDTANK+GTY LAV A HH V F VAAP T++DL   SGQ 
Sbjct  242   NKERKVSAIVVGADRVAANGDTANKVGTYGLAVLAKHHAVKFLVAAPRTTIDLQTKSGQD  301

Query  547   IVIEERSPKELLHTHG---GLGE-------QIAASGISVWNPAFDVTPASLISGIITEKG  398
             I+IEER   E+    G   G  E       ++AA GI VWNPAFDVTP++LI GIITE G
Sbjct  302   IIIEERPAAEVTRIKGAREGCEENDSIATVRVAAPGIDVWNPAFDVTPSALIDGIITEVG  361

Query  397   VISKDGNDAFDI  362
             V+ +  + +F+ 
Sbjct  362   VVERSVDGSFNF  373



>ref|XP_752241.1| translation initiation factor [Aspergillus fumigatus Af293]
 sp|Q4WNI1.1|MTNA_ASPFU RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
fumigatus Af293]
 sp|B0Y5C3.1|MTNA_ASPFC RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
fumigatus A1163]
 gb|EAL90203.1| translation initiation factor, putative [Aspergillus fumigatus 
Af293]
 gb|EDP49958.1| translation initiation factor, putative [Aspergillus fumigatus 
A1163]
Length=387

 Score =   330 bits (847),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 197/373 (53%), Positives = 250/373 (67%), Gaps = 20/373 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y  G L ++DQ +LP    ++ I+ ++D W AIKEM VRGAPAIAI AAL+LA E
Sbjct  5     LQAIRYSHGKLAIIDQLQLPYVEKFITIRTSEDAWHAIKEMRVRGAPAIAIVAALALASE  64

Query  1240  aSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEA  1073
              + L   +  +  A++   F+ +KL+YLVSSRPTAVNLSDAA KL   I+  A T  +  
Sbjct  65    LNTLIIHDKLSSRAEEVKLFIREKLDYLVSSRPTAVNLSDAARKLESTISGHADTPGATG  124

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAG  899
             +T+ EA+I AAE M+  D+  N  IG +GA  +    +   K   ++LTHCNTGSLAT+G
Sbjct  125   RTVAEAFIRAAEEMMTKDLDDNMKIGQNGAEWIIKHALARHKSTATVLTHCNTGSLATSG  184

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaalm  725
             YGTALGVIR++ +   LE AYCTETRP+NQGSRLTAFELV + +PAT    +  AA    
Sbjct  185   YGTALGVIRSLASKKALEHAYCTETRPYNQGSRLTAFELVHDRLPATLITDSMVAALLAS  244

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
                 V+A++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL   SG+ I
Sbjct  245   TKAEVDAIVVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPLTTIDLGTKSGEDI  304

Query  544   VIEERSPKELLHTHGGL-GE-----------QIAASGISVWNPAFDVTPASLISGIITEK  401
             VIEER   E+    G + G+            IAA GI VWNPAFDVTP++LI GIITE 
Sbjct  305   VIEERPSAEVTKIRGPVDGDHPADIVKLETVHIAAKGIDVWNPAFDVTPSTLIDGIITEV  364

Query  400   GVISKDGNDAFDI  362
             GVI K+ +  F +
Sbjct  365   GVIEKEADGQFHL  377



>gb|KEY83965.1| translation initiation factor [Aspergillus fumigatus var. RP-2014]
Length=387

 Score =   330 bits (846),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 197/373 (53%), Positives = 251/373 (67%), Gaps = 20/373 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y  G+L ++DQ +LP    ++ I+ ++D W AIKEM VRGAPAIAI AAL+LA E
Sbjct  5     LQAIRYSHGNLAIIDQLQLPYVEKFITIRTSEDAWHAIKEMRVRGAPAIAIVAALALASE  64

Query  1240  aSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEA  1073
              + L   +  +  A++   F+ +KL+YLVSSRPTAVNLSDAA KL   I+  A T  +  
Sbjct  65    LNTLIIHDKLSSRAEEVKLFIREKLDYLVSSRPTAVNLSDAARKLESTISGHADTPGATG  124

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAG  899
             +T+ EA+I AAE M+  D+  N  IG +GA  +    +   K   ++LTHCNTGSLAT+G
Sbjct  125   RTVAEAFIRAAEEMMTKDLDDNMKIGQNGAEWIIKHALARHKSTATVLTHCNTGSLATSG  184

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaalm  725
             YGTALGVIR++ +   LE AYCTETRP+NQGSRLTAFELV + +PAT    +  AA    
Sbjct  185   YGTALGVIRSLASKKALEHAYCTETRPYNQGSRLTAFELVHDRLPATLITDSMVAALLAS  244

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
                 V+A++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL   SG+ I
Sbjct  245   TKAEVDAIVVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPLTTIDLGTKSGEDI  304

Query  544   VIEERSPKELLHTHGGL-GE-----------QIAASGISVWNPAFDVTPASLISGIITEK  401
             VIEER   E+    G + G+            IAA GI VWNPAFDVTP++LI GIITE 
Sbjct  305   VIEERPSAEVTKIRGPVDGDHPADIVKLETVHIAAKGIDVWNPAFDVTPSTLIDGIITEV  364

Query  400   GVISKDGNDAFDI  362
             GVI K+ +  F +
Sbjct  365   GVIEKEADGQFHL  377



>emb|CEP08072.1| hypothetical protein [Parasitella parasitica]
Length=377

 Score =   330 bits (845),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 197/371 (53%), Positives = 244/371 (66%), Gaps = 13/371 (4%)
 Frame = -2

Query  1426  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGa---paiaiaaal  1256
             KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGA     +A  +  
Sbjct  7     KTLEAIKYTRGDLRILNQLVLPHETIFETVLNVQNGHAAIKTMKTRGAPAIAIVAALSLA  66

Query  1255  slaveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  1076
               A        FN T  +AV FL + L+YL +SRPTAVNL DAA KL  +I   A TA E
Sbjct  67    VDAHTRFQQGQFN-TVDEAVKFLLESLDYLKTSRPTAVNLFDAAAKLEYLIKSTAETAQE  125

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
                +  AYI AAE ML DDV  NK IG +GA  +         IS+LTHCNTGSLATAG+
Sbjct  126   PANVIIAYIEAAEQMLIDDVKDNKNIGKYGADYITKNAKNPDAISVLTHCNTGSLATAGW  185

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALG+IR ++    LE AYCTETRP+NQGSRLTA+ELV E IPATL+ D+ A+AL+K  
Sbjct  186   GTALGIIRDLHENKKLEHAYCTETRPYNQGSRLTAYELVYEQIPATLVCDNMASALLKQN  245

Query  715   -RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
               V A++VGADR+AANGDTANKIGTY LA+ A +HGV F VAAP TS+DL    G  I I
Sbjct  246   PNVQAIVVGADRVAANGDTANKIGTYQLAITAKYHGVLFIVAAPSTSIDLKTKGGNDIPI  305

Query  538   EERSPKELLHTHG-------GLGEQIAASGISVWNPAFDVTPASLISGIITEKG-VISKD  383
             E+R  +EL+   G           + AA+ I VWNP+FDVTPASLIS I+TEKG V+ K+
Sbjct  306   EQRPAEELVTVAGVRVNDNEPTAIRTAAAEIDVWNPSFDVTPASLISAIVTEKGVVVKKE  365

Query  382   GNDAFDITGFV  350
             G D FD+  F+
Sbjct  366   GEDVFDMAAFL  376



>ref|XP_011184740.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184741.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184742.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184743.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184744.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
Length=356

 Score =   329 bits (843),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 251/350 (72%), Gaps = 14/350 (4%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y  G L +LDQ  LP+Q+ Y+ +K  +DGW AI +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYAPGKLDILDQLLLPVQSKYVAVKGVEDGWKAINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E    E F+ + +     +  KL YLVS+RPTAVN+  AA +L    NE+   EA    E
Sbjct  62    EILP-EEFD-SKKSLRQEIEGKLNYLVSARPTAVNMKIAADELIALANELTKDEAIDVQE  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              K   + ++ A E ML+ D+A NKAIG++GA+ + +       + +LTHCNTGSLATAGY
Sbjct  120   MK---QRFLAATEAMLQKDIADNKAIGTNGAAAILDISGKDSSVRVLTHCNTGSLATAGY  176

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R ++    LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AALM+A 
Sbjct  177   GTALGVVRKLHDLKKLEHVYCTETRPYNQGARLTAYELVHDKLPATLVLDSMVAALMRAK  236

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              + AV+VGADR+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG  I+IE
Sbjct  237   NIAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLQIPSGDHIIIE  296

Query  535   ERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
             ER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLISGIITE+GV S
Sbjct  297   ERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLISGIITERGVFS  342



>gb|KJJ15719.1| Initiation factor 2B alphabetadelta [Penicillium solitum]
Length=381

 Score =   330 bits (846),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 185/374 (49%), Positives = 255/374 (68%), Gaps = 18/374 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGa---paiaiaaalsl  1250
             LQAI + +G+L++LDQ +LP    Y+ I+  +DGW AI++M VRGA     +A+ A  S 
Sbjct  2     LQAIKFSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIRDMKVRGAPAIAIVAMLALASE  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVIT-KEASTASEA  1073
                A + +  + ++++   ++++KL YLV+SRPTAVNL+DAA KL  V+  +  ++ S  
Sbjct  62    LTSAVDGDKLSQSSEEVCQYITEKLAYLVTSRPTAVNLADAARKLETVVVNRTKASGSTG  121

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             + +  A+I AAE M+  D+  NK IG +GA  +        ++++LTHCNTGSLAT+GYG
Sbjct  122   QEVAAAFIQAAEDMMGKDLEDNKRIGHNGAEWIATHAARGSEVAVLTHCNTGSLATSGYG  181

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGV+R++ +   L  AYCTETRP+NQGSRLTAFELV + IPATLI DS AAAL+   +
Sbjct  182   TALGVVRSLASKNILRHAYCTETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLADAQ  241

Query  712   --VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
               VNA++VGADR+AANGDTANKIGTY+LAV A +HGV F VAAPLT++D++  SG+ IVI
Sbjct  242   VGVNAIVVGADRVAANGDTANKIGTYALAVLAKYHGVKFLVAAPLTTIDMATKSGKDIVI  301

Query  538   EERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKGV  395
             E+R+  E+    G                +IAA GI+VWNPAFD+TPASLI GIITE GV
Sbjct  302   EQRAASEVTSIKGPRAGSEATDQIAIETVKIAAPGINVWNPAFDITPASLIDGIITEIGV  361

Query  394   ISKDGNDAFDITGF  353
             + K  +  + + G 
Sbjct  362   VEKGSDGQYHLGGL  375



>gb|EFX71518.1| hypothetical protein DAPPUDRAFT_308831 [Daphnia pulex]
Length=352

 Score =   329 bits (843),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 199/352 (57%), Positives = 248/352 (70%), Gaps = 12/352 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y  GSL++LDQ  LP    Y+ I N +D W AI+EM VRGAPAIAI  +LSLAV
Sbjct  3     TLQAIKYNDGSLEILDQLLLPESCTYISINNVQDAWSAIREMKVRGAPAIAIVGSLSLAV  62

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNL---SDAATKL-NEVITKEASTASE  1076
             E   L     T +D  S + +KL+YLV+SRPTAVN+   ++A  KL N ++ K +  A+E
Sbjct  63    ELRKLAAPE-TKKDLHSLVKEKLDYLVTSRPTAVNMQLAAEACVKLSNNLVDKASVDAAE  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
             AK +   ++   E ML +D+A N AIG HGA  +  +     K+ +LTHCNTGSLATAGY
Sbjct  122   AKDVLVKHL---EAMLANDIADNLAIGEHGARDIAKKCGNKDKLRVLTHCNTGSLATAGY  178

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIR+++ A  +++ YCTETRP+NQGSRLTAFELV E IPATLI D  AAA MK  
Sbjct  179   GTALGVIRSLHKANLVDQVYCTETRPYNQGSRLTAFELVYEKIPATLICDDMAAAAMKEF  238

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             +++AVIVGADR+AANGDTANKIGTY LAV A  H + FYVAAP +S+D  + +GQ I IE
Sbjct  239   KIDAVIVGADRVAANGDTANKIGTYQLAVLAKSHNILFYVAAPFSSIDFQIPTGQSIPIE  298

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
             ER   E+ HT G +  + AA+GI  WNP FDVTPA LI+ GI+TEKGV   D
Sbjct  299   ERPHSEMTHT-GSI--RTAAAGIHCWNPGFDVTPAELITGGIVTEKGVFKSD  347



>gb|EPB91090.1| S-methyl-5-thioribose-1-phosphate isomerase [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=388

 Score =   330 bits (846),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 208/371 (56%), Positives = 253/371 (68%), Gaps = 13/371 (4%)
 Frame = -2

Query  1426  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  1247
             KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGAPAIAI AALSLA
Sbjct  18    KTLEAIKYTRGDLRILNQLVLPHETIFETVLNVQNGHAAIKTMKTRGAPAIAIVAALSLA  77

Query  1246  veaSNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  1076
             V+  N     G   T   AV FL + LEYL +SRPTAVNL DAA KL  +I   A TA E
Sbjct  78    VDV-NARFEQGEFETVDQAVKFLLESLEYLKTSRPTAVNLFDAAAKLEHLINTTAKTAQE  136

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
               T+  AYI AAE ML DDV  NK IG  GA  +         IS+LTHCNTGSLATAG+
Sbjct  137   PVTVVTAYIEAAEQMLIDDVKDNKNIGKFGADYIIENAKNPNSISVLTHCNTGSLATAGW  196

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALG+IR ++    LE AYCTETRP+NQGSRLTA+ELV E IPATLI D+ A+AL+K  
Sbjct  197   GTALGIIRDLHKNNKLEHAYCTETRPYNQGSRLTAYELVYEQIPATLICDNMASALLKQN  256

Query  715   -RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
               V A++VGADR+AANGDTANKIGTY LA+ A HHG+ F VAAP TS+DL   SG  I I
Sbjct  257   PNVQAIVVGADRVAANGDTANKIGTYQLAITAKHHGILFIVAAPSTSIDLKTKSGDDIPI  316

Query  538   EERSPKELLHTHG-------GLGEQIAASGISVWNPAFDVTPASLISGIITEKG-VISKD  383
             E+R  +EL+   G           + AA+ I VWNP+FDVTPA+LIS I+TE+G V+ K+
Sbjct  317   EQRPAEELVTVAGVRVNDNEPTTIRTAAAEIGVWNPSFDVTPANLISAIVTEQGVVVKKE  376

Query  382   GNDAFDITGFV  350
             G + FD+  F+
Sbjct  377   GEEVFDMAAFL  387



>ref|XP_003726311.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase-like [Strongylocentrotus purpuratus]
Length=376

 Score =   329 bits (844),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 196/350 (56%), Positives = 255/350 (73%), Gaps = 12/350 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI YKRGSL++L+Q+ LPL+++Y ++K+A DG+ AIK+M VRGAPAIAI  +L +AV
Sbjct  23    TLKAIRYKRGSLEILNQKLLPLESVYEELKSADDGFYAIKDMKVRGAPAIAIVGSLCVAV  82

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAA---TKLNEVITKEASTASEA  1073
             E +++ TF   + D V+F+S++  +L ++RPTAVN+S+A    T L E +  +    +E 
Sbjct  83    ELTHM-TFENKS-DLVAFISKQFRHLNTARPTAVNMSEAVKRLTSLAEELGNDPDLTTE-  139

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
              ++ +  I  AE M+E DV +NK+IG HGA+       G +   ++THCNTGSLATAGYG
Sbjct  140   -SMKDRIIEEAENMMEMDVRTNKSIGMHGANHXMISSGGGQ--VVMTHCNTGSLATAGYG  196

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA++  G LE  YCTETRP+NQG+RLTA+ELV E IPA+LI DS A+  M    
Sbjct  197   TALGVIRALHEKGNLEHVYCTETRPYNQGARLTAYELVYECIPASLITDSMASFCMLKKG  256

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V AV+VGADR+ ANGDTANKIGTY LA+ A HH +PFYVAAP+TS DLSL+SG +IVIEE
Sbjct  257   VTAVVVGADRVVANGDTANKIGTYQLALAARHHNIPFYVAAPVTSCDLSLTSGDEIVIEE  316

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKD  383
             R   EL   +   G QIAA GI  WNPAFDVTPA LI+GI+TE GV   +
Sbjct  317   RDQSELTKIN---GMQIAAPGIRGWNPAFDVTPADLITGIVTEHGVFKPN  363



>emb|CEG65982.1| Putative S-methyl-5-thioribose-1-phosphate isomerase [Rhizopus 
microsporus]
Length=376

 Score =   329 bits (844),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 206/376 (55%), Positives = 257/376 (68%), Gaps = 13/376 (3%)
 Frame = -2

Query  1435  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  1256
             S  KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGAPAIAI AAL
Sbjct  2     SSTKTLEAIQYTRGDLRILNQLVLPHETIFETVLNIQNGHSAIKTMKTRGAPAIAIVAAL  61

Query  1255  slaveaSNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST  1085
             SLAV+  N     G   T    V F+ + LEYL +SRPTAVNL DAA KL  V+ + A  
Sbjct  62    SLAVDI-NTRFEKGEFTTVDQVVQFVQESLEYLKTSRPTAVNLFDAAAKLLTVVQESAKE  120

Query  1084  ASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLAT  905
             A E   +  AYI AAE ML DDV  NK IG  GA  + + +     I +LTHCNTGSLAT
Sbjct  121   AKEPADVVYAYIEAAEKMLVDDVQDNKNIGKFGADYITSNVKDKDNICVLTHCNTGSLAT  180

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AG+GTALG+IR ++ +G L+ AYCTETRP+NQGSRLTA+ELV ENIPATLI D+ A+AL+
Sbjct  181   AGWGTALGIIRDLHASGNLKHAYCTETRPYNQGSRLTAYELVYENIPATLICDNMASALL  240

Query  724   kAG-RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
             K   +V A++VGADR+AANGDTANKIGTY LA+ A +H + F VAAP TS+DL+  SG  
Sbjct  241   KQNPQVQAIVVGADRVAANGDTANKIGTYQLAITAKYHDILFIVAAPSTSIDLNTKSGAD  300

Query  547   IVIEERSPKELLHTHGGLGE-------QIAASGISVWNPAFDVTPASLISGIITEKG-VI  392
             IVIE+R  +EL+   G   +       + AA  I VWNP+FDVTP+ LIS I+TEKG V+
Sbjct  301   IVIEQRPAEELVTVSGVRVQDNEPTSIRTAAEHIGVWNPSFDVTPSELISAIVTEKGVVV  360

Query  391   SKDGNDAFDITGFVHK  344
              KDG   FD+  F+ K
Sbjct  361   KKDGETQFDMAAFLSK  376



>gb|EKV08512.1| Methylthioribose-1-phosphate isomerase [Penicillium digitatum 
Pd1]
 gb|EKV10165.1| Methylthioribose-1-phosphate isomerase [Penicillium digitatum 
PHI26]
Length=382

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 189/375 (50%), Positives = 255/375 (68%), Gaps = 19/375 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGa---paiaiaaalsl  1250
             LQAI + +G+L++LDQ +LP    Y+ I+  +DGW AIK+M VRGA     +A+ A  S 
Sbjct  2     LQAIKFSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVRGAPAIAIVAMLALASE  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI-TKEASTASEA  1073
                A +    + + ++   ++++KL YLV+SRPTAVNL+DAA KL  V+ T+  ++ S  
Sbjct  62    LTSAVDSGKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAARKLEAVVVTRTKASGSTG  121

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV-GSKKISILTHCNTGSLATAGY  896
             + +  A+I AAE M+  D+  NK IG +GA  +      G+ ++++LTHCNTGSLAT+GY
Sbjct  122   QEVAAAFIQAAEDMMGKDLEDNKRIGHNGAEWIATHAARGNSEVAVLTHCNTGSLATSGY  181

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R++ +   L  AYCTETRP+NQGSRLTAFELV + IPATLI DS AAAL+   
Sbjct  182   GTALGVVRSLASKKILRHAYCTETRPYNQGSRLTAFELVHDKIPATLITDSMAAALLADP  241

Query  715   R--VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  VNA++VGADR+AANGDTANKIGTY+LAV A +HGV F VAAPLT++D++  SG  IV
Sbjct  242   QVGVNAIVVGADRVAANGDTANKIGTYALAVLAKYHGVKFLVAAPLTTIDMATKSGNDIV  301

Query  541   IEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IE+R+  E+    G                +IAA GI+VWNPAFDVTPASLI GIITE G
Sbjct  302   IEQRAASEVTSIKGPRAGSETTDQIAIETVKIAAPGINVWNPAFDVTPASLIDGIITENG  361

Query  397   VISKDGNDAFDITGF  353
             V+ K  +  + + G 
Sbjct  362   VVEKGSDGQYHLGGL  376



>ref|XP_011210381.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
dorsalis]
 ref|XP_011210382.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
dorsalis]
Length=356

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 197/350 (56%), Positives = 251/350 (72%), Gaps = 14/350 (4%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y  G L +LDQ  LP+Q+ Y+ +K  +DGW AI +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYAPGKLDILDQLLLPVQSKYVAVKGVEDGWKAINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E    E F+ + +     +  KL YLVS+RPTAVN+  AA +L    NE+   EA    E
Sbjct  62    EILP-EQFD-SKKSLRQEIEGKLNYLVSARPTAVNMKIAADELIALANELTKDEAIDVQE  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              K   + ++ A E ML+ D+A NKAIG++GA+ + +       + +LTHCNTGSLATAGY
Sbjct  120   MK---QRFLAATEAMLQKDIADNKAIGTNGAAAILDISGKDSSVRVLTHCNTGSLATAGY  176

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R ++    LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AALM+A 
Sbjct  177   GTALGVVRKLHELKKLEHVYCTETRPYNQGARLTAYELVHDKLPATLVLDSMVAALMRAK  236

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              + AV+VGADR+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG  I+IE
Sbjct  237   NIAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLQIPSGDHIIIE  296

Query  535   ERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
             ER  +E+ H    +GE +IAA GI+ WNPAFDVTPA+LISGIITE+GV S
Sbjct  297   ERPDREMTH----VGEHRIAAPGINCWNPAFDVTPAALISGIITERGVFS  342



>emb|CDM34949.1| Methylthioribose-1-phosphate isomerase [Penicillium roqueforti 
FM164]
Length=382

 Score =   329 bits (843),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 192/375 (51%), Positives = 252/375 (67%), Gaps = 19/375 (5%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGa---paiaiaaalsl  1250
             LQAI Y +G+L++LDQ +LP    Y+ I+  +DGW AIK+M VRGA     +A+ A  S 
Sbjct  2     LQAIKYSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVRGAPAIAIVAMLALASE  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVIT-KEASTASEA  1073
                A + +  + + ++   ++++KL YLV+SRPTAVNL+DAA KL  V+  +  +  S  
Sbjct  62    LTSAVDSDKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAARKLEAVVVNRTKAPGSTG  121

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV-GSKKISILTHCNTGSLATAGY  896
             +    A+I AAE M+  D+  NK IG +GA  +  +   G+  I++LTHCNTGSLAT+GY
Sbjct  122   REAGAAFIQAAEDMMGKDLEDNKKIGHNGAEWIAVRASRGNSMITVLTHCNTGSLATSGY  181

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R++     L  AYCTETRP+NQGSRLTAFELV + IPATLI DS AAAL+   
Sbjct  182   GTALGVVRSLAEKSLLTHAYCTETRPYNQGSRLTAFELVHDEIPATLITDSMAAALLADT  241

Query  715   --RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
               RVNA++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++D++  SG+ IV
Sbjct  242   KVRVNAIVVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPLTTIDMATKSGRDIV  301

Query  541   IEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKG  398
             IE+R+  E+    G                +IAA GI+VWNPAFD+TPASLI GIITE G
Sbjct  302   IEQRAASEVTSIKGPRAGSEATDQIVIETVKIAAPGINVWNPAFDITPASLIDGIITEVG  361

Query  397   VISKDGNDAFDITGF  353
             V  K G+  F + G 
Sbjct  362   VAEKLGDGKFHLAGL  376



>ref|XP_001357949.1| GA10928 [Drosophila pseudoobscura pseudoobscura]
 sp|Q29BB3.1|MTNA_DROPS RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
pseudoobscura pseudoobscura]
 gb|EAL27085.1| GA10928 [Drosophila pseudoobscura pseudoobscura]
Length=362

 Score =   327 bits (838),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 199/355 (56%), Positives = 256/355 (72%), Gaps = 20/355 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y RGSL++LDQ  LP+Q+ YL ++  +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYTRGSLEILDQLLLPVQSKYLPVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEV---ITKEASTASEA  1073
             E  + E F+ + +     L  KL YLVS+RPTAVN+  AA +L  +   +TK+ +   + 
Sbjct  62    EI-HPEEFD-SKKSLRQELEGKLNYLVSARPTAVNMKMAADELLSLANDLTKDDNV--DV  117

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK-------ISILTHCNTGS  914
               + + ++ A E ML+ D+A N+AIG+HGA  +  QLV +         + +LTHCNTGS
Sbjct  118   AAMKQRFLNATEAMLKKDIADNRAIGAHGAKAIL-QLVAAAAGAPMAGPVRVLTHCNTGS  176

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGV+R ++  G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS  A
Sbjct  177   LATAGYGTALGVVRQLSELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSMVA  236

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             AL++A  V AV+VGADR+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG
Sbjct  237   ALLRAKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLHIPSG  296

Query  553   QQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
               I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE+GV 
Sbjct  297   DHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITERGVF  347



>ref|XP_002072272.1| GK22419 [Drosophila willistoni]
 sp|B4NG41.1|MTNA_DROWI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
willistoni]
 gb|EDW83258.1| GK22419 [Drosophila willistoni]
Length=365

 Score =   327 bits (838),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 252/360 (70%), Gaps = 27/360 (8%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaia--aalsl  1250
             +LQ+I Y RGSL++LDQ  LP+Q+ Y+ ++  +DGW  I +M VRGAPAIAI    +L++
Sbjct  2     SLQSIKYNRGSLEILDQLLLPVQSKYVAVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTA  1082
              +     E+     Q+    +  KL YLVS+RPTAVN+  AA +L    N++   E  + 
Sbjct  62    EIYPEEFESKKSLRQE----IEGKLNYLVSARPTAVNMKIAADELLSLANDLTKAEDVSV  117

Query  1081  SEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV---------GSKKISILTH  929
              + K   + ++ A E ML+ D+A N+AIG++GA  +  ++          G+  + +LTH
Sbjct  118   PDMK---QRFLNATEAMLQKDIADNRAIGANGAQAILKRVATTLGAAGTSGNGSVRVLTH  174

Query  928   CNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatlia  749
             CNTGSLATAGYGTALGVIR ++  G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ 
Sbjct  175   CNTGSLATAGYGTALGVIRNLHELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVL  234

Query  748   dsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDL  569
             DS  AAL++A  V AV+VGADR+AANGDTANKIGTY +AV A HHGVPFYVAAPLTS+DL
Sbjct  235   DSMVAALLRAKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFYVAAPLTSIDL  294

Query  568   SLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
              + SG  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE+GV 
Sbjct  295   QIPSGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITERGVF  350



>ref|NP_001037650.1| methylthioribose-1-phosphate isomerase [Bombyx mori]
 sp|Q0ZB81.1|MTNA_BOMMO RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Bombyx 
mori]
 gb|ABG54283.1| eIF2B-alpha-like protein [Bombyx mori]
Length=364

 Score =   327 bits (838),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 192/350 (55%), Positives = 250/350 (71%), Gaps = 10/350 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L++I Y RGSL++LDQ  LPLQT Y+ ++  +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     SLESIKYTRGSLEILDQLLLPLQTRYIKVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAV-SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT  1067
                 L   N +++  +   +  KL YLVS+RPTAVN+  AA +L  +     +  S +  
Sbjct  62    ---ELSPDNESSKKNMRQEIEGKLNYLVSARPTAVNIKLAADELINLANTLCADDSISAE  118

Query  1066  IF-EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             IF E +I + E ML  D+  NKAIGS G   +   + G   + +LTHCNTGSLATAGYGT
Sbjct  119   IFKERFIGSIEDMLTKDIHDNKAIGSLGCEAILKNIDGDSPVRVLTHCNTGSLATAGYGT  178

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIR+++    LE  +CTETRP+NQG+RLTA+ELV E IP+TL+ DS  +ALM   ++
Sbjct  179   ALGVIRSLHATKRLEHVFCTETRPYNQGARLTAYELVHEKIPSTLMVDSMVSALMHTRKI  238

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AVIVGADR+AANGDTANK+GTY +A+ A +H VPFYVAAPLTS+D+SL  G++I IEER
Sbjct  239   HAVIVGADRVAANGDTANKMGTYQIAIVAKYHDVPFYVAAPLTSIDMSLPYGEKIKIEER  298

Query  529   SPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVISKD  383
               +E+ H    +GE +IAA GI+ WNP+FDVTPASLI+GIITEKGV + D
Sbjct  299   PDREMTH----IGEHRIAAPGINCWNPSFDVTPASLIAGIITEKGVFAPD  344



>ref|XP_001271470.1| translation initiation factor, putative [Aspergillus clavatus 
NRRL 1]
 sp|A1CGN9.1|MTNA_ASPCL RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
clavatus NRRL 1]
 gb|EAW10044.1| translation initiation factor, putative [Aspergillus clavatus 
NRRL 1]
Length=385

 Score =   327 bits (839),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 251/375 (67%), Gaps = 22/375 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y  G L ++DQ +LP    Y+++  +KD W AIK+M VRGAPAIAI AAL+LA 
Sbjct  2     TLEAIRYSTGKLVIIDQLQLPYVEKYIEVPTSKDAWHAIKKMRVRGAPAIAIVAALALAS  61

Query  1243  eaSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SE  1076
             E   L   +  +  A++   F+ +KL+YLVSSRPTAVNLSDAA KL   ++  A    S 
Sbjct  62    ELHTLMAHDKLSNRAEEVRLFIQEKLDYLVSSRPTAVNLSDAARKLAAHVSDHAEMPNST  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSK-KISILTHCNTGSLATA  902
              + + EA+I AAE ML  D+  N  IG +GA  +++N L G + K +ILTHCNTGSLAT+
Sbjct  122   GRAVAEAFIQAAEEMLAKDLKDNTNIGKYGAEWIIRNALAGGRSKATILTHCNTGSLATS  181

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaal  728
             GYGTALGVIRA+ +   L  AYCTETRP+NQGSRLTA+ELV EN+PAT    +  AA   
Sbjct  182   GYGTALGVIRALASKNALAYAYCTETRPYNQGSRLTAYELVHENLPATLVTDSMVAALLA  241

Query  727   mkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
                  V+A++VGADR+AANGDTANKIGTY+LAV A  HGV F VAAPLT++D S  SG  
Sbjct  242   KAEAAVDAIVVGADRVAANGDTANKIGTYALAVLAKFHGVKFLVAAPLTTIDRSTKSGAD  301

Query  547   IVIEERSPKELLHTHGGLGEQ------------IAASGISVWNPAFDVTPASLISGIITE  404
             IVIEER   E+    G +  +            IAA GI VWNPAFDVTP++LI  IITE
Sbjct  302   IVIEERPASEVTTIKGAVETESSCDRIKLETVRIAAEGIHVWNPAFDVTPSALIDAIITE  361

Query  403   KGVISK--DGNDAFD  365
             +GV+ +  DG   FD
Sbjct  362   RGVVERGTDGRYNFD  376



>ref|XP_006023465.1| PREDICTED: methylthioribose-1-phosphate isomerase [Alligator 
sinensis]
Length=387

 Score =   327 bits (839),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 251/351 (72%), Gaps = 15/351 (4%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+A+ Y+RGSLQ+LDQ +LP ++ Y  I+  +DG  AI++M VRGAPAIA+   LSLA  
Sbjct  3     LEALRYRRGSLQILDQLQLPQRSCYQAIRGVRDGQAAIRDMRVRGAPAIALVGCLSLA--  60

Query  1240  aSNLETFNGTA--QDAVS---FLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-AS  1079
                +E   GTA  QDA +   F+ + L+ L S+RPTA N++ AA KL   +T EA    +
Sbjct  61    ---VELHGGTAGGQDAATVATFVGKALQDLASTRPTARNMAQAAEKLGAAVTHEAQCPGA  117

Query  1078  EAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAG  899
              A ++ E  I  AE MLE D+  N+ IG  GA+ +   +    ++++LTHCNTG+LATAG
Sbjct  118   TANSVREIVIQLAEEMLEKDLQDNRRIGELGATCMMRGVAPQGQVTVLTHCNTGALATAG  177

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA  719
             YGTALGVIRA++  G LE  YCTETRP+NQG+RLTA+ELV E IPATLIADSAAA  +K 
Sbjct  178   YGTALGVIRALHARGCLEHVYCTETRPYNQGARLTAYELVYEGIPATLIADSAAALALKE  237

Query  718   GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
               ++A++VGADR+ ANGDTANK+GTY LA+ AMHHGVPFYVAAP TS DLSL++G QI+I
Sbjct  238   KGISAIVVGADRVVANGDTANKVGTYQLAIAAMHHGVPFYVAAPSTSCDLSLATGDQIII  297

Query  538   EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVIS  389
             EER  +EL   +   G +IAA  I VWNPAFDVTP  LI+ GIITE GV +
Sbjct  298   EERPSQELTDIN---GIRIAAPDIGVWNPAFDVTPHDLITGGIITELGVFA  345



>ref|XP_002023756.1| GL27236 [Drosophila persimilis]
 sp|B4GYU1.1|MTNA_DROPE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
persimilis]
 gb|EDW27959.1| GL27236 [Drosophila persimilis]
Length=362

 Score =   327 bits (837),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 199/355 (56%), Positives = 256/355 (72%), Gaps = 20/355 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y RGSL++LDQ  LP+Q+ YL ++  +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYTRGSLEILDQLLLPVQSKYLPVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEV---ITKEASTASEA  1073
             E  + E F+ + +     L  KL YLVS+RPTAVN+  AA +L  +   +TK+ +   + 
Sbjct  62    EI-HPEEFD-SKKSLRQELEGKLNYLVSARPTAVNMKMAADELLSLANDLTKDDNV--DV  117

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK-------ISILTHCNTGS  914
               + + ++ A E ML+ D+A N+AIG+HGA  +  QLV +         + +LTHCNTGS
Sbjct  118   AAMKQRFLNATEAMLKKDIADNRAIGAHGAKAIL-QLVAAAAGAPMAGPVRVLTHCNTGS  176

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGV+R ++  G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS  A
Sbjct  177   LATAGYGTALGVVRQLSELGKLEHIYCTETRPYNQGARLTAYELVHEKFPATLVLDSMVA  236

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             AL++A  V AV+VGADR+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG
Sbjct  237   ALLRAKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLHIPSG  296

Query  553   QQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
               I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE+GV 
Sbjct  297   DHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITERGVF  347



>ref|XP_006003718.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Latimeria chalumnae]
Length=357

 Score =   326 bits (836),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 250/347 (72%), Gaps = 7/347 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+AI Y +GSLQ+L+Q  LP QT Y  I   + GW AI+ M VRGAPAIAI   LSL V
Sbjct  2     SLEAIRYSKGSLQILNQLLLPGQTSYEQINTVEQGWQAIRTMKVRGAPAIAIVGCLSLVV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SEAKT  1067
             E       +G  ++ V  +   L YLV++RPTAVN++ AA +L+ + ++ A  A + A+T
Sbjct  62    ELQTNRKKHGK-EEMVKVIRDSLAYLVTARPTAVNMAKAAEELSALTSQLAEQAGATAET  120

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTA  887
             + E+ +   E MLE DV+ NK IG HGA  + +  V  +K+++LTHCNTGSLATAGYGTA
Sbjct  121   VKESVVAKIEAMLEKDVSDNKNIGRHGAQHILST-VKKEKVTVLTHCNTGSLATAGYGTA  179

Query  886   LGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVN  707
             LGV+R++   G L   YCTETRP+NQG+RLTA+ELV E+IP+TLIADS  +  MKA  ++
Sbjct  180   LGVVRSLQAEGRLAHVYCTETRPYNQGARLTAYELVYEHIPSTLIADSMVSIAMKAKGIS  239

Query  706   AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERS  527
             AV+VGADR+ ANGDTANKIGTY LA+ A +HG+PFYVAAP TS DL+L +G+QIVIEERS
Sbjct  240   AVVVGADRVVANGDTANKIGTYQLAIAAKYHGIPFYVAAPSTSCDLTLENGEQIVIEERS  299

Query  526   PKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVIS  389
               EL   +   G +IAA GI+VWNPAFDVTP  LI+ GIITE GV S
Sbjct  300   HSELTDVN---GMRIAAPGIAVWNPAFDVTPCDLITGGIITEFGVFS  343



>ref|XP_005310723.1| PREDICTED: methylthioribose-1-phosphate isomerase [Chrysemys 
picta bellii]
Length=359

 Score =   326 bits (836),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 250/352 (71%), Gaps = 12/352 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+A+ Y+RGSL++L+Q  LP ++ Y +I + + GW+AI+ M VRGAPAIAI   LSLAV
Sbjct  2     SLEALRYRRGSLRVLNQLLLPQRSCYAEIGSVRQGWEAIRAMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAV---SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASE  1076
                 L    G  Q      +F+   L YLV++RPTAVN++ AA +L    ++EA    + 
Sbjct  62    ---ELHGGAGMGQGKAGLETFIHDSLRYLVTARPTAVNMARAAEELGAFASQEAQREGAT  118

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
             A+++ E+ I  AE MLE D+  N++IG HGA  L  Q     K+++LTHCNTGSLATAGY
Sbjct  119   AESLRESVIQWAEAMLEKDLRDNRSIGEHGARHLL-QASPQDKVTVLTHCNTGSLATAGY  177

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIR+++  G LE  YCTETRP+NQG+RLTA+ELV E+IPATLIADS  +  MK  
Sbjct  178   GTALGVIRSLHALGCLEHVYCTETRPYNQGARLTAYELVYEHIPATLIADSMVSVAMKEK  237

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              V+AVIVGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL+ G +IVIE
Sbjct  238   GVSAVIVGADRVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLAEGAEIVIE  297

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
             ER  +EL   +   G +IAA GI VWNPAFDVTP  LI+ GIITE GV   +
Sbjct  298   ERPSQELTDVN---GVRIAAPGIGVWNPAFDVTPHELITGGIITELGVFRPE  346



>ref|XP_002001025.1| GI10562 [Drosophila mojavensis]
 sp|B4K8A4.1|MTNA_DROMO RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
mojavensis]
 gb|EDW16486.1| GI10562 [Drosophila mojavensis]
Length=362

 Score =   326 bits (836),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 196/358 (55%), Positives = 253/358 (71%), Gaps = 20/358 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y+RGSL++LDQ  LP+ + YL ++  +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYQRGSLEILDQLLLPVVSKYLPVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E    E F+ + +     +  KL YLVS+RPTAVN+  +A +L    NE+   +A T  E
Sbjct  62    EIYP-EEFS-SKKSLRQEIEGKLNYLVSARPTAVNMKISADELITLANELTKDDAITVEE  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKIS------ILTHCNTGS  914
              K   + ++ A E MLE D+A N+AIG++GA  +   +  +  ++      +LTHCNTGS
Sbjct  120   MK---QRFLKATEAMLEKDIADNRAIGANGAKAILEHVAEATGVATAGPVRVLTHCNTGS  176

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGV+R ++  G LE  YCTETRP+NQG+RLTA+ELV E +PATL+ DS  A
Sbjct  177   LATAGYGTALGVVRNLSELGKLEHVYCTETRPYNQGARLTAYELVHEKLPATLVLDSMVA  236

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             AL++   V AV+VGADR+AANGDTANKIGTY +AV A HHGVPFYVAAPLTS+DL + SG
Sbjct  237   ALLRVKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFYVAAPLTSIDLEIPSG  296

Query  553   QQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVISKD  383
               I+IE R  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE GV   +
Sbjct  297   DHIIIEVRPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITEHGVFKPE  350



>gb|KIW51203.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala xenobiotica]
Length=395

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 203/387 (52%), Positives = 259/387 (67%), Gaps = 37/387 (10%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      L++LDQ  LP +T Y  +   ++    IK+M VRGAPAIAI AA
Sbjct  3     LQAIQYEPASASSPPSLRILDQLLLPHRTTYEQVSTCEEAHATIKQMKVRGAPAIAIVAA  62

Query  1258  lslaveaSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  1088
             L+LAVE   +        +A++   +LSQ+L+YL +SRPTAVNL DA  KL +++ K+A+
Sbjct  63    LALAVEIGTVVAARKLPSSAEEVKEYLSQRLDYLKTSRPTAVNLGDAVGKL-KIVAKKAT  121

Query  1087  TASEA--KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISI  938
                +A   T+ +AYI+AAE ML DDV+ NKAIG HGA  ++   V  +K        + +
Sbjct  122   LQPDATPDTVAQAYIVAAERMLVDDVSDNKAIGEHGARWIEENTVAGRKRKQEKSQELQV  181

Query  937   LTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat  758
             LTHCNTGSLATAGYGTALGVIR++ TA  L RAYC+ETRP+NQGSRLTA+ELV + IPAT
Sbjct  182   LTHCNTGSLATAGYGTALGVIRSLRTADMLTRAYCSETRPYNQGSRLTAYELVHDQIPAT  241

Query  757   --liadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
                 + + A    +  R+ A++VGADR+AANGDTANKIGTYSLAV A HHGV F VAAP 
Sbjct  242   LITDSMACALLAKQGDRLAAIVVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKELLHTHGGL-----------GEQI---AASGISVWNPAF  446
             T++DL+ +SGQ IVIEER+P+E+    G             G ++   AA GI VWNPAF
Sbjct  302   TTIDLATASGQDIVIEERAPEEVTRIKGPKVTPEGKILVDEGAEVISTAAIGIEVWNPAF  361

Query  445   DVTPASLISGIITEKGVISK-DGNDAF  368
             DVTPA LI G+ITE GV+ K DG   F
Sbjct  362   DVTPAELIDGVITEVGVVEKVDGKFDF  388



>emb|CEJ01322.1| Putative S-methyl-5-thioribose-1-phosphate isomerase [Rhizopus 
microsporus]
Length=384

 Score =   327 bits (837),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 205/373 (55%), Positives = 255/373 (68%), Gaps = 13/373 (3%)
 Frame = -2

Query  1426  KTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsla  1247
             KTL+AI Y RG L++L+Q  LP +TI+  + N ++G  AIK M  RGAPAIAI AALSLA
Sbjct  13    KTLEAIQYTRGDLRILNQLVLPHETIFETVLNIQNGHSAIKTMKTRGAPAIAIVAALSLA  72

Query  1246  veaSNLETFNG---TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE  1076
             V+  N     G   T    V F+ + LEYL +SRPTAVNL DAA KL  V+ + A  A E
Sbjct  73    VDI-NTRFEKGEFTTVDQVVQFVQESLEYLKTSRPTAVNLFDAAAKLLTVVQESAKEAKE  131

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
                   AYI AAE ML DDV  NK IG  GA  + + +     I +LTHCNTGSLATAG+
Sbjct  132   PADAVYAYIEAAEKMLVDDVQDNKNIGKFGADYITSNVKDKDNICVLTHCNTGSLATAGW  191

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALG+IR ++ +G L+ AYCTETRP+NQGSRLTA+ELV ENIPATLI D+ A+AL+K  
Sbjct  192   GTALGIIRDLHASGNLKHAYCTETRPYNQGSRLTAYELVYENIPATLICDNMASALLKQN  251

Query  715   -RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
              +V A++VGADR+AANGDTANKIGTY LA+ A +H + F VAAP TS+DL+  SG  IVI
Sbjct  252   PQVQAIVVGADRVAANGDTANKIGTYQLAITAKYHDILFIVAAPSTSIDLNTKSGADIVI  311

Query  538   EERSPKELLHTHGGLGE-------QIAASGISVWNPAFDVTPASLISGIITEKG-VISKD  383
             E+R  +EL+   G   +       + AA  I VWNP+FDVTP+ LIS I+TEKG V+ KD
Sbjct  312   EQRPAEELVTVSGVRVQDNEPTSIRTAAEHIGVWNPSFDVTPSELISAIVTEKGVVVKKD  371

Query  382   GNDAFDITGFVHK  344
             G   FD+  F+ K
Sbjct  372   GETQFDMAAFLSK  384



>ref|XP_001993776.1| GH21593 [Drosophila grimshawi]
 sp|B4JRX2.1|MTNA_DROGR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
grimshawi]
 gb|EDV94512.1| GH21593 [Drosophila grimshawi]
Length=363

 Score =   326 bits (835),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 192/358 (54%), Positives = 249/358 (70%), Gaps = 25/358 (7%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaia--aalsl  1250
             +LQ+I YKRGSL++LDQ  LP+ + YL ++  +DGW  I +M VRGAPAIAI    +L++
Sbjct  2     SLQSIKYKRGSLEILDQLLLPVVSKYLPVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTA  1082
              +     ET     Q+    +  KL YLVS+RPTAVN+  +A +L    NE+   +  T 
Sbjct  62    EIYPEEFETKKSLRQE----IEGKLNYLVSARPTAVNMKISADELITLANELSKNDDVTV  117

Query  1081  SEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV-------GSKKISILTHCN  923
             +  K   + ++ A E MLE D+A N+AIGS+GA  +  ++         +  + +LTHCN
Sbjct  118   ANMK---QRFLDATEAMLEKDIADNRAIGSNGAKAILERVAEATGSPGSASPVRVLTHCN  174

Query  922   TGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliads  743
             TGSLATAGYGTALGV+R ++  G LE  YCTETRP+NQG+RLTA+ELV E +PATL+ DS
Sbjct  175   TGSLATAGYGTALGVVRHLSELGKLEHVYCTETRPYNQGARLTAYELVHEKLPATLVLDS  234

Query  742   aaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSL  563
               AAL +   V AV+VGADR+AANGDTANKIGTY +AV A HHGVPFYVAAPLTS+DL +
Sbjct  235   MVAALFRVKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFYVAAPLTSIDLQI  294

Query  562   SSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
              SG+ I+IE R  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE GV 
Sbjct  295   PSGEHIIIEVRPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITEHGVF  348



>gb|KIX06934.1| S-methyl-5-thioribose-1-phosphate isomerase [Rhinocladiella mackenziei 
CBS 650.93]
Length=395

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 213/394 (54%), Positives = 265/394 (67%), Gaps = 37/394 (9%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      L++LDQ  LP +TIY++I N ++   AIK+M VRGAPAIAI AA
Sbjct  3     LQAIQYEPVSASLPPTLRILDQLLLPHRTIYVEITNCEEAHAAIKQMKVRGAPAIAIVAA  62

Query  1258  lslaveaSNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  1088
             L+LAVEA  L        +A++  + L ++LEYL +SRPTAVNL DA  KL +V+ K A+
Sbjct  63    LALAVEAGTLAAAGKLPTSAEEVRAMLGERLEYLKTSRPTAVNLGDAVGKL-KVVVKMAT  121

Query  1087  T--ASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISI  938
             T   + A ++ + YI AAE MLEDDV+ NKAIG HGA  ++   V  K+        + +
Sbjct  122   TEPTATANSVVQMYIAAAERMLEDDVSDNKAIGEHGARWIEENTVAGKRRKLDKEKELKV  181

Query  937   LTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat  758
             LTHCNTGSLATAGYGTALGVIR++  A  L RAYC+ETRP+NQGSRLTA+ELV + IPAT
Sbjct  182   LTHCNTGSLATAGYGTALGVIRSLRNADMLTRAYCSETRPYNQGSRLTAYELVHDKIPAT  241

Query  757   liadsaaaalmkA--GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
             LI DS A AL+     ++ A++VGADR+AANGDTANKIGTYSLAV A HH V F VAAP 
Sbjct  242   LITDSMACALLAREGNQLAAIVVGADRVAANGDTANKIGTYSLAVLAKHHSVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKE--------------LLHTHGGLGEQIAASGISVWNPAF  446
             T++DL+ +SG+ IVIEER+P+E              LL   G     IAA GI VWNPAF
Sbjct  302   TTIDLATASGEYIVIEERAPEEVTRMKGPKVTTDGKLLIDEGSEIISIAAVGIDVWNPAF  361

Query  445   DVTPASLISGIITEKGVISKDGNDAFDITGFVHK  344
             DVTPA LI G+ITE GV+ K  N  FD      +
Sbjct  362   DVTPAELIDGVITEVGVVEK-VNGKFDFRSIFQQ  394



>ref|XP_007422307.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Python bivittatus]
 ref|XP_007422308.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X2 [Python bivittatus]
Length=359

 Score =   325 bits (834),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 191/346 (55%), Positives = 248/346 (72%), Gaps = 6/346 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+A+ Y+RGSLQ+L+Q  LP Q++Y +I + + GW+AI+ M VRGAPAIAI   LSLAV
Sbjct  2     SLEALRYRRGSLQILNQLLLPHQSLYEEISSVRQGWEAIRSMKVRGAPAIAIIGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS-TASEAKT  1067
             E  N      +  +   F+   L YL+S+RPTAVN++ AA  L   + +EA    +  + 
Sbjct  62    ELHNKGNEELSLGNLEIFVLDSLSYLISARPTAVNMARAARDLGHFVHQEAKHEGTTPER  121

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTA  887
             + E+ I  AE++L+ D+  NK IG HGA  L  Q VG  K+ +LTHCNTGSLATAGYGTA
Sbjct  122   LRESVIHWAEMLLQKDLEDNKNIGEHGACHLL-QRVGQGKVRVLTHCNTGSLATAGYGTA  180

Query  886   LGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVN  707
             LG+IR+++  G LE  YCTETRP+NQG+RLTA+ELV E +P+TLIADS A+  MK  +++
Sbjct  181   LGIIRSLHAMGRLEHVYCTETRPYNQGARLTAYELVYEQVPSTLIADSMASLAMKEKKIS  240

Query  706   AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERS  527
             AVIVGADR+ ANGDTANK+GTY LA+ A +HG+PFYVAAP TS DL+L  G QI+IEER 
Sbjct  241   AVIVGADRVVANGDTANKVGTYQLAIAARYHGIPFYVAAPSTSCDLNLEHGGQIIIEERP  300

Query  526   PKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVI  392
              +EL   +   G +IAA GI VWNPAFDVTP  LI+ GI+TE GV 
Sbjct  301   TQELTDIN---GVRIAAPGIGVWNPAFDVTPHELITGGIVTEFGVF  343



>ref|XP_003236958.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
118892]
 gb|EGD85409.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
118892]
 gb|EZF13162.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum MR850]
 gb|EZF39692.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
100081]
 gb|EZF50216.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
288.86]
 gb|EZF60848.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
289.86]
 gb|EZF71366.1| methylthioribose-1-phosphate isomerase [Trichophyton soudanense 
CBS 452.61]
 gb|EZF82175.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum MR1448]
 gb|EZF92925.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum MR1459]
 gb|EZG03937.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
735.88]
 gb|EZG14501.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum CBS 
202.88]
 gb|KDB31425.1| methylthioribose-1-phosphate isomerase [Trichophyton rubrum D6]
Length=385

 Score =   326 bits (836),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 256/377 (68%), Gaps = 23/377 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I YKRG LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++
Sbjct  2     SLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSI  61

Query  1243  eaSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-E  1076
             E + L   E  +  A +  +F+ +KL+YLV+SRPTAVNLSDAA KL  ++ K       +
Sbjct  62    ELTELMDHEKLSAEANEVEAFILEKLDYLVTSRPTAVNLSDAAIKLKALVQKRKQIGDPK  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGS--KKISILTHCNTGSLAT  905
              K + EAY+ AAE ML DD   N  +G  GA+ ++ N  VG   KK+ +LTHCNTGSLAT
Sbjct  122   GKDLAEAYVEAAEKMLIDDAMDNHRLGDFGAAWIMNNTPVGKDGKKVGVLTHCNTGSLAT  181

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR+++ +  LE AYCTETRP+NQG+RLTAFELV + IPATLI DS AA+L+
Sbjct  182   AGYGTALGVIRSLHASDKLEHAYCTETRPYNQGARLTAFELVHDKIPATLITDSMAASLL  241

Query  724   kAG--RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQ  551
                   + A++VGADR+ ANGDTANKIGTY LAV A +HGV F VAAP T++DL    G+
Sbjct  242   AQKGTGLAAIVVGADRVVANGDTANKIGTYQLAVLAKYHGVKFIVAAPRTTIDLRTKEGE  301

Query  550   QIVIEERSPKELLHTHG------GLGEQ--------IAASGISVWNPAFDVTPASLISGI  413
              I+IEER+  E+    G      G  E+        IAA GI VWNPAFDVTP  LI  I
Sbjct  302   DIIIEERAKSEVTRITGPRISDLGRNEENITLETVNIAAPGIDVWNPAFDVTPYDLIDAI  361

Query  412   ITEKGVISKDGNDAFDI  362
             +TE GV  K+ +  F++
Sbjct  362   VTEVGVAEKNADGLFEL  378



>ref|XP_009056765.1| hypothetical protein LOTGIDRAFT_190615 [Lottia gigantea]
 gb|ESO92624.1| hypothetical protein LOTGIDRAFT_190615 [Lottia gigantea]
Length=392

 Score =   327 bits (837),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 193/349 (55%), Positives = 244/349 (70%), Gaps = 9/349 (3%)
 Frame = -2

Query  1429  DKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             D  L+AI Y RG+L +LDQ +LP  T Y+ IKN +DGWDAIK+M VRGAPAIAI   LS+
Sbjct  6     DSNLKAIRYDRGNLDILDQLQLPTHTEYIPIKNTEDGWDAIKQMKVRGAPAIAIVGCLSM  65

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASE--  1076
             AVE  ++E    + Q+   ++  KL YLV++RPTAVN+ +A+  +++++ +E +T S+  
Sbjct  66    AVEIYHMEF--QSHQEIADYVKDKLNYLVTARPTAVNMKEASDWISKML-QELTTDSDLS  122

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
                  E  I AAEI+ EDDV  NK IG HGA  + N       ++ILTHCNTGSLATAGY
Sbjct  123   VHAFKELAIEAAEILFEDDVTINKDIGRHGAEHILNHCQDKDNVNILTHCNTGSLATAGY  182

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIRA++    ++  YCTETRP+NQG+RLTA+ELV ENIPATLI DS  A LM   
Sbjct  183   GTALGVIRALHEKNRIKHVYCTETRPYNQGARLTAYELVHENIPATLILDSMPAILMSHH  242

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              + AV+VGADR+ ANGDTANKIGT  +A+ A H  VPFYVA PLT+ D S  SG++I IE
Sbjct  243   DITAVVVGADRVVANGDTANKIGTIQIAIIAKHFKVPFYVACPLTTFDPSKESGKEIAIE  302

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVI  392
             ER   E+       G++IAA GI  WNPAFDVTPA LI+ GI+TE GV 
Sbjct  303   ERPHIEMTSIK---GQRIAAHGIDCWNPAFDVTPAELITGGIVTEYGVF  348



>ref|XP_007753953.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
yegresii CBS 114405]
 gb|EXJ65386.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
yegresii CBS 114405]
Length=395

 Score =   326 bits (836),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 201/380 (53%), Positives = 255/380 (67%), Gaps = 36/380 (9%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      L++LDQ +LP +T Y+ +   ++   AIK+M VRGAPAIAI AA
Sbjct  3     LQAIQYEPASGHSGPALRILDQLQLPHRTTYVAMSTCEEAHAAIKQMKVRGAPAIAIVAA  62

Query  1258  lslaveaSN---LETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  1088
             L+LAVE  N            D    ++Q+L+YL +SRPTAVNL DA  KL +++TK A+
Sbjct  63    LALAVEIGNEIVARRLPAVPNDVKDSIAQRLDYLKTSRPTAVNLGDAVGKL-KIVTKRAT  121

Query  1087  TASEA--KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISI  938
               SEA  K++ EAYI+AAE ML DDV+ NKAIG HGA  ++   V  +K        + +
Sbjct  122   LQSEASAKSVAEAYILAAEQMLVDDVSDNKAIGEHGARWIEENTVAGRKRKADTSQQLEV  181

Query  937   LTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat  758
             LTHCNTGSLATAGYGTALGVIR++ +A  L RAYC+ETRP+NQGSRLTA+ELV + IPAT
Sbjct  182   LTHCNTGSLATAGYGTALGVIRSLRSADMLTRAYCSETRPYNQGSRLTAYELVHDEIPAT  241

Query  757   --liadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
                 + + A    +  R+ AV+VGADR+AANGDTANKIGT+SLAV A HHGV F VAAP 
Sbjct  242   LITDSMACALMNKEGDRLAAVVVGADRVAANGDTANKIGTHSLAVLARHHGVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKELLHTHG-----------GLGEQI---AASGISVWNPAF  446
             T++D   +SG+ IVIEER+P+E+    G             G ++   AA GI VWNPAF
Sbjct  302   TTIDRDTASGEDIVIEERAPEEVTRIKGPKVTAEGKLLLDEGSEVVSTAAIGIEVWNPAF  361

Query  445   DVTPASLISGIITEKGVISK  386
             DVTPA LI G+ITE GV+ K
Sbjct  362   DVTPAELIDGVITEVGVVEK  381



>ref|XP_969152.1| PREDICTED: methylthioribose-1-phosphate isomerase [Tribolium 
castaneum]
 gb|EFA12349.1| hypothetical protein TcasGA2_TC002054 [Tribolium castaneum]
Length=354

 Score =   324 bits (831),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 244/348 (70%), Gaps = 12/348 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaia--aalsl  1250
             +L+AI Y+  SL++LDQ  LP Q+ Y+ +K  +DGW  I +M VRGAPAIAI    +L++
Sbjct  2     SLKAIKYENNSLEILDQLLLPAQSKYIQVKGVEDGWRVINKMQVRGAPAIAIVGCLSLAV  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-EA  1073
              ++  N ET     QD    +  KL +LVSSRPTAVN+  AA +L  +  K +   S E 
Sbjct  62    ELQRENFETKRQLRQD----IEGKLNFLVSSRPTAVNMKIAAEELIALSNKLSEDESIEL  117

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
             +T+   ++   E MLE D+  NK+IG  GA  + + + G   + ILTHCNTGSLATAGYG
Sbjct  118   ETMKSRFLQTIEAMLEKDIHDNKSIGDFGAREILSGVSGDSLVRILTHCNTGSLATAGYG  177

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIR ++    LE  YCTETRP+NQG+RLTA+ELV + IPATLI DS  AALMK   
Sbjct  178   TALGVIRKLHELKRLEHCYCTETRPYNQGARLTAYELVHDKIPATLIVDSMVAALMKHRN  237

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+AV+VGADR+A+NGDTANKIGTY +AV A  HGVPFYVAAP TS+D+ + SG  IVIEE
Sbjct  238   VSAVVVGADRVASNGDTANKIGTYQIAVLAKFHGVPFYVAAPFTSIDMKIVSGDHIVIEE  297

Query  532   RSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
             R   E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITEKGV 
Sbjct  298   RPDHEMTH----VGEHRIAAKGITCWNPAFDVTPASLIAGIITEKGVF  341



>ref|XP_006621213.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Apis dorsata]
Length=355

 Score =   324 bits (831),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 192/346 (55%), Positives = 243/346 (70%), Gaps = 10/346 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI ++ G L++LDQ  LP  + Y+ ++  +DGW  I  M VRGAPAIAI   LSLA 
Sbjct  2     TLQAIKWENGKLEILDQILLPAMSRYISVRGVEDGWKVINNMQVRGAPAIAIVGCLSLAT  61

Query  1243  eaSNLETFNGTA--QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-EA  1073
             E  N +  +  +  QD    +  KL YLVS+RPTAVN+  AA +L ++  K +   +   
Sbjct  62    EIKNEKYIDKKSLRQD----VEGKLNYLVSARPTAVNMKIAADELIQLANKLSKDETVNV  117

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
               + E +I A E MLE D+A NKAIG +GA  +   + G   + ILTHCNTGSLATAGYG
Sbjct  118   IEMQERFIKAIEAMLEKDIADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGYG  177

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIR+++    LE AYC+ETRP+NQG+RLTA+ELV ENIPATLI D   AALMK+  
Sbjct  178   TALGVIRSLHKKNSLELAYCSETRPYNQGARLTAYELVYENIPATLICDDMVAALMKSRN  237

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             ++AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ SG  I+IEE
Sbjct  238   ISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPSGDHIIIEE  297

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  395
             R  +EL H +    ++IAA GI  WNPAFD+TPA+LI GIITE GV
Sbjct  298   RPERELTHIN---DQRIAAPGIQCWNPAFDITPANLIKGIITEVGV  340



>sp|C0S1C8.1|MTNA_PARBP RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Paracoccidioides 
brasiliensis Pb03]
 gb|EEH19074.1| methylthioribose-1-phosphate isomerase [Paracoccidioides brasiliensis 
Pb03]
Length=386

 Score =   325 bits (834),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 200/379 (53%), Positives = 250/379 (66%), Gaps = 26/379 (7%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L AI Y  G L +L+Q  LP QT Y  I +A D W AI +M VRGAPAIAI AALS+AVE
Sbjct  3     LIAISYSHGKLSILNQLFLPHQTTYDPIYSACDAWHAIHDMRVRGAPAIAIVAALSVAVE  62

Query  1240  aSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNE-VITKEASTASEA  1073
               +L      +  A++   F+ +KLEY+ SSRPTAVNL +AA +L + V+ +        
Sbjct  63    LYDLIQKGKLSDQAKEVEIFIREKLEYIASSRPTAVNLVEAAGRLGKIVVARSCGEGVTG  122

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNTG  917
             + + E YI AAE MLEDDV  N+ IG  GA  +  Q +   +        +++LTHCNTG
Sbjct  123   REVAEEYIRAAEKMLEDDVKDNRGIGEFGAKWIMKQAIDGAEGEGEGKGKVAVLTHCNTG  182

Query  916   SLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liads  743
             SLATAGYGTALGVIR+++ A  L+ AYCTETRP+NQGSRLTA+ELV +NIPAT    + +
Sbjct  183   SLATAGYGTALGVIRSLHAANSLKHAYCTETRPYNQGSRLTAYELVHDNIPATLITDSMA  242

Query  742   aaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSL  563
             AA    K+  V A++VGADR+AANGDTANKIGTY LAV A HHGV F VAAP T++D++ 
Sbjct  243   AALLAHKSAGVGAIVVGADRVAANGDTANKIGTYGLAVLAKHHGVKFLVAAPRTTIDMNT  302

Query  562   SSGQQIVIEERSPKELLHTHG--------GLGEQ----IAASGISVWNPAFDVTPASLIS  419
              SG+ I IEER  +E+    G        GLG      +AA GI VWNPAFDVTPASLI 
Sbjct  303   KSGEGIAIEERPRQEMTRIRGPRVGGEQDGLGAMETITVAADGIDVWNPAFDVTPASLID  362

Query  418   GIITEKGVISKDGNDAFDI  362
             GIITE GV+ KD +  F +
Sbjct  363   GIITEIGVVEKDRDGEFHL  381



>ref|XP_002560080.1| Pc14g00860 [Penicillium rubens Wisconsin 54-1255]
 sp|B6H5R4.1|MTNA_PENCW RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Penicillium 
rubens Wisconsin 54-1255]
 emb|CAP74227.1| Pc14g00860 [Penicillium rubens Wisconsin 54-1255]
Length=382

 Score =   325 bits (833),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 189/378 (50%), Positives = 256/378 (68%), Gaps = 25/378 (7%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGa---paiaiaaalsl  1250
             LQAI + +G+L++LDQ +LP    Y+ I+  +DGW AIK+M VRGA     +A+ A  + 
Sbjct  2     LQAIKFSKGNLEILDQLQLPFVEEYIPIRTTEDGWHAIKDMKVRGAPAIAIVAMLALAAE  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK----EASTA  1082
                A + +  + + ++   ++++KL YLV+SRPTAVNL+DAA KL  V+T       ST 
Sbjct  62    LTSAVDSDKLSQSPEEVCQYITEKLAYLVTSRPTAVNLADAARKLEAVVTDCTKAPGSTG  121

Query  1081  SEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQ-NQLVGSKKISILTHCNTGSLAT  905
              E  T   A+I AAE M+  D+  NK IG +GA  +  +   G+ ++++LTHCNTGSLAT
Sbjct  122   HEVAT---AFIKAAEDMMGKDLEDNKRIGHNGAEWIAIHAAKGNSEVAVLTHCNTGSLAT  178

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             +GYGTALGV+R++     L  AYCTETRP+NQGSRLTAFELV + IPATLI DS AAAL+
Sbjct  179   SGYGTALGVVRSLAEKNTLRHAYCTETRPYNQGSRLTAFELVHDKIPATLITDSMAAALL  238

Query  724   kAGR--VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQ  551
                +  VNA++VGADR+AANGDTANKIGTY+LAV A +HGV F VAAP T++D++ +SG+
Sbjct  239   ADTKVGVNAIVVGADRVAANGDTANKIGTYALAVLAKYHGVKFLVAAPRTTIDMATASGK  298

Query  550   QIVIEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIIT  407
              IVIE+R+  E+    G                +IAA GI+VWNPAFD+TPASLI GIIT
Sbjct  299   DIVIEQRAASEVTSIKGPRAGSEATDQIAIETVKIAAPGINVWNPAFDITPASLIDGIIT  358

Query  406   EKGVISKDGNDAFDITGF  353
             E GV+ K  ++ + + G 
Sbjct  359   EVGVVEKGADEKYHLGGL  376



>ref|XP_005185612.1| PREDICTED: methylthioribose-1-phosphate isomerase [Musca domestica]
 ref|XP_005185613.1| PREDICTED: methylthioribose-1-phosphate isomerase [Musca domestica]
Length=356

 Score =   324 bits (831),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 191/353 (54%), Positives = 246/353 (70%), Gaps = 20/353 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y  G L++LDQ  LP+Q+ Y+ +K  +DGW  I +M VRGAPAIAI   LSLA 
Sbjct  2     SLQSIKYSAGKLEILDQLLLPVQSKYVAVKGVEDGWKVINKMQVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTAQDAVSFLSQ---KLEYLVSSRPTAVNLSDAATKL----NEVITKEAST  1085
                 +E F  T +   +   +   KL YLVS+RPTAVN+  AA +L    NE+   E+  
Sbjct  61    ----VEIFPETYESKKTLRQEIEGKLNYLVSARPTAVNMKIAADELISLANELTKDESVN  116

Query  1084  ASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLAT  905
               E K   + ++   E ML+ D++ NKAIG++GA  +         + +LTHCNTGSLAT
Sbjct  117   VEEMK---QKFLDITEAMLQKDISDNKAIGANGAKAVLESAAKDGPVRVLTHCNTGSLAT  173

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGV+R ++    LE  YCTETRP+NQG+RLTA+ELV + +PATL+ DS  AAL+
Sbjct  174   AGYGTALGVVRKLHELKKLEHVYCTETRPYNQGARLTAYELVHDKLPATLVLDSMVAALL  233

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
             +A  V AV+VGADR+AANGDTANKIGTY +AV A HHGVPF+VAAPLTS+DL + SG  I
Sbjct  234   RAKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFFVAAPLTSIDLQIPSGDHI  293

Query  544   VIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
             +IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE+GV  
Sbjct  294   IIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITERGVFK  342



>gb|EGE01404.1| S-methyl-5-thioribose-1-phosphate isomerase [Trichophyton equinum 
CBS 127.97]
 gb|EZF31897.1| methylthioribose-1-phosphate isomerase [Trichophyton interdigitale 
H6]
 gb|KDB23619.1| methylthioribose-1-phosphate isomerase [Trichophyton interdigitale 
MR816]
Length=385

 Score =   325 bits (833),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 256/377 (68%), Gaps = 23/377 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I YKRG LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++
Sbjct  2     SLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSI  61

Query  1243  eaSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-E  1076
             E + L   +  +  A +  +F+ +KL+YLV+SRPTAVNLSDAA KL  ++ K       +
Sbjct  62    ELTELMDHDKLSAEANEVEAFILEKLDYLVTSRPTAVNLSDAAIKLKALVQKRKQIGDPK  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGS--KKISILTHCNTGSLAT  905
              K + EAY+ AAE ML DD   N  +G  GA+ ++ N  VG   KK+ +LTHCNTGSLAT
Sbjct  122   GKDLAEAYVEAAEKMLIDDAMDNHRLGDFGATWIMNNTPVGKDGKKVGVLTHCNTGSLAT  181

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR+++ +  LE AYCTETRP+NQG+RLTAFELV + IPATLI DS AA+L+
Sbjct  182   AGYGTALGVIRSLHASDKLEHAYCTETRPYNQGARLTAFELVHDKIPATLITDSMAASLL  241

Query  724   kAG--RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQ  551
                   + A++VGADR+ ANGDTANKIGTY LAV A +HGV F VAAP T++DL    G+
Sbjct  242   AQKGTGLAAIVVGADRVVANGDTANKIGTYQLAVLAKYHGVKFIVAAPRTTIDLRTKEGE  301

Query  550   QIVIEERSPKELLHTHG------GLGEQ--------IAASGISVWNPAFDVTPASLISGI  413
              I+IEER+  E+    G      G  E+        IAA GI VWNPAFDVTP  LI  I
Sbjct  302   DIIIEERAKSEVTRITGPRISDLGRNEENITLETVNIAAPGIDVWNPAFDVTPYDLIDAI  361

Query  412   ITEKGVISKDGNDAFDI  362
             +TE GV  K+ +  F++
Sbjct  362   VTEVGVAEKNADGLFEL  378



>ref|XP_006262838.1| PREDICTED: methylthioribose-1-phosphate isomerase [Alligator 
mississippiensis]
Length=387

 Score =   325 bits (833),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 250/351 (71%), Gaps = 15/351 (4%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+A+ Y+RGSLQ+LDQ +LP ++ Y  I+  +DG  AI++M VRGAPAIAI   LSLA  
Sbjct  3     LEALRYRRGSLQILDQLQLPQRSCYEAIRGVRDGQAAIRDMRVRGAPAIAIVGCLSLA--  60

Query  1240  aSNLETFNGTA--QDAVS---FLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-AS  1079
                +E   GTA  QDA +   F+ + L+ L S+RPTA N++ AA KL    T EA    +
Sbjct  61    ---VELHGGTAGGQDAATVAAFVGKALQDLASTRPTARNMAQAAEKLGAAATHEAQCPGA  117

Query  1078  EAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAG  899
              A ++ E  I  AE MLE D+  N+ IG  GA+ +   +    ++++LTHCNTG+LATAG
Sbjct  118   TANSVREIVIQLAEEMLEKDLQDNRRIGELGATCMMQGVAPQGQVTVLTHCNTGALATAG  177

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA  719
             YGTALGVIRA++  G LE  YCTETRP+NQG+RLTA+ELV E IPATLIADSAAA  +K 
Sbjct  178   YGTALGVIRALHARGCLEHVYCTETRPYNQGARLTAYELVYEGIPATLIADSAAALALKE  237

Query  718   GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
               ++A++VGADR+ ANGDTANK+GTY LA+ AMHHGVPFYVAAP TS DLSL++G QI+I
Sbjct  238   KGISAIVVGADRVVANGDTANKVGTYQLAIAAMHHGVPFYVAAPSTSCDLSLATGDQIII  297

Query  538   EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVIS  389
             EER  +EL   +   G +IAA  I VWNPAFDVTP  L++ GIITE GV +
Sbjct  298   EERPSQELTDIN---GIRIAAPDIGVWNPAFDVTPHDLVTGGIITELGVFA  345



>gb|EGD96919.1| translation initiation factor [Trichophyton tonsurans CBS 112818]
Length=385

 Score =   325 bits (833),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 256/377 (68%), Gaps = 23/377 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I YKRG LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++
Sbjct  2     SLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSI  61

Query  1243  eaSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-E  1076
             E + L   +  +  A +  +F+ +KL+YLV+SRPTAVNLSDAA KL  ++ K       +
Sbjct  62    ELTELMDHDKLSAEANEVEAFILEKLDYLVTSRPTAVNLSDAAIKLKALVQKRKQIGDPK  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGS--KKISILTHCNTGSLAT  905
              K + EAY+ AAE ML DD   N  +G  GA+ ++ N  VG   KK+ +LTHCNTGSLAT
Sbjct  122   GKDLAEAYVEAAEKMLIDDAMDNHRLGDFGAAWIMNNTPVGKDGKKVGVLTHCNTGSLAT  181

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR+++ +  LE AYCTETRP+NQG+RLTAFELV + IPATLI DS AA+L+
Sbjct  182   AGYGTALGVIRSLHASDKLEHAYCTETRPYNQGARLTAFELVHDKIPATLITDSMAASLL  241

Query  724   kAG--RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQ  551
                   + A++VGADR+ ANGDTANKIGTY LAV A +HGV F VAAP T++DL    G+
Sbjct  242   AQKGTGLAAIVVGADRVVANGDTANKIGTYQLAVLAKYHGVKFIVAAPRTTIDLRTKEGE  301

Query  550   QIVIEERSPKELLHTHG------GLGEQ--------IAASGISVWNPAFDVTPASLISGI  413
              I+IEER+  E+    G      G  E+        IAA GI VWNPAFDVTP  LI  I
Sbjct  302   DIIIEERAKSEVTRITGPRISDLGRNEENITLETVNIAAPGIDVWNPAFDVTPYDLIDAI  361

Query  412   ITEKGVISKDGNDAFDI  362
             +TE GV  K+ +  F++
Sbjct  362   VTEVGVAEKNADGLFEL  378



>gb|KKA21682.1| S-methyl-5-thioribose-1-phosphate isomerase [Rasamsonia emersonii 
CBS 393.64]
Length=384

 Score =   325 bits (833),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 197/373 (53%), Positives = 252/373 (68%), Gaps = 21/373 (6%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y   SL +LDQ +LP    Y+ I+  ++GW AI+EM VRGAPAIAI A LSLAVE
Sbjct  3     LQAIKYDGTSLSVLDQLQLPHLVKYVPIRTVQEGWQAIREMRVRGAPAIAIVAILSLAVE  62

Query  1240  aSNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SEA  1073
                L T    +  A +  +F+++KL YLV+SRPTAVNL DAA K   +I   A    S  
Sbjct  63    LRTLLTEGKLSPVADEVRTFITEKLRYLVTSRPTAVNLGDAARKFERLIAVHAKEKDSTG  122

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQ--LVGSKKISILTHCNTGSLATAG  899
              ++  A++  AE ML +D+  N+ IG++GA  +  +  L G K +++LTHCNTGSLAT+G
Sbjct  123   HSLAIAFLKEAEQMLTNDLNDNRNIGAYGAKWIVEKALLQGRKTVNVLTHCNTGSLATSG  182

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat--liadsaaaalm  725
             YGTALGVIR+++++ +L RAYCTETRP+NQG+RLTAFELV +NIP+T    + +AA    
Sbjct  183   YGTALGVIRSLHSSHYLGRAYCTETRPYNQGARLTAFELVHDNIPSTLITDSMAAALLAS  242

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
             K   + A++VGADR+AANGDTANKIGTY LAV A HHGV F VAAP T++D    SG+ I
Sbjct  243   KNSEIFAIVVGADRVAANGDTANKIGTYGLAVLAKHHGVKFLVAAPRTTIDRETKSGEDI  302

Query  544   VIEERSPKELLHTHGGLGE-----------QIAASGISVWNPAFDVTPASLISGIITEKG  398
             VIEER   E+ +  G L E           +IAA GI VWNPAFDVTPA+LI  IITE G
Sbjct  303   VIEERPASEVTNIKGPLEEDVTGPLRMETIRIAAPGIDVWNPAFDVTPAALIDAIITEVG  362

Query  397   VISK--DGNDAFD  365
             V+ +  DG   FD
Sbjct  363   VVERGSDGYFHFD  375



>ref|XP_001664017.1| AAEL013828-PA [Aedes aegypti]
 sp|Q16I17.1|MTNA_AEDAE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aedes 
aegypti]
 gb|EAT33907.1| AAEL013828-PA [Aedes aegypti]
Length=360

 Score =   323 bits (829),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 243/347 (70%), Gaps = 8/347 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+AI Y  G L++LDQ  LP Q+ Y+D+K  +DGW AI +M VRGAPAIAI   LSLAV
Sbjct  2     SLKAIKYSNGKLEILDQLLLPAQSKYIDVKGVEDGWKAINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-EAKT  1067
             E    E F+ T Q     +  KL YLVS+RPTAVN+  AA  L  +    A   S    T
Sbjct  62    EIFG-EKFD-TKQTFKQEVEGKLNYLVSARPTAVNMKLAAEDLISLANALAQDESISVDT  119

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTA  887
             + E ++ A E ML+ D+A N AIG +GA ++ + +     + ILTHCNTGSLATAGYGTA
Sbjct  120   MKERFLKAIEDMLDKDIADNMAIGKNGADIILSHIPNGGSVRILTHCNTGSLATAGYGTA  179

Query  886   LGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVN  707
             LGVIR ++    LE  YCTETRP+NQG+RLTA+ELV + +PATLI D+  A+L K+ RV 
Sbjct  180   LGVIRKLHEMNRLEHVYCTETRPYNQGARLTAYELVHDKLPATLILDNMVASLFKSRRVA  239

Query  706   AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERS  527
             AV+VGADR+AANGDTANKIGTY + V A +H VPFYVAAP TS+DL + SG +IVIEER 
Sbjct  240   AVVVGADRVAANGDTANKIGTYQIGVVAKYHDVPFYVAAPFTSIDLKIPSGDRIVIEERP  299

Query  526   PKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
              +E+ H    +GE +IAA GI+ WNPAFDVT A LI+GIITEKGV  
Sbjct  300   DREMTH----VGEHRIAAPGIACWNPAFDVTTADLITGIITEKGVFK  342



>ref|XP_001953494.1| GF17194 [Drosophila ananassae]
 sp|B3M098.1|MTNA_DROAN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
ananassae]
 gb|EDV42055.1| GF17194 [Drosophila ananassae]
Length=364

 Score =   323 bits (829),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 192/362 (53%), Positives = 248/362 (69%), Gaps = 26/362 (7%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaia--aalsl  1250
             +LQ+I Y RGSL +LDQ  LP+Q+ Y+ ++  +DGW  I +M VRGAPAIAI    +L++
Sbjct  2     SLQSIKYSRGSLDILDQLLLPVQSKYVAVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTA  1082
              +     E+     Q+    +  KL YLVS+RPTAVN+  AA +L    N++   E    
Sbjct  62    EIYPEEFESKKRLRQE----VEGKLNYLVSARPTAVNMKIAADELLALANDLTKDETIDV  117

Query  1081  SEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSK--------KISILTHC  926
             +  K   E ++ A E MLE D+A N+AIGSHGA  +  ++  +          + +LTHC
Sbjct  118   AGMK---ERFLNATEAMLEKDIADNQAIGSHGAQAILKRVAEAAGAQTGTAGPVRVLTHC  174

Query  925   NTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliad  746
             NTGSLATAGYGTALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ D
Sbjct  175   NTGSLATAGYGTALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLD  234

Query  745   saaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLS  566
             S  AAL++A  V  V+VGADR+AANGDTANKIGTY +AV A HHGVPFYVAAPLTS+DL+
Sbjct  235   SMVAALLRAKNVAGVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFYVAAPLTSIDLA  294

Query  565   LSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
             +  G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE+GV  
Sbjct  295   IPGGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITERGVFK  350

Query  388   KD  383
              +
Sbjct  351   PE  352



>ref|XP_002099512.1| GE23315 [Drosophila yakuba]
 sp|B4PNE2.1|MTNA_DROYA RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
yakuba]
 gb|EDW99224.1| GE23315 [Drosophila yakuba]
Length=364

 Score =   323 bits (829),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 197/357 (55%), Positives = 251/357 (70%), Gaps = 22/357 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y RGSL++LDQ  LP Q+ YL ++  +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYSRGSLEILDQLLLPGQSKYLVVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E  N E F  T +     +  KL YLVS+RPTAVN+  AA +L    N++   EA   +E
Sbjct  62    EI-NPEDFE-TKKSLRQEIEGKLNYLVSARPTAVNMKIAADELITLANDLYKDEAINVTE  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV--------GSKKISILTHCNT  920
              K   + ++ A E ML+ D+A N+AIG++GA  +  ++          +  + +LTHCNT
Sbjct  120   MK---QRFLDATEAMLKKDIADNRAIGANGAKAILQRVAETGAAPAGSTGSVRVLTHCNT  176

Query  919   GSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsa  740
             GSLATAGYGTALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS 
Sbjct  177   GSLATAGYGTALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSM  236

Query  739   aaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLS  560
              AAL++A  V AV+VGADR+A+NGDTANKIGTY +AV A HH VPFYVAAPLTS+DL++ 
Sbjct  237   VAALLRAKNVAAVVVGADRVASNGDTANKIGTYQIAVVAKHHDVPFYVAAPLTSIDLAIP  296

Query  559   SGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
              G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE+GV 
Sbjct  297   GGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITERGVF  349



>ref|XP_011114920.1| hypothetical protein H072_9321 [Dactylellina haptotyla CBS 200.50]
 gb|EPS37093.1| hypothetical protein H072_9321 [Dactylellina haptotyla CBS 200.50]
Length=384

 Score =   324 bits (831),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 207/379 (55%), Positives = 258/379 (68%), Gaps = 24/379 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL AI Y RGSL++LDQ  LP Q++Y+ + +   GW AI+ M VRGAPAIAI AALSLAV
Sbjct  3     TLLAIKYARGSLEILDQLLLPHQSVYIPVNDVLTGWQAIRSMQVRGAPAIAIVAALSLAV  62

Query  1243  eaSN-LETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT  1067
             E +N  +T   T Q AV  + +KL+YLV+SRPTAVNL+DAA KL + +T+    A+E   
Sbjct  63    ELNNAFDTAPATPQSAVELIHEKLDYLVTSRPTAVNLADAAGKL-KALTQNVLAANEVTP  121

Query  1066  --IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYG  893
               + +AYI AAE+ML  DV  NKAIG HGA  + N +  +  I +LTHCNTGSLATA YG
Sbjct  122   DLVVKAYIEAAELMLLKDVEDNKAIGRHGAEWITNAVGKTSGIRVLTHCNTGSLATASYG  181

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALG+IR+++    L+ AYCTETRP+NQGSRLTA+ELV E IPATLI D+ AAALM    
Sbjct  182   TALGIIRSLHANASLDHAYCTETRPYNQGSRLTAYELVYEQIPATLITDNMAAALMSQQG  241

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             + AVIVGADR+AANGDTANKIGTY LA+ A   GV F VAAP TSVDL   +G+ I IE+
Sbjct  242   LAAVIVGADRVAANGDTANKIGTYQLAILAKFFGVKFVVAAPTTSVDLYTKNGEGIKIEQ  301

Query  532   RSPKELLHTHGGL---------GEQI-----------AASGISVWNPAFDVTPASLISGI  413
             R   E+L   G           GE +           AA+GI V+NP+FDVTPA+LI  I
Sbjct  302   RPGWEVLVVSGPTVTNNPAKESGEVVVDVTDIRSVKQAANGIGVFNPSFDVTPAALIDAI  361

Query  412   ITEKGVISKDGNDAFDITG  356
             +TE GV+ K+ +  F + G
Sbjct  362   VTENGVVEKNADGIFAMEG  380



>emb|CEF98703.1| Putative translation initiation factor,aIF-2BI/5-methylthioribose-1-phosphate 
isomerase [Ostreococcus tauri]
Length=798

 Score =   337 bits (863),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 203/366 (55%), Positives = 257/366 (70%), Gaps = 8/366 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y RGSL++LDQ +LPL+T Y+D+   +  W  IK+M VRGAPAIAIAAAL+LA 
Sbjct  3     TLEAIAYVRGSLRVLDQLRLPLETTYVDVPTCEACWRCIKDMRVRGAPAIAIAAALALAT  62

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E          + +  +F  ++ +Y+ +SRPTAVNL +A  ++ +V    A T    +TI
Sbjct  63    ELERTRGRFRASAEVAAFARERFDYMYTSRPTAVNLGEARGRIQKVAMTLAETCDVTETI  122

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSK---KISILTHCNTGSLATAGYG  893
              +  I A E MLE+DV S + IG  GA  L    VG+K   KI ++T CNTGSLATAGYG
Sbjct  123   -DGVIEACEAMLEEDVRSCREIGRRGAEALLAS-VGAKDGEKIKVMTCCNTGSLATAGYG  180

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA+   G LERAYC ETRP+NQGSRLTA+ELV E IP TLI D+ AAALM  G 
Sbjct  181   TALGVIRALWERGRLERAYCLETRPYNQGSRLTAYELVYEKIPGTLICDNMAAALMARGD  240

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+A++VGADR+AANGD ANKIGTYSLAV A HHGVP + AAP+T++D   ++G  I IEE
Sbjct  241   VDAIVVGADRVAANGDFANKIGTYSLAVNAKHHGVPMFTAAPVTTLDPETATGADIHIEE  300

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGF  353
             R   E+ H+   LG+++AA GI VWNP+FDVTPA+L+SGIITE GVI K+    F ++ F
Sbjct  301   RPADEVTHS---LGKRVAAEGIDVWNPSFDVTPAALLSGIITESGVIEKNVKGFFPVSEF  357

Query  352   VHKVSG  335
             V  V G
Sbjct  358   VANVKG  363



>ref|XP_003697763.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Apis 
florea]
Length=355

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 194/349 (56%), Positives = 243/349 (70%), Gaps = 16/349 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI ++ G L++LDQ  LP  + Y+ ++  +DGW  I  M VRGAPAIAI   LSLA 
Sbjct  2     TLQAIKWENGKLEILDQILLPAMSRYISVRGVEDGWKVINNMQVRGAPAIAIVGCLSLAT  61

Query  1243  eaSNLETFNGTA--QDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTA  1082
             E  N +  +  +  QD    +  KL YLVS+RPTAVN+  AA +L    N++   E    
Sbjct  62    EIKNEKYIDKKSLRQD----VEGKLNYLVSARPTAVNMKIAADELIHLANKLSKDETVNV  117

Query  1081  SEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATA  902
              E +   E +I A E MLE D+A NKAIG +GA  +   + G   + ILTHCNTGSLATA
Sbjct  118   IEMQ---ERFIKAIEAMLEKDIADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATA  174

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk  722
             GYGTALGVIR+++    LE AYC+ETRP+NQG+RLTA+ELV ENIPATLI D   AALMK
Sbjct  175   GYGTALGVIRSLHKKNSLELAYCSETRPYNQGARLTAYELVYENIPATLICDDMVAALMK  234

Query  721   AGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIV  542
             +  ++AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ +G  I+
Sbjct  235   SRNISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPNGDHII  294

Query  541   IEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  395
             IEER  +EL H +    ++IAA GI  WNPAFDVTPA+LI GIITE GV
Sbjct  295   IEERPERELTHIN---DQRIAAPGIQCWNPAFDVTPANLIKGIITEVGV  340



>ref|XP_002054225.1| GJ22917 [Drosophila virilis]
 sp|B4LWZ8.1|MTNA_DROVI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
virilis]
 gb|EDW67745.1| GJ22917 [Drosophila virilis]
Length=362

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 196/355 (55%), Positives = 250/355 (70%), Gaps = 20/355 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y+RGSL++LDQ  LP+ + YL ++  +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYQRGSLEILDQLLLPVVSKYLTVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E    E F G+ +     +  KL YLVS+RPTAVN+  +A +L    NE+   +  T  +
Sbjct  62    EIYP-EEF-GSKKSLRQEIEGKLNYLVSARPTAVNMKISADELITLANELTKDDNVTVED  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSK------KISILTHCNTGS  914
              K   + ++ A E MLE D+A N+AIG++GA  +   +  S        + +LTHCNTGS
Sbjct  120   MK---QRFLNATEAMLEKDIADNRAIGANGAKAILEHVAESASAAAAGPVRVLTHCNTGS  176

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALGV+R ++  G LE  YCTETRP+NQG+RLTA+ELV E +PATL+ DS  A
Sbjct  177   LATAGYGTALGVVRHLSELGKLEHVYCTETRPYNQGARLTAYELVHEKLPATLVLDSMVA  236

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             AL++   V AV+VGADR+AANGDTANKIGTY +AV A HHGVPFYVAAPLTSVDL + SG
Sbjct  237   ALLRVKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGVPFYVAAPLTSVDLQIPSG  296

Query  553   QQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
               I+IE R  +E+ H    +GE +IAA GI+ WNPAFDVTPASL++GIITE GV 
Sbjct  297   DHIIIEVRPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLVTGIITEHGVF  347



>ref|XP_003486247.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Bombus 
impatiens]
Length=355

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 241/347 (69%), Gaps = 12/347 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI ++ G L++LDQ  LP  + Y+ +K  +DGW  I  M VRGAPAIAI   LSLA 
Sbjct  2     TLQAIKWENGKLEILDQILLPAISRYIPVKGVEDGWKVINNMQVRGAPAIAIVGCLSLAT  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E  N E  +   +     +  KL YLVS+RPTAVN+  AA +L    N++   E     E
Sbjct  62    EIRNEEYMD--KKSLRRDIEGKLNYLVSARPTAVNMKIAADELIQLANKLSKDETVNVIE  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              K   E +I A E MLE D+A NKAIG +GA  +   + G   + ILTHCNTGSLATAGY
Sbjct  120   MK---ERFIAAIEAMLEKDIADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGY  176

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIR+++    LE AYC+ETRP+NQG+RLTA+ELV E++PATLI D   AALMK+ 
Sbjct  177   GTALGVIRSLHKRNSLEHAYCSETRPYNQGARLTAYELVYEDVPATLICDDMVAALMKSR  236

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              ++AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D ++ +G  IVIE
Sbjct  237   NISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFTIPNGDHIVIE  296

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  395
             ER  +E+ H +    ++IAA GI  WNPAFDVTPASLI GIITE GV
Sbjct  297   ERPEREMTHIN---DQRIAAPGIQCWNPAFDVTPASLIKGIITEVGV  340



>emb|CCX34105.1| Similar to Methylthioribose-1-phosphate isomerase; acc. no. C5FY68 
[Pyronema omphalodes CBS 100304]
Length=375

 Score =   323 bits (829),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 251/374 (67%), Gaps = 25/374 (7%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQAI Y RGSL +LDQ +LP  +IY+ I   + GWDAIK MVVRGAPAIAI AAL+LAV
Sbjct  2     SLQAIKYTRGSLTILDQLRLPHASIYVPISTCEAGWDAIKRMVVRGAPAIAIVAALALAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  +++      Q     + ++LEYLV+SRPTAVNL+DAA KLN V+ ++A  A E   +
Sbjct  62    ELVDIKAAELEPQQQRQRIQERLEYLVTSRPTAVNLADAAGKLN-VVAQKAFEAGEG--V  118

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
              + Y+ AAE ML DDVA NKAIG HGA  +  Q  G  ++++LTHCNTGSLATAGYGTAL
Sbjct  119   VDKYLEAAEKMLVDDVADNKAIGDHGAQWIVEQ-AGDAEVAVLTHCNTGSLATAGYGTAL  177

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR---  713
             G+IR++NTAG L  AYCTETRP+NQGSRLTA+EL + +IPA        +      R   
Sbjct  178   GIIRSLNTAGHLSHAYCTETRPYNQGSRLTAYEL-SVDIPAGKSTLITDSMASSLLRSRK  236

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             + A++VGADR+AANGDTANKIGTY LA+ A +HGV F VAAP T++D+   SG++I IE+
Sbjct  237   IAAIVVGADRVAANGDTANKIGTYQLAIVAKYHGVKFVVAAPRTTIDMKTKSGEEIEIEQ  296

Query  532   RSPKELLHTHGG-----------LGEQI------AASGISVWNPAFDVTPASLISGIITE  404
             R  +E+L   G            + E+          G+SV+NP+FDVTP  LI  I TE
Sbjct  297   RPEEEVLVVTGPRAKITKDGVEVMQEETYTVAPGVTGGVSVYNPSFDVTPKDLIDAIATE  356

Query  403   KGVISKDGNDAFDI  362
             KGV  K+    F++
Sbjct  357   KGVCVKNAQGEFEL  370



>ref|XP_002105622.1| GD16414 [Drosophila simulans]
 sp|B4QSM8.1|MTNA_DROSI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
simulans]
 gb|EDX15125.1| GD16414 [Drosophila simulans]
Length=364

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 197/357 (55%), Positives = 251/357 (70%), Gaps = 22/357 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y RGSL++LDQ  LP Q+ Y+ ++  +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYSRGSLEILDQLLLPGQSKYVVVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E  N E F    +     +  KL YLVS+RPTAVN+  AA +L    NE+   EA+  ++
Sbjct  62    EI-NPEDFENK-KSLRQEIEGKLNYLVSARPTAVNMKIAADELITLANELYKDEATDVTQ  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNT  920
              K  F   + A E ML+ D+A N+AIG++GA  +  ++  + K        + +LTHCNT
Sbjct  120   MKHRF---LDATEAMLKKDIADNRAIGANGAQAILQRVAKAGKTPAGSTGSVRVLTHCNT  176

Query  919   GSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsa  740
             GSLATAGYGTALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS 
Sbjct  177   GSLATAGYGTALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSM  236

Query  739   aaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLS  560
              AAL++A  V AV+VGADR+A+NGDTANKIGTY +AV A HH VPFYVAAPLTS+DL++ 
Sbjct  237   VAALLRAKNVAAVVVGADRVASNGDTANKIGTYQIAVVAKHHDVPFYVAAPLTSIDLAIP  296

Query  559   SGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
              G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE+GV 
Sbjct  297   GGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITERGVF  349



>ref|XP_003397603.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Bombus 
terrestris]
Length=355

 Score =   322 bits (826),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 241/347 (69%), Gaps = 12/347 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI ++ G L++LDQ  LP  + Y+ +K  +DGW  I  M VRGAPAIAI   LSLA 
Sbjct  2     TLQAIKWENGKLEILDQILLPAISRYIPVKGVEDGWKVINNMQVRGAPAIAIVGCLSLAT  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E  N E  +   +     +  KL YLVS+RPTAVN+  AA +L    N++   E     E
Sbjct  62    EIRNEEYMD--KKSLRRDVEGKLNYLVSARPTAVNMKIAADELIQLANKLSKDETVNVIE  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              K   E +I A E MLE D+A NKAIG +GA  +   + G   + ILTHCNTGSLATAGY
Sbjct  120   MK---ERFIAAIEAMLEKDIADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGY  176

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIR+++    LE AYC+ETRP+NQG+RLTA+ELV E++PATLI D   AALMK+ 
Sbjct  177   GTALGVIRSLHKRNSLEHAYCSETRPYNQGARLTAYELVYEDVPATLICDDMVAALMKSR  236

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              ++AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D ++ +G  IVIE
Sbjct  237   NISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFTIPNGDHIVIE  296

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  395
             ER  +E+ H +    ++IAA GI  WNPAFDVTPASLI GIITE GV
Sbjct  297   ERPEREMTHIN---DQRIAAPGIQCWNPAFDVTPASLIKGIITEVGV  340



>ref|XP_008724306.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
carrionii CBS 160.54]
 gb|ETI26993.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
carrionii CBS 160.54]
Length=395

 Score =   323 bits (829),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 203/383 (53%), Positives = 258/383 (67%), Gaps = 42/383 (11%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      L++LDQ +LP +T Y+ +   ++   AIK+M VRGAPAIAI AA
Sbjct  3     LQAIQYEPASGNSGPALRILDQLQLPHRTAYVAVSTCEEAHAAIKQMKVRGAPAIAIVAA  62

Query  1258  lslaveaSN------LETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITK  1097
             L+LAVE  N      L    G  +D ++   Q+L+YL +SRPTAVNL DA  KL +++TK
Sbjct  63    LALAVEIGNEIVAGRLPAVPGDVRDTIA---QRLDYLKTSRPTAVNLGDAVGKL-KIVTK  118

Query  1096  EASTASEA--KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------  947
             +A+   EA  ++I EAYI+AAE ML DDV+ NKAIG HGA  ++   V  KK        
Sbjct  119   KATLQPEASSQSIAEAYILAAEQMLVDDVSDNKAIGEHGARWIEANTVAGKKRKADTSQQ  178

Query  946   ISILTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENI  767
             + +LTHCNTGSLATAGYGTALGVIR++ +A  L RAYC+ETRP+NQGSRLTA+ELV + I
Sbjct  179   LQVLTHCNTGSLATAGYGTALGVIRSLRSADMLTRAYCSETRPYNQGSRLTAYELVHDEI  238

Query  766   Pat--liadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVA  593
             PAT    + + A    +  R+ AV+VGADR+AANGDTANKIGT+SLAV A HHGV F VA
Sbjct  239   PATLITDSMACALMDKEGDRLAAVVVGADRVAANGDTANKIGTHSLAVLARHHGVKFLVA  298

Query  592   APLTSVDLSLSSGQQIVIEERSPKELLHTHG-----------GLGEQI---AASGISVWN  455
             AP T++D   +SG+ IVIEER+P+E+    G             G ++   AA GI VWN
Sbjct  299   APRTTIDRDTASGEDIVIEERAPEEVTRIKGPKVTVEGKLLLDEGSEVVSTAAIGIEVWN  358

Query  454   PAFDVTPASLISGIITEKGVISK  386
             PAFDVTPA LI G+ITE GV+ K
Sbjct  359   PAFDVTPAELIDGVITEVGVVEK  381



>ref|XP_392553.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X4 [Apis mellifera]
Length=355

 Score =   322 bits (825),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 190/344 (55%), Positives = 241/344 (70%), Gaps = 6/344 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI ++ G L++LDQ  LP  + Y+ ++  +DGW  I  M VRGAPAIAI   LSLA 
Sbjct  2     TLQAIKWENGKLEILDQILLPAMSRYISVRGVEDGWKVINNMQVRGAPAIAIVGCLSLAT  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-EAKT  1067
             E  N +  +   ++    +  KL YLVS+RPTAVN+  AA +L ++  K +   +     
Sbjct  62    EIKNEKYID--KKNLRQDVEGKLNYLVSARPTAVNMKIAADELIQLANKLSKDETVNVIE  119

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTA  887
             + E +I A E MLE D+A NKAIG +GA  +   + G   + ILTHCNTGSLATAGYGTA
Sbjct  120   MQERFIKAIEAMLEKDIADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGYGTA  179

Query  886   LGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVN  707
             LGVIR+++    LE  YC+ETRP+NQG+RLTA+ELV ENIPATLI D   AALMK+  ++
Sbjct  180   LGVIRSLHKKNSLELVYCSETRPYNQGARLTAYELVYENIPATLICDDMVAALMKSRNIS  239

Query  706   AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERS  527
             AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ SG  I+IEER 
Sbjct  240   AVVVGADRVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPSGDHIIIEERP  299

Query  526   PKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  395
              +EL H +    ++IAA GI  WNPAFDVTPA+LI GIITE GV
Sbjct  300   ERELTHIN---DQRIAAPGIQCWNPAFDVTPANLIKGIITEVGV  340



>ref|XP_001641945.1| predicted protein [Nematostella vectensis]
 sp|A7RF00.1|MTNA_NEMVE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Nematostella 
vectensis]
 gb|EDO49882.1| predicted protein [Nematostella vectensis]
Length=350

 Score =   322 bits (825),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 190/345 (55%), Positives = 245/345 (71%), Gaps = 9/345 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+AI YK+G L++L+Q  LP ++ Y  + + +DGW AI+EM VRGAPAIAI  ALSLA 
Sbjct  2     SLEAIKYKKGRLEILNQLLLPHESTYEVVSDTEDGWKAIREMKVRGAPAIAIVGALSLAA  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E  + + F  ++++   F+ QKL+YL ++RPTAVN+++A  +L   +     T    K +
Sbjct  62    EIYS-KPF-ASSEELAEFVKQKLQYLNTARPTAVNMTNAVIELTAFVAD--LTKCSPKDM  117

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
              +  +   E ML +D+A NKAIG  GA  +   + G   + +LTHCNTGSLATAGYGT L
Sbjct  118   KQKLLSKIEGMLSEDIAQNKAIGKFGAESILGAVGGP--VRMLTHCNTGSLATAGYGTGL  175

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIR+++    LE  YCTETRP+NQGSRLTA+ELV E IP+TLIADSA +  MK  +++A
Sbjct  176   GVIRSIHEMKQLEHVYCTETRPYNQGSRLTAYELVYEKIPSTLIADSAVSMAMKTKKISA  235

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADRIA NGDTANKIGTY LA+ A HH +PFYVAAP+TS+D SL +G  IVIEERSP
Sbjct  236   VVVGADRIACNGDTANKIGTYQLALAAKHHEIPFYVAAPVTSIDFSLVNGDAIVIEERSP  295

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
              EL       G  +AASGI VWNPAFDVTPA LI+GI+TE G  S
Sbjct  296   LELTSVK---GIPVAASGIGVWNPAFDVTPAGLITGIVTEHGTFS  337



>ref|XP_002842304.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ86495.1| unnamed protein product [Tuber melanosporum]
Length=363

 Score =   322 bits (826),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 205/367 (56%), Positives = 261/367 (71%), Gaps = 16/367 (4%)
 Frame = -2

Query  1423  TLQAICYKR--GSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             +LQAI Y     +LQ+LDQ KLP +++Y+ I   +D +DAIK MVVRGAPAIAI AAL+L
Sbjct  2     SLQAILYTPTPPALQILDQLKLPHESVYVPICTCEDAYDAIKRMVVRGAPAIAIVAALAL  61

Query  1249  aveaSN--LETFNG-TAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  1079
             AVE S+  L +  G +A DA +++ ++L+YLV SRPTAVNL+DAA KL  V++ EA TA 
Sbjct  62    AVELSSGGLPSEVGESAGDARAYVHRRLDYLVQSRPTAVNLADAAGKLKAVVSAEAGTA-  120

Query  1078  EAKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKK----ISILTHCNTGS  914
               + +   Y+ AAE ML DDV  N+ IG  GA  +L+N  VG  +    +++LTHCNTGS
Sbjct  121   --EAVVGRYVEAAEKMLVDDVMDNENIGRFGAEWILENAKVGEGEEKGMVAVLTHCNTGS  178

Query  913   LATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaa  734
             LATAGYGTALG+IR++N+   L   YCTETRP+NQGSRLTAFELV + IPATLI DS A+
Sbjct  179   LATAGYGTALGIIRSLNSRSNLTHIYCTETRPYNQGSRLTAFELVHDKIPATLITDSMAS  238

Query  733   almkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
             +LM    + AVIVGADR+AANGDTANKIGTY LA+ A +HGV F VAAP TS+D+  +SG
Sbjct  239   SLMSLKSIAAVIVGADRVAANGDTANKIGTYQLAIVAKYHGVKFVVAAPTTSIDMKTASG  298

Query  553   QQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGND  374
             + IVIE R  KE+ +         AA GI+V+NP+FDVTP  LI  I+TEKGV  KD   
Sbjct  299   KDIVIEHRPGKEVTNVE---TVATAARGINVYNPSFDVTPKGLIDAIVTEKGVAVKDAGG  355

Query  373   AFDITGF  353
              F ++ F
Sbjct  356   DFGLSRF  362



>ref|XP_003700639.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Megachile rotundata]
Length=355

 Score =   322 bits (825),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 240/347 (69%), Gaps = 12/347 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI ++ G L++LDQ  LP  + Y+ +K  +DGW  I  M VRGAPAIAI   LSLA 
Sbjct  2     TLQAIKWENGRLEILDQILLPAISRYIPVKGVEDGWKVINNMQVRGAPAIAIVGCLSLAT  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E  N E  +   +     +  KL YLVS+RPTAVN+  AA +L    N++   E     E
Sbjct  62    EIKNEEYMD--KKSLRRDIEGKLNYLVSARPTAVNMKIAAEELIQLANKLSKDETVNVIE  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              K   + ++ A E ML+ DVA NKAIG +GA  +   + G   + ILTHCNTGSLATAGY
Sbjct  120   MK---QRFLQAIEAMLDKDVADNKAIGDYGAQEILKNVSGDNFVRILTHCNTGSLATAGY  176

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIR+++    LE AYC+ETRP+NQG+RLTA+ELV E IPATLI D   AALMK+ 
Sbjct  177   GTALGVIRSLHKKNSLEHAYCSETRPYNQGARLTAYELVYEKIPATLICDDMVAALMKSR  236

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              ++AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ SG  I+IE
Sbjct  237   NISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPSGDHIIIE  296

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  395
             ER  +EL H +    +++AA GI  WNPAFDVTPASLI GIITE GV
Sbjct  297   ERPERELTHIN---NQRVAAPGIQCWNPAFDVTPASLIRGIITEVGV  340



>ref|XP_006678377.1| hypothetical protein BATDEDRAFT_19408 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80893.1| hypothetical protein BATDEDRAFT_19408 [Batrachochytrium dendrobatidis 
JAM81]
Length=399

 Score =   323 bits (829),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 199/391 (51%), Positives = 259/391 (66%), Gaps = 33/391 (8%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y RG L +LDQ  LP +++Y  IK A DG++AIK M VRGAPAIAI AALSLAV
Sbjct  6     TLQAIKYSRGHLDILDQLILPFESVYETIKTAHDGYNAIKTMKVRGAPAIAIVAALSLAV  65

Query  1243  eaSNLETFNGTA-----QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  1079
             E  +  T   +A     QDAV F+S +L  L +SRPTAVNL +AA +L   +   A+ A+
Sbjct  66    ELHSETTHRSSAAFKTPQDAVDFISDRLTLLKTSRPTAVNLFEAADRLLRTVQDAATKAA  125

Query  1078  E------AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSK--KISILTHCN  923
             +         I +AY+  AE ML+ D+  N  IG  GA  +Q+  V  +  K+ +LTHCN
Sbjct  126   KDLVDNPIAVIVKAYMDTAEAMLQQDIQDNMNIGRFGAQFIQDHAVKHQGSKVRVLTHCN  185

Query  922   TGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliads  743
             TGSLATAG+GTALG++R +++   L+ A+CTETRP+NQG+RLTA+ELV E IP+TL+ DS
Sbjct  186   TGSLATAGWGTALGIVRELHSRDKLDHAFCTETRPYNQGARLTAYELVYEQIPSTLVCDS  245

Query  742   aaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSL  563
              A+AL++   + A++VGADR+AANGDTANKIGTY LA+ A +H   F VAAP TS+DL  
Sbjct  246   MASALLREKSIAAIVVGADRVAANGDTANKIGTYQLAIIAKYHNALFIVAAPSTSIDLET  305

Query  562   SSGQQIVIEERSPKELLHTHGGLGE-------------------QIAASGISVWNPAFDV  440
              +G+ I IE+RS  E+ H  G   +                   +IAA GI +WNPAFDV
Sbjct  306   QNGEAIEIEQRSALEVTHIRGKTLDDEANVKEHQFNESMTTTLIEIAARGIDIWNPAFDV  365

Query  439   TPASLISGIITEKGVI-SKDGNDAFDITGFV  350
             TPASLIS I+TE+GVI  K G+D F I  F+
Sbjct  366   TPASLISAIVTERGVILKKPGHDEFSIKEFL  396



>emb|CBJ48521.1| eukaryotic translation initiation factor 2B family protein / 
eIF-2B family protein [Ectocarpus siliculosus]
Length=759

 Score =   334 bits (856),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 201/366 (55%), Positives = 257/366 (70%), Gaps = 11/366 (3%)
 Frame = -2

Query  1411  ICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslaveaSN  1232
             I Y RGSLQ+L+Q KLP +T Y+D++ A+D +DAIK M+VRGAP IAI AAL LAVEAS+
Sbjct  8     IRYTRGSLQVLNQLKLPHETEYMDVRGAEDAFDAIKTMMVRGAPLIAIVAALGLAVEASS  67

Query  1231  LETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAKTIFEA  1055
               T NGTAQ+A S L +KL+YL +SR TAVNL++A   L   I+ EA+   S   +  EA
Sbjct  68    GATQNGTAQEASSMLHEKLDYLKTSRETAVNLANACDALKTTISGEAAREGSTWSSTVEA  127

Query  1054  YIMAAEIMLEDDVASNKAIGSHG--ASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             ++ AAE MLE+D+A+N+  G +   A L +    G  ++S+LTHCNTGSLATAG+GTALG
Sbjct  128   FVGAAEAMLEEDIAANRRQGGYAVEALLSEPSCKGKARLSVLTHCNTGSLATAGFGTALG  187

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             VIRA++  G L   YCTETRP+NQG+RLTA+E V + +P TLI DSAA+ LM  G+V+AV
Sbjct  188   VIRALDEKGLLASCYCTETRPYNQGARLTAYEFVADGLPGTLIPDSAASFLMAQGKVDAV  247

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
              VGADR+AANGDTANKIGT  LA+ A H+G+PF V APLTS D   ++G  I IEER   
Sbjct  248   AVGADRVAANGDTANKIGTLQLAIAAAHYGIPFLVVAPLTSCDPETATGGGISIEERPAS  307

Query  520   ELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK-----DGNDAFDITG  356
             EL       G +IA  GIS WNPAFDVTPA LI+ I+T+KG + +     D +  FD+  
Sbjct  308   ELKTVA---GTKIAPDGISAWNPAFDVTPARLITAIVTDKGCVPRKEATGDKDKEFDVKA  364

Query  355   FVHKVS  338
             F   +S
Sbjct  365   FCQAMS  370



>ref|XP_002037477.1| GM12085 [Drosophila sechellia]
 sp|B4I029.1|MTNA_DROSE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
sechellia]
 gb|EDW53636.1| GM12085 [Drosophila sechellia]
Length=364

 Score =   322 bits (824),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 197/358 (55%), Positives = 250/358 (70%), Gaps = 22/358 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y RGSL++LDQ  LP Q+ Y+ ++  +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYSRGSLEILDQLLLPGQSKYVVVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E  N E F    +     +  KL YLVS+RPTAVN+  AA +L    NE+   EA   ++
Sbjct  62    EI-NPEDFENK-KSLRQEIEGKLNYLVSARPTAVNMKIAADELITLANELYKDEAIDVTQ  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISILTHCNT  920
              K  F   + A E ML+ D+A N+AIG++GA  +  ++  + K        + +LTHCNT
Sbjct  120   MKHRF---LDATEAMLKKDIADNRAIGANGAQAILQRVAKAGKTTAGTTGSVRVLTHCNT  176

Query  919   GSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsa  740
             GSLATAGYGTALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS 
Sbjct  177   GSLATAGYGTALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSM  236

Query  739   aaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLS  560
              AAL++A  V AV+VGADR+A+NGDTANKIGTY +AV A HH VPFYVAAPLTS+DL++ 
Sbjct  237   VAALLRAKNVAAVVVGADRVASNGDTANKIGTYQIAVVAKHHDVPFYVAAPLTSIDLAIP  296

Query  559   SGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
              G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE+GV  
Sbjct  297   GGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITERGVFK  350



>gb|KJE93735.1| translation initiation factor eif-2b [Capsaspora owczarzaki ATCC 
30864]
Length=361

 Score =   322 bits (824),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 199/366 (54%), Positives = 251/366 (69%), Gaps = 8/366 (2%)
 Frame = -2

Query  1435  SEDKTLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaal  1256
             S   TL+AI Y RGSL +LDQ +LP QT+Y+ I +++  W AI+ M VRGAPAIAI AAL
Sbjct  2     SSTPTLEAIRYTRGSLDILDQLQLPAQTVYVSIPDSRAAWTAIRSMQVRGAPAIAIVAAL  61

Query  1255  slaveaSNL-ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS  1079
             S+AVE +         AQ     +    E L +SRPTAVNLS+AA+ L       A++ +
Sbjct  62    SVAVELAAAPRAAWPNAQAVADHVRLAFEALCTSRPTAVNLSEAASALTARAAALAASNA  121

Query  1078  EAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAG  899
                T  +A + A E ML  DVA N+AIG+HG + +   L    + ++LTHCNTGSLATAG
Sbjct  122   SVDTTVDALLKAMEDMLLKDVADNRAIGAHGRAAI---LAAKSQAAMLTHCNTGSLATAG  178

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA  719
             YGTALG+IRA++  G L  AYCTETRP+NQG+RLTA+ELV E IPATLI DS  AALM +
Sbjct  179   YGTALGIIRALHETGKLSHAYCTETRPYNQGARLTAYELVYERIPATLITDSMVAALMAS  238

Query  718   GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
              +++AV+VGADR+ ANGDTANKIGTY LA+ A  H VPFYVAAP TS+DL  + G  I I
Sbjct  239   RKIDAVVVGADRVVANGDTANKIGTYQLAIVAKFHNVPFYVAAPTTSIDLDKADGSMITI  298

Query  538   EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGND-AFDI  362
             EER   EL   +   G +IAA+ I VWNP FDVTPA+LI+GI+TE GVIS    D +FD+
Sbjct  299   EERPASELTQLN---GVRIAAADIGVWNPGFDVTPAALITGIVTENGVISARREDGSFDV  355

Query  361   TGFVHK  344
               F+ +
Sbjct  356   QSFLSR  361



>ref|XP_003172192.1| methylthioribose-1-phosphate isomerase [Microsporum gypseum CBS 
118893]
 gb|EFR01781.1| methylthioribose-1-phosphate isomerase [Microsporum gypseum CBS 
118893]
Length=385

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 256/377 (68%), Gaps = 23/377 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I YKRG LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++
Sbjct  2     SLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSI  61

Query  1243  eaSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI-TKEASTASE  1076
             E + L   +  +  A +  +++ +KL+YLV+SRPTAVNLSDAA KL  ++ T++     +
Sbjct  62    ELTELMDHDKLSAEADEVEAYILEKLDYLVTSRPTAVNLSDAAIKLKALVQTRKQIGDPK  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGS--KKISILTHCNTGSLAT  905
              K + EAY+ AAE ML DD   N  +G  GA+ ++ N  VG   KK+ +LTHCNTGSLAT
Sbjct  122   GKDLAEAYVEAAEKMLIDDAMDNHRLGDFGAAWIVNNTPVGKEGKKVGVLTHCNTGSLAT  181

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR++  +  LE AYCTETRP+NQG+RLTAFELV + IPATLI DS AA+L+
Sbjct  182   AGYGTALGVIRSLLASDKLEHAYCTETRPYNQGARLTAFELVHDKIPATLITDSMAASLL  241

Query  724   kA--GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQ  551
                   + A++VGADR+ ANGDTANKIGTY LAV A +HGV F VAAP T++DL    G+
Sbjct  242   AQKGAGLAAIVVGADRVVANGDTANKIGTYQLAVLAKYHGVKFIVAAPRTTIDLRTKEGE  301

Query  550   QIVIEERSPKELLHTHG------GLGEQ--------IAASGISVWNPAFDVTPASLISGI  413
              I+IEER+  E+    G      G  E+        IAA GI VWNPAFDVTP  LI  I
Sbjct  302   DIIIEERAKSEVTRITGPRISDLGKNEENITLETVNIAAPGIDVWNPAFDVTPYDLIDAI  361

Query  412   ITEKGVISKDGNDAFDI  362
             +TE GV  KD +  F +
Sbjct  362   VTEVGVAEKDADGLFQL  378



>ref|XP_007583690.1| putative methylthioribose-1-phosphate isomerase protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD48853.1| putative methylthioribose-1-phosphate isomerase protein [Neofusicoccum 
parvum UCRNP2]
Length=1824

 Score =   346 bits (887),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 211/378 (56%), Positives = 265/378 (70%), Gaps = 28/378 (7%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y+RGSLQ+LDQ +LP   +Y DI +A+D W AIKEM  RGAPAIAI AAL+LAV 
Sbjct  3     LQAIKYERGSLQILDQLRLPHAEVYDDIHSAQDAWHAIKEMRTRGAPAIAIVAALALAV-  61

Query  1240  aSNLET------FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI-TKEASTA  1082
                LET       +  A++    ++Q L+YLV+SRPTAVNL+DAA KL +++ T      
Sbjct  62    --QLETTAKNDELSSIAEEVRESIAQALDYLVTSRPTAVNLADAARKLRKIVDTAAVVQG  119

Query  1081  SEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVG-SKKISILTHCNTGSLA  908
             +   ++ +AY+ AAE ML DDV+ N+ IG HGA  +++N   G S ++S++THCNTGSLA
Sbjct  120   ASGTSVKDAYVQAAEKMLVDDVSDNENIGKHGAEWIVKNTEAGKSGQVSVVTHCNTGSLA  179

Query  907   TAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaa-  731
             TAGYGTALGVIR+++  G L+ A+CTETRP+NQGSRLTAFELV + IPATL+ DS AAA 
Sbjct  180   TAGYGTALGVIRSLHANGALKHAFCTETRPYNQGSRLTAFELVHDKIPATLVTDSMAAAL  239

Query  730   ---lmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLS  560
                  +  R+ A++VGADR+AANGDTANKIGTYSLA+ A HHGV F VAAP T+VDL   
Sbjct  240   LRLRGQPERIAAIVVGADRVAANGDTANKIGTYSLAINARHHGVKFLVAAPRTTVDLHTK  299

Query  559   SGQQIVIEERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISG  416
             +GQ IVIEER  KE+    G   +             IAA+GI VWNPAFDVTPA LI G
Sbjct  300   TGQDIVIEERPGKEVTLVKGPRYDGASLDLNAVETVSIAANGIDVWNPAFDVTPAELIDG  359

Query  415   IITEKGVISKDGNDAFDI  362
             IITE GV+ KD +  F +
Sbjct  360   IITEVGVVEKDSDGIFRM  377



>ref|XP_002843502.1| methylthioribose-1-phosphate isomerase [Arthroderma otae CBS 
113480]
 sp|C5FY68.1|MTNA_ARTOC RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Arthroderma 
otae CBS 113480]
 gb|EEQ34466.1| methylthioribose-1-phosphate isomerase [Arthroderma otae CBS 
113480]
Length=385

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 254/377 (67%), Gaps = 23/377 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I YKRG LQ+LDQ ++P    Y+ +  AK+GW  IKEM VRGAPAIAI A LSL++
Sbjct  2     SLQSIRYKRGMLQVLDQLQVPHVERYIPVSTAKEGWHVIKEMHVRGAPAIAIVAVLSLSI  61

Query  1243  eaSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-E  1076
             E + L   E  +  A +  +++ +KL+YLV+SRPTAVNLSDAA KL  ++ K       +
Sbjct  62    ELTELMDHEKLSTEADEVEAYILEKLDYLVTSRPTAVNLSDAAIKLKTLVQKRKQIGDPK  121

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGS--KKISILTHCNTGSLAT  905
              K + EAY+ AAE ML DD   N  +G  GA+ ++ N  VG   KK+ +LTHCNTGSLAT
Sbjct  122   GKDLAEAYVEAAEKMLIDDAMDNHRLGDFGATWIVNNTPVGKEGKKVGVLTHCNTGSLAT  181

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR++  +  LE AYCTETRP+NQG+RLTAFELV + IPATLI DS AA+L+
Sbjct  182   AGYGTALGVIRSLLASDKLEHAYCTETRPYNQGARLTAFELVHDKIPATLITDSMAASLL  241

Query  724   kA--GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQ  551
                   + A++VGADR+ ANGDTANKIGTY LAV A +HGV F VAAP T++DL    G+
Sbjct  242   AQKGAGLAAIVVGADRVVANGDTANKIGTYQLAVLAKYHGVKFIVAAPRTTIDLRTKEGE  301

Query  550   QIVIEERSPKELLHTHG------GLGEQ--------IAASGISVWNPAFDVTPASLISGI  413
              I+IEER+  E+    G      G  E+        IAA GI VWNPAFDVTP  LI  I
Sbjct  302   DIIIEERAKSEVTRITGPRISDLGKNEENITLETVNIAAPGIDVWNPAFDVTPYDLIDAI  361

Query  412   ITEKGVISKDGNDAFDI  362
             +TE GV  K+ +  F +
Sbjct  362   VTEVGVAEKNADGLFQL  378



>ref|XP_003455807.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Oreochromis 
niloticus]
 ref|XP_004539081.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Maylandia 
zebra]
 ref|XP_005735752.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pundamilia 
nyererei]
 ref|XP_005925153.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Haplochromis 
burtoni]
 ref|XP_008278518.1| PREDICTED: methylthioribose-1-phosphate isomerase [Stegastes 
partitus]
Length=353

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 245/348 (70%), Gaps = 16/348 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y+ GSLQ+L+Q  LP QT+Y DI++ +D ++AIK M VRGAPAIAI   LSLA 
Sbjct  2     TLEAIRYRTGSLQILNQLLLPHQTVYDDIRSVQDAYEAIKSMKVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTA-QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT  1067
                 +E   G    D V+F+ + L +L S+RPTAVN+  AA +L E    E S    ++ 
Sbjct  61    ----VELRAGAGGDDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENE-SMEKNSEQ  115

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYG  893
             + E+ I   E MLE DV  N+ IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYG
Sbjct  116   LRESVIAWIEDMLERDVNDNRKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYG  172

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGV+R+++  G L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   
Sbjct  173   TALGVVRSLHALGRLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMD  232

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             + AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE 
Sbjct  233   ITAVVVGADRVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEV  292

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVI  392
             R P+EL   +   G  IAA GI VWNPAFDVTP  LI+ GIITE GV 
Sbjct  293   RPPEELTSIN---GVPIAAPGIEVWNPAFDVTPHQLITGGIITELGVF  337



>ref|XP_003798062.1| PREDICTED: methylthioribose-1-phosphate isomerase [Otolemur garnettii]
Length=364

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 249/351 (71%), Gaps = 9/351 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y RGSLQ+LDQ  LP Q+ Y  + +    W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2     TLEAIRYSRGSLQILDQLLLPHQSCYKSVDSVDQAWEAIRSMKVRGAPAIALVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDA-VSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAK  1070
             E        G   DA V+F+  KL +LV++RPTAVN++ AA  L +   +EA+   +  +
Sbjct  62    ELQ--AGAGGPGLDALVAFVRDKLSFLVTARPTAVNMARAAQDLAKDAAQEAAREGATEE  119

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYG  893
              + E  I  AE ML+ D+  N++IG  GA  LL+     S K+++LTHCNTG+LATAGYG
Sbjct  120   AVRERVIRYAEDMLDKDLRDNRSIGDLGAHHLLERVAPSSGKVTVLTHCNTGALATAGYG  179

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIR+++  G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS AAA M    
Sbjct  180   TALGVIRSLHNMGCLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMAAAAMIHKG  239

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             ++AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+I+IEE
Sbjct  240   ISAVVVGADRVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLQTGQEIIIEE  299

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
             R  +EL   +   G +IAA GI+VWNPAFDVTP  LI+ GIITE GV + +
Sbjct  300   RPGQELTDVN---GVRIAAPGIAVWNPAFDVTPHELITGGIITELGVFAPE  347



>ref|XP_011496297.1| PREDICTED: methylthioribose-1-phosphate isomerase [Ceratosolen 
solmsi marchali]
Length=349

 Score =   320 bits (819),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 242/347 (70%), Gaps = 14/347 (4%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQ+I ++ G L++LDQ  LP Q+ Y++I   KDGW AI  M VRGAPAIAI   LSLA 
Sbjct  2     TLQSIKWENGKLEILDQLLLPAQSKYIEITGVKDGWTAIHRMQVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTAQDA---VSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
                 +E F  +       +  + +KL+YLVS+RPTAVN++ AA +L +++   ++  +  
Sbjct  61    ----VEIFPKSYDKKEVLIQEIGEKLDYLVSARPTAVNINLAANELKQLMLTLSNENATP  116

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGY  896
               I E  I     ML++D+A NKAIG HGA  +++NQ   +K ++ILTHCNTGSLATAGY
Sbjct  117   ALIKEKIISRITSMLKEDIADNKAIGEHGAKEIIKNQ--NNKSVTILTHCNTGSLATAGY  174

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALG+IR++   G LE  YCTETRP+NQG+RLTA+ELV + IP+TLI D    +LMK  
Sbjct  175   GTALGIIRSLYNNGNLEHVYCTETRPYNQGARLTAYELVHDRIPSTLICDDMVGSLMKTK  234

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              ++AV++GADRI ANGDTANKIGTY +A+ A +H VPFY+AAP T++D SL  G +I IE
Sbjct  235   NISAVVIGADRIVANGDTANKIGTYQIAILAKYHSVPFYIAAPFTTIDFSLCHGDEIKIE  294

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  395
             ER   EL   +   G +IAA  I  WNP+FDVTPA LISGIITEKGV
Sbjct  295   ERPQNELTEIN---GVRIAAENIQCWNPSFDVTPADLISGIITEKGV  338



>ref|NP_651868.1| CG11334, isoform B [Drosophila melanogaster]
 ref|NP_733430.1| CG11334, isoform A [Drosophila melanogaster]
 ref|NP_001263144.1| CG11334, isoform C [Drosophila melanogaster]
 sp|Q9V9X4.1|MTNA_DROME RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
melanogaster]
 gb|AAF57154.1| CG11334, isoform A [Drosophila melanogaster]
 gb|AAF57155.1| CG11334, isoform B [Drosophila melanogaster]
 gb|AAL28212.1| GH08894p [Drosophila melanogaster]
 gb|ACL85874.1| CG11334-PA, partial [synthetic construct]
 gb|AGB96523.1| CG11334, isoform C [Drosophila melanogaster]
Length=364

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 199/357 (56%), Positives = 250/357 (70%), Gaps = 22/357 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y RGSL++LDQ  LP Q+ Y+ ++  +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYSRGSLEILDQLLLPGQSKYVVVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E  N E F    +     +  KL YLVS+RPTAVN+  AA +L    NE+   EA   ++
Sbjct  62    EI-NPEDFENK-KSLRQEIEGKLNYLVSARPTAVNMKIAADELITLANELYKDEAIDVTQ  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGA-SLLQNQLVGSK-------KISILTHCNT  920
              K  F   + A E ML+ D+A N+AIG++GA ++LQ      K        + +LTHCNT
Sbjct  120   MKHRF---LDATEAMLKKDIADNRAIGANGAQAILQGVAKAGKAPAGSTGSVRVLTHCNT  176

Query  919   GSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsa  740
             GSLATAGYGTALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS 
Sbjct  177   GSLATAGYGTALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSM  236

Query  739   aaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLS  560
              AAL++A  V AV+VGADR+A+NGDTANKIGTY +AV A HH VPFYVAAPLTS+DL++ 
Sbjct  237   VAALLRAKNVAAVVVGADRVASNGDTANKIGTYQIAVVAKHHDVPFYVAAPLTSIDLAIP  296

Query  559   SGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
              G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE+GV 
Sbjct  297   GGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITERGVF  349



>gb|KIW71970.1| S-methyl-5-thioribose-1-phosphate isomerase [Capronia semiimmersa]
 gb|KIW71971.1| S-methyl-5-thioribose-1-phosphate isomerase, variant [Capronia 
semiimmersa]
Length=395

 Score =   321 bits (823),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 206/389 (53%), Positives = 258/389 (66%), Gaps = 39/389 (10%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      L++LDQ +LP +T Y+ + N ++   AIK+M VRGAPAIAI AA
Sbjct  3     LQAIQYQPASANSAPELRILDQLQLPHRTTYVAVSNCEEAHAAIKQMKVRGAPAIAIVAA  62

Query  1258  lslaveaSNLETFNGT----AQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  1091
             L+LAVE  N E   G       +    ++Q+L+YL +SRPTAVNL DA  KL  V T  A
Sbjct  63    LALAVEIGN-EILAGRLPAGPDEVKDSIAQRLDYLKTSRPTAVNLGDAVGKLRAV-TMRA  120

Query  1090  STASE--AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------IS  941
             ++ SE  AK++ EAYI+AAE ML DDV+ NKAIG HGA  ++   V  KK        + 
Sbjct  121   TSQSEVSAKSVAEAYIVAAEQMLVDDVSDNKAIGEHGARWIEENTVAGKKRKADSSQQLQ  180

Query  940   ILTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPa  761
             +LTHCNTGSLATAGYGTALGVIR++ +A  L RA+CTETRP+NQGSRLTA+ELV + IPA
Sbjct  181   VLTHCNTGSLATAGYGTALGVIRSLRSADMLTRAFCTETRPYNQGSRLTAYELVHDEIPA  240

Query  760   t--liadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAP  587
             T    + + A    +  R+ AV+VGADR+AANGDTANKIGT+SLAV A HHGV F VAAP
Sbjct  241   TLVTDSMACALMNKERDRLAAVVVGADRVAANGDTANKIGTHSLAVLARHHGVKFLVAAP  300

Query  586   LTSVDLSLSSGQQIVIEERSPKELLHTHG-----------GLGEQI---AASGISVWNPA  449
              T++D   +SG+ IVIEER+ +E+    G             G ++   AA GI VWNPA
Sbjct  301   RTTIDRDTASGEDIVIEERASEEVTRIKGPKVTAEGKLLLDEGSEVVSTAAIGIDVWNPA  360

Query  448   FDVTPASLISGIITEKGVISKDGNDAFDI  362
             FDVTPA LI G+ITE GV+ K  N  FD 
Sbjct  361   FDVTPAELIDGVITEVGVVEK-VNGRFDF  388



>gb|KIV77933.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala sideris]
Length=395

 Score =   321 bits (822),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 211/387 (55%), Positives = 259/387 (67%), Gaps = 37/387 (10%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      L++LDQ  LP +T Y+D+ N ++   AI+ M VRGAPAIAI AA
Sbjct  3     LQAIQYEPASGSSPPALRILDQLLLPHRTTYVDVPNCEEAHAAIRTMKVRGAPAIAIVAA  62

Query  1258  lslaveaSNLETFNGT----AQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  1091
             L+LAVE    ET  G     A +    + Q+L+YL +SRPTAVNL DA  KL  V  K A
Sbjct  63    LALAVEI-GAETAAGKLPSRADEVKETVGQRLDYLKTSRPTAVNLGDAVGKLKIVAKKAA  121

Query  1090  -STASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISI  938
               + + A+++ +AYI+AAE ML DDV+ NKAIG HGA  ++   V  KK        + +
Sbjct  122   IQSGATAESVAQAYIVAAERMLVDDVSDNKAIGEHGARWIEANTVAGKKRKQDRSQQLKV  181

Query  937   LTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat  758
             LTHCNTGSLATAGYGTALGVIR++     L RAYCTETRP+NQGSRLTA+ELV + IPAT
Sbjct  182   LTHCNTGSLATAGYGTALGVIRSLRAGDMLTRAYCTETRPYNQGSRLTAYELVHDEIPAT  241

Query  757   liadsaaaalmkAGRVN--AVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
             LI DS A AL+     N  A++VGADR+AANGDTANKIGTYSLAV A HHGV F VAAP 
Sbjct  242   LITDSMACALLAKEGTNLAAIVVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKELLHTHG-----------GLGEQI---AASGISVWNPAF  446
             T++DL+ SSGQ I IE+R+P+E+    G             G ++   AA GI VWNPAF
Sbjct  302   TTIDLATSSGQDIEIEQRAPEEVTRIKGPKVATDGKVLVDEGAELISTAAIGIDVWNPAF  361

Query  445   DVTPASLISGIITEKGVISK-DGNDAF  368
             DVTPA LI G+ITE+GV+ K DG   F
Sbjct  362   DVTPAELIDGVITERGVVEKVDGKFDF  388



>ref|XP_010740335.1| PREDICTED: methylthioribose-1-phosphate isomerase [Larimichthys 
crocea]
Length=353

 Score =   319 bits (818),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 246/348 (71%), Gaps = 16/348 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y+ GSLQ+L+Q  LP QT+Y +I++ +D ++AIK M VRGAPAIAI   LSLA 
Sbjct  2     TLEAIRYRAGSLQILNQLLLPHQTVYDEIRSVQDAYEAIKSMKVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTA-QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT  1067
                 +E   G    D V+F+ + L +L S+RPTAVN+  AA +L E    E S    ++ 
Sbjct  61    ----VELRAGAGGDDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENE-SMEKNSEQ  115

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYG  893
             + E+ I   E MLE DV  NK IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYG
Sbjct  116   LRESVIAWIEDMLERDVNDNKKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYG  172

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGV+R++++ G L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   
Sbjct  173   TALGVVRSLHSLGRLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMD  232

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             + AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE 
Sbjct  233   ITAVVVGADRVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEV  292

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVI  392
             R P+EL   +   G  IAA GI VWNPAFDVTP  LI+ GIITE GV 
Sbjct  293   RPPEELTSIN---GVPIAAPGIEVWNPAFDVTPHQLITGGIITELGVF  337



>ref|XP_003972078.1| PREDICTED: methylthioribose-1-phosphate isomerase [Takifugu rubripes]
Length=353

 Score =   319 bits (818),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 245/348 (70%), Gaps = 16/348 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y+ GSLQ+L+Q  LP QT+Y D+++ +D ++AIK M VRGAPAIAI   LSLA 
Sbjct  2     TLEAIRYRAGSLQILNQLLLPHQTVYDDLRSVQDAYEAIKSMKVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTA-QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT  1067
                 +E   G    D V+F+ + L +L S+RPTAVN+  AA +L E    E S    ++ 
Sbjct  61    ----VELRAGAGGDDPVNFIRESLYHLTSARPTAVNMGRAARELMEFAENE-SMEKNSEQ  115

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYG  893
             + E+ I   E MLE DV  NK IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYG
Sbjct  116   LRESVIAWIEDMLERDVNDNKKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYG  172

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGV+R+++    L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   
Sbjct  173   TALGVVRSLHALARLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMN  232

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             ++AV+VGADR+ ANGDTANK+GTY LA+ A HHGVPFYVAAP TS DLSL SG+ I+IE 
Sbjct  233   ISAVVVGADRVVANGDTANKVGTYQLAIAAKHHGVPFYVAAPSTSCDLSLESGKDIIIEV  292

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVI  392
             R P+EL   +   G  IAA GI VWNPAFDVTP  LI+ GIITE GV 
Sbjct  293   RPPEELTSIN---GVPIAAPGIEVWNPAFDVTPHQLITGGIITELGVF  337



>ref|XP_007737063.1| S-methyl-5-thioribose-1-phosphate isomerase [Capronia epimyces 
CBS 606.96]
 gb|EXJ79275.1| S-methyl-5-thioribose-1-phosphate isomerase [Capronia epimyces 
CBS 606.96]
Length=396

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 210/380 (55%), Positives = 259/380 (68%), Gaps = 36/380 (9%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      L++LDQ  LP +T Y  I N ++   AIK+M VRGAPAIAI AA
Sbjct  3     LQAIQYEPASASSPPTLRILDQLLLPHRTAYEAIANCEEAHAAIKQMKVRGAPAIAIVAA  62

Query  1258  lslaveaSNLETFNG---TAQDAV-SFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA  1091
             L+LAVE   +    G   T+ D V   +SQ+L+YL +SRPTAVNL DA  KL  V  K A
Sbjct  63    LALAVEI-GVAAVTGKLATSPDEVREQISQRLDYLKTSRPTAVNLGDAVGKLKIVAKKAA  121

Query  1090  -STASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQ-NQLVGSKK-------ISI  938
               + + A ++ +AYI+AAE ML DDV+ NKAIG HGA  ++ N   G ++       + +
Sbjct  122   LQSGATAGSVAQAYIVAAERMLVDDVSDNKAIGEHGARWIEENTAAGRQRRGDKTCGLQV  181

Query  937   LTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat  758
             LTHCNTGSLATAGYGTALGVIR++  A  L RAYCTETRP+NQGSRLTA+ELV + +PAT
Sbjct  182   LTHCNTGSLATAGYGTALGVIRSLKAADMLTRAYCTETRPYNQGSRLTAYELVHDEVPAT  241

Query  757   liadsaaaa--lmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
             LI DS A A    +  R+ A++VGADR+AANGDTANKIGTYSLAV A HHGV F VAAP 
Sbjct  242   LITDSMACALLAREGNRLAAIVVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKELLHTHGGL----GE----------QIAASGISVWNPAF  446
             T++DL+ +SG+ IVIEER+P+E+    G      GE           IAA+GI VWNPAF
Sbjct  302   TTIDLTTASGKDIVIEERAPEEVTRIKGPKVTVDGEVQVDEAAQVISIAATGIDVWNPAF  361

Query  445   DVTPASLISGIITEKGVISK  386
             DVTPA LI G+ITE GV+ K
Sbjct  362   DVTPAELIDGVITEVGVVEK  381



>ref|XP_003057882.1| translation initiation factor fusion with methylthioribose kinase 
[Micromonas pusilla CCMP1545]
 gb|EEH57833.1| translation initiation factor fusion with methylthioribose kinase 
[Micromonas pusilla CCMP1545]
Length=815

 Score =   332 bits (851),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 206/376 (55%), Positives = 265/376 (70%), Gaps = 20/376 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y RGSLQLLDQ KLP  T+++D+ +    W AIKEM VRGAPAIAIAAAL+LAV
Sbjct  5     TLEAIRYARGSLQLLDQLKLPTSTVFIDVPDCDACWSAIKEMNVRGAPAIAIAAALALAV  64

Query  1243  eaSNLE---TFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEA  1073
             EA         +G A  A +F++QK+++L +SRPTAVNL +A  +L  +     +   +A
Sbjct  65    EAHKTRDALVASGAAAVA-TFVTQKMDHLCTSRPTAVNLGEAVIRLKALADASVADGLDA  123

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLL------------QNQLVGSKKISILTH  929
               + +A + A E MLEDDVA+N AIG+HGA  L            + + VG+  + +LTH
Sbjct  124   AAVVDAVVRACEKMLEDDVAANMAIGAHGADALCAAVASKAADPARAKPVGAA-LRVLTH  182

Query  928   CNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatlia  749
             CNTGSLATAGYGTALGV+RA+     LE  YC ETRP+NQG+RLTA+E+  E +P TLI 
Sbjct  183   CNTGSLATAGYGTALGVVRALRGRNLLEHVYCNETRPYNQGARLTAYEIAFEKMPGTLIC  242

Query  748   dsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDL  569
             DSAAAALM  G+V+AV+VGADR+A NGDTANKIGTY+LAV   +HGVPF+VAAP T++D 
Sbjct  243   DSAAAALMAKGKVDAVVVGADRVADNGDTANKIGTYNLAVSCAYHGVPFFVAAPSTTLDA  302

Query  568   SLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS  389
             + ++G  IVIE+R   E+ H+   LG ++AA GI VWNP+FDVTP SLI GIITE GV  
Sbjct  303   NTATGADIVIEDRPSTEVTHS---LGTRVAAEGIDVWNPSFDVTPGSLIEGIITESGVAR  359

Query  388   KDGNDAFDITGFVHKV  341
             K+ + AF+I  F+  V
Sbjct  360   KNADGAFEIGKFIRDV  375



>ref|XP_003080319.1| methylthioribose kinase (ISS) [Ostreococcus tauri]
Length=1089

 Score =   337 bits (865),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 203/366 (55%), Positives = 257/366 (70%), Gaps = 8/366 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y RGSL++LDQ +LPL+T Y+D+   +  W  IK+M VRGAPAIAIAAAL+LA 
Sbjct  294   TLEAIAYVRGSLRVLDQLRLPLETTYVDVPTCEACWRCIKDMRVRGAPAIAIAAALALAT  353

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E          + +  +F  ++ +Y+ +SRPTAVNL +A  ++ +V    A T    +TI
Sbjct  354   ELERTRGRFRASAEVAAFARERFDYMYTSRPTAVNLGEARGRIQKVAMTLAETCDVTETI  413

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSK---KISILTHCNTGSLATAGYG  893
              +  I A E MLE+DV S + IG  GA  L    VG+K   KI ++T CNTGSLATAGYG
Sbjct  414   -DGVIEACEAMLEEDVRSCREIGRRGAEALLAS-VGAKDGEKIKVMTCCNTGSLATAGYG  471

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIRA+   G LERAYC ETRP+NQGSRLTA+ELV E IP TLI D+ AAALM  G 
Sbjct  472   TALGVIRALWERGRLERAYCLETRPYNQGSRLTAYELVYEKIPGTLICDNMAAALMARGD  531

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+A++VGADR+AANGD ANKIGTYSLAV A HHGVP + AAP+T++D   ++G  I IEE
Sbjct  532   VDAIVVGADRVAANGDFANKIGTYSLAVNAKHHGVPMFTAAPVTTLDPETATGADIHIEE  591

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKDGNDAFDITGF  353
             R   E+ H+   LG+++AA GI VWNP+FDVTPA+L+SGIITE GVI K+    F ++ F
Sbjct  592   RPADEVTHS---LGKRVAAEGIDVWNPSFDVTPAALLSGIITESGVIEKNVKGFFPVSEF  648

Query  352   VHKVSG  335
             V  V G
Sbjct  649   VANVKG  654



>ref|NP_001104708.1| methylthioribose-1-phosphate isomerase [Danio rerio]
 sp|A9JRE2.1|MTNA_DANRE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Danio 
rerio]
 gb|AAI55627.1| Zgc:172216 protein [Danio rerio]
 gb|AAI71374.1| Zgc:172216 [Danio rerio]
 gb|AAI71376.1| Zgc:172216 [Danio rerio]
Length=353

 Score =   318 bits (814),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 196/348 (56%), Positives = 246/348 (71%), Gaps = 16/348 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y+ GSLQ+L+Q  LP +T+Y +I++ +DG++AIK M VRGAPAIAI   LSLA 
Sbjct  2     TLEAIRYRSGSLQILNQLLLPRETVYDEIRSVRDGYEAIKSMKVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGT-AQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT  1067
                 +E   G  A+D VSF+   L +L S+RPTAVN+  AA +L E  T+  S     + 
Sbjct  61    ----VELRAGAGAEDLVSFVRDSLCHLTSARPTAVNMGRAARELME-FTENESMEKNTEQ  115

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYG  893
             + ++ I   E MLE DV  NK IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYG
Sbjct  116   LRDSVIGWIEEMLERDVNDNKKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYG  172

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGV+R+++  G L+R YCTETRP+NQG+RLTA+E V E  PATLI DS AA  M+   
Sbjct  173   TALGVVRSLHMLGRLKRLYCTETRPYNQGARLTAYEAVAEGFPATLITDSMAALAMREKS  232

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             + AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ IVIEE
Sbjct  233   ITAVVVGADRVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIVIEE  292

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVI  392
             R  +EL   +   G  +AA GI VWNPAFDVTP  LI+ GIITE GV 
Sbjct  293   RPAEELTSIN---GVPVAAPGIDVWNPAFDVTPHQLITGGIITELGVF  337



>ref|XP_008853656.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Nannospalax galili]
Length=362

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 193/353 (55%), Positives = 245/353 (69%), Gaps = 15/353 (4%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI Y RGSLQ+LDQ +LPL + Y  + + +  W+AI+ M VRGAPAIA+   LSLA  
Sbjct  3     LEAIRYSRGSLQILDQLQLPLHSHYEVLGSVQQAWEAIRAMKVRGAPAIALVGCLSLA--  60

Query  1240  aSNLETFNGTAQDA----VSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASE  1076
                +E   G         V+F+  +L +LVS+RPTAVN++ AA  L  V  +EA    + 
Sbjct  61    ---VELQAGAGGPGLLALVAFVHDQLNFLVSARPTAVNMARAARDLAHVAAQEAEQEGAT  117

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAG  899
              KT+ E  I  AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAG
Sbjct  118   EKTVRERVIRYAEDMLEKDLRDNRSIGDLGACHLLERAAPRGGKVTVLTHCNTGALATAG  177

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA  719
             YGTALGVIR+++  G LE  +CTETRP+NQG+RLTAFELV E IPATLIADS  AA +  
Sbjct  178   YGTALGVIRSLHKMGHLEHVFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAVAH  237

Query  718   GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
               V+AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+IVI
Sbjct  238   WGVSAVVVGADRVVANGDTANKVGTYQLAIIANHHGIPFYVAAPSSSCDLHLETGQEIVI  297

Query  538   EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
             EER  +EL   +   G +IAA GI VWNPAFD+TP  LI+ GIITE GV + +
Sbjct  298   EERPGQELTDLN---GVRIAAPGIGVWNPAFDITPHQLITGGIITELGVFAPE  347



>ref|XP_003123394.2| PREDICTED: methylthioribose-1-phosphate isomerase [Sus scrofa]
Length=397

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 195/350 (56%), Positives = 247/350 (71%), Gaps = 11/350 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y RGSLQ+LDQ  LP Q+ Y  + + +  W+AI+ M VRGAPAIA+   LSLAV
Sbjct  41    TLEAIRYSRGSLQILDQLLLPQQSRYEAVGSVRQAWEAIRAMKVRGAPAIALVGCLSLAV  100

Query  1243  eaSNLETFNGTA--QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEA  1073
                 L+   G       V+F+   L +LV++RPTAVN++ AA  L +V  +EA    +  
Sbjct  101   ---ELQAGAGGPGLSSLVAFVRDALSFLVTARPTAVNMARAARDLTDVAAQEAEREGATE  157

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGY  896
             + + E  I  AE MLE D++ N++IG  GA  LL+       K+ +LTHCNTG+LATAGY
Sbjct  158   EAVRERVISWAEDMLEKDLSDNRSIGDLGARHLLERAAPQGGKVIVLTHCNTGALATAGY  217

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIR++++ G LE A+CTETRP+NQG+RLTAFELV E+IPATLI DS AAA M   
Sbjct  218   GTALGVIRSLHSLGRLEHAFCTETRPYNQGARLTAFELVYEHIPATLITDSMAAAAMAHK  277

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              V+AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L SGQ+I+IE
Sbjct  278   GVSAVVVGADRVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLESGQEIIIE  337

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVIS  389
             ER  +EL   +   G +IAA GI VWNPAFDVTP  LI+ GIITE GV +
Sbjct  338   ERPGQELTDVN---GVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFA  384



>gb|KIX97693.1| hypothetical protein Z520_06471 [Fonsecaea multimorphosa CBS 
102226]
Length=395

 Score =   319 bits (817),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 201/387 (52%), Positives = 255/387 (66%), Gaps = 37/387 (10%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      LQ+LDQ  LP +T Y+ I+N ++   AIK+M VRGAPAIAI AA
Sbjct  3     LQAIQYEPASADSSPSLQILDQLVLPHRTAYVPIRNCEEAHAAIKQMKVRGAPAIAIVAA  62

Query  1258  lslave---aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  1088
             L+LAVE              ++    + Q+L+YL +SRPTAVNL DA  KL +++ K+A+
Sbjct  63    LALAVEVGGEVKTGKLPAAPEEVKDSIGQRLDYLKTSRPTAVNLGDAVGKL-KIVAKKAT  121

Query  1087  --TASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--------ISI  938
                 + A+++ +AYI+AAE ML DDV+ NK+IG HGA  ++   V  +K        I+I
Sbjct  122   LQPGASAESVAQAYIVAAERMLVDDVSDNKSIGEHGARWIEENTVAGRKRKADKGQDIAI  181

Query  937   LTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat  758
             LTHCNTGSLATAGYGTALGVIR++  A  L RAYC+ETRP+NQGSRLTA+ELV + IPAT
Sbjct  182   LTHCNTGSLATAGYGTALGVIRSLRAADMLTRAYCSETRPYNQGSRLTAYELVHDEIPAT  241

Query  757   --liadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
                 + + A    +  R+ A++VGADR+AANGDTANKIGT+SLAV A HHGV F VAAP 
Sbjct  242   LITDSMACALMAREGDRLAAIVVGADRVAANGDTANKIGTHSLAVLARHHGVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKE--------------LLHTHGGLGEQIAASGISVWNPAF  446
             T++D   +SG+ IVIEER+P+E              LL   G      AA GI VWNPAF
Sbjct  302   TTIDRDTASGKDIVIEERAPEEVTRIKGPRVKADGKLLLDEGSEMVSTAAVGIDVWNPAF  361

Query  445   DVTPASLISGIITEKGVISK-DGNDAF  368
             DVTPA LI G+ITE GV+ K DG   F
Sbjct  362   DVTPAELIDGVITEVGVVEKVDGKFNF  388



>ref|XP_004060186.1| PREDICTED: methylthioribose-1-phosphate isomerase [Gorilla gorilla 
gorilla]
Length=369

 Score =   318 bits (814),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 192/350 (55%), Positives = 244/350 (70%), Gaps = 7/350 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y RGSLQ+LDQ  LP Q+ Y  + +    W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2     TLEAIRYSRGSLQILDQLLLPQQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAKT  1067
             E              V+F+  KL +LV++RPTAVN++ AA  L +V  +EA    +  + 
Sbjct  62    EL-QAGAGGPGLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEA  120

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             + E  I   E MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGT
Sbjct  121   VRERVICCTEDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGT  180

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIR++++ G LE A+CTETRP+NQG+RLTAFELV E IPATLIADS  AA M    V
Sbjct  181   ALGVIRSLHSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLIADSMVAAAMAHRGV  240

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER
Sbjct  241   SAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEER  300

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
               +EL   +   G +IAA GI VWNPAFDVTP  LI+ GIITE GV + +
Sbjct  301   PVQELTDVN---GVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPE  347



>gb|KDR24083.1| Methylthioribose-1-phosphate isomerase [Zootermopsis nevadensis]
Length=359

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 188/349 (54%), Positives = 237/349 (68%), Gaps = 14/349 (4%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaia-aalsla  1247
             TL++I Y+ G L++LDQ  LP Q+ Y+++K  +DGW AI +M VRGAPAIAI        
Sbjct  2     TLKSIRYESGKLEILDQLLLPSQSQYIEVKGVEDGWRAIHKMHVRGAPAIAIVGCLSLAV  61

Query  1246  veaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTAS  1079
                  + T   T +  V     KL YLVS+RPTAVN+  AA +L    N +   E  +A 
Sbjct  62    EIQPEVFTDKKTLRQEV---EGKLNYLVSARPTAVNMKLAADELISLVNALDKDETVSAE  118

Query  1078  EAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAG  899
             + K  F   + A E ML+ D+  N+AIG  GA  + +       + ILTHCNTGSLATAG
Sbjct  119   QMKLKF---LSAIETMLDKDIIDNRAIGDAGAKAILSHCPKDSMVRILTHCNTGSLATAG  175

Query  898   YGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkA  719
             YGTALGVIR++++   LE  YCTETRP+NQG+RLTA+ELV + IPATL+ DS  +ALM+A
Sbjct  176   YGTALGVIRSLHSLKRLEHVYCTETRPYNQGARLTAYELVHDKIPATLVCDSMVSALMRA  235

Query  718   GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  539
               + AV+VGADR+A NGDTANKIGTY +AV A HHGV FYVAAP TS+D S+ SG+ I+I
Sbjct  236   RNITAVVVGADRVATNGDTANKIGTYQIAVVAKHHGVLFYVAAPFTSIDFSIPSGEHILI  295

Query  538   EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVI  392
             EER   E+ H       +IAA+GIS WNPAFDVTPASLI+GIITEKGV 
Sbjct  296   EERPEHEMSHV---ADHRIAATGISCWNPAFDVTPASLITGIITEKGVF  341



>ref|XP_011120963.1| hypothetical protein AOL_s00076g108 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX50344.1| hypothetical protein AOL_s00076g108 [Arthrobotrys oligospora 
ATCC 24927]
Length=374

 Score =   318 bits (814),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 196/373 (53%), Positives = 247/373 (66%), Gaps = 26/373 (7%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             LQAI Y RG+L +LDQ  LP Q+IY+ + +    W+AIK M VRGAPAIAI A LSLAVE
Sbjct  3     LQAIKYTRGTLSILDQLFLPHQSIYISVPDVTTAWNAIKTMQVRGAPAIAIVAVLSLAVE  62

Query  1240  aSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTIF  1061
               N    N  + +    + QKL+YLV+SRPTAVNL+DA+ KL  +    A+   E  T  
Sbjct  63    LHN----NPPSSNPKEEIHQKLDYLVTSRPTAVNLADASNKLKSLTNSVANETPEIVT--  116

Query  1060  EAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTALG  881
             + +I AAE ML  DV  NKAIG HGA  +QN +  +  I +LTHCNTGSLATA YGTALG
Sbjct  117   KTFIEAAEQMLTQDVEDNKAIGHHGAQWIQNAVGKTSDIKVLTHCNTGSLATASYGTALG  176

Query  880   VIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNAV  701
             +IR++++   L  AYCTETRP+NQGSRLTA+ELV E IP+TLI DS AA+L+   +++A+
Sbjct  177   IIRSLHSDTSLSHAYCTETRPYNQGSRLTAYELVHEKIPSTLITDSMAASLLSHQQISAI  236

Query  700   IVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSPK  521
             IVGADR+AANGDTANKIGT+ LA+ A H GV F VAAP TSVDL   SG+ I IE+R   
Sbjct  237   IVGADRVAANGDTANKIGTFQLAIIAKHFGVKFVVAAPTTSVDLETKSGEGIKIEQRPGW  296

Query  520   ELLHTHGGLGEQI--------------------AASGISVWNPAFDVTPASLISGIITEK  401
             E+L   G     +                    AA GI V+NP+FDVTPA+LI  I+TE 
Sbjct  297   EVLVVSGPTVVNVPGKDDGTVKVNVEDVRSVKQAADGIGVFNPSFDVTPAALIDAIVTEN  356

Query  400   GVISKDGNDAFDI  362
             GV+ K+ +  F +
Sbjct  357   GVVEKNADGVFPM  369



>gb|KIW17463.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala spinifera]
Length=395

 Score =   318 bits (816),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 208/387 (54%), Positives = 260/387 (67%), Gaps = 37/387 (10%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      L++LDQ  LP +T Y  +   ++   AIK+M VRGAPAIAI AA
Sbjct  3     LQAIQYEAASADSPPSLRILDQLLLPHRTTYEQVSTCEEAHGAIKQMKVRGAPAIAIVAA  62

Query  1258  lslaveaSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  1088
             L+LAVE       +    +A+     L+Q+LEYL +SRPTAVNL DA  KL +++ K AS
Sbjct  63    LALAVEIGTAVVAKKLPDSAEVVKENLNQRLEYLKTSRPTAVNLGDAVGKL-KIVAKTAS  121

Query  1087  TASEA--KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQ-NQLVGSKK-------ISI  938
                EA   ++ +AYI AAE ML DDV+ NKAIG HGA  ++ N + G ++       + +
Sbjct  122   LRPEATPDSVVQAYIAAAERMLIDDVSDNKAIGEHGARWIEENTIAGRRRKQDKSHELKV  181

Query  937   LTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat  758
             LTHCNTGSLATAGYGTALGVIR++  A  L RAYC+ETRP+NQGSRLTA+ELV +++PAT
Sbjct  182   LTHCNTGSLATAGYGTALGVIRSLRAADMLSRAYCSETRPYNQGSRLTAYELVHDHVPAT  241

Query  757   liadsaaaa--lmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
             LI DS A A    +   + A+IVGADR+AANGDTANKIGTYSLAV A HHGV F VAAP 
Sbjct  242   LITDSMACALLAKEGDDLAAIIVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKELLHTHGGLGE--------------QIAASGISVWNPAF  446
             T++DLS +SGQ IVIEER+P+E+    G   +                AA+GI VWNPAF
Sbjct  302   TTIDLSTASGQDIVIEERAPEEVTRVKGPKIDPDGRIRVDEDAEVISTAANGIDVWNPAF  361

Query  445   DVTPASLISGIITEKGVISK-DGNDAF  368
             DVTPA LI G+ITE GV+ K DG+  F
Sbjct  362   DVTPADLIDGVITEVGVVVKVDGHFEF  388



>ref|XP_011143671.1| PREDICTED: methylthioribose-1-phosphate isomerase [Harpegnathos 
saltator]
 ref|XP_011143672.1| PREDICTED: methylthioribose-1-phosphate isomerase [Harpegnathos 
saltator]
Length=361

 Score =   317 bits (812),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 195/350 (56%), Positives = 237/350 (68%), Gaps = 18/350 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI +  G L++LDQ  LP  T  + I   +DGW AI +M VRGAPAIAI   LSLA 
Sbjct  2     TLQAITWDNGRLEILDQTLLPETTRSVLINGVEDGWHAINKMQVRGAPAIAIVGCLSLAT  61

Query  1243  eaSNLETFNGTAQDAVSFLSQ---KLEYLVSSRPTAVNLSDAATKL----NEVITKEAST  1085
                  E       D   F  +   KL YLVS+RPTAVN+  AA +L    N +   +  T
Sbjct  62    -----EILPENITDKKRFRHEVEGKLNYLVSARPTAVNMKTAADELITLVNSLSENDKVT  116

Query  1084  ASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLAT  905
             A E K  F   I+A   MLE DVA N+AIG++GA  +   +     I ILTHCNTGSLAT
Sbjct  117   ACEMKDRFINTIVA---MLEKDVADNQAIGNYGADEILRSVPRDSFIRILTHCNTGSLAT  173

Query  904   AGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalm  725
             AGYGTALGVIR++     L+  YCTETRP+NQG+RLTA+ELV + IPATLI D   AAL+
Sbjct  174   AGYGTALGVIRSLRRRKKLDHVYCTETRPYNQGARLTAYELVHDKIPATLICDDMVAALL  233

Query  724   kAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQI  545
             K+ ++ AV+VGADR+AANGDTANKIGTY +A+ A HHGVPFYVAAP TS+D +++SG QI
Sbjct  234   KSKQITAVVVGADRVAANGDTANKIGTYQIAILAKHHGVPFYVAAPRTSIDFAIASGDQI  293

Query  544   VIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  395
             VIEER  +E+ H      ++IAA GI  WNPAFDVTPA LI+GIITE GV
Sbjct  294   VIEERPEREMTHIK---NQRIAAPGIQCWNPAFDVTPAHLIAGIITEVGV  340



>ref|NP_001026897.1| methylthioribose-1-phosphate isomerase isoform 1 [Homo sapiens]
 sp|Q9BV20.1|MTNA_HUMAN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Mediator of RhoA-dependent 
invasion; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation factor 
eIF-2B subunit alpha/beta/delta-like protein [Homo sapiens]
 pdb|4LDQ|A Chain A, Crystal Structure Of The Mediator Of Rho Dependent Invasion
 pdb|4LDQ|B Chain B, Crystal Structure Of The Mediator Of Rho Dependent Invasion
 gb|AAH01703.1| Methylthioribose-1-phosphate isomerase homolog (S. cerevisiae) 
[Homo sapiens]
 gb|AAQ88543.1| TLEA6390 [Homo sapiens]
 gb|EAW84370.1| hypothetical protein MGC3207, isoform CRA_b [Homo sapiens]
 gb|ACE86908.1| hypothetical protein MGC3207 protein [synthetic construct]
 gb|ACE87595.1| hypothetical protein MGC3207 protein [synthetic construct]
 gb|ADQ32721.1| hypothetical protein MGC3207 [synthetic construct]
Length=369

 Score =   317 bits (813),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 243/350 (69%), Gaps = 7/350 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y RGSLQ+LDQ  LP Q+ Y  + +    W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2     TLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAKT  1067
             E              V+F+  KL +LV++RPTAVN++ AA  L +V  +EA    +  + 
Sbjct  62    EL-QAGAGGPGLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEA  120

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             + E  I   E MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGT
Sbjct  121   VRERVICCTEDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGT  180

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIR++++ G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS  AA M    V
Sbjct  181   ALGVIRSLHSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMVAAAMAHRGV  240

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER
Sbjct  241   SAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEER  300

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
               +EL   +   G +IAA GI VWNPAFDVTP  LI+ GIITE GV + +
Sbjct  301   PGQELTDVN---GVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPE  347



>gb|KFB37657.1| AGAP001589-PA-like protein [Anopheles sinensis]
Length=351

 Score =   317 bits (811),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 186/352 (53%), Positives = 247/352 (70%), Gaps = 16/352 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI YK G L++LDQ  LP ++ Y+ I   KDGW+AI +M VRGAPAIAI   LSL  
Sbjct  2     TLEAIKYKTGRLEILDQLLLPAESTYIPIAGVKDGWNAIHKMQVRGAPAIAIVGCLSLV-  60

Query  1243  eaSNLETFNGTAQDAVSF---LSQKLEYLVSSRPTAVNLSDAATKLNEVI-TKEASTASE  1076
                 +E ++       +    + ++L+YLV+SRPTAVNL  AA +L  +I T  A+    
Sbjct  61    ----VEIYDKQYDSKAALKNEIDEQLQYLVTSRPTAVNLKLAADELKSLIATLLANEDMN  116

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              + + ++ I + E ML+ D+  N+AIG +GA+ L   +   + + ++THCNTGSLATAGY
Sbjct  117   VEGMKKSVIDSIEKMLQKDINDNRAIGENGANALLKGI--DRPLKLMTHCNTGSLATAGY  174

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIR+VN    L+  +CTETRP+NQG+RLTA+ELV + +PATLI DS  AAL+ + 
Sbjct  175   GTALGVIRSVNERNLLDHVFCTETRPYNQGARLTAYELVHDKLPATLITDSMVAALLNSR  234

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             +++A+IVGADR+AANGDTANKIGTY +AV A HH VPFYVAAP TS+D++++ G  I IE
Sbjct  235   KIDAIIVGADRVAANGDTANKIGTYQMAVVAKHHQVPFYVAAPFTSIDVAIADGSHIKIE  294

Query  535   ERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVISKD  383
             ER  +EL H    +GE +IAA GI  WNPAFDVTPA LI+GIITE GV   +
Sbjct  295   ERPERELTH----IGELRIAAPGIGCWNPAFDVTPAELITGIITEVGVFKPN  342



>ref|XP_012054845.1| PREDICTED: methylthioribose-1-phosphate isomerase [Atta cephalotes]
Length=365

 Score =   317 bits (811),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 197/359 (55%), Positives = 253/359 (70%), Gaps = 18/359 (5%)
 Frame = -2

Query  1423  TLQAICYKR--GSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             TLQAI + +  G L++LDQ  LP  T Y+ +K  KDGW+ I +M VRGAPAIAI  +LS+
Sbjct  2     TLQAIKWNKADGKLEILDQTLLPATTSYIQVKGVKDGWNVINKMQVRGAPAIAIVGSLSV  61

Query  1249  aveaSNLETFNGTAQDAV-SFLSQKLEYLVSSRPTAVNLSDAATKLNEVIT----KEAST  1085
             AVE   L+  N   + A+   +   + YLV++RPTAVN++ AA    E+       +  T
Sbjct  62    AVEI--LQHPNYEDKKALFQTIKDNMNYLVTARPTAVNMNKAANFFTEIADYLSYSDEFT  119

Query  1084  ASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLA  908
              S+ K   + +I   + ML DD+  NKAIG  GA  +L+N   GS  + +LTHCNTGSLA
Sbjct  120   LSQMK---DEFIDRIDKMLMDDIKDNKAIGKFGADEILRNVPEGSS-VRVLTHCNTGSLA  175

Query  907   TAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaal  728
             TAGYGTALGVIR+++  G LE  YCTETRP+NQG+RLTA+ELV +NIPATLI D   AAL
Sbjct  176   TAGYGTALGVIRSLHERGRLEHVYCTETRPYNQGARLTAYELVHDNIPATLICDDMVAAL  235

Query  727   mkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
             MK  ++ AV+VGADRIAANGDTANKIGTY +A+ A +H VPFYVAAPLTS+DL++S+G Q
Sbjct  236   MKTKQITAVVVGADRIAANGDTANKIGTYQIAILAKYHDVPFYVAAPLTSIDLNMSNGDQ  295

Query  547   IVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS-KDGND  374
             I+IEERS +E+ H +    ++IAA GI+ WNPAFDVTP SLI+GII   GV    DG+D
Sbjct  296   IIIEERSEQEMTHMN---DKRIAAEGITCWNPAFDVTPTSLITGIIMNTGVSKPSDGSD  351



>ref|XP_001981082.1| GG11866 [Drosophila erecta]
 sp|B3P538.1|MTNA_DROER RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
erecta]
 gb|EDV52952.1| GG11866 [Drosophila erecta]
Length=364

 Score =   316 bits (810),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 195/357 (55%), Positives = 249/357 (70%), Gaps = 22/357 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +LQ+I Y RGSL++LDQ  LP Q+ Y  ++  +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     SLQSIKYSRGSLEILDQLLLPGQSKYEVVRGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E  N E F  T +     +  KL YLVS+RPTAVN+  AA +L    N++   EA   + 
Sbjct  62    EI-NPEDFE-TKKSLRQEVEGKLNYLVSARPTAVNMKIAADELITLANDLYKDEAIDVNG  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLV--------GSKKISILTHCNT  920
              K   + ++ A E ML+ D+A N+AIG++GA  +  ++          +  + +LTHCNT
Sbjct  120   MK---QRFLDATEAMLKKDIADNRAIGANGAKAILQRVAEKGGAPAGSTGSVRVLTHCNT  176

Query  919   GSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsa  740
             GSLATAGYGTALGV+R +   G LE  YCTETRP+NQG+RLTA+ELV E  PATL+ DS 
Sbjct  177   GSLATAGYGTALGVVRQLAELGKLEHVYCTETRPYNQGARLTAYELVHEKFPATLVLDSM  236

Query  739   aaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLS  560
              AAL++A  V AV+VGADR+A+NGDTANKIGTY +AV A HH VPFYVAAPLTS+DL++ 
Sbjct  237   VAALLRAKNVAAVVVGADRVASNGDTANKIGTYQIAVVAKHHDVPFYVAAPLTSIDLAIP  296

Query  559   SGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPASLISGIITEKGVI  392
              G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPASLI+GIITE+GV 
Sbjct  297   GGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPASLITGIITERGVF  349



>gb|AIC57312.1| MRI1, partial [synthetic construct]
Length=369

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 190/350 (54%), Positives = 243/350 (69%), Gaps = 7/350 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+A+ Y RGSLQ+LDQ  LP Q+ Y  + +    W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2     TLEALRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAKT  1067
             E              V+F+  KL +LV++RPTAVN++ AA  L +V  +EA    +  + 
Sbjct  62    EL-QAGAGGPGLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEA  120

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             + E  I   E MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGT
Sbjct  121   VRERVICCTEDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGT  180

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIR++++ G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS  AA M    V
Sbjct  181   ALGVIRSLHSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMVAAAMAHRGV  240

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +G++I+IEER
Sbjct  241   SAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEER  300

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
               +EL   +   G +IAA GI VWNPAFDVTP  LI+ GIITE GV + +
Sbjct  301   PGQELTDVN---GVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPE  347



>ref|XP_002733184.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Saccoglossus 
kowalevskii]
Length=365

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 189/348 (54%), Positives = 248/348 (71%), Gaps = 7/348 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L++I YK GSL++L+QR LP +++Y +I   +D WDAIK M+VRGAPAIAI  AL+LAV
Sbjct  2     SLESIHYKTGSLKILNQRLLPTKSVYEEIHTIQDAWDAIKTMMVRGAPAIAIVGALTLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
             E    +  + T      F+   L +L ++RPTAVN+++AA +L +++      +   + I
Sbjct  62    ELIKQQFESKTKLS--EFVETSLTHLKTARPTAVNMTEAANRLIKLVEVLCQNSMSVEII  119

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGYGTAL  884
              E  I   E ML+ DVA NK++G HGA ++ NQ  G+  + ++THCNTGSLATAGYGTA+
Sbjct  120   KERIIEECEAMLKKDVADNKSMGQHGAKVIINQ-CGNDNLHVMTHCNTGSLATAGYGTAI  178

Query  883   GVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRVNA  704
             GVIRA++  G LE AYCTETRP+NQGSRLTA+E+V + IPATLIADSA A  MK   ++A
Sbjct  179   GVIRALHEIGKLEHAYCTETRPYNQGSRLTAYEMVHDKIPATLIADSAVAMTMKTKPISA  238

Query  703   VIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEERSP  524
             V+VGADR+ ANGDTANKIGTY +A+ A H G+PF+V +P TS+DL + SG+ IVIEERS 
Sbjct  239   VVVGADRVVANGDTANKIGTYQMAIVAKHFGIPFFVVSPSTSIDLHIPSGEDIVIEERSH  298

Query  523   KELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
              EL       G QIAA GI  WNPAFDVTPA LI+ GI+TE GV   +
Sbjct  299   DELTKMK---GHQIAAPGIGCWNPAFDVTPAELITGGIVTEHGVFKPE  343



>pdb|4LDR|A Chain A, Structure Of The S283y Mutant Of Mrdi
 pdb|4LDR|B Chain B, Structure Of The S283y Mutant Of Mrdi
Length=369

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 242/350 (69%), Gaps = 7/350 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y RGSLQ+LDQ  LP Q+ Y  + +    W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2     TLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAKT  1067
             E              V+F+  KL +LV++RPTAVN++ AA  L +V  +EA    +  + 
Sbjct  62    EL-QAGAGGPGLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEA  120

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             + E  I   E MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGT
Sbjct  121   VRERVICCTEDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGT  180

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIR++++ G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS  AA M    V
Sbjct  181   ALGVIRSLHSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMVAAAMAHRGV  240

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP  S DL L +G++I+IEER
Sbjct  241   SAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSYSCDLRLETGKEIIIEER  300

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
               +EL   +   G +IAA GI VWNPAFDVTP  LI+ GIITE GV + +
Sbjct  301   PGQELTDVN---GVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPE  347



>ref|XP_005805132.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Xiphophorus 
maculatus]
Length=353

 Score =   315 bits (808),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 195/348 (56%), Positives = 244/348 (70%), Gaps = 16/348 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y+ GSLQ+L+Q  LP QT+Y DI++ +  ++AIK M VRGAPAIAI   LSLA 
Sbjct  2     TLEAIRYRSGSLQILNQLLLPHQTVYEDIRSVQGAYEAIKSMKVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTA-QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT  1067
                 +E   G    D V+F+ + L +L S+RPTAVN+  AA +L E    E S    ++ 
Sbjct  61    ----VELRAGAGGDDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENE-SMEKNSEQ  115

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYG  893
             + E+ I   E MLE DV  N+ IG++GA   Q+ L G  +  +++LTHCNTGSLATAGYG
Sbjct  116   LRESVISWIEDMLERDVNDNRKIGNYGA---QHILSGVPRDSVTVLTHCNTGSLATAGYG  172

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGV+R+++  G L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   
Sbjct  173   TALGVVRSLHGLGRLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMD  232

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             + AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE 
Sbjct  233   ITAVVVGADRVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEV  292

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVI  392
             R P+EL   +   G  IAA GI VWNPAFDVTP  LI+ GIITE GV 
Sbjct  293   RPPEELTSIN---GVPIAAPGIEVWNPAFDVTPHQLITGGIITELGVF  337



>ref|NP_001016877.1| methylthioribose-1-phosphate isomerase [Xenopus (Silurana) tropicalis]
 emb|CAJ83906.1| novel protein containing Initiation factor 2 subunit family domain 
[Xenopus (Silurana) tropicalis]
Length=354

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 244/351 (70%), Gaps = 12/351 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+++ Y RGSLQ+L+Q  LP ++ Y  +   + G DAI+ M VRGAPAIAI   LSLA 
Sbjct  2     SLESVRYSRGSLQVLNQLLLPHKSEYEPVTGVQQGADAIRTMKVRGAPAIAIVGVLSLA-  60

Query  1243  eaSNLETFNGTAQDAVSFLS---QKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SE  1076
                 +E  + T QD  SF++   + L +LV +RPTAVN+  AA +LN  + KEA  A + 
Sbjct  61    ----VERTSRTCQDVPSFIAFVQESLCHLVDARPTAVNMKKAADELNAFLAKEAEKAGAT  116

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              + + E+ I  AE +L+ DV  N+ IG  GA  +      ++K+ +LTHCNTGSLATAGY
Sbjct  117   TQGLAESVIQWAEALLKKDVEDNQMIGDFGAKHILETAGPTEKVCMLTHCNTGSLATAGY  176

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R+++  G L   +CTETRP+NQGSRLTA+ELV E IPATLI DS A+A ++  
Sbjct  177   GTALGVVRSLHVLGRLSHVFCTETRPYNQGSRLTAYELVYEKIPATLITDSMASAAIRDR  236

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             +V AV+VGADR+ ANGDTANKIGTY LA+ A +HG+PFYVAAP TS DLSL +G  IVIE
Sbjct  237   KVTAVVVGADRVVANGDTANKIGTYQLAITARYHGIPFYVAAPSTSCDLSLPTGGSIVIE  296

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKD  383
             ER   EL   +   G +IAA GI VWNPAFDVTP  LI+GIITE+GV   +
Sbjct  297   ERPSHELTDIN---GVRIAAPGIGVWNPAFDVTPHELITGIITERGVFKPE  344



>sp|Q0VFN1.1|MTNA_XENTR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Xenopus 
(Silurana) tropicalis]
 gb|AAI18768.1| Translation initiation factor eIF-2B subunit alpha/beta/delta-like 
protein [Xenopus (Silurana) tropicalis]
Length=354

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 244/351 (70%), Gaps = 12/351 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+++ Y RGSLQ+L+Q  LP ++ Y  +   + G DAI+ M VRGAPAIAI   LSLA 
Sbjct  2     SLESVRYSRGSLQVLNQLLLPHKSEYEPVTGVQQGADAIRTMKVRGAPAIAIVGVLSLA-  60

Query  1243  eaSNLETFNGTAQDAVSFLS---QKLEYLVSSRPTAVNLSDAATKLNEVITKEASTA-SE  1076
                 +E  + T QD  SF++   + L +LV +RPTAVN+  AA +LN  + KEA  A + 
Sbjct  61    ----VELTSRTCQDVPSFIAFVQESLCHLVDARPTAVNMKKAADELNAFLAKEAEKAGAT  116

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              + + E+ I  AE +L+ DV  N+ IG  GA  +      ++K+ +LTHCNTGSLATAGY
Sbjct  117   TQGLAESVIQWAEALLKKDVEDNQMIGDFGAKHILETAGPTEKVCMLTHCNTGSLATAGY  176

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R+++  G L   +CTETRP+NQGSRLTA+ELV E IPATLI DS A+A ++  
Sbjct  177   GTALGVVRSLHVLGRLSHVFCTETRPYNQGSRLTAYELVYEKIPATLITDSMASAAIRDR  236

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             +V AV+VGADR+ ANGDTANKIGTY LA+ A +HG+PFYVAAP TS DLSL +G  IVIE
Sbjct  237   KVTAVVVGADRVVANGDTANKIGTYQLAITARYHGIPFYVAAPSTSCDLSLPTGGSIVIE  296

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKD  383
             ER   EL   +   G +IAA GI VWNPAFDVTP  LI+GIITE+GV   +
Sbjct  297   ERPSHELTDIN---GVRIAAPGIGVWNPAFDVTPHELITGIITERGVFKPE  344



>ref|XP_007229603.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Astyanax 
mexicanus]
Length=353

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 244/347 (70%), Gaps = 14/347 (4%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y+ GSLQ+L+Q  LP +T+Y +I++ +DG++AIK M VRGAPAIAI   LSLAV
Sbjct  2     TLEAIRYRTGSLQILNQLLLPHETVYEEIRSVQDGYEAIKTMKVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKTI  1064
                 L    G  +D V+F+ + L +L S+RPTAVN+  AA +L E  T+  S       +
Sbjct  62    ---ELRAGAG-GEDPVAFIRESLCHLTSARPTAVNMGRAARELME-FTENESMEKSGDQL  116

Query  1063  FEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYGT  890
              E+ I   E MLE DV  NK IG++GA   Q+ L G  +  ++ILTHCNTGSLATAGYGT
Sbjct  117   KESVIALIEEMLERDVNDNKKIGNYGA---QHILSGVPRDSVTILTHCNTGSLATAGYGT  173

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGV+R++   G L+R YCTETRP+NQG+RLTA+E V+E  PATLI DS AA  M+   +
Sbjct  174   ALGVVRSLYALGRLKRMYCTETRPYNQGARLTAYEAVSEGFPATLITDSMAAIAMREKGI  233

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
              AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ IVIEER
Sbjct  234   TAVVVGADRVVANGDTANKVGTYQLAILAKHHGIPFYVAAPSTSCDLSLESGRDIVIEER  293

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVI  392
                EL   +   G  +AA GI VWNPAFDVTP  LI+ GIITE GV 
Sbjct  294   PAVELTSIN---GVPVAAPGIEVWNPAFDVTPHQLITGGIITELGVF  337



>gb|KEF62771.1| S-methyl-5-thioribose-1-phosphate isomerase [Exophiala aquamarina 
CBS 119918]
Length=395

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 202/387 (52%), Positives = 258/387 (67%), Gaps = 37/387 (10%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             L+AI Y  GS      L +LDQ +LP +T++  I   ++ +DAIK M VRGAPAIAI AA
Sbjct  3     LEAIRYDPGSDSTPPALHILDQLQLPHRTVFERITTCEEAYDAIKSMKVRGAPAIAIVAA  62

Query  1258  lslaveaSNLET---FNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAS  1088
             L+LA E   L        +A+     L ++L+YL +SRPTAVNL DA  KL ++I K+AS
Sbjct  63    LALAAEIGTLAVKSHLPHSAEVVHESLIRRLDYLKTSRPTAVNLGDAVGKL-KIIAKKAS  121

Query  1087  TASEA--KTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQ-NQLVGSKK-------ISI  938
               ++A  +++  AYI AAE ML DDV+ N+AIG HGA  ++ N   G K+       + +
Sbjct  122   LIADADGRSVALAYIAAAERMLVDDVSDNEAIGEHGARWIEINTTAGQKRQKDKSQELKV  181

Query  937   LTHCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPat  758
             LTHCNTGSLATAGYGTALGVIR++     L RAYCTETRP+NQGSRLTA+ELV ++IPAT
Sbjct  182   LTHCNTGSLATAGYGTALGVIRSLRAGNSLTRAYCTETRPYNQGSRLTAYELVHDDIPAT  241

Query  757   --liadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPL  584
                 + + A    +  R+ A++VGADR+AANGDTANKIGT+SLAV A HHGV F VAAP 
Sbjct  242   LITDSMACALMTKEGDRLAAIVVGADRVAANGDTANKIGTHSLAVLARHHGVKFLVAAPR  301

Query  583   TSVDLSLSSGQQIVIEERSPKELLHTHGG---------LGE-----QIAASGISVWNPAF  446
             T++DL+ SSG+ I+IEER+P+E+    G          L E       AA GI+VWNPAF
Sbjct  302   TTIDLATSSGENIIIEERAPEEVTRIKGPKVTPEGKLLLDEGAELISTAADGIAVWNPAF  361

Query  445   DVTPASLISGIITEKGVISK-DGNDAF  368
             DVTPA LI G+ITE GV+ K DG   F
Sbjct  362   DVTPAQLIDGVITEVGVVEKRDGRFDF  388



>ref|XP_007744831.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
psammophila CBS 110553]
 gb|EXJ71052.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
psammophila CBS 110553]
Length=395

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 208/386 (54%), Positives = 261/386 (68%), Gaps = 35/386 (9%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      L +LDQ  LP +T Y+ ++N ++   AI++M VRGAPAIAI A+
Sbjct  3     LQAIQYEPASADSPPSLHILDQLVLPHRTTYVPVRNCEEAHAAIRQMKVRGAPAIAIVAS  62

Query  1258  lslavea-SNLETFNGTA--QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA-  1091
             L+LAVE  + ++T N  A  +D    ++Q+L++L +SRPTAVNL DA  KL  VI K A 
Sbjct  63    LALAVEVGAQMKTGNLPAAPEDVKDSINQRLDFLKTSRPTAVNLGDAVGKLKIVIKKAAL  122

Query  1090  STASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQ-NQLVGSKK-------ISIL  935
                + A+++  AYI AAE ML DDV+ N+AIG +GA  ++ N   G K+       ++IL
Sbjct  123   QPGASAESVARAYIAAAERMLVDDVSDNRAIGEYGARWIEENTTAGRKRKADRTREVAIL  182

Query  934   THCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatl  755
             THCNTGSLATAGYGTALGVIR++  A  L RAYC+ETRP+NQGSRLTA+ELV + IPATL
Sbjct  183   THCNTGSLATAGYGTALGVIRSLRAADMLTRAYCSETRPYNQGSRLTAYELVHDEIPATL  242

Query  754   iadsaaaalmkA--GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLT  581
             I DS A ALM+     + AV+VGADR+AANGDTANKIGTYSLAV A HHGV F VAAP T
Sbjct  243   ITDSMACALMEREGDHLAAVVVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPRT  302

Query  580   SVDLSLSSGQQIVIEERSPKE--------------LLHTHGGLGEQIAASGISVWNPAFD  443
             ++D   +SG+ IVIEER+P+E              LL   G      AA GI VWNPAFD
Sbjct  303   TIDRDTASGKDIVIEERAPEEVTRIKGPRVTADGKLLLDEGSEMVSTAAVGIDVWNPAFD  362

Query  442   VTPASLISGIITEKGVISK-DGNDAF  368
             VTPA L+ G+ITE GV+ K DG   F
Sbjct  363   VTPAELVDGVITEVGVVEKVDGKFNF  388



>ref|XP_006206282.1| PREDICTED: methylthioribose-1-phosphate isomerase [Vicugna pacos]
Length=358

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 196/350 (56%), Positives = 248/350 (71%), Gaps = 7/350 (2%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y RGSLQ+LDQ  LP Q+ Y  + + +  W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2     TLEAIRYSRGSLQILDQLLLPQQSRYEAVGSVRQAWEAIRAMKVRGAPAIALVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEAKT  1067
             E              V+F+   L +LV++RPTAVN++ AA  L+E   +EA    +  +T
Sbjct  62    EL-QAGAGGPGLAALVAFVRDALSFLVTARPTAVNMARAARDLSEAAAQEAEQEGATEET  120

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYGT  890
             + E  I  AE MLE D+  N++IG  GA  LL+       K+++LTHCNTG+LATAGYGT
Sbjct  121   VRERVIHWAEDMLEKDLRDNRSIGDLGARHLLERAAPEGDKVTVLTHCNTGALATAGYGT  180

Query  889   ALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGRV  710
             ALGVIR+++  G LERA+CTETRP+NQG+RLTAFELV E IPATLIADS AAA M    V
Sbjct  181   ALGVIRSLHNLGRLERAFCTETRPYNQGARLTAFELVYEQIPATLIADSMAAAAMAHQGV  240

Query  709   NAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEER  530
             +AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP +S DL L +GQ+I+IEER
Sbjct  241   SAVVVGADRVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSSSCDLRLETGQEIIIEER  300

Query  529   SPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
               +EL   +   G +IAA GI+VWNPAFDVTP  LI+ GIITE GV + +
Sbjct  301   PGQELTDVN---GVRIAAPGIAVWNPAFDVTPHDLITGGIITELGVFAPE  347



>ref|XP_003068154.1| methylthioribose-1-phosphate isomerase, putative [Coccidioides 
posadasii C735 delta SOWgp]
 sp|C5PBM5.1|MTNA_COCP7 RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER26009.1| methylthioribose-1-phosphate isomerase, putative [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EAS28711.3| methylthioribose-1-phosphate isomerase [Coccidioides immitis 
RS]
Length=390

 Score =   316 bits (810),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 200/374 (53%), Positives = 260/374 (70%), Gaps = 21/374 (6%)
 Frame = -2

Query  1420  LQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslave  1241
             L+AI YKRG L ++DQ  LP  T ++ I++A+DGW +IKEM VRGAPAIAI A LSLAVE
Sbjct  5     LEAIRYKRGHLLIIDQLLLPHVTRFIPIRSAEDGWHSIKEMHVRGAPAIAIVAMLSLAVE  64

Query  1240  aSNL---ETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTAS-EA  1073
              S L   +  +  A+D   ++ +KL+YL +SRPTAVNLSD+  K+  V+ ++  T +   
Sbjct  65    MSGLVSQQKISKNAEDTRVYIEEKLDYLATSRPTAVNLSDSVRKMKSVLEQKTRTLTCSG  124

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVG--SKKISILTHCNTGSLATA  902
             + I  ++I  AE ML  DVA N++IG HGA+ ++ N   G    K+ ILTHCNTGSLATA
Sbjct  125   EEIAMSFIAYAENMLVHDVADNRSIGEHGANWIVANTPSGVEDSKLCILTHCNTGSLATA  184

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaa-aalm  725
             GYGTALG+IR ++    L  AYCTETRP+NQG+RLTA+ELV++ IPATLI DS A   L 
Sbjct  185   GYGTALGIIRHLHEKSQLCHAYCTETRPYNQGARLTAYELVSDQIPATLITDSMAGQLLA  244

Query  724   kAGR-VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQ  548
             K G+ + A++VGADR+A+NGDTANKIGTY+LAV A +HGV F VAAP T++D+   +G+ 
Sbjct  245   KMGQSIAAIVVGADRVASNGDTANKIGTYTLAVLAKYHGVKFVVAAPRTTIDMGTRTGKD  304

Query  547   IVIEERS---------PKELLHTHGGL---GEQIAASGISVWNPAFDVTPASLISGIITE  404
             IVIEER          P+E     G +     +IAA GI+VWNPAFDVTPA+LI  I+TE
Sbjct  305   IVIEERPHSEVTTITGPRERGDECGNIVMENIKIAADGINVWNPAFDVTPAALIDAIVTE  364

Query  403   KGVISKDGNDAFDI  362
             KGV  KD N  F +
Sbjct  365   KGVEVKDANGRFHL  378



>ref|XP_004389786.1| PREDICTED: methylthioribose-1-phosphate isomerase [Trichechus 
manatus latirostris]
Length=358

 Score =   315 bits (807),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 236/350 (67%), Gaps = 11/350 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+AI Y RGSLQ+LDQ  LP Q+ Y  + + +  W+AI+ M VRG       A +    
Sbjct  2     SLEAIRYSRGSLQILDQLLLPQQSRYEAVSSVRQAWEAIRAMKVRG---APAIALVGCLS  58

Query  1243  eaSNLETFNGTA--QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST-ASEA  1073
              A  L+   G       V+F+   L +LV++RPTAVN++ AA  L E+  +EA    +  
Sbjct  59    LAVELQAGAGGPGLTALVAFVRDALSFLVTARPTAVNMARAARDLAEIAAQEAEREGATD  118

Query  1072  KTIFEAYIMAAEIMLEDDVASNKAIGSHGA-SLLQNQLVGSKKISILTHCNTGSLATAGY  896
             + + E  I  AE MLE D+  N++IG  GA  LL+    G  K+++LTHCNTG+LATAGY
Sbjct  119   EAVRERVICYAEDMLEKDLKDNRSIGDLGAHHLLERAAPGGGKVTVLTHCNTGALATAGY  178

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGVIR+++  G LE A+CTETRP+NQG+RLTAFELV E IPATLI DS AA  M   
Sbjct  179   GTALGVIRSLHRLGRLECAFCTETRPYNQGARLTAFELVYEQIPATLITDSMAATAMAHR  238

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
              V+AV+VGADR+ ANGDTANK+GTY LA+ A +HG+PFYVAAP +S DL L +GQ IVIE
Sbjct  239   GVSAVVVGADRVVANGDTANKVGTYQLAITAKYHGIPFYVAAPSSSCDLRLETGQDIVIE  298

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVIS  389
             ER  +EL   +   G +IAA GI VWNPAFDVTP  LI+ GIITE GV +
Sbjct  299   ERPGQELTDVN---GVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFA  345



>gb|KIW94717.1| S-methyl-5-thioribose-1-phosphate isomerase [Cladophialophora 
bantiana CBS 173.52]
Length=395

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 208/386 (54%), Positives = 260/386 (67%), Gaps = 35/386 (9%)
 Frame = -2

Query  1420  LQAICYKRGS------LQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaa  1259
             LQAI Y+  S      L++LDQ  LP +T Y+ ++N ++   AIK+M VRGAPAIAI A+
Sbjct  3     LQAIQYEPASADSSPSLRILDQLVLPHRTTYIPVRNCEEAHVAIKQMKVRGAPAIAIVAS  62

Query  1258  lslavea-SNLETFNGTA--QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA-  1091
             L++AVE  + ++T N  A  +D    + Q+L++L +SRPTAVNL DA  KL  VI K   
Sbjct  63    LAIAVEMGAEMKTGNLPAAPEDVKDSIDQRLDFLKTSRPTAVNLGDAVGKLKIVIKKATL  122

Query  1090  STASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLL-QNQLVGSKK-------ISIL  935
                + A+++  AYI AAE ML DDV+ N+AIG +GA  + +N   G K+       ++IL
Sbjct  123   QPGASAESVTRAYITAAERMLVDDVSDNRAIGEYGARWIGENTTAGRKRKADRTRDVAIL  182

Query  934   THCNTGSLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatl  755
             THCNTGSLATAGYGTALGVIR++  A  L RAYC+ETRP+NQGSRLTA+ELV + IPATL
Sbjct  183   THCNTGSLATAGYGTALGVIRSLRAADMLTRAYCSETRPYNQGSRLTAYELVHDEIPATL  242

Query  754   iadsaaaalmkA--GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLT  581
             I DS A ALM+     + AV+VGADR+AANGDTANKIGTYSLAV A HHGV F VAAP T
Sbjct  243   ITDSMACALMEREGDHLAAVVVGADRVAANGDTANKIGTYSLAVLARHHGVKFLVAAPRT  302

Query  580   SVDLSLSSGQQIVIEERSPKE--------------LLHTHGGLGEQIAASGISVWNPAFD  443
             ++D   +SG+ IVIEER+P+E              LL   G      AA GI VWNPAFD
Sbjct  303   TIDRDTASGKDIVIEERAPEEVTRVKGPKVTVDGKLLLDEGSEMVSTAAVGIDVWNPAFD  362

Query  442   VTPASLISGIITEKGVISK-DGNDAF  368
             VTPA LI G+ITE GV+ K DG   F
Sbjct  363   VTPAELIDGVITEVGVVEKVDGKFNF  388



>ref|NP_001090076.1| methylthioribose-1-phosphate isomerase [Xenopus laevis]
 sp|Q4FZP2.1|MTNA_XENLA RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Xenopus 
laevis]
 gb|AAH99301.1| MGC116493 protein [Xenopus laevis]
Length=354

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 188/356 (53%), Positives = 245/356 (69%), Gaps = 16/356 (4%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+++ Y RGSLQ+L+Q  LP ++ Y  +   + G DAI+ M VRGAPAIAI   LSLA 
Sbjct  2     SLESVRYSRGSLQVLNQLLLPHKSEYEPVTGVQQGADAIRTMKVRGAPAIAIVGVLSLA-  60

Query  1243  eaSNLETFNGTAQDA---VSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEA-STASE  1076
                 +E      QD    ++F+ + L +LVS+RPTAVN+  AA +LN  + +EA    + 
Sbjct  61    ----VELTTKPCQDVPSLITFVRESLHHLVSARPTAVNMKKAADELNAFLAEEADKPGAT  116

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
             ++ + E+ +  AE +L+ DV  N+ IG  GA  +  +   ++K+ +LTHCNTGSLATAGY
Sbjct  117   SQRLTESVVQWAESLLKKDVEDNQMIGDFGAKHILEKAGPTEKVCMLTHCNTGSLATAGY  176

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R+++  G L   +CTETRP+NQGSRLTA+ELV E IPATLI DS A+  M+  
Sbjct  177   GTALGVVRSLHALGRLSHVFCTETRPYNQGSRLTAYELVYEKIPATLITDSMASVTMRER  236

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             +V AV+VGADR+ ANGDTANKIGTY LA+ A +HG+PFYVAAP TS DLSL +G  IVIE
Sbjct  237   KVTAVVVGADRVVANGDTANKIGTYQLAIIAKYHGIPFYVAAPSTSCDLSLPTGGSIVIE  296

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS----KDG  380
             ER   EL   +   G +IAA GI VWNPAFDVTP  LI+GIITE+GV      KDG
Sbjct  297   ERPSHELTDIN---GIRIAAPGIDVWNPAFDVTPHELITGIITERGVFKPEELKDG  349



>ref|XP_007570269.1| PREDICTED: methylthioribose-1-phosphate isomerase [Poecilia formosa]
Length=353

 Score =   314 bits (805),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 244/348 (70%), Gaps = 16/348 (5%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TL+AI Y+ GSLQ+L+Q  LP QT+Y DI++ +  ++AIK M VRGAPAIAI   LSLA 
Sbjct  2     TLEAIRYRSGSLQILNQLLLPHQTVYEDIRSVQGAYEAIKSMKVRGAPAIAIVGCLSLA-  60

Query  1243  eaSNLETFNGTA-QDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEASTASEAKT  1067
                 +E   G    D V+F+ + L +L S+RPTAVN+  AA +L E    E S    ++ 
Sbjct  61    ----VELRAGAGGDDPVTFIRESLCHLTSARPTAVNMGRAARELMEFAENE-SMEKNSEQ  115

Query  1066  IFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKK--ISILTHCNTGSLATAGYG  893
             + ++ I   E MLE DV  N+ IG++GA   Q+ L G  +  +++LTHCNTGSLATAGYG
Sbjct  116   LRDSVISWIEDMLERDVNDNRKIGNYGA---QHILSGVPRDSVTVLTHCNTGSLATAGYG  172

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGV+R+++  G L+R YCTETRP+NQGSRLTA+E V E IPATLI DS AA  M+   
Sbjct  173   TALGVVRSLHGLGRLKRVYCTETRPYNQGSRLTAYEAVAEGIPATLITDSMAALTMREMD  232

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             + AV+VGADR+ ANGDTANK+GTY LA+ A HHG+PFYVAAP TS DLSL SG+ I+IE 
Sbjct  233   ITAVVVGADRVVANGDTANKVGTYQLAIAAKHHGIPFYVAAPSTSCDLSLESGRDIIIEV  292

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVI  392
             R P+EL   +   G  IAA GI VWNPAFDVTP  LI+ GIITE GV 
Sbjct  293   RPPEELTSIN---GVPIAAPGIEVWNPAFDVTPHQLITGGIITELGVF  337



>ref|XP_001943893.1| PREDICTED: methylthioribose-1-phosphate isomerase [Acyrthosiphon 
pisum]
Length=363

 Score =   315 bits (806),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 188/348 (54%), Positives = 243/348 (70%), Gaps = 12/348 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y+ G+L++LDQ  LP ++ Y+ I   +DGW  I +M VRGAPAIAI   LSLAV
Sbjct  2     TLQAIKYENGTLEVLDQLLLPKESKYIPILGVEDGWKVINKMQVRGAPAIAIVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKL----NEVITKEASTASE  1076
             E S  E     A      +  KL YL+S+RPTAVN+  AA  L    N +   E+ +A E
Sbjct  62    EISKEEFEKKKALR--REVEGKLNYLISARPTAVNMKQAADHLISYINSLDNDESVSAQE  119

Query  1075  AKTIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQLVGSKKISILTHCNTGSLATAGY  896
              +  F   + A E MLE D++ N++IG  GA  + N +   +++ ILTHCNTGSLATA +
Sbjct  120   MQARF---VAAIEAMLEKDISDNRSIGEFGAKAILNNVTDGEQVRILTHCNTGSLATAYF  176

Query  895   GTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAG  716
             GTALGV+R +++A  LE  Y TETRP+NQG+RLTA+ELV + IP+TL+ DS  A LMK  
Sbjct  177   GTALGVVRCLHSASRLENCYFTETRPYNQGARLTAYELVHDKIPSTLVCDSTVAYLMKTA  236

Query  715   RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  536
             ++NAV+VGADR+AANGDTANKIGTY +AV A HH VPFYVAAPLTS+D ++++G  IVIE
Sbjct  237   QINAVVVGADRVAANGDTANKIGTYQIAVVAKHHEVPFYVAAPLTSIDFNVNTGDNIVIE  296

Query  535   ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVI  392
             ER   E+ H +     +IA+ G++ WNPAFDVTPA LI+GIITEKGV 
Sbjct  297   ERPQVEMTHINNI---RIASPGVTCWNPAFDVTPARLITGIITEKGVF  341



>ref|XP_004616861.1| PREDICTED: methylthioribose-1-phosphate isomerase [Sorex araneus]
Length=358

 Score =   314 bits (805),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 244/351 (70%), Gaps = 9/351 (3%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             +L+AI Y RGSLQ+LDQ  LP QT Y  + + +  W+AI+ M VRGAPAIA+   LSLAV
Sbjct  2     SLEAIRYSRGSLQILDQLLLPQQTRYEVVGSVRQAWEAIRTMKVRGAPAIALVGCLSLAV  61

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVITKEAST--ASEAK  1070
             E              V+F+ + L +LV++RPTAVN++ AA  L    T+EA    A+EA 
Sbjct  62    EL-QAGAGGPGLAALVAFVREALSFLVTARPTAVNMARAARDLTAAATQEAEREGATEA-  119

Query  1069  TIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTGSLATAGYG  893
              + E  I  AE MLE D+  N+ IG  GA  LL+      +K+ +LTHCNTG+LATAGYG
Sbjct  120   AVRERVIRFAEDMLEKDLRDNQNIGDLGARHLLERAAPDGRKVVVLTHCNTGALATAGYG  179

Query  892   TALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmkAGR  713
             TALGVIR+++  G LE A+CTETRP+NQG+RLTAFELV E+IPATLIADS AAA M    
Sbjct  180   TALGVIRSLHRLGRLEHAFCTETRPYNQGARLTAFELVYEHIPATLIADSMAAAAMAQRG  239

Query  712   VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  533
             V+AV+VGADR+ ANGDTANK+GTY LA+ A HH +PFYVAAP +S DL L +GQ IVIEE
Sbjct  240   VSAVVVGADRVVANGDTANKVGTYQLAIAAKHHSIPFYVAAPSSSCDLHLHTGQDIVIEE  299

Query  532   RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVISKD  383
             R  +EL       G +IAA GI VWNPAFDVTP  LI+ GIITE GV + +
Sbjct  300   RPGQELTEVQ---GIRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPE  347



>ref|XP_011052943.1| PREDICTED: methylthioribose-1-phosphate isomerase [Acromyrmex 
echinatior]
 gb|EGI66416.1| Methylthioribose-1-phosphate isomerase [Acromyrmex echinatior]
Length=362

 Score =   314 bits (805),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 198/363 (55%), Positives = 251/363 (69%), Gaps = 26/363 (7%)
 Frame = -2

Query  1423  TLQAICYKR--GSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalsl  1250
             TLQAI + +  G L++LDQ  LP  T Y+ +K  KDGW+ I +M VRGAPAIAI  +LS+
Sbjct  2     TLQAIKWSKTDGKLEILDQTLLPATTSYIQVKGVKDGWNVINKMQVRGAPAIAIVGSLSV  61

Query  1249  aveaSNLETFNGTAQDAVSFLSQ----KLEYLVSSRPTAVNLSDAATKLNEVI----TKE  1094
             A     +E       D    LS+     + YLV++RPTAVN+  AA    E+     + +
Sbjct  62    A-----VEILQHPNYDDKKVLSRAIKDNMNYLVTARPTAVNMKVAANFFTEIADYLSSSD  116

Query  1093  ASTASEAKTIFEAYIMAAEIMLEDDVASNKAIGSHGAS-LLQNQLVGSKKISILTHCNTG  917
               T S+ K   + +I   + ML DD+  NKAIG  GA  +L+N   GS  + +LTHCNTG
Sbjct  117   EFTLSQMK---DEFIDRIDKMLMDDIKDNKAIGKFGADEILRNVPEGSS-VRVLTHCNTG  172

Query  916   SLATAGYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaa  737
             SLATAGYGTALGVIR+++  G LE  YCTETRP+NQG+RLTA+ELV + IPATLI D   
Sbjct  173   SLATAGYGTALGVIRSLHEMGRLEHVYCTETRPYNQGARLTAYELVHDKIPATLICDDMV  232

Query  736   aalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSS  557
             AALMK  ++ AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAPLTS+DL++S+
Sbjct  233   AALMKTKQITAVVVGADRVAANGDTANKIGTYQIAILAKYHDVPFYVAAPLTSIDLNVSN  292

Query  556   GQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK--D  383
             G QIVIEERS +E+ H +    ++IAA GI+ WNPAFDVTPASLI GII   GV SK  D
Sbjct  293   GDQIVIEERSEQEMTHMN---DKRIAAEGITCWNPAFDVTPASLIRGIIMNIGV-SKPSD  348

Query  382   GND  374
             G+D
Sbjct  349   GSD  351



>ref|XP_001226203.1| hypothetical protein CHGG_10936 [Chaetomium globosum CBS 148.51]
 sp|Q2GM68.1|MTNA_CHAGB RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Chaetomium 
globosum CBS 148.51]
 gb|EAQ83118.1| hypothetical protein CHGG_10936 [Chaetomium globosum CBS 148.51]
Length=389

 Score =   315 bits (807),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 196/378 (52%), Positives = 246/378 (65%), Gaps = 23/378 (6%)
 Frame = -2

Query  1423  TLQAICYKRGSLQLLDQRKLPLQTIYLDIKNAKDGWDAIKEMVVRGapaiaiaaalslav  1244
             TLQAI Y RG L +LDQ +LP +  Y ++  A+  +D I+ M VRGAPAIAI AAL+ AV
Sbjct  3     TLQAIKYSRGKLLVLDQLRLPHEHHYDEVSTAEQAFDCIRSMRVRGAPAIAIVAALAHAV  62

Query  1243  eaSNLETFNGTAQDAVSFLSQKLEYLVSSRPTAVNLSDAATKLNEVI---TKEASTASEA  1073
             E  N +    T +D ++++  +L+YL  SRPTAV+LS+A   L +     T E     EA
Sbjct  63    ELHNGDCTATTPEDTIAYIESRLDYLKDSRPTAVDLSNAIALLKQAARAATVEGLAHPEA  122

Query  1072  K-TIFEAYIMAAEIMLEDDVASNKAIGSHGASLLQNQL--VGSKKISILTHCNTGSLATA  902
             K  I  AYI AAE +L  D+ +N +IG+HGA+ LQ Q     S+ +S+LTHCNTGSLAT+
Sbjct  123   KEAILNAYIAAAETILAKDLDNNTSIGTHGAAWLQQQYHATPSRPLSVLTHCNTGSLATS  182

Query  901   GYGTALGVIRAVNTAGFLERAYCTETRPFNQGSRLTAFELVTENIPatliadsaaaalmk  722
             G+GTALG+IR+++    L+ AYCTETRP+NQGSRLTAFELV E IPATL+ DS AAAL  
Sbjct  183   GHGTALGIIRSLHQQQLLKHAYCTETRPYNQGSRLTAFELVFEGIPATLVTDSMAAALFA  242

Query  721   AGR----VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSG  554
               R    + AV+VGADR+  NGDTANKIGTY+LAV A HHGV F VAAP TS+DL   SG
Sbjct  243   LHRERMNIGAVVVGADRVVRNGDTANKIGTYALAVLARHHGVKFVVAAPTTSIDLETESG  302

Query  553   QQIVIEERSPKELLHTHGGLGE-------------QIAASGISVWNPAFDVTPASLISGI  413
               I IEER P+EL    G +                IA   I VWNPAFDVTP  LI  I
Sbjct  303   AGIEIEERKPEELTQVTGAVVNADGSVDASRTARVAIADQRIGVWNPAFDVTPHDLIDAI  362

Query  412   ITEKGVISKDGNDAFDIT  359
             +TE+G + K  +  FD +
Sbjct  363   VTERGAVVKGADGRFDFS  380



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5495616104904